Genome sequence of foxtail millet (Setaria italica) provides insights into grass evolution and biofuel potential

DEFF Research Database (Denmark)

Zhang, Gengyun; Liu, Xin; Quan, Zhiwu

2012-01-01

Foxtail millet (Setaria italica), a member of the Poaceae grass family, is an important food and fodder crop in arid regions and has potential for use as a C(4) biofuel. It is a model system for other biofuel grasses, including switchgrass and pearl millet. We produced a draft genome (∼423 Mb) an...

Factors influencing seed germination in Cerrado grasses

Directory of Open Access Journals (Sweden)

Rosana Marta Kolb

2016-03-01

Full Text Available Few studies address the ecology of herbs of Cerrado grasslands, which are ecosystems where the long dry season, high temperatures, insolation, fire and invasive grasses greatly influencing germination and the establishment of plants. We assessed germination of 13 species of Poaceae from Cerrado grasslands under nursery conditions or in germination chambers, the latter with i recently collected seeds and seeds after six months storage, ii under constant and alternating temperatures, and iii in the presence and absence of light. Germinability, mean germination time (MGT and required light were quantified to elucidate factors involved in successful germination. Germinability was low for most grasses, probably because of low seed viability. For most species, germinability and MGT were not altered by seed storage. Germination percentages were higher at alternating temperatures and in the presence of light, factors that are more similar to natural environmental situations compared with constant temperature or the absence of light. Our findings indicate that alternating temperatures and light incidence are key factors for germination of species of Poaceae. The maintenance of these environmental factors, which are crucial for the conservation of Cerrado grasslands, depends on appropriate management interventions, such as fire management and the control of biological invasion.

Genome-Wide Analysis of Syntenic Gene Deletion in the Grasses

Science.gov (United States)

Schnable, James C.; Freeling, Michael; Lyons, Eric

2012-01-01

The grasses, Poaceae, are one of the largest and most successful angiosperm families. Like many radiations of flowering plants, the divergence of the major grass lineages was preceded by a whole-genome duplication (WGD), although these events are not rare for flowering plants. By combining identification of syntenic gene blocks with measures of gene pair divergence and different frequencies of ancient gene loss, we have separated the two subgenomes present in modern grasses. Reciprocal loss of duplicated genes or genomic regions has been hypothesized to reproductively isolate populations and, thus, speciation. However, in contrast to previous studies in yeast and teleost fishes, we found very little evidence of reciprocal loss of homeologous genes between the grasses, suggesting that post-WGD gene loss may not be the cause of the grass radiation. The sets of homeologous and orthologous genes and predicted locations of deleted genes identified in this study, as well as links to the CoGe comparative genomics web platform for analyzing pan-grass syntenic regions, are provided along with this paper as a resource for the grass genetics community. PMID:22275519

7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).

Science.gov (United States)

2010-01-01

... ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-5 Grass.... During germination the scutellum remains inside the seed to absorb nutrients from the endosperm and... with the endosperm. During germination the scutellum remains inside the seed to absorb nutrients from...

Checklist of Serengeti Ecosystem Grasses.

Science.gov (United States)

Williams, Emma Victoria; Elia Ntandu, John; Ficinski, Paweł; Vorontsova, Maria

2016-01-01

We present the first taxonomic checklist of the Poaceae species of the Serengeti, Tanzania. A review of the literature and herbarium specimens recorded 200 species of grasses, in line with similar studies in other parts of East Africa. The checklist is supported by a total of 939 herbarium collections. Full georeferenced collection data is made available alongside a summary checklist in pdf format. More than a quarter of the species are known from a single collection highlighting the need for further research, especially concerning the rare species and their distribution.

Checklist of Serengeti Ecosystem Grasses

Science.gov (United States)

Ficinski, Paweł; Vorontsova, Maria

2016-01-01

Abstract We present the first taxonomic checklist of the Poaceae species of the Serengeti, Tanzania. A review of the literature and herbarium specimens recorded 200 species of grasses, in line with similar studies in other parts of East Africa. The checklist is supported by a total of 939 herbarium collections. Full georeferenced collection data is made available alongside a summary checklist in pdf format. More than a quarter of the species are known from a single collection highlighting the need for further research, especially concerning the rare species and their distribution. PMID:27226761

IDENTIFIKASI TUMBUHAN SUKU POACEAE SEBAGAI SUPLEMEN MATAKULIAH KEANEKARAGAMAN TUMBUHAN

Directory of Open Access Journals (Sweden)

Desy Yanuarita Wulandari

2017-01-01

Full Text Available Poaceae known as plants used as food ingredients in Indonesian. One area thas has high level diversity of plants Poaceae is Tahura R. Soerjo. Morphological characterization Poaceae in that region are still rare. The Goal for this research are to identify Poaceae tribes, and make photography Poaceae data that can be used as a supplement on Diversity of Plants course. This study included descriptive exploratory study with free cruising method. The species Poaceae has identified are Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflor. Suku Poaceae dikenal sebagai tumbuhan yang dimanfaatkan sebagai bahan pangan masyarakat Indonesia. Salah satu daerah yang memiliki tingkat keanekaragaman tumbuhan Poaceae adalah di Tahura R. Soerjo. Karakterisasi morfologi terkait suku Poaceae di daerah tersebut masih sedikit. Tujuan dalam penelitian ini adalah untuk identifikasi suku Poaceae, membuat data fotografi suku Poaceae sehingga dapat digunakan sebagai suplemen keanekaragaman tumbuhan. Penelitian ini termasuk penelitian deskriptif eksploratif dengan metode jelajah bebas. Sebelas spesies suku Poaceae yang telah teridentifikasi, yaitu Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflora.

Brassinosteroid Mediated Cell Wall Remodeling in Grasses under Abiotic Stress

Directory of Open Access Journals (Sweden)

Xiaolan Rao

2017-05-01

Full Text Available Unlike animals, plants, being sessile, cannot escape from exposure to severe abiotic stresses such as extreme temperature and water deficit. The dynamic structure of plant cell wall enables them to undergo compensatory changes, as well as maintain physical strength, with changing environments. Plant hormones known as brassinosteroids (BRs play a key role in determining cell wall expansion during stress responses. Cell wall deposition differs between grasses (Poaceae and dicots. Grass species include many important food, fiber, and biofuel crops. In this article, we focus on recent advances in BR-regulated cell wall biosynthesis and remodeling in response to stresses, comparing our understanding of the mechanisms in grass species with those in the more studied dicots. A more comprehensive understanding of BR-mediated changes in cell wall integrity in grass species will benefit the development of genetic tools to improve crop productivity, fiber quality and plant biomass recalcitrance.

Molecular, phylogenetic and comparative genomic analysis of the cytokinin oxidase/dehydrogenase gene family in the Poaceae.

Science.gov (United States)

Mameaux, Sabine; Cockram, James; Thiel, Thomas; Steuernagel, Burkhard; Stein, Nils; Taudien, Stefan; Jack, Peter; Werner, Peter; Gray, John C; Greenland, Andy J; Powell, Wayne

2012-01-01

The genomes of cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare) are large and therefore problematic for the map-based cloning of agronomicaly important traits. However, comparative approaches within the Poaceae permit transfer of molecular knowledge between species, despite their divergence from a common ancestor sixty million years ago. The finding that null variants of the rice gene cytokinin oxidase/dehydrogenase 2 (OsCKX2) result in large yield increases provides an opportunity to explore whether similar gains could be achieved in other Poaceae members. Here, phylogenetic, molecular and comparative analyses of CKX families in the sequenced grass species rice, brachypodium, sorghum, maize and foxtail millet, as well as members identified from the transcriptomes/genomes of wheat and barley, are presented. Phylogenetic analyses define four Poaceae CKX clades. Comparative analyses showed that CKX phylogenetic groupings can largely be explained by a combination of local gene duplication, and the whole-genome duplication event that predates their speciation. Full-length OsCKX2 homologues in barley (HvCKX2.1, HvCKX2.2) and wheat (TaCKX2.3, TaCKX2.4, TaCKX2.5) are characterized, with comparative analysis at the DNA, protein and genetic/physical map levels suggesting that true CKX2 orthologs have been identified. Furthermore, our analysis shows CKX2 genes in barley and wheat have undergone a Triticeae-specific gene-duplication event. Finally, by identifying ten of the eleven CKX genes predicted to be present in barley by comparative analyses, we show that next-generation sequencing approaches can efficiently determine the gene space of large-genome crops. Together, this work provides the foundation for future functional investigation of CKX family members within the Poaceae. © 2011 National Institute of Agricultural Botany (NIAB). Plant Biotechnology Journal © 2011 Society for Experimental Biology, Association of Applied Biologists and Blackwell

Genetic modification of wetland grasses for phytoremediation

Energy Technology Data Exchange (ETDEWEB)

Czako, M.; Liang Dali; Marton, L. [Dept. of Biological Sciences, Univ. of South Carolina, Columbia, SC (United States); Feng Xianzhong; He Yuke [National Lab. of Plant Molecular Genetics, Shanghai Inst. of Plant Physiology, Chinese Academy of Sciences, Shanghai, SH (China)

2005-04-01

Wetland grasses and grass-like monocots are very important natural remediators of pollutants. Their genetic improvement is an important task because introduction of key transgenes can dramatically improve their remediation potential. Tissue culture is prerequisite for genetic manipulation, and methods are reported here for in vitro culture and micropropagation of a number of wetland plants of various ecological requirements such as salt marsh, brackish water, riverbanks, and various zones of lakes and ponds, and bogs. The monocots represent numerous genera in various families such as Poaceae, Cyperaceae, Juncaceae, and Typhaceae. The reported species are in various stages of micropropagation and Arundo donax is scaled for mass propagation for selecting elite lines for pytoremediation. Transfer of key genes for mercury phytoremediation into the salt marsh cordgrass (Spartina alterniflora) is also reported here. All but one transgenic lines contained both the organomercurial lyase (merB) and mercuric reductase (merA) sequences showing that co-introduction into Spartina of two genes from separate Agrobacterium strains is possible. (orig.)

Complete chloroplast genome sequence of common bermudagrass (Cynodon dactylon (L.) Pers.) and comparative analysis within the family Poaceae.

Science.gov (United States)

Huang, Ya-Yi; Cho, Shu-Ting; Haryono, Mindia; Kuo, Chih-Horng

2017-01-01

Common bermudagrass (Cynodon dactylon (L.) Pers.) belongs to the subfamily Chloridoideae of the Poaceae family, one of the most important plant families ecologically and economically. This grass has a long connection with human culture but its systematics is relatively understudied. In this study, we sequenced and investigated the chloroplast genome of common bermudagrass, which is 134,297 bp in length with two single copy regions (LSC: 79,732 bp; SSC: 12,521 bp) and a pair of inverted repeat (IR) regions (21,022 bp). The annotation contains a total of 128 predicted genes, including 82 protein-coding, 38 tRNA, and 8 rRNA genes. Additionally, our in silico analyses identified 10 sets of repeats longer than 20 bp and predicted the presence of 36 RNA editing sites. Overall, the chloroplast genome of common bermudagrass resembles those from other Poaceae lineages. Compared to most angiosperms, the accD gene and the introns of both clpP and rpoC1 genes are missing. Additionally, the ycf1, ycf2, ycf15, and ycf68 genes are pseudogenized and two genome rearrangements exist. Our phylogenetic analysis based on 47 chloroplast protein-coding genes supported the placement of common bermudagrass within Chloridoideae. Our phylogenetic character mapping based on the parsimony principle further indicated that the loss of the accD gene and clpP introns, the pseudogenization of four ycf genes, and the two rearrangements occurred only once after the most recent common ancestor of the Poaceae diverged from other monocots, which could explain the unusual long branch leading to the Poaceae when phylogeny is inferred based on chloroplast sequences.

Poaceae vs. Abiotic Stress: Focus on Drought and Salt Stress, Recent Insights and Perspectives

Directory of Open Access Journals (Sweden)

Simone Landi

2017-07-01

Full Text Available Poaceae represent the most important group of crops susceptible to abiotic stress. This large family of monocotyledonous plants, commonly known as grasses, counts several important cultivated species, namely wheat (Triticum aestivum, rice (Oryza sativa, maize (Zea mays, and barley (Hordeum vulgare. These crops, notably, show different behaviors under abiotic stress conditions: wheat and rice are considered sensitive, showing serious yield reduction upon water scarcity and soil salinity, while barley presents a natural drought and salt tolerance. During the green revolution (1940–1960, cereal breeding was very successful in developing high-yield crops varieties; however, these cultivars were maximized for highest yield under optimal conditions, and did not present suitable traits for tolerance under unfavorable conditions. The improvement of crop abiotic stress tolerance requires a deep knowledge of the phenomena underlying tolerance, to devise novel approaches and decipher the key components of agricultural production systems. Approaches to improve food production combining both enhanced water use efficiency (WUE and acceptable yields are critical to create a sustainable agriculture in the future. This paper analyzes the latest results on abiotic stress tolerance in Poaceae. In particular, the focus will be directed toward various aspects of water deprivation and salinity response efficiency in Poaceae. Aspects related to cell wall metabolism will be covered, given the importance of the plant cell wall in sensing environmental constraints and in mediating a response; the role of silicon (Si, an important element for monocots' normal growth and development, will also be discussed, since it activates a broad-spectrum response to different exogenous stresses. Perspectives valorizing studies on landraces conclude the survey, as they help identify key traits for breeding purposes.

Grass pollen (Poaceae in the air of Sosnowiec (Poland, 1997 - 2006

Directory of Open Access Journals (Sweden)

Kazimiera Chłopek

2012-12-01

Full Text Available The article presents the analysis results of the grass pollen seasons from 1997 to 2006 in Sosnowiec. The research was carried out by means of the volumetric method with the use of a Burkard device. The duration of the pollen seasons was determined by means of the 98% method. The influence of meteorological conditions on the starting date and duration of the grass pollen seasons has been estimated in the article. The beginning of the pollen seasons was recorded between 23 April and 23 May. It has been demonstrated that the average duration of the pollen season amounted to 138 days. The period of maximum concentrations was recorded in June and the first half of July. The highest daily concentration was found in 2000 (495 grains in m3 and the highest annual sums in 2002 and 2000. The daily concentration distribution curve has shown three peaks. The highest values were recorded from 7 am until 11 am, from 13 pm until 17 pm and from 19 pm until 21 pm. It has been found that there is a significant influence of weather conditions (temperature, precipitation and relative humidity on the beginning and duration of the pollen seasons and the period of maximum concentrations.

Meiosis in elephant grass (Pennisetum purpureum, pearl millet (Pennisetum glaucum (Poaceae, Poales and their interspecific hybrids

Directory of Open Access Journals (Sweden)

Vânia Helena Techio

2006-01-01

Full Text Available The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28 and Pennisetum glaucum (pearl millet, 2n = 2x = 14 can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21. This study describes meiosis in elephant grass x pearl millet hybrids and their progenitors. Panicles were prepared according to the conventional protocol for meiotic studies and Alexander’s stain was used for assessing pollen viability. Pearl millet accessions presented regular meiosis with seven bivalents and high pollen viability. For elephant grass, 14 bivalents in diakinesis and metaphase I were observed. The BAG 63 elephant grass accession, derived from tissue culture, presented a high frequency of meiotic abnormalities. The three hybrid accessions presented a high frequency of abnormalities characterized by irregular chromosomal segregation which resulted in the formation of sterile pollen.

Evolutionary modes of emergence of short interspersed nuclear element (SINE) families in grasses.

Science.gov (United States)

Kögler, Anja; Schmidt, Thomas; Wenke, Torsten

2017-11-01

Short interspersed nuclear elements (SINEs) are non-autonomous transposable elements which are propagated by retrotransposition and constitute an inherent part of the genome of most eukaryotic species. Knowledge of heterogeneous and highly abundant SINEs is crucial for de novo (or improvement of) annotation of whole genome sequences. We scanned Poaceae genome sequences of six important cereals (Oryza sativa, Triticum aestivum, Hordeum vulgare, Panicum virgatum, Sorghum bicolor, Zea mays) and Brachypodium distachyon to examine the diversity and evolution of SINE populations. We comparatively analyzed the structural features, distribution, evolutionary relation and abundance of 32 SINE families and subfamilies within grasses, comprising 11 052 individual copies. The investigation of activity profiles within the Poaceae provides insights into their species-specific diversification and amplification. We found that Poaceae SINEs (PoaS) fall into two length categories: simple SINEs of up to 180 bp and dimeric SINEs larger than 240 bp. Detailed analysis at the nucleotide level revealed that multimerization of related and unrelated SINE copies is an important evolutionary mechanism of SINE formation. We conclude that PoaS families diversify by massive reshuffling between SINE families, likely caused by insertion of truncated copies, and provide a model for this evolutionary scenario. Twenty-eight of 32 PoaS families and subfamilies show significant conservation, in particular either in the 5' or 3' regions, across Poaceae species and share large sequence stretches with one or more other PoaS families. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

The grasses (Poaceae) of the Colombian guayana: analyses on their composition, richness, endemism, and invasion

International Nuclear Information System (INIS)

Canas, Diego Giraldo

2010-01-01

The checklist of grasses from Colombian Guayana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guayana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guayana, which represent 12.5% of the agrostological flora for the Colombian Guayana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed Flora of Colombia,

The grasses (Poaceae) of the Colombian Guyana: analyses on their composition, richness, endemism, and invasion

International Nuclear Information System (INIS)

Giraldo Canas, Diego

2010-01-01

The checklist of grasses from Colombian Guyana is presented. In all, 152 species, 69 genera, and six subfamilies were recorded. Thus, in the Colombian Guyana is represented the 18.7 and 43.7% of the species and genera of Colombian grasses, respectively. The subfamilies with the highest number of species were Panicoideae (110 species/46 genera), Chloridoideae (21/9), and Bambusoideae (11/9). The most diverse genera were Paspalum (19 species), Panicum (16), Axonopus (14), Eragrostis (9), and Digitaria (8). Nineteen species are introduced and naturalized in the Colombian Guyana, which represent 12.5% of the agrostological flora for the Colombian Guyana. There were 8 endemic species (5.3% of Colombian Guayanan grasses). In addition, some species are reported for the first time for Colombian flora (belonging to Axonopus, Cyphonanthus, Gymnopogon, and Paspalum), and some species are new to science (belonging to Axonopus, Digitaria, Eragrostis, and Sacciolepis). On the other hand, some preliminary biogeographical aspect are analyzed.

Diversification of C(4) grasses (Poaceae) does not coincide with their ecological dominance.

Science.gov (United States)

Bouchenak-Khelladi, Yanis; Slingsby, Jasper A; Verboom, G Anthony; Bond, William J

2014-02-01

The radiation of a lineage and its rise to ecological dominance are distinct phenomena and driven by different processes. For example, paleoecological data has been used to show that the Cretaceous angiosperm radiation did not coincide with their rise to dominance. Using a phylogenetic approach, we here explored the evolution of C4 grasses and evaluated whether the diversification of this group and its rise to ecological dominance in the late Miocene were decoupled. We assembled a matrix including 675 grass species of the PACMAD clade and 2784 characters (ITS and ndhF) to run a molecular dating analysis using three fossils as reference calibrations. We coded species as C3 vs. C4 and reconstructed ancestral states under maximum likelihood. We used the program BiSSE to test whether rates of diversification are correlated with photosynthetic pathway and whether the radiation of C4 lineages preceded or coincided with their rise to ecological dominance from ∼10 Ma. C4 grass lineages first originated around 35 Ma at the time of the Eocene-Oligocene transition. Accelerated diversification of C4 lineages did not coincide with their rise to ecological dominance. C4-dominated grasslands have expanded only since the Late Miocene and Pliocene. The initial diversification of their biotic elements can be tracked back as far as the Eocene-Oligocene transition. We suggest that shifts in taxonomic diversification and ecological dominance were stimulated by different factors, as in the case of the early angiosperms in the Cretaceous.

Meiosis in elephant grass (Pennisetum purpureum), pearl millet (Pennisetum glaucum) (Poaceae, Poales) and their interspecific hybrids

OpenAIRE

Techio, Vânia Helena; Davide, Lisete Chamma; Pereira, Antônio Vander

2006-01-01

The cultivated and sexually compatible species Pennisetum purpureum (elephant grass, 2n = 4x = 28) and Pennisetum glaucum (pearl millet, 2n = 2x = 14) can undergo hybridization which favors the amplification of their genetic background and the introgression of favorable alleles into breeding programs. The main problem with interspecific hybrids of these species is infertility due to triploidy (2n = 3x = 21). This study describes meiosis in elephant grass x pearl millet hybrids and their proge...

Additions to the grasses (Poaceae of Telangana from Kawal Tiger Reserve, Adilabad District, India

Directory of Open Access Journals (Sweden)

Alok Chorghe

2015-07-01

Full Text Available Three species of grasses viz., Dimeria orissae, Iseilema holei and Spodiopogon rhizophorus are being reported for the first time as new distributional records to Telangana from the Kawal Tiger Reserve. Detailed description and illustrations are provided here.

Classification of grass pollen through the quantitative analysis of surface ornamentation and texture.

Science.gov (United States)

Mander, Luke; Li, Mao; Mio, Washington; Fowlkes, Charless C; Punyasena, Surangi W

2013-11-07

Taxonomic identification of pollen and spores uses inherently qualitative descriptions of morphology. Consequently, identifications are restricted to categories that can be reliably classified by multiple analysts, resulting in the coarse taxonomic resolution of the pollen and spore record. Grass pollen represents an archetypal example; it is not routinely identified below family level. To address this issue, we developed quantitative morphometric methods to characterize surface ornamentation and classify grass pollen grains. This produces a means of quantifying morphological features that are traditionally described qualitatively. We used scanning electron microscopy to image 240 specimens of pollen from 12 species within the grass family (Poaceae). We classified these species by developing algorithmic features that quantify the size and density of sculptural elements on the pollen surface, and measure the complexity of the ornamentation they form. These features yielded a classification accuracy of 77.5%. In comparison, a texture descriptor based on modelling the statistical distribution of brightness values in image patches yielded a classification accuracy of 85.8%, and seven human subjects achieved accuracies between 68.33 and 81.67%. The algorithmic features we developed directly relate to biologically meaningful features of grass pollen morphology, and could facilitate direct interpretation of unsupervised classification results from fossil material.

Pervasive survival of expressed mitochondrial rps14 pseudogenes in grasses and their relatives for 80 million years following three functional transfers to the nucleus

Directory of Open Access Journals (Sweden)

Palmer Jeffrey D

2006-07-01

Full Text Available Abstract Background Many mitochondrial genes, especially ribosomal protein genes, have been frequently transferred as functional entities to the nucleus during plant evolution, often by an RNA-mediated process. A notable case of transfer involves the rps14 gene of three grasses (rice, maize, and wheat, which has been relocated to the intron of the nuclear sdh2 gene and which is expressed and targeted to the mitochondrion via alternative splicing and usage of the sdh2 targeting peptide. Although this transfer occurred at least 50 million years ago, i.e., in a common ancestor of these three grasses, it is striking that expressed, nearly intact pseudogenes of rps14 are retained in the mitochondrial genomes of both rice and wheat. To determine how ancient this transfer is, the extent to which mitochondrial rps14 has been retained and is expressed in grasses, and whether other transfers of rps14 have occurred in grasses and their relatives, we investigated the structure, expression, and phylogeny of mitochondrial and nuclear rps14 genes from 32 additional genera of grasses and from 9 other members of the Poales. Results Filter hybridization experiments showed that rps14 sequences are present in the mitochondrial genomes of all examined Poales except for members of the grass subfamily Panicoideae (to which maize belongs. However, PCR amplification and sequencing revealed that the mitochondrial rps14 genes of all examined grasses (Poaceae, Cyperaceae, and Joinvilleaceae are pseudogenes, with all those from the Poaceae sharing two 4-NT frameshift deletions and all those from the Cyperaceae sharing a 5-NT insertion (only one member of the Joinvilleaceae was examined. cDNA analysis showed that all mitochondrial pseudogenes examined (from all three families are transcribed, that most are RNA edited, and that surprisingly many of the edits are reverse (U→C edits. Putatively nuclear copies of rps14 were isolated from one to several members of each of these

The perennial ryegrass GenomeZipper: targeted use of genome resources for comparative grass genomics.

Science.gov (United States)

Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F X; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno

2013-02-01

Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species.

Genome sequence of foxtail millet (Setaria italica) provides insights into grass evolution and biofuel potential.

Science.gov (United States)

Zhang, Gengyun; Liu, Xin; Quan, Zhiwu; Cheng, Shifeng; Xu, Xun; Pan, Shengkai; Xie, Min; Zeng, Peng; Yue, Zhen; Wang, Wenliang; Tao, Ye; Bian, Chao; Han, Changlei; Xia, Qiuju; Peng, Xiaohua; Cao, Rui; Yang, Xinhua; Zhan, Dongliang; Hu, Jingchu; Zhang, Yinxin; Li, Henan; Li, Hua; Li, Ning; Wang, Junyi; Wang, Chanchan; Wang, Renyi; Guo, Tao; Cai, Yanjie; Liu, Chengzhang; Xiang, Haitao; Shi, Qiuxiang; Huang, Ping; Chen, Qingchun; Li, Yingrui; Wang, Jun; Zhao, Zhihai; Wang, Jian

2012-05-13

Foxtail millet (Setaria italica), a member of the Poaceae grass family, is an important food and fodder crop in arid regions and has potential for use as a C(4) biofuel. It is a model system for other biofuel grasses, including switchgrass and pearl millet. We produced a draft genome (∼423 Mb) anchored onto nine chromosomes and annotated 38,801 genes. Key chromosome reshuffling events were detected through collinearity identification between foxtail millet, rice and sorghum including two reshuffling events fusing rice chromosomes 7 and 9, 3 and 10 to foxtail millet chromosomes 2 and 9, respectively, that occurred after the divergence of foxtail millet and rice, and a single reshuffling event fusing rice chromosome 5 and 12 to foxtail millet chromosome 3 that occurred after the divergence of millet and sorghum. Rearrangements in the C(4) photosynthesis pathway were also identified.

Detrimental and neutral effects of a wild grass-fungal endophyte symbiotum on insect preference and performance.

Science.gov (United States)

Clement, Stephen L; Hu, Jinguo; Stewart, Alan V; Wang, Bingrui; Elberson, Leslie R

2011-01-01

Seed-borne Epichloë/Neotyphodium Glenn, Bacon, Hanlin (Ascomycota: Hypocreales: Clavicipitaceae) fungal endophytes in temperate grasses can provide protection against insect attack with the degree of host resistance related to the grass-endophyte symbiotum and the insect species involved in an interaction. Few experimental studies with wild grass-endophyte symbiota, compared to endophyte-infected agricultural grasses, have tested for anti-insect benefits, let alone for resistance against more than one insect species. This study quantified the preference and performance of the bird cherry oat-aphid, Rhopalosiphum padi (L.) (Hemiptera: Aphididae) and the cereal leaf beetle, Oulema melanopus (L.) (Coleoptera: Chrysomelidae), two important pests of forage and cereal grasses, on Neotyphodium-infected (E+) and uninfected (E-) plants of the wild grass Alpine timothy, Phleum alpinum L. (Poales: Poaceae). The experiments tested for both constitutive and wound-induced resistance in E+ plants to characterize possible plasticity of defense responses by a wild E+ grass. The aphid, R. padi preferred E- over E+ test plants in choice experiments and E+ undamaged test plants constitutively expressed antibiosis resistance to this aphid by suppressing population growth. Prior damage of E+ test plants did not induce higher levels of resistance to R. padi. By contrast, the beetle, O. melanopus showed no preference for E+ or E- test plants and endophyte infection did not adversely affect the survival and development of larvae. These results extend the phenomenon of variable effects of E+ wild grasses on the preference and performance of phytophagous insects. The wild grass- Neotyphodium symbiotum in this study broadens the number of wild E+ grasses available for expanded explorations into the effects of endophyte metabolites on insect herbivory.

Desenvolvimento pós-seminal de espécies de Poaceae (Poales Post-seminal development of Poaceae species (Poales

Directory of Open Access Journals (Sweden)

Adriana Tiemi Nakamura

2009-03-01

Full Text Available O presente estudo objetivou verificar a existência de um padrão do desenvolvimento pós-seminal em Poaceae. Para tanto, foram estudadas as seguintes espécies: Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae. Procurou-se também comparar as estruturas da plântula de Poaceae com as demais monocotiledôneas. As espécies estudadas são plantas perenes, rizomatosas, cespitosas e apresentam cariopses de tamanhos diferentes. Apresentam sementes albuminosas; embrião lateral, diferenciado, com raiz endógena (adventícia; cotilédone dividido em hiperfilo (escutelo, bainha reduzida e hipofilo (coleóptilo; coleorriza (raiz primária reduzida e mesocótilo (eixo localizado entre o escutelo e coleóptilo. A presença de epiblasto (folha embrionária foi observada em Olyra humilis, Chloris elata e Eragrostis solida. O desenvolvimento pós-seminal é semelhante nas espécies estudadas e forma um padrão em Poaceae. Primeiramente, observa-se a emissão da coleorriza, que cresce no sentido geotrópico positivo, seguida do coleóptilo e plúmula que crescem em sentido contrário, a partir do desenvolvimento do mesocótilo. As primeiras folhas são semelhantes às folhas definitivas (metafilos das espécies, exceto em Olyra humilis, que são modificadas em catafilos e podem ser interpretadas como caráter basal em Bambusoideae. Raiz primária reduzida (coleorriza e hipofilo modificado em coleóptilo são considerados caracteres derivados em Poaceae, quando comparados com as demais monocotiledôneas.This work has aimed to verify the existence of a pattern of the post-seminal development in Poaceae. Thus, Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae have been studied. Besides, it was compared the structures of

In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

Directory of Open Access Journals (Sweden)

Ertuğrul Filiz

2013-01-01

Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

Agricultural field reclamation utilizing native grass crop production

Science.gov (United States)

J. Cure

2013-01-01

Developing a method of agricultural field reclamation to native grasses in the Lower San Pedro Watershed could prove to be a valuable tool for educational and practical purposes. Agricultural field reclamation utilizing native grass crop production will address water table depletion, soil degradation and the economic viability of the communities within the watershed....

The Perennial Ryegrass GenomeZipper: Targeted Use of Genome Resources for Comparative Grass Genomics1[C][W

Science.gov (United States)

Pfeifer, Matthias; Martis, Mihaela; Asp, Torben; Mayer, Klaus F.X.; Lübberstedt, Thomas; Byrne, Stephen; Frei, Ursula; Studer, Bruno

2013-01-01

Whole-genome sequences established for model and major crop species constitute a key resource for advanced genomic research. For outbreeding forage and turf grass species like ryegrasses (Lolium spp.), such resources have yet to be developed. Here, we present a model of the perennial ryegrass (Lolium perenne) genome on the basis of conserved synteny to barley (Hordeum vulgare) and the model grass genome Brachypodium (Brachypodium distachyon) as well as rice (Oryza sativa) and sorghum (Sorghum bicolor). A transcriptome-based genetic linkage map of perennial ryegrass served as a scaffold to establish the chromosomal arrangement of syntenic genes from model grass species. This scaffold revealed a high degree of synteny and macrocollinearity and was then utilized to anchor a collection of perennial ryegrass genes in silico to their predicted genome positions. This resulted in the unambiguous assignment of 3,315 out of 8,876 previously unmapped genes to the respective chromosomes. In total, the GenomeZipper incorporates 4,035 conserved grass gene loci, which were used for the first genome-wide sequence divergence analysis between perennial ryegrass, barley, Brachypodium, rice, and sorghum. The perennial ryegrass GenomeZipper is an ordered, information-rich genome scaffold, facilitating map-based cloning and genome assembly in perennial ryegrass and closely related Poaceae species. It also represents a milestone in describing synteny between perennial ryegrass and fully sequenced model grass genomes, thereby increasing our understanding of genome organization and evolution in the most important temperate forage and turf grass species. PMID:23184232

Airborne grass (Poaceae) pollen in southern Spain. Results of a 10-year study (1987-96).

Science.gov (United States)

González Minero, F J; Candau, P; Tomás, C; Morales, J

1998-03-01

This work reports an exhaustive study of the aerobiology of the Gramineae in Seville, Spain, which is typical of coastal Mediterranean areas. Sampling was done with a Cour trap installed on the roof terrace of the School of Pharmacy, Seville, from 1987 to 1996, both inclusive. The climatic pattern of that period was characterized by two exceptionally wet years (1989 and 1996), between which were 5 consecutive years of drought (1990-5). This typically Mediterranean climate affects grass aerobiology. The annual amounts of total grass pollen are low, never exceeding 2500 grains/m3. The start, length, and intensity of the pollen season are significantly correlated with preseasonal meteorologic factors (precipitation and temperature), but intraseasonal meteorologic conditions have no effect on the three variables. The relationships are stated by three equations that, while further years of observations are anticipated, can be considered models to forecast the characteristics of the pollen season: the starting date depends on the mean temperatures of January and February, and the length and intensity of the season depend on the rainfall between the beginning of January and the starting date of the season. For the study period, the weekly concentrations (pollen curves) throughout the year showed no typical pattern of variation over the years, so that it was impossible to make mid- and long-term forecasts of the variation in weekly concentration. The most noteworthy aspects of grass pollen curves are a long pollen season, which starts in February or March and lasts until September or October; peaks of higher concentration (> 100 grains/m3) in May and June, associated with increases in temperature and absence of precipitation; and other peaks in the summer months that may be as high as the spring peaks.

New chloroplast microsatellite markers suitable for assessing genetic diversity of Lolium perenne and other related grass species.

Science.gov (United States)

Diekmann, Kerstin; Hodkinson, Trevor R; Barth, Susanne

2012-11-01

Lolium perenne (perennial ryegrass) is the most important forage grass species of temperate regions. We have previously released the chloroplast genome sequence of L. perenne 'Cashel'. Here nine chloroplast microsatellite markers are published, which were designed based on knowledge about genetically variable regions within the L. perenne chloroplast genome. These markers were successfully used for characterizing the genetic diversity in Lolium and different grass species. Chloroplast genomes of 14 Poaceae taxa were screened for mononucleotide microsatellite repeat regions and primers designed for their amplification from nine loci. The potential of these markers to assess genetic diversity was evaluated on a set of 16 Irish and 15 European L. perenne ecotypes, nine L. perenne cultivars, other Lolium taxa and other grass species. All analysed Poaceae chloroplast genomes contained more than 200 mononucleotide repeats (chloroplast simple sequence repeats, cpSSRs) of at least 7 bp in length, concentrated mainly in the large single copy region of the genome. Nucleotide composition varied considerably among subfamilies (with Pooideae biased towards poly A repeats). The nine new markers distinguish L. perenne from all non-Lolium taxa. TeaCpSSR28 was able to distinguish between all Lolium species and Lolium multiflorum due to an elongation of an A(8) mononucleotide repeat in L. multiflorum. TeaCpSSR31 detected a considerable degree of microsatellite length variation and single nucleotide polymorphism. TeaCpSSR27 revealed variation within some L. perenne accessions due to a 44-bp indel and was hence readily detected by simple agarose gel electrophoresis. Smaller insertion/deletion events or single nucleotide polymorphisms detected by these new markers could be visualized by polyacrylamide gel electrophoresis or DNA sequencing, respectively. The new markers are a valuable tool for plant breeding companies, seed testing agencies and the wider scientific community due to

The effect of geographical and climatic properties on grass pollen and Phl p 5 allergen release

Science.gov (United States)

Alan, Şenol; Şahin, Aydan Acar; Sarışahin, Tuğba; Şahin, Serap; Kaplan, Ayşe; Pınar, Nur Münevver

2018-04-01

The Poaceae family, including grasses, comprises several cosmopolitan and allergenic species. The aim of this study was to determine the correlations between Poaceae pollen and Phl p 5 allergen concentrations in two cities with different geographical and climatic properties in Turkey. Pollen were collected from Burkard traps in Ankara and Zonguldak. Phl p 5 sampling was carried out between March and October in both 2015 and 2016 using a BGI900 Cascade High Volume Air Sampler (900 L/min.). The concentrations of Phl p 5 were measured by the enzyme-linked immunosorbent assay (ELISA) technique. The annual sum of Poaceae pollen (pollen index) during 2015-2016 was 5454 in Ankara and 4142 in Zonguldak. The total Phl p 5 concentration was 1309 pg/m3 in Zonguldak, whereas it was 8181 pg/m3 in Ankara over 2 years. About 90% of the allergen was found in the fraction with particulate matter (PM) > 10 μm in both cities. It was found that the main meteorological parameter which affected pollen and Phl p 5 was temperature in both stations. Rainfall was also found to be important for Zonguldak, due to its climatic and geographic properties. Lastly, we suggest that the primary wind direction, which is from the south of Zonguldak, could have a `drift effect' for allergens because of the airborne pollen concentrations and the dates on which the allergen is released into the atmosphere. The wind direction may be an important factor in the distribution of allergen and pollen grains in stations, especially those with a hilly topography.

Plastome Sequence Determination and Comparative Analysis for Members of the Lolium-Festuca Grass Species Complex

Science.gov (United States)

Hand, Melanie L.; Spangenberg, German C.; Forster, John W.; Cogan, Noel O. I.

2013-01-01

Chloroplast genome sequences are of broad significance in plant biology, due to frequent use in molecular phylogenetics, comparative genomics, population genetics, and genetic modification studies. The present study used a second-generation sequencing approach to determine and assemble the plastid genomes (plastomes) of four representatives from the agriculturally important Lolium-Festuca species complex of pasture grasses (Lolium multiflorum, Festuca pratensis, Festuca altissima, and Festuca ovina). Total cellular DNA was extracted from either roots or leaves, was sequenced, and the output was filtered for plastome-related reads. A comparison between sources revealed fewer plastome-related reads from root-derived template but an increase in incidental bacterium-derived sequences. Plastome assembly and annotation indicated high levels of sequence identity and a conserved organization and gene content between species. However, frequent deletions within the F. ovina plastome appeared to contribute to a smaller plastid genome size. Comparative analysis with complete plastome sequences from other members of the Poaceae confirmed conservation of most grass-specific features. Detailed analysis of the rbcL–psaI intergenic region, however, revealed a “hot-spot” of variation characterized by independent deletion events. The evolutionary implications of this observation are discussed. The complete plastome sequences are anticipated to provide the basis for potential organelle-specific genetic modification of pasture grasses. PMID:23550121

Phylogenomics and taxonomy of Lecomtelleae (Poaceae), an isolated panicoid lineage from Madagascar.

Science.gov (United States)

Besnard, Guillaume; Christin, Pascal-Antoine; Malé, Pierre-Jean G; Coissac, Eric; Ralimanana, Hélène; Vorontsova, Maria S

2013-10-01

An accurate characterization of biodiversity requires analyses of DNA sequences in addition to classical morphological descriptions. New methods based on high-throughput sequencing may allow investigation of specimens with a large set of genetic markers to infer their evolutionary history. In the grass family, the phylogenetic position of the monotypic genus Lecomtella, a rare bamboo-like endemic from Madagascar, has never been appropriately evaluated. Until now its taxonomic treatment has remained controversial, indicating the need for re-evaluation based on a combination of molecular and morphological data. The phylogenetic position of Lecomtella in Poaceae was evaluated based on sequences from the nuclear and plastid genomes generated by next-generation sequencing (NGS). In addition, a detailed morphological description of L. madagascariensis was produced, and its distribution and habit were investigated in order to assess its conservation status. The complete plastid sequence, a ribosomal DNA unit and fragments of low-copy nuclear genes (phyB and ppc) were obtained. All phylogenetic analyses place Lecomtella as an isolated member of the core panicoids, which last shared a common ancestor with other species >20 million years ago. Although Lecomtella exhibits morphological characters typical of Panicoideae, an unusual combination of traits supports its treatment as a separate group. The study showed that NGS can be used to generate abundant phylogenetic information rapidly, opening new avenues for grass phylogenetics. These data clearly showed that Lecomtella forms an isolated lineage, which, in combination with its morphological peculiarities, justifies its treatment as a separate tribe: Lecomtelleae. New descriptions of the tribe, genus and species are presented with a typification, a distribution map and an IUCN conservation assessment.

Révision du genre Digitaria Haller (Poaceae) au Sénégal ...

African Journals Online (AJOL)

Le genre Digitaria Haller (Poaceae) constitue l'un des genres les plus diversifiés des Poaceae du Sénégal avec 19 espèces. Bien qu'il y ait une monographie mondiale du genre, la détermination des espèces reste difficile et repose essentiellement sur les caractères de l'appareil reproducteur. Ce travail, qui est une ...

Genetic resources of perennial forage grasses in Serbia: Current state, broadening and evaluation

Directory of Open Access Journals (Sweden)

Sokolović Dejan

2017-01-01

Full Text Available Due to historical background of vegetation development, geographical position, climate and relief, Serbia represents one of the 158 world biodiversity centres, based upon the number of plant species and territory size (biodiversity index 0.72. Large areas in Serbia are under natural grasslands and pastures, composed of forage grass species, and important as source of natural plant genetic diversity and germplasm for breeding. These eco-systems represent basic prerequisites for sustainable forage production, but very low potential of them is utilized and genetic resources are not protected. Family Poaceae is present in Serbia flora with 70 genera and among them from the aspect of forage production and quality, the most important are perennial Festuca, Lolium, Dactylis, Phleum, Bromus, Arrhenatherum, Poa and Agrostis species. Most of these grasses have been bred in Serbia and lot of cultivars were released. These cultivars contain autochthonous Serbian material and represent great and important resource of genetic variability. Therefore, collecting of new samples which are acclimatised to local eco-geographical conditions and including them in plant ex situ gene bank is of exceptional importance for further utilization in different plant breeding programmes as well as genetic resources protection. These autochthonous populations have natural variability and very often have satisfactory yielding performance in comparison with introduced cultivars, which referred them for direct phenotypic selection for cultivars release. Broadening of forage grasses genotypes collection is permanent objective of Serbian scientists. Collected accessions are being characterized and evaluated for important phenological, morphological and agronomical traits. In this paper genetic resources of forage grass species, their diversity and potentials, state of the grasses gene banks, as well as possibility for breeding of new cultivars has been analysed.

Anti-methicillin-resistant Staphylococcus aureus (MRSA) activity of Rubiaceae, Fabaceae and Poaceae plants: A search for new sources of useful alternative antibacterials against MRSA infections.

Science.gov (United States)

Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J

2016-08-29

In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.

Using maize as a model to study pollen tube growth and guidance, cross-incompatibility and sperm delivery in grasses.

Science.gov (United States)

Dresselhaus, Thomas; Lausser, Andreas; Márton, Mihaela L

2011-09-01

In contrast to animals and lower plants such as mosses and ferns, sperm cells of flowering plants (angiosperms) are immobile and require transportation to the female gametes via the vegetative pollen tube cell to achieve double fertilization. The path of the pollen tube towards the female gametophyte (embryo sac) has been intensively studied in many intra- and interspecific crossing experiments with the aim of increasing the gene pool of crop plants for greater yield, improved biotic and abiotic stress resistance, and for introducing new agronomic traits. Many attempts to hybridize different species or genotypes failed due to the difficulty for the pollen tubes in reaching the female gametophyte. Detailed studies showed that these processes are controlled by various self-incompatible (intraspecific) and cross-incompatible (interspecific) hybridization mechanisms. Understanding the molecular mechanisms of crossing barriers is therefore of great interest in plant reproduction, evolution and breeding research. In particular, pre-zygotic hybridization barriers related to pollen tube germination, growth, guidance and sperm delivery, which are considered the major hybridization controls in nature and thus also contribute to species isolation and speciation, have been intensively investigated. Despite this general interest, surprisingly little is known about these processes in the most important agronomic plant family, the Gramineae, Poaceae or grasses. Small polymorphic proteins and their receptors, degradation of sterility locus proteins and general compounds such as calcium, γ-aminobutyric acid or nitric oxide have been shown to be involved in progamic pollen germination, adhesion, tube growth and guidance, as well as sperm release. Most advances have been made in the Brassicaceae, Papaveraceae, Linderniaceae and Solanaceae families including their well-understood self-incompatibility (SI) systems. Grass species evolved similar mechanisms to control the penetration

Interactive effects of plant-available soil silicon and herbivory on competition between two grass species

Science.gov (United States)

Garbuzov, Mihail; Reidinger, Stefan; Hartley, Susan E.

2011-01-01

Background and Aims The herbivore defence system of true grasses (Poaceae) is predominantly based on silicon that is taken up from the soil and deposited in the leaves in the form of abrasive phytoliths. Silicon uptake mechanisms can be both passive and active, with the latter suggesting that there is an energetic cost to silicon uptake. This study assessed the effects of plant-available soil silicon and herbivory on the competitive interactions between the grasses Poa annua, a species that has previously been reported to accumulate only small amounts of silicon, and Lolium perenne, a high silicon accumulator. Methods Plants were grown in mono- and mixed cultures under greenhouse conditions. Plant-available soil silicon levels were manipulated by adding silicon to the soil in the form of sodium silicate. Subsets of mixed culture pots were exposed to above-ground herbivory by desert locusts (Schistocerca gregaria). Key Results In the absence of herbivory, silicon addition increased biomass of P. annua but decreased biomass of L. perenne. Silicon addition increased foliar silicon concentrations of both grass species >4-fold. Under low soil-silicon availability the herbivores removed more leaf biomass from L. perenne than from P. annua, whereas under high silicon availability the reverse was true. Consequently, herbivory shifted the competitive balance between the two grass species, with the outcome depending on the availability of soil silicon. Conclusions It is concluded that a complex interplay between herbivore abundance, growth–defence trade-offs and the availability of soil silicon in the grasses' local environment affects the outcome of inter-specific competition, and so has the potential to impact on plant community structure. PMID:21868406

Basic chromosome numbers and polyploid levels in some South African and Australian grasses (Poaceae

Directory of Open Access Journals (Sweden)

J. J. Spies

1991-10-01

Full Text Available Chromosome numbers of 46 specimens of grasses, involving 24 taxa from South Africa and Australia, have been determined during the present study. For the first time chromosome numbers are given for Eragrostis sarmentosa (Thunb. Trin. (n = 20. Panicum aequinerve Nees (n = 18,  Digitaria argyrograpta (Nees Stapf (n = 9 and D. maitlandii Stapf & C.E. Hubb. (n = 9. Additional polyploid levels are described for Diplachne fusca (L. Beauv. ex Roem. & Schult. (n = 10 and Digitaria diagonalis (Nees Stapf var.  diagonalis (n = 9. B-chromosomes were observed in several different specimens. The presence of B-chromosomes often results in abnormal chromosomal behaviour during meiosis.

Barrier island morphology and sediment characteristics affect the recovery of dune building grasses following storm-induced overwash.

Science.gov (United States)

Brantley, Steven T; Bissett, Spencer N; Young, Donald R; Wolner, Catherine W V; Moore, Laura J

2014-01-01

Barrier islands are complex and dynamic systems that provide critical ecosystem services to coastal populations. Stability of these systems is threatened by rising sea level and the potential for coastal storms to increase in frequency and intensity. Recovery of dune-building grasses following storms is an important process that promotes topographic heterogeneity and long-term stability of barrier islands, yet factors that drive dune recovery are poorly understood. We examined vegetation recovery in overwash zones on two geomorphically distinct (undisturbed vs. frequently overwashed) barrier islands on the Virginia coast, USA. We hypothesized that vegetation recovery in overwash zones would be driven primarily by environmental characteristics, especially elevation and beach width. We sampled species composition and environmental characteristics along a continuum of disturbance from active overwash zones to relict overwash zones and in adjacent undisturbed environments. We compared species assemblages along the disturbance chronosequence and between islands and we analyzed species composition data and environmental measurements with Canonical Correspondence Analysis to link community composition with environmental characteristics. Recovering and geomorphically stable dunes were dominated by Ammophila breviligulata Fernaud (Poaceae) on both islands while active overwash zones were dominated by Spartina patens (Aiton) Muhl. (Poaceae) on the frequently disturbed island and bare sand on the less disturbed island. Species composition was associated with environmental characteristics only on the frequently disturbed island (p = 0.005) where A. breviligulata was associated with higher elevation and greater beach width. Spartina patens, the second most abundant species, was associated with larger sediment grain size and greater sediment size distribution. On the less frequently disturbed island, time since disturbance was the only factor that affected community

Barrier island morphology and sediment characteristics affect the recovery of dune building grasses following storm-induced overwash.

Directory of Open Access Journals (Sweden)

Steven T Brantley

Full Text Available Barrier islands are complex and dynamic systems that provide critical ecosystem services to coastal populations. Stability of these systems is threatened by rising sea level and the potential for coastal storms to increase in frequency and intensity. Recovery of dune-building grasses following storms is an important process that promotes topographic heterogeneity and long-term stability of barrier islands, yet factors that drive dune recovery are poorly understood. We examined vegetation recovery in overwash zones on two geomorphically distinct (undisturbed vs. frequently overwashed barrier islands on the Virginia coast, USA. We hypothesized that vegetation recovery in overwash zones would be driven primarily by environmental characteristics, especially elevation and beach width. We sampled species composition and environmental characteristics along a continuum of disturbance from active overwash zones to relict overwash zones and in adjacent undisturbed environments. We compared species assemblages along the disturbance chronosequence and between islands and we analyzed species composition data and environmental measurements with Canonical Correspondence Analysis to link community composition with environmental characteristics. Recovering and geomorphically stable dunes were dominated by Ammophila breviligulata Fernaud (Poaceae on both islands while active overwash zones were dominated by Spartina patens (Aiton Muhl. (Poaceae on the frequently disturbed island and bare sand on the less disturbed island. Species composition was associated with environmental characteristics only on the frequently disturbed island (p = 0.005 where A. breviligulata was associated with higher elevation and greater beach width. Spartina patens, the second most abundant species, was associated with larger sediment grain size and greater sediment size distribution. On the less frequently disturbed island, time since disturbance was the only factor that affected

Reproductive biology of the native forage grass Trichloris crinita (Poaceae, Chloridoideae).

Science.gov (United States)

Kozub, P C; Barboza, K; Galdeano, F; Quarin, C L; Cavagnaro, J B; Cavagnaro, P F

2017-05-01

Trichloris crinita is a perennial forage grass species native to arid regions of the American continent. Due to its extensive area of distribution, good forage quality and resistance to drought and grazing, this species is widely utilised as forage and for revegetation purposes in environments with low water availability. Despite its importance, genetic improvement of T. crinita has been very limited, partly as consequence of the lack of knowledge on its mode of reproduction. In the present work, we studied the reproductive biology of T. crinita by means of embryological analyses, flow cytometric seed screen (FCSS), self-compatibility tests and progeny testing with morphological and molecular markers. Cytological analyses revealed embryo sacs with eight nuclei and of Polygonum type for all T. crinita accessions analysed. FCSS histograms exhibited two clear peaks corresponding to 2C and 3C DNA content, indicating embryo sacs of sexual origin. Controlled pollination experiments designed to evaluate seed set (%) demonstrated that T. crinita is self-compatible, whereas results from morphological and simple sequence repeat (SSR) marker analysis of progeny revealed lack of outcrossing. Together, these results indicate that T. crinita reproduces sexually. It is a self-compatible and autogamous species. It is expected that these data will have a positive impact in the genetics and breeding of this species, and therefore contribute to its proper utilisation in arid regions. © 2017 German Botanical Society and The Royal Botanical Society of the Netherlands.

Characterization of an alkali-treated grass fiber by thermogravimetric and X-ray crystallographic analysis

NARCIS (Netherlands)

De, D.; De, Debapriya

2008-01-01

The thermal behavior of grass fiber was characterized by means of thermogravimetric analysis and differential scanning calorimetry analysis. The results proved that the removal of water-soluble matter improved the thermal behavior of grass fiber over that of unleached fiber, and this was further

Descriptions of the immature stages and new host plant records of Notozulia entreriana (Berg) (Hemiptera: Cercopidae) pests of grasses in subtropical areas of the Americas.

Science.gov (United States)

Foieri, Alvaro; Lenicov, Ana M Marino De Remes; Virla, Eduardo G

2016-04-11

Notozulia entreriana (Berg) (Hemiptera: Cercopidae) is one of the most common spittlebugs inhabiting the subtropical region of the America, inflicting important economic damage to grass crops. The immature stages are described and illustrated; the main characteristics that distinguish instars are the body size, color, number of flagellomeres, and number of tibial and metatarsomere spines. A key for identification of nymphs is provided as a tool to develop field studies.  Nine host plants, all belonging to Poaceae, are recorded as breeding and feeding host plants from different localities in northern Argentina.

Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

Science.gov (United States)

Fauteux, François; Strömvik, Martina V

2009-01-01

Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs

Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

Directory of Open Access Journals (Sweden)

Fauteux François

2009-10-01

Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination

Cytomorphological studies in some members of tribe Paniceae (Poaceae) from district Kangra of Himachal Pradesh (Western Himalayas).

Science.gov (United States)

Kaur, H; Kumari, S; Gupta, R C

2013-01-01

The present paper deals with cytological studies on the population basis of 21 species belonging to 9 genera of tribe Paniceae of family Poaceae from cytologically unexplored area of Western Himalayas i.e. district Kangra of Himachal Pradesh for the assessment of genetic diversity of grass flora. On world-wide basis, the chromosome counts have been made for the first time for three species such as Brachiaria remota (n = 16), Digitaria granularis (n = 36) and Isachne albens (n = 5). Similarly, on India basis, altogether new records are made for two species such as Echinochloa cruspavonis (n = 27) and Paspalum distichum (2n = 50). A comparison of the different euploid cytotypes studied at present for Digitaria adscendens, D. setigera and Oplismenus compositus revealed significant variations in their morphology, depicting increase in some of the characters of polyploid cytotypes. The course of meiosis has been observed to be normal in all the studied populations with high pollen fertility except for two species such as Paspalum dilatatum and P. distichum marked with abnormal meiosis and reduced pollen fertility.

Nature of ergastic substances in some Poaceae seeds

African Journals Online (AJOL)

ajl yemi

2011-08-29

Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...

Plastid phylogenomics of the cool-season grass subfamily: clarification of relationships among early-diverging tribes.

Science.gov (United States)

Saarela, Jeffery M; Wysocki, William P; Barrett, Craig F; Soreng, Robert J; Davis, Jerrold I; Clark, Lynn G; Kelchner, Scot A; Pires, J Chris; Edger, Patrick P; Mayfield, Dustin R; Duvall, Melvin R

2015-05-04

Whole plastid genomes are being sequenced rapidly from across the green plant tree of life, and phylogenetic analyses of these are increasing resolution and support for relationships that have varied among or been unresolved in earlier single- and multi-gene studies. Pooideae, the cool-season grass lineage, is the largest of the 12 grass subfamilies and includes important temperate cereals, turf grasses and forage species. Although numerous studies of the phylogeny of the subfamily have been undertaken, relationships among some 'early-diverging' tribes conflict among studies, and some relationships among subtribes of Poeae have not yet been resolved. To address these issues, we newly sequenced 25 whole plastomes, which showed rearrangements typical of Poaceae. These plastomes represent 9 tribes and 11 subtribes of Pooideae, and were analysed with 20 existing plastomes for the subfamily. Maximum likelihood (ML), maximum parsimony (MP) and Bayesian inference (BI) robustly resolve most deep relationships in the subfamily. Complete plastome data provide increased nodal support compared with protein-coding data alone at nodes that are not maximally supported. Following the divergence of Brachyelytrum, Phaenospermateae, Brylkinieae-Meliceae and Ampelodesmeae-Stipeae are the successive sister groups of the rest of the subfamily. Ampelodesmeae are nested within Stipeae in the plastome trees, consistent with its hybrid origin between a phaenospermatoid and a stipoid grass (the maternal parent). The core Pooideae are strongly supported and include Brachypodieae, a Bromeae-Triticeae clade and Poeae. Within Poeae, a novel sister group relationship between Phalaridinae and Torreyochloinae is found, and the relative branching order of this clade and Aveninae, with respect to an Agrostidinae-Brizinae clade, are discordant between MP and ML/BI trees. Maximum likelihood and Bayesian analyses strongly support Airinae and Holcinae as the successive sister groups of a Dactylidinae

Ecophysiological responses of native and invasive grasses to simulated warming and drought

Science.gov (United States)

Ravi, S.; Law, D. J.; Wiede, A.; Barron-Gafford, G. A.; Breshears, D. D.; Dontsova, K.; Huxman, T. E.

2011-12-01

Climate models predict that many arid regions around the world - including the North American deserts - may become affected more frequently by recurrent droughts. At the same time, these regions are experiencing rapid vegetation transformations such as invasion by exotic grasses. Thus, understanding the ecophysiological processes accompanying exotic grass invasion in the context of rising temperatures and recurrent droughts is fundamental to global change research. Under ambient and warmer (+ 4° C) conditions inside the Biosphere 2 facility, we compared the ecophysiological responses (e.g. photosynthesis, stomatal conductance, pre-dawn leaf water potential, light & CO2 response functions, biomass) of a native grass - Heteropogan contortus (Tangle head) and an invasive grass - Pennisetum ciliare (Buffel grass) growing in single and mixed communities. Further, we monitored the physiological responses and mortality of these plant communities under moisture stress conditions, simulating a global change-type-drought. The results indicate that the predicted warming scenarios may enhance the invasibility of desert landscapes by exotic grasses. In this study, buffel grass assimilated more CO2 per unit leaf area and out-competed native grasses more efficiently in a warmer environment. However, scenarios involving a combination of drought and warming proved disastrous to both the native and invasive grasses, with drought-induced grass mortality occurring at much shorter time scales under warmer conditions.

CATÁLOGO DE LA FAMILIA POACEAE EN COLOMBIA

Directory of Open Access Journals (Sweden)

Diego Giraldo-Cañas

2011-01-01

Full Text Available Se presenta un inventario de las especies de Poaceae de Colombia junto con un análisis de la diversidad específica de esta familia según las regiones naturales colombianas, los gradientes de altitud y de precipitaciones, y la distribución sistemática. Se realizaron 96 expediciones de campo a las diez grandes regiones naturales de Colombia (Amazonia, Andes, Caribe, Chocó Biogeográfico, Guayana, islas caribeñas, Orinoquia, Sierra Nevada de Santa Marta, valle del río Cauca y valle del río Magdalena con un muestreo total de alrededor de 5800 ejemplares. Además, se consultaron colecciones de los herbarios CAUP, COAH, COL, CUVC, CHOCO, HFAB, HUA, HUQ, JAUM, MEDEL, MEXU, MO, NY, PSO, RSA, SI, UDBC, UIS, US, VALLE y VEN, y se realizó una investigación bibliográfica exhaustiva. Las Poaceae están representadas en Colombia por 840 especies y 173 géneros. Se reconocieron 74 especies y un género (Agrostopoa endémicos. Por otra parte, se documentaron 83 especies introducidas-naturalizadas y 50 introducidas-cultivadas. Los géneros más ricos en especies son Paspalum (89 especies, Panicum (42, Festuca (36, Eragrostis (29, Calamagrostis (25, Chusquea (25, Digitaria (24, Axonopus (21, Setaria (20, Cenchrus (18, Poa (17, Muhlenbergia (16, Andropogon (15, Aristida (15, Agrostis (14, Lasiacis (12, Urochloa (12, Pariana (11, Sporobolus (11, Arthrostylidium (10, Cortaderia (10, Nassella (10, Neurolepis (10 y Schizachyrium (10. Durante el desarrollo de esta investigación, se descubrieron 10 nuevos registros para la flora colombiana. La regiones Andina, Orinocense, Caribe y Guayanesa son las más ricas en especies, con 583, 233, 186 y 179 especies, respectivamente. La Región Andina presenta el mayor número de especies endémicas (57 especies. Los gradientes altitudinales más diversos corresponden a los de las tierras bajas (por debajo de 1200 m s.m.. Al igual que en otras áreas tropicales, en Colombia las subfamilias de Poaceae muestran una

Interspecific sex in grass smuts and the genetic diversity of their pheromone-receptor system.

Directory of Open Access Journals (Sweden)

Ronny Kellner

2011-12-01

Full Text Available The grass smuts comprise a speciose group of biotrophic plant parasites, so-called Ustilaginaceae, which are specifically adapted to hosts of sweet grasses, the Poaceae family. Mating takes a central role in their life cycle, as it initiates parasitism by a morphological and physiological transition from saprobic yeast cells to pathogenic filaments. As in other fungi, sexual identity is determined by specific genomic regions encoding allelic variants of a pheromone-receptor (PR system and heterodimerising transcription factors. Both operate in a biphasic mating process that starts with PR-triggered recognition, directed growth of conjugation hyphae, and plasmogamy of compatible mating partners. So far, studies on the PR system of grass smuts revealed diverse interspecific compatibility and mating type determination. However, many questions concerning the specificity and evolutionary origin of the PR system remain unanswered. Combining comparative genetics and biological approaches, we report on the specificity of the PR system and its genetic diversity in 10 species spanning about 100 million years of mating type evolution. We show that three highly syntenic PR alleles are prevalent among members of the Ustilaginaceae, favouring a triallelic determination as the plesiomorphic characteristic of this group. Furthermore, the analysis of PR loci revealed increased genetic diversity of single PR locus genes compared to genes of flanking regions. Performing interspecies sex tests, we detected a high potential for hybridisation that is directly linked to pheromone signalling as known from intraspecies sex. Although the PR system seems to be optimised for intraspecific compatibility, the observed functional plasticity of the PR system increases the potential for interspecific sex, which might allow the hybrid-based genesis of newly combined host specificities.

Toxic effects of Cu2+ on growth, nutrition, root morphology, and distribution of Cu in roots of Sabi grass

International Nuclear Information System (INIS)

Kopittke, P.M.; Asher, C.J.; Blamey, F.P.C.; Menzies, N.W.

2009-01-01

Sabi grass (Urochloa mosambicensis (Hack.) Dandy) (a C4 species of Poaceae) is commonly used to revegetate disturbed sites in low-rainfall environments, but comparatively little is known regarding copper (Cu) toxicity in this species. A dilute nutrient solution culture experiment was conducted for 10 d to examine the effects of elevated Cu 2+ activities ({Cu 2+ }) on the growth of Sabi grass. Growth was inhibited by high Cu in solution, with a 50% reduction in the relative fresh mass occurring at 1.0 μM {Cu 2+ } for the roots and 1.2 μM {Cu 2+ } for the shoots. In solutions containing 1.2-1.9 μM {Cu 2+ }, many of the roots ruptured due to the tearing and separation of the rhizodermis and outer cortex from the underlying tissues. Transmission electron microscopy revealed that Cu-rich deposits were found to accumulate predominantly within vacuoles. Due to limited translocation of Cu from the roots to the shoots, phytotoxicity is likely to be more of a problem in remediation of Cu-toxic sites than is Cu toxicity of fauna consuming the above-ground biomass.

Facilitation of a native pest of rice, Stenotus rubrovittatus (Hemiptera: Miridae), by the non-native Lolium multiflorum (Cyperales: Poaceae) in an agricultural landscape.

Science.gov (United States)

Yoshioka, Akira; Takada, Mayura; Washitani, Izumi

2011-10-01

Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.

Late-Quaternary variation in C3 and C4 grass abundance in southeastern Australia as inferred from δ13C analysis: Assessing the roles of climate, pCO2, and fire

Science.gov (United States)

Nelson, David M.; Urban, Michael A.; Kershaw, A. Peter; Hu, Feng Sheng

2016-05-01

Climate, atmospheric pCO2, and fire all may exert major influences on the relative abundance of C3 and C4 grasses in the present-day vegetation. However, the relative role of these factors in driving variation in C3 and C4 grass abundances in the paleorecord is uncertain, and C4 abundance is often interpreted narrowly as a proxy indicator of aridity or pCO2. We measured δ13C values of individual grains of grass (Poaceae) pollen in the sediments of two sites in southeastern Australia to assess changes in the proportions of C3 and C4 grasses during the past 25,000 years. These data were compared with shifts in pCO2, temperature, moisture balance, and fire to assess how these factors were related to long-term variation of C4 grass abundance during the late Quaternary. At Caledonia Fen, a high-elevation site in the Snowy Mountains, C4 grass abundance decreased from an average of 66% during the glacial period to 11% during the Holocene, primarily in response to increased pCO2 and temperature. In contrast, this pattern did not exist in low-elevation savannah woodlands around Tower Hill Northwest Crater, where C4 grass abundance instead varied in response to shifts in regional aridity. Fire did not appear to have strongly influenced the proportions of C3 and C4 grasses on the landscape at millennial timescales at either site. These patterns are similar to those of a recent study in East Africa, suggesting that elevation-related climatic differences influence how the abundance of C3 and C4 grasses responds to shifts in climate and pCO2. These results caution against using C4 plant abundance as a proxy indicator of either climate or pCO2 without an adequate understanding of key controlling factors.

Nature of ergastic substances in some Poaceae seeds | Idu | African ...

African Journals Online (AJOL)

Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and protein and were devoid of tannins and inulin. Only 12 seed samples indicated the presence of alkaloids. The Positively ...

Multiple photosynthetic transitions, polyploidy, and lateral gene transfer in the grass subtribe Neurachninae.

Science.gov (United States)

Christin, Pascal-Antoine; Wallace, Mark J; Clayton, Harmony; Edwards, Erika J; Furbank, Robert T; Hattersley, Paul W; Sage, Rowan F; Macfarlane, Terry D; Ludwig, Martha

2012-10-01

The Neurachninae is the only grass lineage known to contain C(3), C(4), and C(3)-C(4) intermediate species, and as such has been suggested as a model system for studies of photosynthetic pathway evolution in the Poaceae; however, a lack of a robust phylogenetic framework has hindered this possibility. In this study, plastid and nuclear markers were used to reconstruct evolutionary relationships among Neurachninae species. In addition, photosynthetic types were determined with carbon isotope ratios, and genome sizes with flow cytometry. A high frequency of autopolyploidy was found in the Neurachninae, including in Neurachne munroi F.Muell. and Paraneurachne muelleri S.T.Blake, which independently evolved C(4) photosynthesis. Phylogenetic analyses also showed that following their separate C(4) origins, these two taxa exchanged a gene encoding the C(4) form of phosphoenolpyruvate carboxylase. The C(3)-C(4) intermediate Neurachne minor S.T.Blake is phylogenetically distinct from the two C(4) lineages, indicating that intermediacy in this species evolved separately from transitional stages preceding C(4) origins. The Neurachninae shows a substantial capacity to evolve new photosynthetic pathways repeatedly. Enablers of these transitions might include anatomical pre-conditions in the C(3) ancestor, and frequent autopolyploidization. Transfer of key C(4) genetic elements between independently evolved C(4) taxa may have also facilitated a rapid adaptation of photosynthesis in these grasses that had to survive in the harsh climate appearing during the late Pliocene in Australia.

Grass pollen seasons in Poland against a background of the meteorological conditions

Directory of Open Access Journals (Sweden)

Dorota Myszkowska

2015-12-01

Full Text Available The paper refers to the estimation of Poaceae pollen seasons in Poland in selected areas. The aim of the study was to present the long-term variability of the start, end and duration of grass pollen seasons and the seasonal pollen index (SPI in Poland against a background of the meteorological conditions over pollen seasons. The study was performed in eight Polish cities in 1992–2014 (the common seasons were 2003–2012. Pollen season start was relatively stable in the studied period, the seasons began about the 10th of May, a bit earlier in the south part of Poland. Pollen season ends were more changeable in comparison to the season start and fluctuated from the middle of July to the middle of September. SPI clearly depended on temperature and precipitation in April–August. Daily maximum pollen concentrations were achieved between the end of May and the first decade of July and no evident relationship between this day and weather conditions was found, apart from 2004.

Are diversification rates and chromosome evolution in the temperate grasses (Pooideae) associated with major environmental changes in the Oligocene-Miocene?

Science.gov (United States)

Pimentel, Manuel; Escudero, Marcial; Sahuquillo, Elvira; Minaya, Miguel Ángel; Catalán, Pilar

2017-01-01

The Pooideae are a highly diverse C3 grass subfamily that includes some of the most economically important crops, nested within the highly speciose core-pooid clade. Here, we build and explore the phylogeny of the Pooideae within a temporal framework, assessing its patterns of diversification and its chromosomal evolutionary changes in the light of past environmental transformations. We sequenced five plastid DNA loci, two coding ( ndhF , matk ) and three non-coding ( trnH-psbA , trnT-L and trnL-F ), in 163 Poaceae taxa, including representatives for all subfamilies of the grasses and all but four ingroup Pooideae tribes. Parsimony and Bayesian phylogenetic analyses were conducted and divergence times were inferred in BEAST using a relaxed molecular clock. Diversification rates were assessed using the MEDUSA approach, and chromosome evolution was analyzed using the chromEvol software. Diversification of the Pooideae started in the Late-Eocene and was especially intense during the Oligocene-Miocene. The background diversification rate increased significantly at the time of the origin of the Poodae + Triticodae clade. This shift in diversification occurred in a context of falling temperatures that potentially increased ecological opportunities for grasses adapted to open areas around the world. The base haploid chromosome number n  = 7 has remained stable throughout the phylogenetic history of the core pooids and we found no link between chromosome transitions and major diversification events in the Pooideae.

Variation in sequences containing microsatellite motifs in the perennial biomass and forage grass, Phalaris arundinacea (Poaceae).

Science.gov (United States)

Barth, Susanne; Jankowska, Marta Jolanta; Hodkinson, Trevor Roland; Vellani, Tia; Klaas, Manfred

2016-03-22

Forty three microsatellite markers were developed for further genetic characterisation of a forage and biomass grass crop, for which genomic resources are currently scarce. The microsatellite markers were developed from a normalized EST-SSR library. All of the 43 markers gave a clear banding pattern on 3% Metaphor agarose gels. Eight selected SSR markers were tested in detail for polymorphism across eleven DNA samples of large geographic distribution across Europe. The new set of 43 SSR markers will help future research to characterise the genetic structure and diversity of Phalaris arundinacea, with a potential to further understand its invasive character in North American wetlands, as well as aid in breeding work for desired biomass and forage traits. P. arundinacea is particularly valued in the northern latitude as a crop with high biomass potential, even more so on marginal lands.

Phytostabilisation potential of lemon grass (Cymbopogon flexuosus (Nees ex Stend) Wats) on iron ore tailings.

Science.gov (United States)

Mohanty, M; Dhal, N K; Patra, P; Das, B; Reddy, P S R

2012-01-01

The present pot culture study was carried out for the potential phytostabilisation of iron ore tailings using lemon grass (Cymbopogon flexuosus) a drought tolerant, perennial, aromatic grass. Experiments have been conducted by varying the composition of garden soil (control) with iron ore tailings. The various parameters, viz. growth of plants, number of tillers, biomass and oil content of lemon grass are evaluated. The studies have indicated that growth parameters of lemon grass in 1:1 composition of garden soil and iron ore tailings are significantly more (-5% increase) compared to plants grown in control soil. However, the oil content of lemon grass in both the cases more or less remained same. The results also infer that at higher proportion of tailings the yield of biomass decreases. The studies indicate that lemongrass with its fibrous root system is proved to be an efficient soil binder by preventing soil erosion.

resistance of napier grass clones to napier grass stunt disease

African Journals Online (AJOL)

ACSS

Napier grass (Pennisetum purpureum Schumach) is the major livestock fodder under intensive and semi-intensive systems in East Africa. However, the productivity of the grass is constrained by Napier grass Stunt Disease. (NSD). The purpose of this study was to identify Napier grass clones with resistance to NSD.

Resistance of Napier grass clones to Napier grass Stunt Disease ...

African Journals Online (AJOL)

Napier grass (Pennisetum purpureum Schumach) is the major livestock fodder under intensive and semi-intensive systems in East Africa. However, the productivity of the grass is constrained by Napier grass Stunt Disease (NSD). The purpose of this study was to identify Napier grass clones with resistance to NSD.

Airborne study of grass allergen (Lol p 1) in different-sized particles.

Science.gov (United States)

De Linares, C; Díaz de la Guardia, C; Nieto Lugilde, D; Alba, F

2010-01-01

The Poaceae family is considered one of the main causes of pollen allergy in industrialized countries. The aim of this study is to establish the dynamics of the Poaceae allergens and determine their distribution in the different-sized particles in the atmosphere. The air of Granada (southern Spain) was sampled during the pollination period of Poaceae using a cascade impactor and a Hirst-type volumetric collector simultaneously. The sampled airborne allergens were analyzed by indirect ELISA and field emission scanning electron microscopy. Airborne pollen was evaluated with the Spanish Aerobiological Network methodology. Poaceae pollen and allergenic activity have parallel dynamics during the period of maximum pollination, which is reflected in the positive correlations between the 2 variables. In addition, the highest Lol p 1 concentrations were recorded in particle sizes lower than 3.3 mum (stage 4-F). The Spearman correlation test showed that airborne allergens are not dependent on meteorological factors, such as humidity, wind direction or sunshine, however, Lol p 1 allergen correlated positively with Poaceae pollen. The results of the present study confirm that the Lol p 1 allergen is detected more frequently with pollutants than with coarse particles with similar dynamics and a positive correlation between airborne pollen and aeroallergens. Moreover, Lol p 1 is released in stable weather conditions without large changes in humidity or temperature. Copyright 2009 S. Karger AG, Basel.

Transcriptome Analysis in Sheepgrass (Leymus chinensis). A Dominant Perennial Grass of the Eurasian Steppe

Energy Technology Data Exchange (ETDEWEB)

Chen, Shuangyan [Chinese Academy of Sciences (CAS), Institute of Botany (IB), Beijing; Huang, Xin [Chinese Academy of Sciences (CAS), Institute of Botany (IB), Beijing; Yang, Xiaohan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Liu, Gongshe [Chinese Academy of Sciences (CAS), Institute of Botany (IB), Beijing

2013-07-04

BACKGROUND: Sheepgrass [Leymus chinensis (Trin.) Tzvel.] is an important perennial forage grass across the Eurasian Steppe and is known for its adaptability to various environmental conditions. However, insufficient data resources in public databases for sheepgrass limited our understanding of the mechanism of environmental adaptations, gene discovery and molecular marker development. RESULTS: The transcriptome of sheepgrass was sequenced using Roche 454 pyrosequencing technology. We assembled 952,328 high-quality reads into 87,214 unigenes, including 32,416 contigs and 54,798 singletons. There were 15,450 contigs over 500 bp in length. BLAST searches of our database against Swiss-Prot and NCBI non-redundant protein sequences (nr) databases resulted in the annotation of 54,584 (62.6%) of the unigenes. Gene Ontology (GO) analysis assigned 89,129 GO term annotations for 17,463 unigenes. We identified 11,675 core Poaceae-specific and 12,811 putative sheepgrass-specific unigenes by BLAST searches against all plant genome and transcriptome databases. A total of 2,979 specific freezing-responsive unigenes were found from this RNAseq dataset. We identified 3,818 EST-SSRs in 3,597 unigenes, and some SSRs contained unigenes that were also candidates for freezing-response genes. Characterizations of nucleotide repeats and dominant motifs of SSRs in sheepgrass were also performed. Similarity and phylogenetic analysis indicated that sheepgrass is closely related to barley and wheat. CONCLUSIONS: This research has greatly enriched sheepgrass transcriptome resources. The identified stress-related genes will help us to decipher the genetic basis of the environmental and ecological adaptations of this species and will be used to improve wheat and barley crops through hybridization or genetic transformation. The EST-SSRs reported here will be a valuable resource for future gene-phenotype studies and for the molecular breeding of sheepgrass and other Poaceae species.

Transcriptome analysis in sheepgrass (Leymus chinensis): a dominant perennial grass of the Eurasian Steppe.

Science.gov (United States)

Chen, Shuangyan; Huang, Xin; Yan, Xueqing; Liang, Ye; Wang, Yuezhu; Li, Xiaofeng; Peng, Xianjun; Ma, Xingyong; Zhang, Lexin; Cai, Yueyue; Ma, Tian; Cheng, Liqin; Qi, Dongmei; Zheng, Huajun; Yang, Xiaohan; Li, Xiaoxia; Liu, Gongshe

2013-01-01

Sheepgrass [Leymus chinensis (Trin.) Tzvel.] is an important perennial forage grass across the Eurasian Steppe and is known for its adaptability to various environmental conditions. However, insufficient data resources in public databases for sheepgrass limited our understanding of the mechanism of environmental adaptations, gene discovery and molecular marker development. The transcriptome of sheepgrass was sequenced using Roche 454 pyrosequencing technology. We assembled 952,328 high-quality reads into 87,214 unigenes, including 32,416 contigs and 54,798 singletons. There were 15,450 contigs over 500 bp in length. BLAST searches of our database against Swiss-Prot and NCBI non-redundant protein sequences (nr) databases resulted in the annotation of 54,584 (62.6%) of the unigenes. Gene Ontology (GO) analysis assigned 89,129 GO term annotations for 17,463 unigenes. We identified 11,675 core Poaceae-specific and 12,811 putative sheepgrass-specific unigenes by BLAST searches against all plant genome and transcriptome databases. A total of 2,979 specific freezing-responsive unigenes were found from this RNAseq dataset. We identified 3,818 EST-SSRs in 3,597 unigenes, and some SSRs contained unigenes that were also candidates for freezing-response genes. Characterizations of nucleotide repeats and dominant motifs of SSRs in sheepgrass were also performed. Similarity and phylogenetic analysis indicated that sheepgrass is closely related to barley and wheat. This research has greatly enriched sheepgrass transcriptome resources. The identified stress-related genes will help us to decipher the genetic basis of the environmental and ecological adaptations of this species and will be used to improve wheat and barley crops through hybridization or genetic transformation. The EST-SSRs reported here will be a valuable resource for future gene-phenotype studies and for the molecular breeding of sheepgrass and other Poaceae species.

O gênero Chloris (Poaceae) em Pernambuco, Brasil

OpenAIRE

Maciel, Jefferson Rodrigues; Silva, Wegliane Campelo da; Costa-e-Silva, Maria Bernadete

2013-01-01

Com o objetivo de colaborar com o conhecimento da riqueza de Poaceae em Pernambuco, foi estudado o gênero Chloris Sw. As coletas foram realizadas no estado, bem como dados foram coligidos de levantamento em herbários da região. Foram registradas sete espécies de Chloris em Pernambuco: C. barbata Sw., C. elata Desv., C. exilis Renv., C. gayana Kunth, C. orthonoton Döll, C. pycnothrix Trin. e C. virgata Sw. O gênero apresenta distribuição ampla em todas as zonas fitogeográficas do estado. Chlor...

Acute toxic effects of endosulfan sulfate on three life stages of grass shrimp, Palaemonetes pugio.

Science.gov (United States)

Key, Peter B; Chung, Katy W; Venturella, John J; Shaddrick, Brian; Fulton, Michael H

2010-01-01

In this study, the toxicity of endosulfan sulfate, the primary degradation product of the insecticide endosulfan, was determined in three life stages of the grass shrimp (Palaemonetes pugio). After 96 h exposure to endosulfan sulfate, the grass shrimp adult LC50 was 0.86 microg/L (95% CI 0.56-1.31), the grass shrimp larvae LC50 was 1.64 microg/L (95% CI 1.09-2.47) and the grass shrimp embryo LC50 was 45.85 microg/L (95% CI 23.72-88.61 microg/L). This was compared to the previously published grass shrimp 96-h LC50s for endosulfan. The toxicity of the two compounds was similar for the grass shrimp life stages with adults more sensitive than larvae and embryos. The presence of sediment in 24h endosulfan sulfate-exposures raised LC50s for both adult and larval grass shrimp but not significantly. The USEPA expected environmental concentrations (EEC) for total endosulfan and endosulfan sulfate and the calculations of risk quotients (RQ) based on the more sensitive adult grass shrimp 96-h LC50 clearly show that environmental concentrations equal to acute EECs would prove detrimental to grass shrimp or other similarly sensitive aquatic organisms. These results indicate that given the persistence and toxicity of endosulfan sulfate, future risk assessments should consider the toxicity potential of the parent compound as well as this degradation product.

Test Area C-62 Final Programmatic Environmental Assessment

Science.gov (United States)

2002-05-01

grasses, leaves, fruits , seeds, and insects. The foods most frequently found in their diets are grasses (Poaceae spp.) and legume fruits (Fabaceae spp...heavily on grasses, herbs, fruits , and mast. They also feed on carrion and insects (Jonkel, 1978). The key habitat requirements of black bears are...transforming toxic compounds into harmless water, carbon dioxide, and/or methane (U.S. Army Corps of Engineers, 1999). Soil and groundwater microbiota are

Disentangling the effects of feedback structure and climate on Poaceae annual airborne pollen fluctuations and the possible consequences of climate change.

Science.gov (United States)

García de León, David; García-Mozo, Herminia; Galán, Carmen; Alcázar, Purificación; Lima, Mauricio; González-Andújar, José L

2015-10-15

Pollen allergies are the most common form of respiratory allergic disease in Europe. Most studies have emphasized the role of environmental processes, as the drivers of airborne pollen fluctuations, implicitly considering pollen production as a random walk. This work shows that internal self-regulating processes of the plants (negative feedback) should be included in pollen dynamic systems in order to give a better explanation of the observed pollen temporal patterns. This article proposes a novel methodological approach based on dynamic systems to investigate the interaction between feedback structure of plant populations and climate in shaping long-term airborne Poaceae pollen fluctuations and to quantify the effects of climate change on future airborne pollen concentrations. Long-term historical airborne Poaceae pollen data (30 years) from Cordoba city (Southern Spain) were analyzed. A set of models, combining feedback structure, temperature and actual evapotranspiration effects on airborne Poaceae pollen were built and compared, using a model selection approach. Our results highlight the importance of first-order negative feedback and mean annual maximum temperature in driving airborne Poaceae pollen dynamics. The best model was used to predict the effects of climate change under two standardized scenarios representing contrasting temporal patterns of economic development and CO2 emissions. Our results predict an increase in pollen levels in southern Spain by 2070 ranging from 28.5% to 44.3%. The findings from this study provide a greater understanding of airborne pollen dynamics and how climate change might impact the future evolution of airborne Poaceae pollen concentrations and thus the future evolution of related pollen allergies. Copyright © 2015 Elsevier B.V. All rights reserved.

Gene Expression Profiling of Grass Carp (Ctenopharyngodon idellus and Crisp Grass Carp

Directory of Open Access Journals (Sweden)

Ermeng Yu

2014-01-01

Full Text Available Grass carp (Ctenopharyngodon idellus is one of the most important freshwater fish that is native to China, and crisp grass carp is a kind of high value-added fishes which have higher muscle firmness. To investigate biological functions and possible signal transduction pathways that address muscle firmness increase of crisp grass carp, microarray analysis of 14,900 transcripts was performed. Compared with grass carp, 127 genes were upregulated and 114 genes were downregulated in crisp grass carp. Gene ontology (GO analysis revealed 30 GOs of differentially expressed genes in crisp grass carp. And strong correlation with muscle firmness increase of crisp grass carp was found for these genes from differentiation of muscle fibers and deposition of ECM, and also glycolysis/gluconeogenesis pathway and calcium metabolism may contribute to muscle firmness increase. In addition, a number of genes with unknown functions may be related to muscle firmness, and these genes are still further explored. Overall, these results had been demonstrated to play important roles in clarifying the molecular mechanism of muscle firmness increase in crisp grass carp.

Environ: E00167 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available PD:C01530], Benzoxazinones, Polysaccharide, Protein Coix lacryma-jobi [TAX:714458] Same as: D06798 Poaceae (grass family) Coicis semen Major component: Coixenolide [CPD:C17566] ...

A maize resistance gene functions against bacterial streak disease in rice

OpenAIRE

Zhao, Bingyu; Lin, Xinghua; Poland, Jesse; Trick, Harold; Leach, Jan; Hulbert, Scot

2005-01-01

Although cereal crops all belong to the grass family (Poacea), most of their diseases are specific to a particular species. Thus, a given cereal species is typically resistant to diseases of other grasses, and this nonhost resistance is generally stable. To determine the feasibility of transferring nonhost resistance genes (R genes) between distantly related grasses to control specific diseases, we identified a maize R gene that recognizes a rice pathogen, Xanthomonas oryzae pv. oryzicola, wh...

Treatment with grass allergen peptides improves symptoms of grass pollen-induced allergic rhinoconjunctivitis.

Science.gov (United States)

Ellis, Anne K; Frankish, Charles W; O'Hehir, Robyn E; Armstrong, Kristen; Steacy, Lisa; Larché, Mark; Hafner, Roderick P

2017-08-01

Synthetic peptide immunoregulatory epitopes are a new class of immunotherapy to treat allergic rhinoconjunctivitis (ARC). Grass allergen peptides, comprising 7 synthetic T-cell epitopes derived from Cyn d 1, Lol p 5, Dac g 5, Hol l 5, and Phl p 5, is investigated for treatment of grass pollen-induced ARC. We sought to evaluate the efficacy, safety, and tolerability of intradermally administered grass allergen peptides. A multicenter, randomized, double-blind, placebo-controlled study evaluated 3 regimens of grass allergen peptides versus placebo in patients with grass pollen-induced allergy (18-65 years). After a 4-day baseline challenge to rye grass in the environmental exposure unit (EEU), subjects were randomized to receive grass allergen peptides at 6 nmol at 2-week intervals for a total of 8 doses (8x6Q2W), grass allergen peptides at 12 nmol at 4-week intervals for a total of 4 doses (4x12Q4W), or grass allergen peptides at 12 nmol at 2-week intervals for a total of 8 doses (8x12Q2W) or placebo and treated before the grass pollen season. The primary efficacy end point was change from baseline in total rhinoconjunctivitis symptom score across days 2 to 4 of a 4-day posttreatment challenge (PTC) in the EEU after the grass pollen season. Secondary efficacy end points and safety were also assessed. Two hundred eighty-two subjects were randomized. Significantly greater improvement (reduction of total rhinoconjunctivitis symptom score from baseline to PTC) occurred across days 2 to 4 with grass allergen peptide 8x6Q2W versus placebo (-5.4 vs -3.8, respectively; P = .0346). Greater improvement at PTC also occurred for grass allergen peptide 8x6Q2W versus placebo (P = .0403) in patients with more symptomatic ARC. No safety signals were detected. Grass allergen peptide 8x6Q2W significantly improved ARC symptoms after rye grass allergen challenge in an EEU with an acceptable safety profile. Copyright © 2017 American Academy of Allergy, Asthma & Immunology

Drug: D10238 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available ucris; Adlay ... Coix lacryma-jobi [TAX:714458] ... Same as: E00845 ... Poaceae (grass family) Adlay fruit and bract; Standards for non-pharmacopoeial crude drugs ... PubChem: 163312269 ...

Effects of livestock exclusion on density, survival and biomass of the perennial sagebrush grass Hymenachne pernambucense (Poaceae) from a temperate fluvial wetland

Science.gov (United States)

Magnano, Andrea L.; Nanni, Analía S.; Krug, Pamela; Astrada, Elizabeth; Vicari, Ricardo; Quintana, Rubén D.

2018-01-01

In Argentina, the intensification of soybean production has displaced a substantial proportion of cattle ranching to fluvial wetlands such as those in the Delta of the Paraná River. Cattle grazing affects structure and dynamics of native forage plants but there is little information on this impact in populations from fluvial wetlands. This study addresses the effect of cattle ranching on density, survival, mean life-span and aerial biomass of Hymenachne pernambucense (Poaceae), an important forage species in the region. The study was carried out monthly for one year in permanents plots subject to continuous grazing and plots excluded from grazing in the Middle Delta of the Paraná River. In plots excluded from grazing, tillers showed significantly higher population density and survival, and a two-fold increase in mean life-span, while continuous grazing decreased survival of cohorts. The largest contribution to tiller density in ungrazed and grazed populations was made by spring and summer cohorts, respectively. Total and green biomass were significantly higher in the ungrazed population, with highest differences in late spring-early summer. Cattle grazing affected the relationship between tiller density and green biomass suggesting that cattle prefer sprouts because they are more palatable and nutritious than older tissue.

Potential biological control agents for management of cogongrass (Cyperales: Poaceae) in the southeastern USA

Science.gov (United States)

Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...

Cercosporoid fungi (Mycosphaerellaceae) 2. Species on monocots (Acoraceae to Xyridaceae, excluding Poaceae).

Science.gov (United States)

Braun, Uwe; Crous, Pedro W; Nakashima, Chiharu

2014-12-01

Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosperms were treated. This second part deals with cercosporoid fungi on monocots (Liliopsida; Equisetopsida, Magnoliidae, Lilianae), which covers species occurring on host plants belonging to families arranged in alphabetical order from Acoraceae to Xyridaceae, excluding Poaceae (cereals and grasses) which requires a separate treatment. The species are described and illustrated in alphabetical order under the particular cercosporoid genera, supplemented by keys to the species concerned. A detailed introduction, a survey of currently recognised cercosporoid genera, a key to the genera concerned, and a discussion of taxonomically relevant characters were published in the first part of this series. Neopseudocercospora, an additional recently introduced cercosporoid genus, is briefly discussed. The following taxonomic novelties are introduced: Cercospora alpiniigena sp. nov., C. neomaricae sp. nov., Corynespora palmicola comb. nov., Exosporium miyakei comb. nov., E. petersii comb. nov., Neopseudocercospora zambiensis comb. nov., Passalora caladiicola comb. nov., P. streptopi comb. nov., P. togashiana comb. nov., P. tranzschelii var. chinensis var. nov., Pseudocercospora beaucarneae comb. nov., P. constrictoflexuosa comb. et stat. nov., P. curcumicola sp. nov., P. dispori comb. nov., P. smilacicola sp. nov., P. urariigena nom. nov., Zasmidium agavicola comb. nov., Z. cercestidis-afzelii comb. nov., Z. citri-griseum comb. nov., Z. cyrtopodii comb. nov., Z. gahnae comb. nov., Z. indicum

Assessing universality of DNA barcoding in geographically isolated selected desert medicinal species of Fabaceae and Poaceae

Science.gov (United States)

Hussain, Fatma; Ahmed, Nisar; Ghorbani, Abdolbaset

2018-01-01

In pursuit of developing fast and accurate species-level molecular identification methods, we tested six DNA barcodes, namely ITS2, matK, rbcLa, ITS2+matK, ITS2+rbcLa, matK+rbcLa and ITS2+matK+rbcLa, for their capacity to identify frequently consumed but geographically isolated medicinal species of Fabaceae and Poaceae indigenous to the desert of Cholistan. Data were analysed by BLASTn sequence similarity, pairwise sequence divergence in TAXONDNA, and phylogenetic (neighbour-joining and maximum-likelihood trees) methods. Comparison of six barcode regions showed that ITS2 has the highest number of variable sites (209/360) for tested Fabaceae and (106/365) Poaceae species, the highest species-level identification (40%) in BLASTn procedure, distinct DNA barcoding gap, 100% correct species identification in BM and BCM functions of TAXONDNA, and clear cladding pattern with high nodal support in phylogenetic trees in both families. ITS2+matK+rbcLa followed ITS2 in its species-level identification capacity. The study was concluded with advocating the DNA barcoding as an effective tool for species identification and ITS2 as the best barcode region in identifying medicinal species of Fabaceae and Poaceae. Current research has practical implementation potential in the fields of pharmaco-vigilance, trade of medicinal plants and biodiversity conservation. PMID:29576968

Complete plastid genome sequence of goosegrass (Eleusine indica) and comparison with other Poaceae.

Science.gov (United States)

Zhang, Hui; Hall, Nathan; McElroy, J Scott; Lowe, Elijah K; Goertzen, Leslie R

2017-02-05

Eleusine indica, also known as goosegrass, is a serious weed in at least 42 countries. In this paper we report the complete plastid genome sequence of goosegrass obtained by de novo assembly of paired-end and mate-paired reads generated by Illumina sequencing of total genomic DNA. The goosegrass plastome is a circular molecule of 135,151bp in length, consisting of two single-copy regions separated by a pair of inverted repeats (IRs) of 20,919 bases. The large (LSC) and the small (SSC) single-copy regions span 80,667 bases and 12,646 bases, respectively. The plastome of goosegrass has 38.19% GC content and includes 108 unique genes, of which 76 are protein-coding, 28 are transfer RNA, and 4 are ribosomal RNA. The goosegrass plastome sequence was compared to eight other species of Poaceae. Although generally conserved with respect to Poaceae, this genomic resource will be useful for evolutionary studies within this weed species and the genus Eleusine. Copyright © 2016. Published by Elsevier B.V.

New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela

Directory of Open Access Journals (Sweden)

Stancik Daniel

2001-07-01

Full Text Available The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.

De novo Sequencing and Analysis of Lemongrass Transcriptome Provides First Insights into the Essential Oil Biosynthesis of Aromatic Grasses

Directory of Open Access Journals (Sweden)

Seema Meena

2016-07-01

Full Text Available Aromatic grasses of the genus Cymbopogon (Poaceae family represent unique group of plants that produce diverse composition of monoterpene rich essential oils, which have great value in flavour, fragrance, cosmetic and aromatherapy industries. Despite the commercial importance of these natural aromatic oils, their biosynthesis at the molecular level remains unexplored. As the first step towards understanding the essential oil biosynthesis, we performed de novo transcriptome assembly and analysis of C. flexuosus (lemongrass by employing Illumina sequencing. Mining of transcriptome data and subsequent phylogenetic analysis led to identification of terpene synthases (TPS, pyrophosphatases (PPase, alcohol dehydrogenases (ADH, aldo-keto reductases (AKR, carotenoid cleavage dioxygenases (CCD, alcohol acetyltransferases (AAT and aldehyde dehydrogenases (ALDH, which are potentially involved in essential oil biosynthesis. Comparative essential oil profiling and mRNA expression analysis in three Cymbopogon species (C. flexuosus, aldehyde type; C. martinii, alcohol type; and C. winterianus, intermediate type with varying essential oil composition indicated the involvement of identified candidate genes in the formation of alcohols, aldehydes and acetates. Molecular modeling and docking further supported the role of identified enzymes in aroma formation in Cymbopogon. Also, simple sequence repeats (SSRs were found in the transcriptome with many linked to terpene pathway genes including the genes potentially involved in aroma biosynthesis. This work provides the first insights into the essential oil biosynthesis of aromatic grasses, and the identified candidate genes and markers can be a great resource for biotechnological and molecular breeding approaches to modulate the essential oil composition.

De Novo Sequencing and Analysis of Lemongrass Transcriptome Provide First Insights into the Essential Oil Biosynthesis of Aromatic Grasses

Science.gov (United States)

Meena, Seema; Kumar, Sarma R.; Venkata Rao, D. K.; Dwivedi, Varun; Shilpashree, H. B.; Rastogi, Shubhra; Shasany, Ajit K.; Nagegowda, Dinesh A.

2016-01-01

Aromatic grasses of the genus Cymbopogon (Poaceae family) represent unique group of plants that produce diverse composition of monoterpene rich essential oils, which have great value in flavor, fragrance, cosmetic, and aromatherapy industries. Despite the commercial importance of these natural aromatic oils, their biosynthesis at the molecular level remains unexplored. As the first step toward understanding the essential oil biosynthesis, we performed de novo transcriptome assembly and analysis of C. flexuosus (lemongrass) by employing Illumina sequencing. Mining of transcriptome data and subsequent phylogenetic analysis led to identification of terpene synthases, pyrophosphatases, alcohol dehydrogenases, aldo-keto reductases, carotenoid cleavage dioxygenases, alcohol acetyltransferases, and aldehyde dehydrogenases, which are potentially involved in essential oil biosynthesis. Comparative essential oil profiling and mRNA expression analysis in three Cymbopogon species (C. flexuosus, aldehyde type; C. martinii, alcohol type; and C. winterianus, intermediate type) with varying essential oil composition indicated the involvement of identified candidate genes in the formation of alcohols, aldehydes, and acetates. Molecular modeling and docking further supported the role of identified protein sequences in aroma formation in Cymbopogon. Also, simple sequence repeats were found in the transcriptome with many linked to terpene pathway genes including the genes potentially involved in aroma biosynthesis. This work provides the first insights into the essential oil biosynthesis of aromatic grasses, and the identified candidate genes and markers can be a great resource for biotechnological and molecular breeding approaches to modulate the essential oil composition. PMID:27516768

De Novo Sequencing and Analysis of Lemongrass Transcriptome Provide First Insights into the Essential Oil Biosynthesis of Aromatic Grasses.

Science.gov (United States)

Meena, Seema; Kumar, Sarma R; Venkata Rao, D K; Dwivedi, Varun; Shilpashree, H B; Rastogi, Shubhra; Shasany, Ajit K; Nagegowda, Dinesh A

2016-01-01

Aromatic grasses of the genus Cymbopogon (Poaceae family) represent unique group of plants that produce diverse composition of monoterpene rich essential oils, which have great value in flavor, fragrance, cosmetic, and aromatherapy industries. Despite the commercial importance of these natural aromatic oils, their biosynthesis at the molecular level remains unexplored. As the first step toward understanding the essential oil biosynthesis, we performed de novo transcriptome assembly and analysis of C. flexuosus (lemongrass) by employing Illumina sequencing. Mining of transcriptome data and subsequent phylogenetic analysis led to identification of terpene synthases, pyrophosphatases, alcohol dehydrogenases, aldo-keto reductases, carotenoid cleavage dioxygenases, alcohol acetyltransferases, and aldehyde dehydrogenases, which are potentially involved in essential oil biosynthesis. Comparative essential oil profiling and mRNA expression analysis in three Cymbopogon species (C. flexuosus, aldehyde type; C. martinii, alcohol type; and C. winterianus, intermediate type) with varying essential oil composition indicated the involvement of identified candidate genes in the formation of alcohols, aldehydes, and acetates. Molecular modeling and docking further supported the role of identified protein sequences in aroma formation in Cymbopogon. Also, simple sequence repeats were found in the transcriptome with many linked to terpene pathway genes including the genes potentially involved in aroma biosynthesis. This work provides the first insights into the essential oil biosynthesis of aromatic grasses, and the identified candidate genes and markers can be a great resource for biotechnological and molecular breeding approaches to modulate the essential oil composition.

Forma de crecimiento en Leptochloa Chloridiformis (Poaceae

Directory of Open Access Journals (Sweden)

Mariel G. Perreta

2000-01-01

Full Text Available Perreta, M. G., Tivano, J. C. & Vegetti, A. C. 2000. Forma de crecimiento en Leptochloachloridiformis (Poaceae. Darwiniana 38(3-4: 219-226.El objetivo de este trabajo fue analizar la forma de crecimiento de Leptochloa chloridiformis (Hack.Parodi. En esta especie perenne la ramificación ocurre principalmente a través de yemas axilarespresentes en la zona de innovación. Este sistema de ramificación genera una planta cespitosa, en la cual lasconexiones entre unidades estructurales son rizomas cortos. Dependiendo de su posición estas conexio-nes muestran diferentes tendencias en relación a la desarticulación estructural. En algunas plantas seobservó ramificación en la zona de entrenudos largos posiblemente debido a cambios ambientalesrelacionados con las distintas estaciones

SQ grass sublingual allergy immunotherapy tablet for disease-modifying treatment of grass pollen allergic rhinoconjunctivitis

DEFF Research Database (Denmark)

Dahl, Ronald; Roberts, Graham; de Blic, Jacques

2016-01-01

BACKGROUND: Allergy immunotherapy is a treatment option for allergic rhinoconjunctivitis (ARC). It is unique compared with pharmacotherapy in that it modifies the immunologic pathways that elicit an allergic response. The SQ Timothy grass sublingual immunotherapy (SLIT) tablet is approved in North...... America and throughout Europe for the treatment of adults and children (≥5 years old) with grass pollen-induced ARC. OBJECTIVE: The clinical evidence for the use of SQ grass SLIT-tablet as a disease-modifying treatment for grass pollen ARC is discussed in this review. METHODS: The review included...... the suitability of SQ grass SLIT-tablet for patients with clinically relevant symptoms to multiple Pooideae grass species, single-season efficacy, safety, adherence, coseasonal initiation, and cost-effectiveness. The data from the long-term SQ grass SLIT-tablet clinical trial that evaluated a clinical effect 2...

GUI development for GRASS GIS

Directory of Open Access Journals (Sweden)

Martin Landa

2007-12-01

Full Text Available This article discusses GUI development for GRASS GIS. Sophisticated native GUI for GRASS is one of the key points (besides the new 2D/3D raster library, vector architecture improvements, etc. for the future development of GRASS. In 2006 the GRASS development team decided to start working on the new generation of GUI instead of improving the current GUI based on Tcl/Tk.

Commelinid Monocotyledon Lignins Are Acylated by p-Coumarate1[OPEN

Science.gov (United States)

Free, Heather C.A.; Smith, Bronwen G.

2018-01-01

Commelinid monocotyledons are a monophyletic clade differentiated from other monocotyledons by the presence of cell wall-bound ferulate and p-coumarate. The Poaceae, or grass family, is a member of this group, and most of the p-coumarate in the cell walls of this family acylates lignin. Here, we isolated and examined lignified cell wall preparations from 10 species of commelinid monocotyledons from nine families other than Poaceae, including species from all four commelinid monocotyledon orders (Poales, Zingiberales, Commelinales, and Arecales). We showed that, as in the Poaceae, lignin-linked p-coumarate occurs exclusively on the hydroxyl group on the γ-carbon of lignin unit side chains, mostly on syringyl units. Although the mechanism of acylation has not been studied directly in these species, it is likely to be similar to that in the Poaceae and involve BAHD acyl-coenzyme A:monolignol transferases. PMID:29724771

Ecological survey of M-Field, Edgewood Area Aberdeen Proving Ground, Maryland

Energy Technology Data Exchange (ETDEWEB)

Downs, J.L.; Eberhardt, L.E.; Fitzner, R.E.; Rogers, L.E.

1991-12-01

An ecological survey was conducted on M-Field, at the Edgewood Area, Aberdeen Proving Ground, Maryland. M-Field is used routinely to test army smokes and obscurants, including brass flakes, carbon fibers, and fog oils. The field has been used for testing purposes for the past 40 years, but little documented history is available. Under current environmental regulations, the test field must be assessed periodically to document the presence or potential use of the area by threatened and endangered species. The M-Field area is approximately 370 acres and is part of the US Army's Edgewood Area at Aberdeen Proving Ground in Harford County, Maryland. The grass-covered field is primarily lowlands with elevations from about 1.0 to 8 m above sea level, and several buildings and structures are present on the field. The ecological assessment of M-Field was conducted in three stages, beginning with a preliminary site visit in May to assess sampling requirements. Two field site visits were made June 3--7, and August 12--15, 1991, to identify the biota existing on the site. Data were gathered on vegetation, small mammals, invertebrates, birds, large mammals, amphibians, and reptiles.

Ecological survey of M-Field, Edgewood Area Aberdeen Proving Ground, Maryland

Energy Technology Data Exchange (ETDEWEB)

Downs, J.L.; Eberhardt, L.E.; Fitzner, R.E.; Rogers, L.E.

1991-12-01

An ecological survey was conducted on M-Field, at the Edgewood Area, Aberdeen Proving Ground, Maryland. M-Field is used routinely to test army smokes and obscurants, including brass flakes, carbon fibers, and fog oils. The field has been used for testing purposes for the past 40 years, but little documented history is available. Under current environmental regulations, the test field must be assessed periodically to document the presence or potential use of the area by threatened and endangered species. The M-Field area is approximately 370 acres and is part of the US Army`s Edgewood Area at Aberdeen Proving Ground in Harford County, Maryland. The grass-covered field is primarily lowlands with elevations from about 1.0 to 8 m above sea level, and several buildings and structures are present on the field. The ecological assessment of M-Field was conducted in three stages, beginning with a preliminary site visit in May to assess sampling requirements. Two field site visits were made June 3--7, and August 12--15, 1991, to identify the biota existing on the site. Data were gathered on vegetation, small mammals, invertebrates, birds, large mammals, amphibians, and reptiles.

Development of Simple Sequence Repeats (SSR) markers in Setaria italica (Poaceae) and cross-amplification in related species.

Science.gov (United States)

Lin, Heng-Sheng; Chiang, Chih-Yun; Chang, Song-Bin; Kuoh, Chang-Sheng

2011-01-01

Foxtail millet is one of the world's oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR) markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21%) and CAT (46.15%). The average number of alleles (N(a)), the average heterozygosities observed (H(o)) and expected (H(e)) are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

Genome sequence analysis of the model grass Brachypodium distachyon: insights into grass genome evolution

Energy Technology Data Exchange (ETDEWEB)

Schulman, Al

2009-08-09

Three subfamilies of grasses, the Erhardtoideae (rice), the Panicoideae (maize, sorghum, sugar cane and millet), and the Pooideae (wheat, barley and cool season forage grasses) provide the basis of human nutrition and are poised to become major sources of renewable energy. Here we describe the complete genome sequence of the wild grass Brachypodium distachyon (Brachypodium), the first member of the Pooideae subfamily to be completely sequenced. Comparison of the Brachypodium, rice and sorghum genomes reveals a precise sequence- based history of genome evolution across a broad diversity of the grass family and identifies nested insertions of whole chromosomes into centromeric regions as a predominant mechanism driving chromosome evolution in the grasses. The relatively compact genome of Brachypodium is maintained by a balance of retroelement replication and loss. The complete genome sequence of Brachypodium, coupled to its exceptional promise as a model system for grass research, will support the development of new energy and food crops

Monoclonal antibodies to the major Lolium perenne (rye grass) pollen allergen Lol p I (Rye I).

Science.gov (United States)

Kahn, C R; Marsh, D G

1986-12-01

Thirteen monoclonal antibodies (MAbs) were produced against Lol p I (Rye I), the major Lolium perenne (rye grass) pollen allergen. Spleen cells from A/J and SJL mice immunized with highly purified Lol p I (Lol I) were allowed to fuse with cells from the non-secreting Sp2/0-Ag14 myeloma cell line. Each MAb was analyzed for antigenic specificity by radioimmunoassay (RIA) using 125I-Lol I. The epitope specificities of seven of the MAbs were examined by competitive binding against a labelled standard MAb for the Lol I antigen (Ag). The dissociation constant, Kd, of one MAb (No. 3.2) that was studied most extensively was determined by double Ab RIA to be 3.5 X 10(-6) L/M. This MAb recognized the related 27,000-30,000 Group I glycoproteins found in the pollens of nine other species of grass pollens tested, including weak binding to Bermuda grass Group I (Cyn d I), which by conventional analysis using polyclonal anti-Lol I serum shows no detectable binding. Monoclonal antibody No. 3.2 was coupled covalently to Sepharose 4B and used to prepare highly purified Lol I from a partially purified rye pollen extract. Finally, an RIA was developed which permitted the analysis of the Group I components in rye grass and nine other grass pollen species. The latter assay is likely to prove useful in the standardization of grass pollen extracts according to their Group I contents.

Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae) para la Flora Argentina

OpenAIRE

Ana María Cialdella

2010-01-01

Durante la revisión de los géneros de Stipeae (Poaceae) para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P...

Chromosome numbers and meiotic analysis in the pre-breeding of ...

Indian Academy of Sciences (India)

2011-08-19

Aug 19, 2011 ... of Brachiaria decumbens (Poaceae). GLÉIA CRISTINA LAVERDE ... widely used grass forage worldwide because it adapts to acid soils, is easy to man- ... individual plants growing in the field, fixed in a mixture of ethanol 95% ...

Development of Simple Sequence Repeats (SSR Markers in Setaria italica (Poaceae and Cross-Amplification in Related Species

Directory of Open Access Journals (Sweden)

Chih-Yun Chiang

2011-11-01

Full Text Available Foxtail millet is one of the world’s oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21% and CAT (46.15%. The average number of alleles (Na, the average heterozygosities observed (Ho and expected (He are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

High degree of genetic diversity among genotypes of the forage grass Brachiaria ruziziensis (Poaceae) detected with ISSR markers.

Science.gov (United States)

Azevedo, A L S; Costa, P P; Machado, M A; de Paula, C M P; Sobrinho, F S

2011-11-17

The grasses of the genus Brachiaria account for 80% of the cultivated pastures in Brazil. Despite its importance for livestock production, little information is available for breeding purposes. Embrapa has a population of B. ruziziensis from different regions of Brazil, representing most of existing variability. This population was used to initiate an improvement program based on recurrent selection. In order to assist the genetic improvement program, we estimated the molecular variability among 93 genotypes of Embrapa's collection using ISSR (inter-simple sequence repeat) markers. DNA was extracted from the leaves. Twelve ISSR primers generated 89 polymorphic bands in the 93 genotypes. The number of bands identified by each primer ranged from two to 13, with a mean of 7.41. Cluster analysis revealed a clearly distinct group, containing most of the B. ruziziensis genotypes apart from the outgroup genotypes. Genetic similarity coefficients ranged from 0.0 to 0.95, with a mean of 0.50 and analysis of molecular variance indicated higher variation within (73.43%) than among species (26.57%). We conclude that there is a high genetic diversity among these B. ruziziensis genotypes, which could be explored by breeding programs.

Crop-associated virus reduces the rooting depth of non-crop perennial native grass more than non-crop-associated virus with known viral suppressor of RNA silencing (VSR).

Science.gov (United States)

Malmstrom, Carolyn M; Bigelow, Patrick; Trębicki, Piotr; Busch, Anna K; Friel, Colleen; Cole, Ellen; Abdel-Azim, Heba; Phillippo, Colin; Alexander, Helen M

2017-09-15

As agricultural acreage expanded and came to dominate landscapes across the world, viruses gained opportunities to move between crop and wild native plants. In the Midwestern USA, virus exchange currently occurs between widespread annual Poaceae crops and remnant native perennial prairie grasses now under consideration as bioenergy feedstocks. In this region, the common aphid species Rhopalosiphum padi L. (the bird cherry-oat aphid) transmits several virus species in the family Luteoviridae, including Barley yellow dwarf virus (BYDV-PAV, genus Luteovirus) and Cereal yellow dwarf virus (CYDV-RPV and -RPS, genus Polerovirus). The yellow dwarf virus (YDV) species in these two genera share genetic similarities in their 3'-ends, but diverge in the 5'-regions. Most notably, CYDVs encode a P0 viral suppressor of RNA silencing (VSR) absent in BYDV-PAV. Because BYDV-PAV has been reported more frequently in annual cereals and CYDVs in perennial non-crop grasses, we examine the hypothesis that the viruses' genetic differences reflect different affinities for crop and non-crop hosts. Specifically, we ask (i) whether CYDVs might persist within and affect a native non-crop grass more strongly than BYDV-PAV, on the grounds that the polerovirus VSR could better moderate the defenses of a well-defended perennial, and (ii) whether the opposite pattern of effects might occur in a less defended annual crop. Because previous work found that the VSR of CYDV-RPS possessed greater silencing suppressor efficiency than that of CYDV-RPV, we further explored (iii) whether a novel grass-associated CYDV-RPS isolate would influence a native non-crop grass more strongly than a comparable CYDV-RPV isolate. In growth chamber studies, we found support for this hypothesis: only grass-associated CYDV-RPS stunted the shoots and crowns of Panicum virgatum L. (switchgrass), a perennial native North American prairie grass, whereas crop-associated BYDV-PAV (and coinfection with BYDV-PAV and CYDV-RPS) most

Accumulation of 137Cs and 90Sr from contaminated soil by three grass species inoculated with mycorrhizal fungi

International Nuclear Information System (INIS)

Entry, J.A.; Watrud, L.S.; Reeves, M.

1999-01-01

The use of plants to accumulate low level radioactive waste from soil, followed by incineration of plant material to concentrate radionuclides may prove to be a viable and economical method of remediating contaminated areas. We tested the influence of arbuscular mycorrhizae on 137 Cs and 90 Sr uptake by bahia grass (Paspalum notatum), johnson grass (Sorghum halpense) and switchgrass (Panicum virginatum) for the effectiveness on three different contaminated soil types. Exposure to 137 Cs or 90 Sr over the course of the experiment did not affect above ground biomass of the three grasses. The above ground biomass of bahia, johnson and switchgrass plants accumulated from 26.3 to 71.7% of the total amount of the 137 Cs and from 23.8 to 88.7% of the total amount of the 90 Sr added to the soil after three harvests. In each of the three grass species tested, plants inoculated with Glomus mosseae or Glomus intraradices had greater aboveground plant biomass, higher concentrations of 137 Cs or 90 Sr in plant tissue, % accumulation of 137 Cs or 90 Sr from soil and plant bioconcentration ratios at each harvest than those that did not receive mycorrhizal inoculation. Johnson grass had greater aboveground plant biomass, greater accumulation of 137 Cs or 90 Sr from soil and plant higher bioconcentration ratios with arbuscular mycorrhizal fungi than bahia grass and switchgrass. The greatest accumulation of 137 Cs and 90 Sr was observed in johnson grass inoculated with G. mosseae. Grasses can grow in wide geographical ranges that include a broad variety of edaphic conditions. The highly efficient removal of these radionuclides by these grass species after inoculation with arbuscular mycorrhizae supports the concept that remediation of radionuclide contaminated soils using mycorrhizal plants may present a viable strategy to remediate and reclaim sites contaminated with radionuclides

Dated historical biogeography of the temperate Loliinae (Poaceae, Pooideae) grasses in the northern and southern hemispheres.

Science.gov (United States)

Inda, Luis A; Segarra-Moragues, José Gabriel; Müller, Jochen; Peterson, Paul M; Catalán, Pilar

2008-03-01

Divergence times and biogeographical analyses have been conducted within the Loliinae, one of the largest subtribes of temperate grasses. New sequence data from representatives of the almost unexplored New World, New Zealand, and Eastern Asian centres were added to those of the panMediterranean region and used to reconstruct the phylogeny of the group and to calculate the times of lineage-splitting using Bayesian approaches. The traditional separation between broad-leaved and fine-leaved Festuca species was still maintained, though several new broad-leaved lineages fell within the fine-leaved clade or were placed in an unsupported intermediate position. A strong biogeographical signal was detected for several Asian-American, American, Neozeylandic, and Macaronesian clades with different affinities to both the broad and the fine-leaved Festuca. Bayesian estimates of divergence and dispersal-vicariance analyses indicate that the broad-leaved and fine-leaved Loliinae likely originated in the Miocene (13My) in the panMediterranean-SW Asian region and then expanded towards C and E Asia from where they colonized the New World. Further expansions in America (10-3.8My) showed a predominant migratory route from North to South (N Americathe AndesPatagonia). This late Tertiary scenario of successive colonizations and secondary polyploid radiations in the southern hemisphere from the northern hemisphere was accompanied by occasional transcontinental long-distance dispersal events between South America and New Zealand. Multiple Pliocene dispersal events (3.6-2.5My) from the near SW European and NW African continents gave rise to the Macaronesian Loliinae flora, while a more recent Pleistocene origin (2-1My) is hypothesized for the high polyploid lineages that successfully colonized newly deglaciated areas in both hemispheres.

Postruminal degradation of crude protein, neutral detergent fibre and starch of maize and grass silages in dairy cows

DEFF Research Database (Denmark)

Ali, M.; Weisbjerg, Martin Riis; Cone, J.W.

2012-01-01

samples of grass silage were used. The samples were selected to represent a broad range in digestibility and chemical composition. Prior to the intestinal incubations, samples were incubated in the rumen for 6 h (starch), 12 h (CP) or 24 h (aNDFom) using the rumen nylon bag technique. Residues from....... The objective of this study was to develop a unique dataset on the ruminal degradability and the postruminal digestibility of CP, NDF (aNDFom, amylase neutral detergent fibre organic matter basis) and starch in maize and grass silages, using the mobile nylon bag technique. Twenty samples of maize silage and 20...... in the maize and grass silages. The results proved the assumption of the Dutch feed evaluation system that the rumen undegraded starch is completely digested in the small intestine of dairy cows. Regression showed that the rumen degradability, the intestinal digestibility and the total tract undigested...

Analysis of the soil food web structure under grass and grass clover

NARCIS (Netherlands)

Eekeren, van N.J.M.; Smeding, F.W.; Vries, de F.T.; Bloem, J.

2006-01-01

The below ground biodiversity of soil organisms plays an important role in the functioning of the the soil ecosystem, and consequently the above ground plant production. The objective of this study is to investigate the effect of grass or grass-clover in combination with fertilisation on the soil

Computational identification of putative cytochrome P450 genes in ...

African Journals Online (AJOL)

Chattha

Economically, legumes represent the second most important family of crop plants after Poacea (grass family), accounting for ... further characterization of P450 genes with both known and unknown functions. MATERIALS AND METHODS ..... Cytochrome P450. In: Somerville CR, Meyerowitz EM (eds) .The Arabidopsis book,.

Problems, control, and opportunity of starch in the large scale processing of sugarcane and sweet sorghum

Science.gov (United States)

Both sugarcane (Saccharum officinarum) and sweet sorghum (Sorghum bicolor) crops are members of the grass (Poaceae) family, and consist of stalks rich in soluble sugars. The extracted juice from both of these crops contains insoluble starch, with much greater quantities occurring in sweet sorghum. ...

Scanning electron microscopy of the leaf epidermis of Merostachys Spreng. (Poaceae: Bambusoideae Microscopia eletrônica de varredura da epiderme foliar de Merostachys Spreng. (Poaceae: Bambusoideae

Directory of Open Access Journals (Sweden)

Doria Maria Saiter Gomes

2009-06-01

Full Text Available This study presents data on leaf micromorphology of 13 species of Merostachys Spreng. (Poaceae: Bambusoideae, a neotropical genus with numerous endemic species. Greatest species richness is found in Central and Southern Brazil, with 41 of the 46 species described. Species were collected in the field at the localities: Itatiaia National Park and Tijuca National Park, Rio de Janeiro State; Fontes do Ipiranga State Park, São Paulo state; Santa Teresa, Espírito Santo State and Rio Doce State Park, Minas Gerais State. Dried plant material came from the herbarium at the São Paulo Botany Institute. The presence of prickles, silica bodies and macro hairs may be especially useful in delimiting species.São apresentados dados relativos à micromorfologia foliar de 13 espécies de Merostachys Spreng. (Poaceae:Bambusoideae, um gênero neotropical, com numerosas espécies endêmicas, que tem sua maior diversidade nas regiões central e sul do Brasil, onde ocorrem 41 das 46 espécies descritas. O material coletado foi obtido nas seguintes localidades: Parque Nacional do Itatiaia e Parque Nacional da Tijuca (RJ; Parque Estadual das Fontes do Ipiranga (SP; Propriedade dos Irmãos Martinelli, Vargem Alta, Santa Teresa (ES e Parque Estadual do Rio Doce (MG. As espécies herborizadas são provenientes do herbário do Instituto de Botânica de São Paulo (SP. Atenção especial é dada à presença de cerdas, corpúsculos silicosos e macropêlos, características que podem ser úteis na delimitação das espécies.

Meadow-grass gall midge

DEFF Research Database (Denmark)

Hansen, Lars Monrad

The area with meadow-grass (Poa pratensis, L.) grown for seed production in Den-mark is a significant proportion of the entire seed production. The meadow-grass gall midge (Mayetiola schoberi, Barnes 1958) is of considerable economic importance since powerful attacks can reduce the yield...

Nutritional value of cabbage and kikuyu grass as food for grass carp ...

African Journals Online (AJOL)

and digestibility coefficients were obtained for the protein, fibre, ash and fat contents of both ... Cabbage is a superior feed compared to grass for raising grass carp and a suitable low-cost alternative ... Materials and Methods ... from jumping out and was fitted with an air lift under- .... In: Aquatic weeds in South East Asia.

Estimating grass and grass silage degradation characteristics by in situ and in vitro gas production methods

Directory of Open Access Journals (Sweden)

Danijel Karolyi

2010-01-01

Full Text Available Fermentation characteristics of grass and grass silage at different maturities were studied using in situ and in vitro gas production methods. In situ data determined difference between grass and silage. Degradable fraction decreased as grass matured while the undegradable fraction increased. Rate of degradation (kd was slower for silage than fresh grass. Gas production method (GP data showed that fermentation of degradable fraction was different between stage of maturity in both grass and silage. Other data did not show any difference with the exception for the rate of GP of soluble and undegradable fraction. The in situ degradation characteristics were estimated from GP characteristics. The degradable and undegradable fractions could be estimated by multiple relationships. Using the three-phases model for gas production kd and fermentable organic matter could be estimated from the same parameters. The only in situ parameter that could not be estimated with GP parameters was the soluble fraction. The GP method and the three phases model provided to be an alternative to the in situ method for animal feed evaluations.

High green fodder yielding new grass varieties

OpenAIRE

C. Babu, K. Iyanar and A. Kalamani

2014-01-01

Two high biomass yielding forage grass varieties one each in Cumbu Napier hybrid and Guinea grass have been evolved at the Department of Forage Crops, Centre for Plant Breeding and Genetics, Tamil Nadu Agricultural University, Coimbatore and identified for release at national (All India) level as Cumbu Napier hybrid grass CO (BN) 5 and Guinea grass CO (GG) 3 during 2012 and 2013 respectively. Cumbu Napier hybrid grass CO (BN) 5 secured first rank at all national level with reference to green ...

Enhancing GRASS data communication with videographic technology

Energy Technology Data Exchange (ETDEWEB)

Sullivan, R.G. [Argonne National Lab., IL (United States); Gerdes, D.; Youngs, D. [Army Construction Engineering Research Lab., Champaign, IL (United States)

1992-07-01

Research at Argonne National Laboratory and the US Army Construction Engineering Research Laboratory has shown that computer videographic technology can be used to assist visualization and communication of GIS-generated geographic information. Videographic tools can be used to make results of GRASS analyses clear to decision-makers and to public interest groups, as well as to help GRASS users visualize geographic data more easily. Useful videographic visualization tools include graphic overlay of GRASS layers onto panchromatic images, allowing landscape features to be associated with GIS classifications; draping of GIS layers onto terrain models to create shaded relief maps; and incorporation of photographic imagery into GIS graphics. Useful videographic communications capabilities include convenient, direct interface to video formats, allowing incorporation of live video into GRASS graphics and output of GRASS graphics to video; convenient output of high-quality slides and prints; and enhanced labeling and editing of GRASS images. Conversion of GRASS imagery to standard videographic file formats also facilitates incorporation of GRASS images into other software programs, such as database and work-processing packages.

Enhancing GRASS data communication with videographic technology

Energy Technology Data Exchange (ETDEWEB)

Sullivan, R.G. (Argonne National Lab., IL (United States)); Gerdes, D.; Youngs, D. (Army Construction Engineering Research Lab., Champaign, IL (United States))

1992-01-01

Research at Argonne National Laboratory and the US Army Construction Engineering Research Laboratory has shown that computer videographic technology can be used to assist visualization and communication of GIS-generated geographic information. Videographic tools can be used to make results of GRASS analyses clear to decision-makers and to public interest groups, as well as to help GRASS users visualize geographic data more easily. Useful videographic visualization tools include graphic overlay of GRASS layers onto panchromatic images, allowing landscape features to be associated with GIS classifications; draping of GIS layers onto terrain models to create shaded relief maps; and incorporation of photographic imagery into GIS graphics. Useful videographic communications capabilities include convenient, direct interface to video formats, allowing incorporation of live video into GRASS graphics and output of GRASS graphics to video; convenient output of high-quality slides and prints; and enhanced labeling and editing of GRASS images. Conversion of GRASS imagery to standard videographic file formats also facilitates incorporation of GRASS images into other software programs, such as database and work-processing packages.

Leaf transcriptome of two highly divergent genotypes of Urochloa humidicola (Poaceae), a tropical polyploid forage grass adapted to acidic soils and temporary flooding areas.

Science.gov (United States)

Vigna, Bianca Baccili Zanotto; de Oliveira, Fernanda Ancelmo; de Toledo-Silva, Guilherme; da Silva, Carla Cristina; do Valle, Cacilda Borges; de Souza, Anete Pereira

2016-11-11

Urochloa humidicola (Koronivia grass) is a polyploid (6x to 9x) species that is used as forage in the tropics. Facultative apospory apomixis is present in most of the genotypes of this species, although one individual has been described as sexual. Molecular studies have been restricted to molecular marker approaches for genetic diversity estimations and linkage map construction. The objectives of the present study were to describe and compare the leaf transcriptome of two important genotypes that are highly divergent in terms of their phenotypes and reproduction modes: the sexual BH031 and the aposporous apomictic cultivar BRS Tupi. We sequenced the leaf transcriptome of Koronivia grass using an Illumina GAIIx system, which produced 13.09 Gb of data that consisted of 163,575,526 paired-end reads between the two libraries. We de novo-assembled 76,196 transcripts with an average length of 1,152 bp and filtered 35,093 non-redundant unigenes. A similarity search against the non-redundant National Center of Biotechnology Information (NCBI) protein database returned 65 % hits. We annotated 24,133 unigenes in the Phytozome database and 14,082 unigenes in the UniProtKB/Swiss-Prot database, assigned 108,334 gene ontology terms to 17,255 unigenes and identified 5,324 unigenes in 327 known metabolic pathways. Comparisons with other grasses via a reciprocal BLAST search revealed a larger number of orthologous genes for the Panicum species. The unigenes were involved in C4 photosynthesis, lignocellulose biosynthesis and flooding stress responses. A search for functional molecular markers revealed 4,489 microsatellites and 560,298 single nucleotide polymorphisms (SNPs). A quantitative real-time PCR analysis validated the RNA-seq expression analysis and allowed for the identification of transcriptomic differences between the two evaluated genotypes. Moreover, 192 unannotated sequences were classified as containing complete open reading frames, suggesting that the new

Different techniques to study rumen fermentation characteristics of maturing grass and grass silage

NARCIS (Netherlands)

Cone, J.W.; Gelder, van A.H.; Soliman, I.A.; Visser, de H.; Vuuren, van A.M.

1999-01-01

Grass samples were harvested during the 1993 growing season after a precut on April 27, 1993 and were stored frozen or left to ensile in 30-L buckets. Effects on chemical composition and fermentation kinetics of the maturation of the grass and of ensiling were investigated. Chemical composition and

Lemon grass (Cymbopogon citratus essential oil as a potent anti-inflammatory and antifungal drugs

Directory of Open Access Journals (Sweden)

Mohamed Nadjib Boukhatem

2014-09-01

Full Text Available Background: Volatile oils obtained from lemon grass [Cymbopogon citratus (DC. Stapf, Poaceae family] are used in traditional medicine as remedies for the treatment of various diseases. Aims: In the present study, lemon grass essential oil (LGEO was evaluated for its in vivo topical and oral anti-inflammatory effects, and for its in vitro antifungal activity using both liquid and vapor phases. Methods: The chemical profile of LGEO as determined by gas chromatography–mass spectrometry analysis revealed two major components: geranial (42.2%, and neral (31.5%. The antifungal activity of LGEO was evaluated against several pathogenic yeasts and filamentous fungi using disc diffusion and vapor diffusion methods. Results: LGEO exhibited promising antifungal effect against Candida albicans, C. tropicalis, and Aspergillus niger, with different inhibition zone diameters (IZDs (35–90 mm. IZD increased with increasing oil volume. Significantly, higher anti-Candida activity was observed in the vapor phase. For the evaluation of the anti-inflammatory effect, LGEO (10 mg/kg, administered orally significantly reduced carrageenan-induced paw edema with a similar effect to that observed for oral diclofenac (50 mg/kg, which was used as the positive control. Oral administration of LGEO showed dose-dependent anti-inflammatory activity. In addition, topical application of LGEO in vivo resulted in a potent anti-inflammatory effect, as demonstrated by using the mouse model of croton oil-induced ear edema. To our knowledge, this is the first such report to be published. The topical application of LGEO at doses of 5 and 10 µL/ear significantly reduced acute ear edema induced by croton oil in 62.5 and 75% of the mice, respectively. In addition, histological analysis clearly confirmed that LGEO inhibits the skin inflammatory response in animal models. Conclusion: Results of the present study indicate that LGEO has a noteworthy potential for the development of drugs for

Two new stilbene trimers from Cynodon dactylon.

Science.gov (United States)

Li, Bi-Jun; Liu, Yao; Gu, Ai-Tong; Zhang, Qing; Chen, Lei; Wang, Shu-Mei; Wang, Feng

2017-11-01

Many naturally occurring oligostilbenes have drawn considerable attention because of their intricate structures and diverse bioactivities. Two new stilbene trimers, cystibenetrimerol A (1) and cystibenetrimerol B (2) were isolated from the dried grass of Cynodon dactylon (L.) Pers. The planar structures and stereo configurations of them were elucidated by spectroscopic and spectrometric methods. The isolation and structures elucidation of two new stilbene trimers suggested the ordinary grass belonging to the family Poaceae may be a rich source of stilbene oligomers.

Breeding for Grass Seed Yield

DEFF Research Database (Denmark)

Boelt, Birte; Studer, Bruno

2010-01-01

Seed yield is a trait of major interest for many fodder and amenity grass species and has received increasing attention since seed multiplication is economically relevant for novel grass cultivars to compete in the commercial market. Although seed yield is a complex trait and affected...... by agricultural practices as well as environmental factors, traits related to seed production reveal considerable genetic variation, prerequisite for improvement by direct or indirect selection. This chapter first reports on the biological and physiological basics of the grass reproduction system, then highlights...... important aspects and components affecting the seed yield potential and the agronomic and environmental aspects affecting the utilization and realization of the seed yield potential. Finally, it discusses the potential of plant breeding to sustainably improve total seed yield in fodder and amenity grasses....

Linkage Maps of a Mediterranean × Continental Tall Fescue Population and their Comparative Analysis with Other Poaceae Species

Directory of Open Access Journals (Sweden)

Ryan Dierking

2015-03-01

Full Text Available Temperate grasses belonging to the complex are important throughout the world in pasture and grassland agriculture. Tall fescue ( Schreb. is the predominant species in the United States, covering approximately 15 million ha. Tall fescue has distinctive morphotypes, two of which are Continental (summer active and Mediterranean (summer semidormant. This is the first report of a linkage map created for Mediterranean tall fescue, while updating the Continental map with additional simple sequence repeat and sequence-tagged site markers. Additionally, this is the first time that diversity arrays technology (DArT markers were used in the construction of a tall fescue map. The male parent (Continental, R43-64, map consisted of 594 markers arranged in 22 linkage groups (LGs and covered a total of 1577 cM. The female parent (Mediterranean, 103-2, map was shorter (1258 cM and consisted of only 208 markers arranged in 29 LGs. Marker densities for R43-64 and 103-2 were 2.65 and 6.08 cM per marker, respectively. When compared with the other Poaceae species, meadow fescue ( Huds., annual ryegrass ( Lam., perennial ryegrass ( L., (L. Beauv., and barley ( L., a total of 171 and 98 orthologous or homologous sequences, identified by DArT analysis, were identified in R43-64 and 103-2, respectively. By using genomic in situ hybridization, we aimed to identify potential progenitors of both morphotypes. However, no clear conclusion on genomic constitution was reached. These maps will aid in the search for quantitative trait loci of various traits as well as help define and distinguish genetic differences between the two morphotypes.

Post-ruminal digestibility of crude protein from grass and grass silages in cows

NARCIS (Netherlands)

Cone, J.W.; Gelder, van A.H.; Mathijssen-Kamman, A.A.; Hindle, V.A.

2006-01-01

Grass samples were grown on a clay or sandy soil, fertilised with 150 or 300 kg N/ha per year, and harvested on different days during two consecutive growing seasons. The grass samples were stored frozen or ensiled after wilting to approximately 250 or 450 g DM/kg. The recoveries of crude protein

Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

Science.gov (United States)

Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing

2017-01-01

Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

Grass pollen immunotherapy induces highly cross-reactive IgG antibodies to group V allergen from different grass species

NARCIS (Netherlands)

van Ree, R.; Brewczyński, P. Z.; Tan, K. Y.; Mulder-Willems, H. J.; Widjaja, P.; Stapel, S. O.; Aalberse, R. C.; Kroon, A. M.

1995-01-01

Sera from two groups of patients receiving grass pollen immunotherapy were tested on IgG reactivity with group V allergen from six different grass species. One group of patients was treated with a mixture of 10 grass species, and the other with a mixture of five. Only Lolium perenne, Dactylis

Spatiotemporal Variation in the Environmental Controls of C4-Grass Origin and Ecology: Insights from Grass-Pollen δ13C Data

Science.gov (United States)

Nelson, D. M.; Urban, M.; Hu, F.

2014-12-01

Understanding the environmental factors controlling the origin and shifting abundance of C4 grasses in Earth's history is useful for projecting the response of C4-grass dominated grasslands to future environmental change. Unfortunately, grass pollen is typically morphologically indistinct, making palynological analysis a blunt tool for studying C4-grasses in the paleorecord. δ13C of individual grass-pollen grains using a spooling wire microcombustion device interfaced with an isotope ratio mass spectrometer (Single Pollen Isotope Ratio AnaLysis, SPIRAL) overcomes this challenge and the potential biases of δ13C data from other substrates (e.g. leaf waxes). To assess the presence and relative abundance of C3- and C4-grass pollen in samples of unknown composition, we developed a hierarchical Bayesian model, trained with ~1,900 δ13C values from pollen grains of 31 grass species. Surface-sediment data from Africa, Australia, and North America demonstrate the reliability of this technique for quantifying C4-grass abundance on the landscape. To investigate the timing and control of the origin of C4-grasses we analyzed samples from the Oligocene-Miocene from Europe and from the Eocene from North America. Results indicate that C4 grasses appeared on the landscape of southwest Europe no later than the early Oligocene, implying that low atmospheric pCO2 may not have been the main driver and/or precondition for the development of C4 photosynthesis in the grass family. In contrast, we found no evidence for C4 grasses in the southeast United States before pCO2 fell. In application of SPIRAL to the late Quaternary, we found that shifts in pCO2 and moisture balance exerted key controls on the relative abundance of C3 and C4 grasses in Africa and Australia. Overall, our results imply that as in the past, future changes in the C3/C4 composition of grass-dominated ecosystems will likely exhibit striking spatiotemporal variability as a result of differing combinations of

Aira (Poaceae: a new generic record for Nicobar Islands, India

Directory of Open Access Journals (Sweden)

Kumar Vinod Chhotupuri Gosavi

2016-06-01

Full Text Available During plant exploration of Andaman and Nicobar in 2014, we were collected some interesting grass specimens from Kamorta Islands of Nicobar. After critical study and taxonomic analysis the unidentified grass species has identified as an Aira caryophyllea L.  Perusals of relevant literature were revealed that, the genus Aira L. has so far not reported from Andaman and Nicobar islands. Hence, it is reported in present communication for new record to the Andaman and Nicobar Islands. 

Genetic improvement and diversity in Snake River wheatgrass (Elymus wawawaiensis) (Poaceae: Triticeae)

Science.gov (United States)

With the increased emphasis to use native plant materials in range revegetation programs in the western US, it is critical to develop native grasses that are competitive with invasive weeds, easy to establish, persistent, and produce high seed yield. One such native grass species with appreciable d...

Grass leaves as potential hominin dietary resources.

Science.gov (United States)

Paine, Oliver C C; Koppa, Abigale; Henry, Amanda G; Leichliter, Jennifer N; Codron, Daryl; Codron, Jacqueline; Lambert, Joanna E; Sponheimer, Matt

2018-04-01

Discussions about early hominin diets have generally excluded grass leaves as a staple food resource, despite their ubiquity in most early hominin habitats. In particular, stable carbon isotope studies have shown a prevalent C 4 component in the diets of most taxa, and grass leaves are the single most abundant C 4 resource in African savannas. Grass leaves are typically portrayed as having little nutritional value (e.g., low in protein and high in fiber) for hominins lacking specialized digestive systems. It has also been argued that they present mechanical challenges (i.e., high toughness) for hominins with bunodont dentition. Here, we compare the nutritional and mechanical properties of grass leaves with the plants growing alongside them in African savanna habitats. We also compare grass leaves to the leaves consumed by other hominoids and demonstrate that many, though by no means all, compare favorably with the nutritional and mechanical properties of known primate foods. Our data reveal that grass leaves exhibit tremendous variation and suggest that future reconstructions of hominin dietary ecology take a more nuanced approach when considering grass leaves as a potential hominin dietary resource. Copyright © 2017. Published by Elsevier Ltd.

Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae para la Flora Argentina

Directory of Open Access Journals (Sweden)

Ana María Cialdella

2010-01-01

Full Text Available Durante la revisión de los géneros de Stipeae (Poaceae para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P. mapuche, P. marqueziana y P. zulmae. Se incluye también una clave para identificar los géneros de Stipeae en la Argentina.

Bromus interruptus (Hack.) Druce (Poaceae) in Nederland

NARCIS (Netherlands)

Rich, Tim C.G.

2001-01-01

Bromus interruptus is a grass which was endemic to England but is now extinct in the wild. Attention is drawn to the two historic records from the Netherlands, where it was probably introduced with agricultural seed, in case it still survives in the wild. It is readily recognised from the contracted

Methods for short-term control of Imperata grass in Peruvian Amazon

Directory of Open Access Journals (Sweden)

Zbynek Polesny

2011-06-01

Full Text Available The traditional control of Imperata brasiliensis grasslands used by farmers in the Peruvian Amazon is to burn the grass. The objective of this study was to compare different methods of short-term control. Biological, mechanical, chemical and traditional methods of control were compared. Herbicide spraying and manual weeding have shown to be very effective in reducing above- and below-ground biomass growth in the first 45 days after slashing the grass, with effects persisting in the longer term, but both are expensive methods. Shading seems to be less effective in the short-term, whereas it influences the Imperata growth in the longer term. After one year shading, glyphosate application and weeding significantly reduced aboveground biomass by 94, 67 and 53%; and belowground biomass by 76, 65 and 58%, respectively, compared to control. We also found a significant decrease of Imperata rhizomes in soil during time under shading. Burning has proved to have no significant effect on Imperata growth. The use of shade trees in a kind of agroforestry system could be a suitable method for small farmers to control Imperata grasslands.

EFFECT OF MULCH AND MIXED CROPPING GRASS - LEGUME AT SALINE SOIL ON GROWTH, FORAGE YIELD AND NUTRITIONAL QUALITY OF GUINEA GRASS

Directory of Open Access Journals (Sweden)

F. Kusmiyati

2014-10-01

Full Text Available The research was conducted to evaluate the effect of mulch and mixed cropping grass – legume atsaline soil on growth, forage yield and nutritional quality of guinea grass. Saline soil used in thisresearch was classified into strongly saline soil with low soil fertility. The research was arrranged inrandomized complete block design with 3 blocks. The treatments were : M1 = guinea grassmonoculture, without mulch; M2 = guinea grass monoculture, 3 ton/ha mulch; M3 = guinea grassmonoculture, 6 ton/ha mulch, M4 = mixed cropping grass with Sesbania grandiflora, without mulch;M5 = mixed cropping grass with Sesbania grandiflora, 3 ton/ha mulch; M6 = mixed cropping grass withSesbania grandiflora, 6 ton/ha mulch. Data were analyzed using analysis of variance, then followed byDuncan's Multiple Range Test. The highest soil moisture content was achieved at mixed cropping grasslegumewith 6 ton/ha of mulch. The effect of mulch at saline soil significantly increased plant growth,forage yield and nutritional quality of guinea grass. Application of 3 ton/ha mulch increased plantgrowth, forage yield and nutritional quality of guinea grass. Plant growth, forage yield and nutritionalquality of guinea grass were not affected by monoculture or mixed cropping with Sesbania at saline soil.

Evaluating grasses as a long-term energy resource

Energy Technology Data Exchange (ETDEWEB)

Christian, D.G.; Riche, A.B.

2001-07-01

The work reported here is part of an ongoing project that aims to evaluate the yields of three perennial rhizomatous grasses and determine their suitability as bio-energy crops. The work began in 1993, and the grasses have been monitored continuously since that time. This report covers the period 1999/2000, and includes: the performance of plots of the energy grasses Miscanthus grass, switchgrass and reed canary grass seven years after they were planted; assessment of the yield of 15 genotypes of Miscanthus planted in 1997; monitoring all the species throughout the growing period for the presence of pests, weeds and diseases; measurement of the amount of nitrate leached from below Miscanthus grass; investigating the occurrence of lodging in switchgrass. (Author)

Phalaris canariensis L. (Poaceae: A new alien plant record for Kashmir Himalaya, India

Directory of Open Access Journals (Sweden)

Shugufta Rasheed

2016-03-01

Full Text Available The correct taxonomic identification assumes first and foremost priority in the scientific documentation of biodiversity. The Kashmir Himalaya, located in the north-western side of the Himalayan biodiversity hotspot, is well-known for its diverse flora which merits immediate scientific documentation. In this context, the present study reports Phalaris canariensis L. (Poaceae as a new alien plant record to the flora of Kashmir Himalaya, India. In this paper, a detailed description, photographs, and comparison of diagnostic characters with allied species are provided to scientifically validate this alien plant record for this Himalayan region.

Genetic compatibility determines endophyte-grass combinations.

Directory of Open Access Journals (Sweden)

Kari Saikkonen

Full Text Available Even highly mutually beneficial microbial-plant interactions, such as mycorrhizal- and rhizobial-plant exchanges, involve selfishness, cheating and power-struggles between the partners, which depending on prevailing selective pressures, lead to a continuum of interactions from antagonistic to mutualistic. Using manipulated grass-endophyte combinations in a five year common garden experiment, we show that grass genotypes and genetic mismatches constrain genetic combinations between the vertically (via host seeds transmitted endophytes and the out-crossing host, thereby reducing infections in established grass populations. Infections were lost in both grass tillers and seedlings in F(1 and F(2 generations, respectively. Experimental plants were collected as seeds from two different environments, i.e., meadows and nearby riverbanks. Endophyte-related benefits to the host included an increased number of inflorescences, but only in meadow plants and not until the last growing season of the experiment. Our results illustrate the importance of genetic host specificity and trans-generational maternal effects on the genetic structure of a host population, which act as destabilizing forces in endophyte-grass symbioses. We propose that (1 genetic mismatches may act as a buffering mechanism against highly competitive endophyte-grass genotype combinations threatening the biodiversity of grassland communities and (2 these mismatches should be acknowledged, particularly in breeding programmes aimed at harnessing systemic and heritable endophytes to improve the agriculturally valuable characteristics of cultivars.

Preliminary Results of Clover and Grass Coverage and Total Dry Matter Estimation in Clover-Grass Crops Using Image Analysis

Directory of Open Access Journals (Sweden)

Anders K. Mortensen

2017-12-01

Full Text Available The clover-grass ratio is an important factor in composing feed ratios for livestock. Cameras in the field allow the user to estimate the clover-grass ratio using image analysis; however, current methods assume the total dry matter is known. This paper presents the preliminary results of an image analysis method for non-destructively estimating the total dry matter of clover-grass. The presented method includes three steps: (1 classification of image illumination using a histogram of the difference in excess green and excess red; (2 segmentation of clover and grass using edge detection and morphology; and (3 estimation of total dry matter using grass coverage derived from the segmentation and climate parameters. The method was developed and evaluated on images captured in a clover-grass plot experiment during the spring growing season. The preliminary results are promising and show a high correlation between the image-based total dry matter estimate and the harvested dry matter ( R 2 = 0.93 with an RMSE of 210 kg ha − 1 .

Genomic homeology between Pennisetum purpureum and Pennisetum glaucum (Poaceae

Directory of Open Access Journals (Sweden)

Gabriela Barreto dos Reis

2014-08-01

Full Text Available The genus Pennisetum (Richard, 1805 includes two economically important tropical forage plants: Pennisetum purpureum (Schumacher, 1827 (elephant grass, with 2n = 4x = 28 chromosomes and genomes A'A'BB, and Pennisetum glaucum (Linnaeus, 1753 (pearl millet, with 2n = 2x = 14 chromosomes and genomes AA. The genetic proximity between them allows obtaining hybrids (2n = 3x = 21 that yield forage of higher quality in relation to the parents. The study of genomic relationships provides subsidies for the knowledge about phylogenetic relations and evolution, and is useful in breeding programs seeking gene introgression. Concerning elephant grass and pearl millet, the homeology between the genomes A and A', and between these and the genome B, has been reported by conventional cytogenetic techniques. The objective of the present study was to demonstrate the degree of homeology between these genomes by means of genomic in situ hybridization (GISH. The results confirmed the homeology between the genomes A of pearl millet and A'B of elephant grass, and showed that there are differences in the distribution and proportion of homologous regions after hybridization. Discussion regarding the evolutionary origin of P. purpureum and P. glaucum was also included.

Grass Biomethane for Agriculture and Energy

DEFF Research Database (Denmark)

Korres, N.E.; Thamsiriroj, T.; Smith, B.

2011-01-01

have advanced the role of grassland as a renewable source of energy in grass biomethane production with various environmental and socio-economic benefits. It is underlined that the essential question whether the gaseous biofuel meets the EU sustainability criteria of 60% greenhouse gas emission savings...... by 2020 can be met since savings up to 89.4% under various scenarios can be achieved. Grass biomethane production compared to other liquid biofuels either when these are produced by indigenous of imported feedstocks is very promising. Grass biomethane, given the mature and well known technology...

Two New Records from Lebanon: Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae)

OpenAIRE

HABER, Ricardus M.; SEMAAN, Myrna T.

2007-01-01

Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae) are described as new records for the flora of Lebanon. Specimens of C. nutans collected from roadsides and rocks in a middle mountain forest confirm the occurrence of the species on the western slopes of the Mount Lebanon Range. Additionally, specimens of E. indica were collected from wasteland and roadsides in the coastal town of Kaslik. The species were observed to thrive abundantly in similar habitat...

A field key to upload Kenya grasses | Agnew | Journal of East ...

African Journals Online (AJOL)

The species of Gramineae (Poaceae) that have been recorded in a delimited area of central and western Kenya are listed and keys are provided for their identification. The area is bounded by the 1000 m contour except in the southern Rift Valley where the Kenya/Tanzania boundary encorporates lower altitudes. For every ...

Determining the regional potential for a grass biomethane industry

International Nuclear Information System (INIS)

Smyth, Beatrice M.; Smyth, Henry; Murphy, Jerry D.

2011-01-01

Research highlights: → We identified assessment criteria for determining the regional potential for grass biomethane. → Grass biomethane is distributed via the natural gas grid. → The criteria include: land use; grass yields; gas grid coverage; availability of co-substrates. → The county with the highest potential can fuel 50% of cars or supply 130% of domestic gas consumption. - Abstract: Grass biogas/biomethane has been put forward as a renewable energy solution and it has been shown to perform well in terms of energy balance, greenhouse gas emissions and policy constraints. Biofuel and energy crop solutions are country-specific and grass biomethane has strong potential in countries with temperate climates and a high proportion of grassland, such as Ireland. For a grass biomethane industry to develop in a country, suitable regions (i.e. those with the highest potential) must be identified. In this paper, factors specifically related to the assessment of the potential of a grass biogas/biomethane industry are identified and analysed. The potential for grass biogas and grass biomethane is determined on a county-by-county basis using multi-criteria decision analysis. Values are assigned to each county and ratings and weightings applied to determine the overall county potential. The potential for grass biomethane with co-digestion of slaughter waste (belly grass) is also determined. The county with the highest potential (Limerick) is analysed in detail and is shown to have ready potential for production of gaseous biofuel to meet either 50% of the vehicle fleet or 130% of the domestic natural gas demand, through 25 facilities at a scale of ca. 30 kt yr -1 of feedstock. The assessment factors developed in this paper can be used in other resource studies into grass biomethane or other energy crops.

Brachypodium distachyon. A New Model System for Functional Genomics in Grasses1

Science.gov (United States)

Draper, John; Mur, Luis A.J.; Jenkins, Glyn; Ghosh-Biswas, Gadab C.; Bablak, Pauline; Hasterok, Robert; Routledge, Andrew P.M.

2001-01-01

A new model for grass functional genomics is described based on Brachypodium distachyon, which in the evolution of the Pooideae diverged just prior to the clade of “core pooid” genera that contain the majority of important temperate cereals and forage grasses. Diploid ecotypes of B. distachyon (2n = 10) have five easily distinguishable chromosomes that display high levels of chiasma formation at meiosis. The B. distachyon nuclear genome was indistinguishable in size from that of Arabidopsis, making it the simplest genome described in grasses to date. B. distachyon is a self-fertile, inbreeding annual with a life cycle of less than 4 months. These features, coupled with its small size (approximately 20 cm at maturity), lack of seed-head shatter, and undemanding growth requirements should make it amenable to high-throughput genetics and mutant screens. Immature embryos exhibited a high capacity for plant regeneration via somatic embryogenesis. Regenerated plants display very low levels of albinism and have normal fertility. A simple transformation system has been developed based on microprojectile bombardment of embryogenic callus and hygromycin selection. Selected B. distachyon ecotypes were resistant to all tested cereal-adapted Blumeria graminis species and cereal brown rusts (Puccinia reconditia). In contrast, different ecotypes displayed resistance or disease symptoms following challenge with the rice blast pathogen (Magnaporthe grisea) and wheat/barley yellow stripe rusts (Puccinia striformis). Despite its small stature, B. distachyon has large seeds that should prove useful for studies on grain filling. Such biological characteristics represent important traits for study in temperate cereals. PMID:11743099

Post-treatment efficacy of discontinuous treatment with 300IR 5-grass pollen sublingual tablet in adults with grass pollen-induced allergic rhinoconjunctivitis

DEFF Research Database (Denmark)

Didier, A; Malling, H-J; Worm, Marcel

2013-01-01

Sustained efficacy over three pollen seasons of pre- and co-seasonal treatment with 300IR 5-grass pollen sublingual tablet has been demonstrated in adults with moderate-severe grass pollen-associated allergic rhinoconjunctivitis.......Sustained efficacy over three pollen seasons of pre- and co-seasonal treatment with 300IR 5-grass pollen sublingual tablet has been demonstrated in adults with moderate-severe grass pollen-associated allergic rhinoconjunctivitis....

Grasses for energy production: hydrological guidelines

Energy Technology Data Exchange (ETDEWEB)

Hall, R.L.

2003-07-01

This report provides hydrological guidelines for growers, land and water resource managers, environmental groups and other parties interested in utilising grasses for energy production. The aim of the report is to help interested parties decide if a location is suitable for planting energy grasses by considering whether potential hydrological impacts will have an adverse effect on crop productivity and yield. The guidelines consider: the water use of energy grasses compared with other crops; the factors governing water use; the water requirements for a productive crop; and the likely impacts on the availability and quantity of water. The report points out that there are still gaps in our knowledge of the processes controlling the water use and growth of energy grasses and notes that, in some situations, there will be considerable uncertainty in predictions of water use and the magnitude of the associated hydrological impacts.

Silicon in Imperata cylindrica (L.) P. Beauv: content, distribution, and ultrastructure.

Science.gov (United States)

Rufo, Lourdes; Franco, Alejandro; de la Fuente, Vicenta

2014-07-01

Silicon concentration, distribution, and ultrastructure of silicon deposits in the Poaceae Imperata cylindrica (L.) P. Beauv. have been studied. This grass, known for its medicinal uses and also for Fe hyperaccumulation and biomineralization capacities, showed a concentration of silicon of 13,705 ± 9,607 mg/kg dry weight. Silicon was found as an important constituent of cell walls of the epidermis of the whole plant. Silica deposits were found in silica bodies, endodermis, and different cells with silicon-collapsed lumen as bulliforms, cortical, and sclerenchyma cells. Transmission electron microscope observations of these deposits revealed an amorphous material of an ultrastructure similar to that previously reported in silica bodies of other Poaceae.

La familia Poaceae del distrito de Arahuay (Canta, Lima, Perú

Directory of Open Access Journals (Sweden)

Paúl Gonzáles

2011-08-01

Full Text Available Se reportan para el distrito de Arahuay (Canta, Lima, Perú (zona baja y media un total de 49 especies de la familia Poaceae agrupadas en 28 géneros, 14 tribus y 4 subfamilias. El género Poa es el más diverso con cinco especies, seguido por Eragrostis y Nassella con cuatro especies cada una. Las especies Calamagrostis spiciformis Hack. ex Stuck., Chloris halophila Parodi, Lamprothyrsus peruvianus Hitchc., Festuca glyceriantha Pilg., Lolium multiflorum Lam. y Poa supina Schrad. son nuevos reportes para el departamento de Lima. Se presentan claves dicotómicas para la determinación de los géneros y para las especies en los casos pertinentes. Para cada especie se incluye datos sobre su hábitat, distribución y el material estudiado.

Ecological niche differentiation of polyploidization is not supported by environmental differences among species in a cosmopolitan grass genus.

Science.gov (United States)

Visser, Vernon; Molofsky, Jane

2015-01-01

• Polyploidization frequently results in the creation of new plant species, the establishment of which is thought to often be facilitated by ecological niche differentiation from the diploid species. We tested this hypothesis using the cosmopolitan grass genus Phalaris (Poaceae), consisting of 19 species that range from diploid to tetraploid to hexaploid. Specifically, we tested whether (1) polyploids occupy more extreme environments and/or (2) have broader niche breadths and/or (3) whether the polyploid species' distributions indicate a niche shift from diploid species.• We employed a bootstrapping approach using distribution data for each species and eight environmental variables to investigate differences between species in the means, extremes, and breadths of each environmental variable. We used a kernel smoothing technique to quantify niche overlap between species.• Although we found some support for the three hypotheses for a few diploid-polyploid pairs and for specific environmental variables, none of these hypotheses were generally supported.• Our results suggest that these commonly held hypotheses about the effects of polyploidization on ecological distributions are not universally applicable. Correlative biogeographic studies like ours provide a necessary first step for suggesting specific hypotheses that require experimental verification. A combination of genetic, physiological, and ecological studies will be required to achieve a better understanding of the role of polyploidization in niche evolution. © 2015 Botanical Society of America, Inc.

VAM populations in relation to grass invasion associated with forest decline.

Science.gov (United States)

Vosatka, M; Cudlin, P; Mejstrik, V

1991-01-01

Spruce stands in Northern Bohemia forests, damaged to various degrees by industrial pollution, have shown establishment of grass cover following tree defoliation. Populations of vesicular-arbuscular mycorrhizal (VAM) fungi were studied under this grass cover in four permanent plots with spruce under different levels of pollution stress. Soil and root samples were collected in April and June within each plot as follows: (1) sites without grass, (2) sites with initial stages of grass invasion, and (3) sites with fully developed grass cover. In all plots, the highest number of propagules were recovered from samples taken from sites having full grass cover. Mycorrhizal infection of grass was highest in the plot with the severest pollution damage and lowest in the least damaged plot. The development of grass cover and VAM infection of grass increased with tree defoliation caused by air pollution.

Grass survey of the Itremo Massif records endemic central highland ...

African Journals Online (AJOL)

Twenty species are endemic to the central highlands, and a further 1 4 species are restricted to Madagascar. Five ecological groups of grasses were identified in the Itremo Massif: shade species in gallery forests, open wet area species, fire grasses, anthropogenic disturbance associated grasses and rock-dwelling grasses.

Rumen escape protein in grass and grass silage deterimened with a nylon bag and an enzymatic technique

NARCIS (Netherlands)

Cone, J.W.; Gelder, van A.H.; Mathijssen-Kamman, A.A.; Hindle, V.A.

2004-01-01

Rumen escape protein (REP) was determined for six grasses and 16 grass silages using a nylon bag technique and an in vitro technique using a proteolytic enzyme preparation of Streptomyces griseus. In vitro, the samples were incubated for 0, 1, 6 and 24 h. The highest correlation observed between

EroGRASS : Failure of grass cover layers at seaward and shoreward dike slopes. design, construction and performance

NARCIS (Netherlands)

Verhagen, H.J.; Verheij, H.J.; Cao, T.M.; Dassanayake, D.; Roelvink, D.; Piontkowitz, T.

2009-01-01

A large number of the dikes in the North Sea and Baltic Sea regions are covered with grass that is exposed to hydraulic loading from waves and currents during storm surges. During previous storm surges the grass cover layers often showed large strength and remained undamaged. A clear physical

Nature of ergastic substances in some Poaceae seeds

African Journals Online (AJOL)

ajl yemi

2011-08-29

Aug 29, 2011 ... 1Department of Botany, University of Benin, PMB 1154, Benin City, Edo State, Nigeria. 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011 ... grasses) contribute more food seeds than any other plant family; it contributes about 50% per capita energy ...

Investigation of Desso GrassMaster® as application in hydraulic engineering

NARCIS (Netherlands)

Steeg, van der P.; Paulissen, M.P.C.P.; Roex, E.; Mommer, L.

2015-01-01

Dessa GrassMaster® is a reinforced grass system which is applied successfully on sports fields and enables to use a sports field more intensively than a normal grass field. In this report the possibility of an application of Dessa GrassMaster®in hydraulic conditions, with a focus on grass dikes, is

Established native perennial grasses out-compete an invasive annual grass regardless of soil water and nutrient availability

Science.gov (United States)

Christopher M. McGlone; Carolyn Hull Sieg; Thomas E. Kolb; Ty Nietupsky

2012-01-01

Competition and resource availability influence invasions into native perennial grasslands by nonnative annual grasses such as Bromus tectorum. In two greenhouse experiments we examined the influence of competition, water availability, and elevated nitrogen (N) and phosphorus (P) availability on growth and reproduction of the invasive annual grass B. tectorum and two...

Germination of Themeda triandra (Kangaroo grass) as affected by ...

African Journals Online (AJOL)

Low rainfall in range areas restricts germination, growth and development of majority of range grasses. However, germination and establishment potential of forage grasses vary and depends on environmental conditions. Themeda triandra is an excellent known grass to grow under different environmental conditions.

The importance of cross-reactivity in grass pollen allergy

Directory of Open Access Journals (Sweden)

Aleksić Ivana

2014-01-01

Full Text Available According to the data obtained from in vivo and in vitro testing in Serbia, a significant number of patients have allergic symptoms caused by grass pollen. We examined the protein composition of grass pollens (Dactylis glomerata, Lolium perenne and Phleum pratense and cross-reactivity in patients allergic to grass pollen from our region. The grass pollen allergen extract was characterized by SDS-PAGE, while cross-reactivity of single grass pollens was revealed by immunoblot analysis. A high degree of cross-reactivity was demonstrated for all three single pollens in the sera of allergic patients compared to the grass pollen extract mixture. Confirmation of the existence of cross-reactivity between different antigenic sources facilitates the use of monovalent vaccines, which are easier to standardize and at the same time prevent further sensitization of patients and reduces adverse reactions. [Projekat Ministarstva nauke Republike Srbije, br. 172049 i br. 172024

Anther and pollen development in some species of Poaceae (Poales

Directory of Open Access Journals (Sweden)

AT. Nakamura

Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.

Thermogravimetric analysis of forest understory grasses

Science.gov (United States)

Thomas Elder; John S. Kush; Sharon M. Hermann

2011-01-01

Forest understory grasses are of significance in the initiation, establishment and maintenance of fire, whether used as a management tool or when occurring as wildfire. The fundamental thermal properties of such grasses are critical to their behavior in fire situations and have been investigated in the current work by the application of thermogravimetric analysis (TGA...

Ecology and management of the Prairie Division

Science.gov (United States)

Roger C. Anderson

2012-01-01

Grasslands occurred on all continents, comprised almost 42 percent of the world’s plant cover, and once covered approximately 46 million km2 of the Earth’s surface. Grasslands contain few trees or shrubs, are dominated by grasses (members of the family Poaceae), and have a mixture of nongraminoid herbaceous species called forbs. Plant families...

Helicoverpa zea (Lepidoptera: Noctuidae) and Spodoptera frugiperda (Lepidoptera: Noctuidae) Responses to Sorghum bicolor (Poales: Poaceae) Tissues From Lowered Lignin Lines.

Science.gov (United States)

Dowd, Patrick F; Sattler, Scott E

2015-01-01

The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

Names of Southern African grasses: Name changes and additional ...

African Journals Online (AJOL)

The main reasons for changes in botanical names are briefly reviewed, with examples from the lists. At this time, about 1040 grass species and subspecific taxa are recognized in the subcontinent. Keywords: botanical research; botanical research institute; botany; grass; grasses; identification; name change; nomenclature; ...

Acrapex azumai Sugi (Lepidoptera, Noctuidae) as a possible biological control agent of the invasive weed Imperata cylindrica (L.) Beauv. (Poaceae) in the United States

Science.gov (United States)

Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...

Bud-bank and tiller dynamics of co-occurring C3 caespitose grasses in mixed-grass prairie.

Science.gov (United States)

Ott, Jacqueline P; Hartnett, David C

2015-09-01

Tiller recruitment from the belowground bud bank of caespitose grasses influences their ability to monopolize local resources and, hence, their genet fitness. Differences in bud production and outgrowth among tiller types within a genet and among species may explain co-occurrence of caespitose grasses. This study aimed to characterize genet bud-bank and tiller production and dynamics in two co-occurring species and compare their vegetative reproductive strategies. Bud-bank and tiller dynamics of Hesperostipa comata and Nassella viridula, dominant C3 caespitose grasses in the northern mixed-grass prairie of North America, were assessed throughout an annual cycle. The two species showed similar strategies, maintaining polycyclic tillers and thus creating mixed-age genet bud banks comprising multiple bud cohorts produced in different years. Vegetative tillers produced the majority of buds, whereas flowering tillers contributed little to the bud bank. Buds lived for at least 2 yr and were maintained in multiple developmental stages throughout the year. Because bud longevity rarely exceeded tiller longevity, tiller longevity drove turnover within the bud bank. Tiller population dynamics, more than bud production per tiller, determined the differential contribution of tiller types to the bud bank. Nassella viridula had higher bud production per tiller, a consistent annual tiller recruitment density, and greater longevity of buds on senesced and flowering tillers than H. comata. Co-occurring C3 caespitose grasses had similar bud-bank and tiller dynamics contributing to genet persistence but differed in bud characteristics that could affect genet longevity and species coexistence. © 2015 Botanical Society of America.

Dose-response relationship of a new Timothy grass pollen allergoid in comparison with a 6-grass pollen allergoid.

Science.gov (United States)

Pfaar, O; Hohlfeld, J M; Al-Kadah, B; Hauswald, B; Homey, B; Hunzelmann, N; Schliemann, S; Velling, P; Worm, M; Klimek, L

2017-11-01

Subcutaneous allergen immunotherapy with grass pollen allergoids has been proven to be effective and safe in the treatment of patients with allergic rhinoconjunctivitis. Based on the extensive cross-reactivity among Pooideae species, it has been suggested that grass pollen extracts could be prepared from a single species, rather than from a multiple species mixture. To find the optimal dose of a Phleum pratense (P. pratense) allergoid preparation and compare its efficacy and safety to a 6-grass pollen allergoid preparation. In this double-blind, placebo-controlled study (EudraCT: 2011-000674-58), three doses of P. pratense allergoid (1800 therapeutic units (TU), standard-dose 6000 TU and 18 000 TU) were compared with placebo and the marketed 6-grass pollen allergoid (6000 TU). In a pre-seasonal dosing regimen, 102 patients were randomized to five treatment groups and received nine subcutaneous injections. The primary efficacy endpoint was the change in weal size (late-phase reaction [LPR]) in response to the intracutaneous testing (ICT) before and after treatment, comparing the active allergoids to placebo. Secondary outcomes were the change in Total Nasal Symptom Score (TNSS) assessed in the allergen exposure chamber (AEC), the changes in P. pratense-serum-specific IgG 4 and the incidence of adverse events (AEs). All three doses of the P. pratense and the 6-grass pollen allergoid preparations were significantly superior to placebo for the primary outcome, whereas there were no significant differences in the change in TNSS. Compared to the standard-dose, the high-dose of P. pratense did not produce any additional significant benefit, but showed a slight increase in AEs. Yet this increase in AEs was lower than for the 6-grass pollen preparation. The standard-dose of the new P. pratense allergoid was comparable to the marketed 6-grass pollen preparation at equal dose for the parameters measured. © 2017 The Authors. Clinical & Experimental Allergy Published by John

GRASS GIS: The first Open Source Temporal GIS

Science.gov (United States)

Gebbert, Sören; Leppelt, Thomas

2015-04-01

GRASS GIS is a full featured, general purpose Open Source geographic information system (GIS) with raster, 3D raster and vector processing support[1]. Recently, time was introduced as a new dimension that transformed GRASS GIS into the first Open Source temporal GIS with comprehensive spatio-temporal analysis, processing and visualization capabilities[2]. New spatio-temporal data types were introduced in GRASS GIS version 7, to manage raster, 3D raster and vector time series. These new data types are called space time datasets. They are designed to efficiently handle hundreds of thousands of time stamped raster, 3D raster and vector map layers of any size. Time stamps can be defined as time intervals or time instances in Gregorian calendar time or relative time. Space time datasets are simplifying the processing and analysis of large time series in GRASS GIS, since these new data types are used as input and output parameter in temporal modules. The handling of space time datasets is therefore equal to the handling of raster, 3D raster and vector map layers in GRASS GIS. A new dedicated Python library, the GRASS GIS Temporal Framework, was designed to implement the spatio-temporal data types and their management. The framework provides the functionality to efficiently handle hundreds of thousands of time stamped map layers and their spatio-temporal topological relations. The framework supports reasoning based on the temporal granularity of space time datasets as well as their temporal topology. It was designed in conjunction with the PyGRASS [3] library to support parallel processing of large datasets, that has a long tradition in GRASS GIS [4,5]. We will present a subset of more than 40 temporal modules that were implemented based on the GRASS GIS Temporal Framework, PyGRASS and the GRASS GIS Python scripting library. These modules provide a comprehensive temporal GIS tool set. The functionality range from space time dataset and time stamped map layer management

Polyphyly, gene-duplication and extensive allopolyploidy framed the evolution of the ephemeral Vulpia grasses and other fine-leaved Loliinae (Poaceae).

Science.gov (United States)

Díaz-Pérez, A J; Sharifi-Tehrani, M; Inda, L A; Catalán, P

2014-10-01

The fine-leaved Loliinae is one of the temperate grass lineages that is richest in number of evolutionary switches from perennial to annual life-cycle, and also shows one of the most complex reticulate patterns involving distinct diploid and allopolyploid lineages. Eight distinct annual lineages, that have traditionally been placed in the genus Vulpia and in other fine-leaved ephemeral genera, have apparently emerged from different perennial Festuca ancestors. The phenotypically similar Vulpia taxa have been reconstructed as polyphyletic, with polyploid lineages showing unclear relationships to their purported diploid relatives. Interspecific and intergeneric hybridization is, however, rampant across different lineages. An evolutionary analysis based on cloned nuclear low-copy GBSSI (Granule-Bound Starch Synthase I) and multicopy ITS (Internal Transcribed Spacer) sequences has been conducted on representatives of most Vulpia species and other fine-leaved lineages, using Bayesian consensus and agreement trees, networking split graphs and species tree-based approaches, to disentangle their phylogenetic relationships and to identify the parental genome donors of the allopolyploids. Both data sets were able to reconstruct a congruent phylogeny in which Vulpia was resolved as polyphyletic from at least three main ancestral diploid lineages. These, in turn, participated in the origin of the derived allopolyploid Vulpia lineages together with other Festuca-like, Psilurus-like and some unknown genome donors. Long-distance dispersal events were inferred to explain the polytopic origin of the Mediterranean and American Vulpia lineages. Copyright © 2014 Elsevier Inc. All rights reserved.

MACRO NUTRIENTS UPTAKE OF FORAGE GRASSES AT DIFFERENT SALINITY STRESSES

Directory of Open Access Journals (Sweden)

F. Kusmiyati

2014-10-01

Full Text Available The high concentration of sodium chloride (NaCl in saline soils has negative effects on the growth ofmost plants. The experiment was designed to evaluate macro nutrient uptake (Nitrogen, Phosphorus andPotassium of forage grasses at different NaCl concentrations in growth media. The experiment wasconducted in a greenhouse at Forage Crops Laboratory of Animal Agriculture Faculty, Diponegoro University.Split plot design was used to arrange the experiment. The main plot was forage grasses (Elephant grass(Pennisetum purpureum and King grass (Pennisetum hybrida. The sub plot was NaCl concentrationin growth media (0, 150, and 300 mM. The nitrogen (N, phosphorus (P and potassium (K uptake in shootand root of plant were measured. The result indicated increasing NaCl concentration in growth mediasignificantly decreased the N, P and K uptake in root and shoot of the elephant grass and king grass. Thepercentage reduction percentage of N, P and K uptake at 150 mM and 300 mM were high in elephant grassand king grass. It can be concluded that based on nitrogen, phosphorus and potassium uptake, elephantgrass and king grass are not tolerant to strong and very strong saline soil.

Grasses as invasive plants in South Africa revisited: Patterns, pathways and management

Directory of Open Access Journals (Sweden)

Vernon Visser

2017-03-01

Full Text Available Background: In many countries around the world, the most damaging invasive plant species are grasses. However, the status of grass invasions in South Africa has not been documented recently. Objectives: To update Sue Milton’s 2004 review of grasses as invasive alien plants in South Africa, provide the first detailed species level inventory of alien grasses in South Africa and assess the invasion dynamics and management of the group. Method: We compiled the most comprehensive inventory of alien grasses in South Africa to date using recorded occurrences of alien grasses in the country from various literature and database sources. Using historical literature, we reviewed past efforts to introduce alien grasses into South Africa. We sourced information on the origins, uses, distributions and minimum residence times to investigate pathways and patterns of spatial extent. We identified alien grasses in South Africa that are having environmental and economic impacts and determined whether management options have been identified, and legislation created, for these species. Results: There are at least 256 alien grass species in the country, 37 of which have become invasive. Alien grass species richness increased most dramatically from the late 1800s to about 1940. Alien grass species that are not naturalised or invasive have much shorter residence times than those that have naturalised or become invasive. Most grasses were probably introduced for forage purposes, and a large number of alien grass species were trialled at pasture research stations. A large number of alien grass species in South Africa are of Eurasian origin, although more recent introductions include species from elsewhere in Africa and from Australasia. Alien grasses are most prevalent in the south-west of the country, and the Fynbos Biome has the most alien grasses and the most widespread species. We identified 11 species that have recorded environmental and economic impacts in the

Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

Directory of Open Access Journals (Sweden)

Peng-Cheng Yao

Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

Lessons learned in managing alfalfa-grass mixtures

Science.gov (United States)

Grass-alfalfa mixtures have a number of benefits that make them attractive to producers. However, they can be problematic to establish and maintain. Research programs have made progress in understanding the benefits and challenges of alfalfa-grass mixtures. Mixtures may have greater winter survival ...

Variation in important pasture grasses: I. Morphological and ...

African Journals Online (AJOL)

Variation in important pasture grasses: I. Morphological and geographical variation. ... Seven species are important pasture grasses throughout the western Transvaal, Orange Free State, northern Cape and Natal. ... Language: English.

A Consensus Map in Cultivated Hexaploid Oat Reveals Conserved Grass Synteny with Substantial Subgenome Rearrangement

Directory of Open Access Journals (Sweden)

Ashley S. Chaffin

2016-07-01

Full Text Available Hexaploid oat ( L., 2 = 6 = 42 is a member of the Poaceae family and has a large genome (∼12.5 Gb containing 21 chromosome pairs from three ancestral genomes. Physical rearrangements among parental genomes have hindered the development of linkage maps in this species. The objective of this work was to develop a single high-density consensus linkage map that is representative of the majority of commonly grown oat varieties. Data from a cDNA-derived single-nucleotide polymorphism (SNP array and genotyping-by-sequencing (GBS were collected from the progeny of 12 biparental recombinant inbred line populations derived from 19 parents representing oat germplasm cultivated primarily in North America. Linkage groups from all mapping populations were compared to identify 21 clusters of conserved collinearity. Linkage groups within each cluster were then merged into 21 consensus chromosomes, generating a framework consensus map of 7202 markers spanning 2843 cM. An additional 9678 markers were placed on this map with a lower degree of certainty. Assignment to physical chromosomes with high confidence was made for nine chromosomes. Comparison of homeologous regions among oat chromosomes and matches to orthologous regions of rice ( L. reveal that the hexaploid oat genome has been highly rearranged relative to its ancestral diploid genomes as a result of frequent translocations among chromosomes. Heterogeneous chromosome rearrangements among populations were also evident, probably accounting for the failure of some linkage groups to match the consensus. This work contributes to a further understanding of the organization and evolution of hexaploid grass genomes.

Karyotype evolution in Phalaris (Poaceae): The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

Science.gov (United States)

Winterfeld, Grit; Becher, Hannes; Voshell, Stephanie; Hilu, Khidir; Röser, Martin

2018-01-01

Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae) is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH) of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1) the exclusively Mediterranean genome A based on x = 6, (2) the cosmopolitan genome B based on x = 7 and (3) a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

Karyotype evolution in Phalaris (Poaceae: The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

Directory of Open Access Journals (Sweden)

Grit Winterfeld

Full Text Available Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1 the exclusively Mediterranean genome A based on x = 6, (2 the cosmopolitan genome B based on x = 7 and (3 a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

Grass-on-grass competition along a catenal gradient in mesic ...

African Journals Online (AJOL)

Three aboveground treatments (full light competition, no light competition and clipping to simulate grazing), and two belowground treatments (full belowground competition and belowground competition excluded by a root tube), were used. On all soil depths the three grass species differed in mean mass, with E. racemosa ...

Results from the 5-year SQ grass sublingual immunotherapy tablet asthma prevention (GAP) trial in children with grass pollen allergy.

Science.gov (United States)

Valovirta, Erkka; Petersen, Thomas H; Piotrowska, Teresa; Laursen, Mette K; Andersen, Jens S; Sørensen, Helle F; Klink, Rabih

2018-02-01

Allergy immunotherapy targets the immunological cause of allergic rhinoconjunctivitis and allergic asthma and has the potential to alter the natural course of allergic disease. The primary objective was to investigate the effect of the SQ grass sublingual immunotherapy tablet compared with placebo on the risk of developing asthma. A total of 812 children (5-12 years), with a clinically relevant history of grass pollen allergic rhinoconjunctivitis and no medical history or signs of asthma, were included in the randomized, double-blind, placebo-controlled trial, comprising 3 years of treatment and 2 years of follow-up. There was no difference in time to onset of asthma, defined by prespecified asthma criteria relying on documented reversible impairment of lung function (primary endpoint). Treatment with the SQ grass sublingual immunotherapy tablet significantly reduced the risk of experiencing asthma symptoms or using asthma medication at the end of trial (odds ratio = 0.66, P year posttreatment follow-up, and during the entire 5-year trial period. Also, grass allergic rhinoconjunctivitis symptoms were 22% to 30% reduced (P years). At the end of the trial, the use of allergic rhinoconjunctivitis pharmacotherapy was significantly less (27% relative difference to placebo, P < .001). Total IgE, grass pollen-specific IgE, and skin prick test reactivity to grass pollen were all reduced compared to placebo. Treatment with the SQ grass sublingual immunotherapy tablet reduced the risk of experiencing asthma symptoms and using asthma medication, and had a positive, long-term clinical effect on rhinoconjunctivitis symptoms and medication use but did not show an effect on the time to onset of asthma. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

Convex relationships in ecosystems containing mixtures of trees and grass

CSIR Research Space (South Africa)

Scholes, RJ

2003-12-01

Full Text Available The relationship between grass production and the quantity of trees in mixed tree-grass ecosystems (savannas) is convex for all or most of its range. In other words, the grass production declines more steeply per unit increase in tree quantity...

Establishing native warm season grasses on Eastern Kentucky strip mines

Energy Technology Data Exchange (ETDEWEB)

Barnes, T.G.; Larkin, J.L.; Arnett, M.B. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Forestry

1998-12-31

The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomass samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife habitat.

Establishing native warm season grasses on Eastern Kentucky strip mines

International Nuclear Information System (INIS)

Barnes, T.G.; Larkin, J.L.; Arnett, M.B.

1998-01-01

The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomass samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife habitat

The effects of altered levels of UV-B radiation on an Antarctic grass and lichen

NARCIS (Netherlands)

Lud, D.; Huiskes, A.H.L.; Moerdijk-Poortvliet, T.C.W.; Rozema, J.J.

2001-01-01

We report a long-term experiment on the photosynthetic response of natural vegetation of Deschampsia antarctica (Poaceae) and Turgidosculum complicatulum (Lichenes) to altered UV-B levels on Leonie Island, Antarctica. UV-B above the vegetation was reduced by filter screens during two seasons. Half

A new species of Rhopalosiphum (Hemiptera, Aphididae) on Chusquea tomentosa (Poaceae, Bambusoideae) from Costa Rica

Science.gov (United States)

Hidalgo, Nicolás Pérez; Martínez-Torres, David; Collantes-Alegre, Jorge Mariano; Muller, William Villalobos; Nafría, Juan M. Nieto

2012-01-01

Abstract The new species Rhopalosiphum chusqueae Pérez Hidalgo & Villalobos Muller, is described from apterous viviparous females caught on Chusquea tomentosa in Cerro de la Muerte (Costa Rica). The identity of the species is supported both by the morphological features and by a molecular phylogenetic analysis based on a fragment of the mitochondrial DNA containing the 5’ region of the cytochrome c oxidase 1 (COI) and on the nuclear gene coding for the Elongation factor-1 alpha (EF1α). The taxonomic position of the new species is discussed. An identification key to the Aphidinae species living on plants of Bambusoideae (Poaceae) is presented. PMID:22328859

Estimating grass-clover ratio variations caused by traffic intensities using image analysis

DEFF Research Database (Denmark)

Jørgensen, Rasmus Nyholm; Sørensen, Claus Grøn; Green, Ole

Grass and especially clover have a negative yield response as a function of  traffic intensity.  Conventional grass-clover production for silage have high traffic intensity due to fertilizing with slurry, cutting the grass, rolling the grass into swaths, and collecting and chopping the grass...... to fulfill the aim [1]http://www.ruralni.gov.uk/index/publications/press_articles/dairy-2/role-of-clover.htm...

Controlling grass weeds on hard surfaces

DEFF Research Database (Denmark)

Rask, Anne Merete; Kristoffersen, Palle; Andreasen, Christian

2012-01-01

An experiment was conducted on a specially designed hard surface to study the impact of time interval between flaming treatments on the regrowth and flower production of two grass weeds. The goal of this experiment was to optimize the control of annual bluegrass and perennial ryegrass, both species...... that are very difficult to control without herbicides. Aboveground biomass from 72 plants per treatment was harvested and dry weights were recorded at regular intervals to investigate how the plants responded to flaming. Regrowth of the grasses was measured by harvesting aboveground biomass 2 wk after......, as they did not increase the reduction of aboveground biomass compared with the 7-d treatment interval. Knowledge on the regrowth of grass weeds after flaming treatments provided by this study can help improve recommendations given to road keepers and park managers for management on these weeds. Nomenclature...

Microbial protein synthesis, digestion and lactation responses of cows to grass or grass-red clover silage diet supplemented with barley or oats

Directory of Open Access Journals (Sweden)

A. VANHATALO

2008-12-01

Full Text Available The study was conducted to evaluate effects of silage type (grass-red clover vs. pure grass and grain supplement (oats vs. barley on rumen fermentation, post-ruminal nutrient flows, diet digestion and milk production. Four primiparous Finnish Ayrshire cows fitted with cannulae in the rumen and duodenum were used in a 4 × 4 Latin square experiment with four 28-d experimental periods and 2 × 2 factorial arrangements of treatments. Using red clover-containing (40% silage rather than pure grass silage had minor effects on rumen fermentation or diet digestion but increased non-ammonia nitrogen (N flow in terms of increased flows of microbial and dietary N entering to the small intestine. This was reflected as a reduced ruminal N degradability on grass-red clover diets. Furthermore, grass-red clover diets in comparison to grass silage diets increased milk lactose concentration and yields of milk, protein and lactose. Feeding oats in replacement for barley had minor effects on rumen fermentation or post-ruminal non-ammonia N flows but reduced digestibility of organic matter and neutral detergent fibre in the diet. Using oats rather than barley increased yields of milk and lactose but reduced milk protein concentration. Oats also increased proportions of C18:0 and C18:1 in milk fat and reduced those of C10:0 to C16:0. It is concluded that inclusion of red clover and replacement of barley with oats in grass silage based diets have beneficial effects in dairy cow production.;

Estimating the energy requirements and CO{sub 2} emissions from production of the perennial grasses miscanthus, switchgrass and reed canary grass

Energy Technology Data Exchange (ETDEWEB)

Bullard, M.; Metcalfe, P.

2001-07-01

The perennial grasses miscanthus, reed canary and swithchgrass have attractions as energy crops in the United Kingdom: all have low demand for fertilizer and pesticide, and are harvested annually. Research on energy ratios and carbon ratios of the grasses is reported. A Microsoft Excel-based model was developed (from an ADAS database) and the input calculations and assumptions are explained. The study demonstrated the attractions of theses grasses as a source of fuel. The results agreed with those from a model developed for the SRC.

The effects of energy grass plantations on biodiversity

Energy Technology Data Exchange (ETDEWEB)

Semere, T; Slater, F

2005-07-01

The ecological impact on local wildlife of biomass plantations of three different species of grasses has been monitored in the years 2002 to 2004 inclusive at farms in Herefordshire UK. Two of the grasses were not native to Britain. Wildlife monitored included ground flora, beetles, insects, birds, small mammals, butterflies, bees and hoverflies. The results provide a baseline of biodiversity data from biomass farms in England, although due to poor crop growth, the data from the switch-grass plantation was incomplete. The surveys were carried out by Cardiff University supported financially by the DTI.

The effects of energy grass plantations on biodiversity

International Nuclear Information System (INIS)

Semere, T.; Slater, F.

2005-01-01

The ecological impact on local wildlife of biomass plantations of three different species of grasses has been monitored in the years 2002 to 2004 inclusive at farms in Herefordshire UK. Two of the grasses were not native to Britain. Wildlife monitored included ground flora, beetles, insects, birds, small mammals, butterflies, bees and hoverflies. The results provide a baseline of biodiversity data from biomass farms in England, although due to poor crop growth, the data from the switch-grass plantation was incomplete. The surveys were carried out by Cardiff University supported financially by the DTI

Functional immunoglobulin E cross-reactivity between Pas n 1 of Bahia grass pollen and other group 1 grass pollen allergens.

Science.gov (United States)

Davies, J M; Dang, T D; Voskamp, A; Drew, A C; Biondo, M; Phung, M; Upham, J W; Rolland, J M; O'Hehir, R E

2011-02-01

Grass pollens are major triggers of allergic rhinitis and asthma, but the immunological relationships between pollen allergens of the subtropical Bahia grass, Paspalum notatum, and temperate grasses are unresolved. To assess serum IgE cross-reactivity between subtropical P. notatum and temperate Lolium perenne (Ryegrass) pollen allergens. Serum IgE reactivities of grass pollen-allergic patients with P. notatum, L. perenne and Cynodon dactylon (Bermuda grass) pollen extracts and their respective purified group 1 allergens, Pas n 1, Lol p 1 and Cyn d 1, were compared by immunoblotting, ELISA and basophil activation. In a cohort of 51 patients from a temperate region, a high frequency of IgE reactivity with each grass pollen was detected, but reactivity with L. perenne pollen was substantially greater than with P. notatum and C. dactylon pollen. Similarly, serum IgE reactivity with Lol p 1 was greater than with Pas n 1 or Cyn d 1. For seven of eight sera studied in detail, asymmetric serum IgE cross-reactivity was observed; L. perenne pollen inhibited IgE reactivity with P. notatum pollen but not the converse, and IgE reactivity with Pas n 1 was inhibited by Lol p 1 but IgE reactivity with Lol p 1 was not inhibited by Pas n 1 or Cyn d 1. Importantly, P. notatum pollen and Pas n 1 activated basophils in grass pollen-allergic patients from a temperate region, although stimulation was greater by pollen of L. perenne than P. notatum or C. dactylon, and by Lol p 1 than Pas n 1 or Cyn d 1. In contrast, a cohort of 47 patients from a subtropical region showed similar IgE reactivity with P. notatum and L. perenne pollen, and reciprocal cross-inhibition of IgE reactivity between L. perenne and P. notatum. Pollen allergens of the subtropical P. notatum, including Pas n 1, show clinically relevant IgE cross-reactivity with pollen allergens of L. perenne but also species-specific IgE reactivity. © 2011 Blackwell Publishing Ltd.

High-biomass C4 grasses-Filling the yield gap.

Science.gov (United States)

Mullet, John E

2017-08-01

A significant increase in agricultural productivity will be required by 2050 to meet the needs of an expanding and rapidly developing world population, without allocating more land and water resources to agriculture, and despite slowing rates of grain yield improvement. This review examines the proposition that high-biomass C 4 grasses could help fill the yield gap. High-biomass C 4 grasses exhibit high yield due to C 4 photosynthesis, long growth duration, and efficient capture and utilization of light, water, and nutrients. These C 4 grasses exhibit high levels of drought tolerance during their long vegetative growth phase ideal for crops grown in water-limited regions of agricultural production. The stems of some high-biomass C 4 grasses can accumulate high levels of non-structural carbohydrates that could be engineered to enhance biomass yield and utility as feedstocks for animals and biofuels production. The regulatory pathway that delays flowering of high-biomass C 4 grasses in long days has been elucidated enabling production and deployment of hybrids. Crop and landscape-scale modeling predict that utilization of high-biomass C 4 grass crops on land and in regions where water resources limit grain crop yield could increase agricultural productivity. Copyright © 2017 Elsevier B.V. All rights reserved.

Grass Rooting the System

Science.gov (United States)

Perlman, Janice E.

1976-01-01

Suggests a taxonomy of the grass roots movement and gives a general descriptive over view of the 60 groups studied with respect to origin, constituency, size, funding, issues, and ideology. (Author/AM)

Hilly grasses and leaves: a promising unconventional feed resource for livestock.

OpenAIRE

Hossain M.E.; Karim M.H.; Ahmed M.I.; Sultana S.A.

2016-01-01

The study was undertaken to find out the chemical composition of different hilly grasses and leaves available in Bandarban areas of Bangladesh. Total 10 different hilly grasses and leaves such as Bottle gourd leaf (Lagenaria siceraria), Castor bean leaf (Ricinus communis), Cogon grass (Imperata cylindrica), Dhol kolmi (Ipomoea carnea), Giant reed leaf (Arundo donax), Hilly grass (Cynodon dactylon), Pithraj leaf (Aphanamixis polystachya), Sal leaf (Shorea robusta), Shegun leaf (Tectona grandis...

Effect of machinery wheel load on grass yield

DEFF Research Database (Denmark)

Green, Ole; Jørgensen, Rasmus Nyholm; Kristensen, Kristian

2010-01-01

Effect of machinery wheel load on grass   Ole Green1, Rasmus N. Jørgensen2, Kristian Kristensen3, René Gislum3, Dionysis Bochtis1, & Claus G. Sørensen1   1University of Aarhus, Dept. of Agricultural Engineering 2University of Southern Denmark, Inst. of Chemical Eng., Biotechnology and Environmental...... 3University of Aarhus, Dept. of Genetics and Biotechnology   Corresponding author: Ole Green Address & e-mail: Research Centre Foulum, Blichers Allé 20, 8830 Tjele. Ole.Green@agrsci.dk     Abstract   Different traffic intensities have been shown to have a negative influence on the yield of grass...... and clover. A full scale grass-clover field trial was established to estimate the effect on clover-grass yields as a function of different wheel loads and tire pressures. The trial comprised 16 different traffic intensities with 35 replicates and 1 traffic free treatment with 245 replicates, totalling 17...

Alley cropping of legumes with grasses as forages : Effect of different grass species and row spacing of gliricidia on the growth and biomass production of forages

Directory of Open Access Journals (Sweden)

Siti Yuhaeni

1998-12-01

Full Text Available A study to evaluate the effect of different grass species and row spacing of gliricidia (Gliricidia sepium on the growth and biomass production of forages in an alley cropping system was conducted in two different agroclimatical zones i.e. Bogor, located at 500 m a .s .l . with an average annual rainfall of 3,112 nun/year and Sukabumi located at 900 m a .s .l . with an average annual rainfall of 1,402 mm/year . Both locations have low N, P, and K content and the soil is classified as acidic. The experimental design used was a split plot design with 3 replicates . The main plots were different grass species i.e. king grass (Pennisetum purpureum x P. typhoides and elephant grass (P. purpureum. The sub plots were the row spacing of gliricidia at 2, 3, 4, 6 m (1 hedgerows and 4 m (2 hedgerows. The results indicated that the growth and biomass production of grasses were significantly affected (P<0 .05 by the treatments in Bogor. The highest biomass productions was obtained from the 2 m row spacing which gave the highest dry matter production of grasses (1 .65 kg/hill and gliricidia (0 .086 kg/tree . In Sukabumi the growth and biomass production of grasses and gliricidia were also significantly affected by the treatments . The highest dry matter production was obtained with 2 m row spacing (dry matter of grasses and gliricidia were 1 .12 kg/hill and 0 .026 kg/tree, respectively . The result further indicated that biomass production of forages increased with the increase in gliricidia population. The alley cropping system wich is suitable for Bogor was the 2 m row spacing of gliricidia intercropped with either king or elephant grass and for Sukabumi 2 and 4 m (2 rows of gliricidia row spacing intercropped with king or elephant grass .

Energy evaluation of fresh grass in the diets of lactating dairy cows

NARCIS (Netherlands)

Bruinenberg, M.H.; Zom, R.L.G.; Valk, H.

2002-01-01

The discrepancy between the estimated feeding value of fresh grass and the output per kg grass in terms of milk and maintenance was studied by evaluating 12 experiments with grass-fed dairy cows. The percentage grass in the diets varied between 40 and 90. Intake and milk production were recorded

Seasonal responses of six Poaceae to differential levels of solar UV-B radiation

International Nuclear Information System (INIS)

Deckmyn, G.; Impens, I.

1999-01-01

The effects of changes in solar UV-B on the growth and pigmentation of six grass species from cold-temperate grasslands (Lolium perenne, Lolium multiflorum, Festuca arundinacea, Festuca rubra, Phleum pratense and Dactylis glomerata) in spring and summer were studied. The grasses were grown in greenhouses with different foils, resulting in three treatments: no UV-B, 80% of ambient and 90% of ambient UV-BBE (biologically effective UV-B). The results indicated important effects of ambient UV-B levels on grass, but the different species reacted in very different ways. Both morphology and biomass production were influenced by UV-B in some species. However, changes in biomass production did not necessarily occur within the same species as changes in morphology. The grasses were more sensitive in summer. Overall, only F. rubra was positively influenced by UV-B under all circumstances. The biomass of D. glomerata and L. perenne was reduced by UV-B in spring and summer. Morphological changes included reduced height and increased tillering. The sensitivity of the different species was partially explained by their ability to reduce their specific leaf area in response to UV-B. Only the more sensitive species showed increased production of protective pigments. Overall, there were important differences between the effect of a low level of UV-B, and the further increase in UV-B, indicating that several mechanisms are operating at different light levels. (author)

Short-term effects of airborne pollens on asthma attacks as seen by general practitioners in the Greater Paris area, 2003-2007.

Science.gov (United States)

Huynh, Bich Tram; Tual, Séverine; Turbelin, Clément; Pelat, Camille; Cecchi, Lorenzo; D'Amato, Gennaro; Blanchon, Thierry; Annesi-Maesano, Isabella

2010-09-01

To investigate for the first time the short-term effects of airborne pollen counts on general practitioner (GP) consultations for asthma attacks in the Greater Paris area between 2003-2007. Counts were available for common pollens (Betula, Cupressa, Fraxinus and Poaceae). Weekly data on GP visits for asthma attacks were obtained from the French GP Sentinel Network. A quasi-Poisson regression with generalised additive models was implemented. Short-term effects of pollen counts were assessed using single and multi-pollen models after adjustment for air pollution and influenza. A mean weekly incidence rate of 25.4 cases of asthma attacks per 100,000 inhabitants was estimated during the study period. The strongest significant association between asthma attacks and pollen counts was registered for grass (Poaceae) in the same week of asthma attacks, with a slight reduction of the effect observed in the multi-pollen model. Adjusted relative risk for Poaceae was 1.54 (95% CI: 1.33-1.79) with an inter-quartile range increase of 17.6 grains/m3 during the pollen season. For the first time, a significant short-term association was observed between Poaceae pollen counts and consultations for asthma attacks as seen by GPs. These findings need to be confirmed by more consistent time-series and investigations on a daily basis.

The Potential of Cellulosic Ethanol Production from Grasses in Thailand

Directory of Open Access Journals (Sweden)

Jinaporn Wongwatanapaiboon

2012-01-01

Full Text Available The grasses in Thailand were analyzed for the potentiality as the alternative energy crops for cellulosic ethanol production by biological process. The average percentage composition of cellulose, hemicellulose, and lignin in the samples of 18 types of grasses from various provinces was determined as 31.85–38.51, 31.13–42.61, and 3.10–5.64, respectively. The samples were initially pretreated with alkaline peroxide followed by enzymatic hydrolysis to investigate the enzymatic saccharification. The total reducing sugars in most grasses ranging from 500–600 mg/g grasses (70–80% yield were obtained. Subsequently, 11 types of grasses were selected as feedstocks for the ethanol production by simultaneous saccharification and cofermentation (SSCF. The enzymes, cellulase and xylanase, were utilized for hydrolysis and the yeasts, Saccharomyces cerevisiae and Pichia stipitis, were applied for cofermentation at 35°C for 7 days. From the results, the highest yield of ethanol, 1.14 g/L or 0.14 g/g substrate equivalent to 32.72% of the theoretical values was obtained from Sri Lanka ecotype vetiver grass. When the yields of dry matter were included in the calculations, Sri Lanka ecotype vetiver grass gave the yield of ethanol at 1,091.84 L/ha/year, whereas the leaves of dwarf napier grass showed the maximum yield of 2,720.55 L/ha/year (0.98 g/L or 0.12 g/g substrate equivalent to 30.60% of the theoretical values.

Changes in salt-marsh carabid assemblages after an invasion by the native grass Elymus athericus (Link Kerguélen

Directory of Open Access Journals (Sweden)

Anita Georges

2011-05-01

Full Text Available As a result of an invasion by the native grass Elymus athericus (Link Kerguélen (Poaceae in the last 10 years, a major change in vegetation cover has occurred in salt marshes of the Mont Saint-Michel bay, Western France. The impact of such an invasion on carabid assemblages, a dominant group of terrestrial arthropods in these habitats and containing several stenotopic species, is investigated here. In our study site, carabid data are available from 1983 and 1984, allowing a comparison of species distribution ranges in salt marshes before (1983–1984 and after (2002 the E. athericus invasion. A total of 16,867 adults belonging to 40 species were caught. By considering the presence-absence of species shared between studies, we show that the invasion by E. athericus promoted the progression of non-coastal species (mainly Pterostichus s.l. spp.. This did however not interfere with resident species distributions, finally resulting in higher carabid species richness in the entire area. The species composition and abundances of carabid assemblages were also compared between natural and invaded stations in 2002. The main result is that abundances of some halophilic species decreased in one invaded plot (in case of Pogonus chalceus (Marsham 1802 whereas the opposite pattern was observed for other species (e.g., Bembidion minimum (Fabricius 1792. Invaded habitats were characterized by lower percentages of halophilic species and higher total species richness.

Two new species of scale insects (Hemiptera, Coccoidea from Sardinia (Italy with a check list of Sardinian Coccoidea

Directory of Open Access Journals (Sweden)

Giuseppina Pellizzari

2011-09-01

Full Text Available Two new species of scale insects collected in Sardinia (Italy are described and illustrated: Spinococcus giuliae sp. n. (Pseudococcidae off the roots of Umbilicus rupestris (Crassulaceae and Micrococcus sardous sp. n. (Micrococcidae off the root of an undetermined grass (Poaceae growing near the sea. A n identification key to Micrococcus species and a revised list of the scales presently known in the island are also provided.

In Silico and Fluorescence In Situ Hybridization Mapping Reveals Collinearity between the Pennisetum squamulatum Apomixis Carrier-Chromosome and Chromosome 2 of Sorghum and Foxtail Millet

OpenAIRE

Sapkota, Sirjan; Conner, Joann A.; Hanna, Wayne W.; Simon, Bindu; Fengler, Kevin; Deschamps, St?phane; Cigan, Mark; Ozias-Akins, Peggy

2016-01-01

Apomixis, or clonal propagation through seed, is a trait identified within multiple species of the grass family (Poaceae). The genetic locus controlling apomixis in Pennisetum squamulatum (syn Cenchrus squamulatus) and Cenchrus ciliaris (syn Pennisetum ciliare, buffelgrass) is the apospory-specific genomic region (ASGR). Previously, the ASGR was shown to be highly conserved but inverted in marker order between P. squamulatum and C. ciliaris based on fluorescence in situ hybridization (FISH) a...

Perennial Grass Bioenergy Cropping on Wet Marginal Land

NARCIS (Netherlands)

Das, Srabani; Teuffer, Karin; Stoof, Cathelijne R.; Walter, Michael F.; Walter, M.T.; Steenhuis, Tammo S.; Richards, Brian K.

2018-01-01

The control of soil moisture, vegetation type, and prior land use on soil health parameters of perennial grass cropping systems on marginal lands is not well known. A fallow wetness-prone marginal site in New York (USA) was converted to perennial grass bioenergy feedstock production. Quadruplicate

Tensile fracture properties of seven tropical grasses at different phenological stages

NARCIS (Netherlands)

Jacobs, A.A.A.; Scheper, J.A.; Benvenutti, M.A.; Gordon, I.J.; Poppi, D.P.; Elgersma, A.

2011-01-01

The intake of forage grasses by grazing ruminants is closely related to the mechanical fracture properties of grasses. The relationship between the tensile fracture properties of grasses and foraging behaviour is of particular importance in tropical reproductive swards composed of both stems and

How much gas can we get from grass?

International Nuclear Information System (INIS)

Nizami, A.S.; Orozco, A.; Groom, E.; Dieterich, B.; Murphy, J.D.

2012-01-01

Highlights: ► We highlight the various results for biomethane potential that may be obtained from the same grass silage. ► The results indicated that methane potential varied from 350 to 493 L CH 4 kg −1 VS added for three different BMP procedures. ► We compare two distinct digestion systems using the same grass. ► A two stage wet system achieved 451 L CH 4 kg −1 VS added over a 50 day retention period. ► A two phase system achieved 341 L CH 4 kg −1 VS added at a 30 day retention time. -- Abstract: Grass biomethane has been shown to be a sustainable gaseous transport biofuel, with a good energy balance, and significant potential for economic viability. Of issue for the designer is the variation in characteristics of the grass depending on location of source, time of cut and species. Further confusion arises from the biomethane potential tests (BMP) which have a tendency to give varying results. This paper has dual ambitions. One of these is to highlight the various results for biomethane potential that may be obtained from the same grass silage. The results indicated that methane potential from the same grass silage varied from 350 to 493 L CH 4 kg −1 VS added for three different BMP procedures. The second ambition is to attempt to compare two distinct digestion systems again using the same grass: a two stage continuously stirred tank reactor (CSTR); and a sequentially fed leach bed reactor connected to an upflow anaerobic sludge blanket (SLBR–UASB). The two engineered systems were designed, fabricated, commissioned and operated at small pilot scale until stable optimal operating conditions were reached. The CSTR system achieved 451 L CH 4 kg −1 VS added over a 50 day retention period. The SLBR–UASB achieved 341 L CH 4 kg −1 VS added at a 30 day retention time.

Effects of rye grass coverage on soil loss from loess slopes

Directory of Open Access Journals (Sweden)

Yuequn Dong

2015-09-01

Full Text Available Vegetative coverage is commonly used to reduce urban slope soil erosion. Laboratory experimental study on soil erosion under grass covered slopes is conventionally time and space consuming. In this study, a new method is suggested to study the influences of vegetation coverage on soil erosion from a sloped loess surface under three slope gradients of 5°, 15°, and 25°; four rye grass coverages of 0%, 25%, 50%, and 75%; and three rainfall intensities of 60, 90, and 120 mm/h with a silt-loamy loess soil. Rye grasses were planted in the field with the studied soil before being transplanted into a laboratory flume. Grass was allowed to resume growth for a period before the rain simulation experiment. Results showed that the grass cover reduced soil erosion by 63.90% to 92.75% and sediment transport rate by 80.59% to 96.17% under different slope gradients and rainfall intensities. The sediment concentration/sediment transport rate from bare slope was significantly higher than from a grass-covered slope. The sediment concentration/transport rate from grass-covered slopes decreased linearly with grass coverage and increased with rainfall intensity. The sediment concentration/transport rate from the bare slope increased as a power function of slope and reached the maximum value at the gradient of about 25°, whereas that from grass-covered slope increased linearly and at much lower levels. The results of this study can be used to estimate the effect of vegetation on soil erosion from loess slopes.

Seasonal variation in diurnal atmospheric grass pollen concentration profiles

DEFF Research Database (Denmark)

Peel, Robert George; Ørby, Pia Viuf; Skjøth, Carsten Ambelas

2014-01-01

the time of day when peak concentrations are most likely to occur using seasonally averaged diurnal profiles. Atmospheric pollen loads are highly dependent upon emissions, and different species of grass are known to flower and emit pollen at different times of the day and during different periods......In this study, the diurnal atmospheric grass pollen concentration profile within the Danish city of Aarhus was shown to change in a systematic manner as the pollen season progressed. Although diurnal grass pollen profiles can differ greatly from day-to-day, it is common practice to establish...... of the pollen season. Pollen concentrations are also influenced by meteorological factors - directly through those parameters that govern pollen dispersion and transport, and indirectly through the weather-driven flowering process. We found that three different profiles dominated the grass pollen season...

Response of itchgrass and johnson grass to asulam/dalapon combinations

International Nuclear Information System (INIS)

Hook, B.J.

1986-01-01

Activities of asumlam [methyl[(4-aminophenyl)sulfonyl]carbamate], dalapon (2,2-dichloropropionic acid) and asulam/dalapon combinations on itchgrass (Rottboellia exaltata L.f.) and johnson grass [Sorghum halepense (L.) Pers.] were examined. When metabolism of 14 C-asulam was monitored, seven days after application, 97-100% of recovered 14 C co-chromatographed with 14 C-asulam. Itchgrass exhibited rapid uptake of 14 C-asulam within 8 hr after application. Asumlam concentrations remained constant in the plant between 8 and 72 hr. Johnson grass plants showed a differential response to asulam and asulam/dalapon treatments. Asulam-treated johnson grass absorbed 26-34% 14 C within 2 hr with no future significant increase in absorption in absorption through 72 hr. Treatment of johnson grass with asulam/dalapon enhanced 14 C absorption with time. At 24 and 72 hr 14 C levels were double that absorbed from treatment of asulam alone. Movement of 14 C-asulam in the apoplast and symplast of both itchgrass and johnson grass was noted. The highest radiolabel accumulated in the lower leaves of itchgrass and remained in the treated leaf of johnson grass

Native Grass Community Management Plan for the Oak Ridge Reservation

Energy Technology Data Exchange (ETDEWEB)

Ryon, Michael G [ORNL; Parr, Patricia Dreyer [ORNL; Cohen, Kari [ORNL

2007-06-01

Land managers at the Department of Energy's Oak Ridge National Laboratory in East Tennessee are restoring native warm-season grasses and wildflowers to various sites across the Oak Ridge Reservation (ORR). Some of the numerous benefits to planting native grasses and forbs include improved habitat quality for wildlife, improved aesthetic values, lower long-term maintenance costs, and compliance with Executive Order 13112 (Clinton 1999). Challenges to restoring native plants on the ORR include the need to gain experience in establishing and maintaining these communities and the potentially greater up-front costs of getting native grasses established. The goals of the native grass program are generally outlined on a fiscal-year basis. An overview of some of the issues associated with the successful and cost-effective establishment and maintenance of native grass and wildflower stands on the ORR is presented in this report.

Reversing land degradation through grasses: a systematic meta-analysis in the Indian tropics

Science.gov (United States)

Mandal, Debashis; Srivastava, Pankaj; Giri, Nishita; Kaushal, Rajesh; Cerda, Artemi; Meherul Alam, Nurnabi

2017-02-01

Although intensive agriculture is necessary to sustain the world's growing population, accelerated soil erosion contributes to a decrease in the environmental health of ecosystems at local, regional and global scales. Reversing the process of land degradation using vegetative measures is of utmost importance in such ecosystems. The present study critically analyzes the effect of grasses in reversing the process of land degradation using a systematic review. The collected information was segregated under three different land use and land management situations. Meta-analysis was applied to test the hypothesis that the use of grasses reduces runoff and soil erosion. The effect of grasses was deduced for grass strip and in combination with physical structures. Similarly, the effects of grasses were analyzed in degraded pasture lands. The overall result of the meta-analysis showed that infiltration capacity increased approximately 2-fold after planting grasses across the slopes in agricultural fields. Grazing land management through a cut-and-carry system increased conservation efficiencies by 42 and 63 % with respect to reduction in runoff and erosion, respectively. Considering the comprehensive performance index (CPI), it has been observed that hybrid Napier (Pennisetum purpureum) and sambuta (Saccharum munja) grass seem to posses the most desirable attributes as an effective grass barrier for the western Himalayas and Eastern Ghats, while natural grass (Dichanthium annulatum) and broom grass (Thysanolaena maxima) are found to be most promising grass species for the Konkan region of the Western Ghats and the northeastern Himalayan region, respectively. In addition to these benefits, it was also observed that soil carbon loss can be reduced by 83 % with the use of grasses. Overall, efficacy for erosion control of various grasses was more than 60 %; hence, their selection should be based on the production potential of these grasses under given edaphic and agro

Grass genomes

OpenAIRE

Bennetzen, Jeffrey L.; SanMiguel, Phillip; Chen, Mingsheng; Tikhonov, Alexander; Francki, Michael; Avramova, Zoya

1998-01-01

For the most part, studies of grass genome structure have been limited to the generation of whole-genome genetic maps or the fine structure and sequence analysis of single genes or gene clusters. We have investigated large contiguous segments of the genomes of maize, sorghum, and rice, primarily focusing on intergenic spaces. Our data indicate that much (>50%) of the maize genome is composed of interspersed repetitive DNAs, primarily nested retrotransposons that in...

Anaerobic co-digestion of sewage sludge with shredded grass from public green spaces.

Science.gov (United States)

Hidaka, Taira; Arai, Sayuri; Okamoto, Seiichiro; Uchida, Tsutomu

2013-02-01

Adding greenery from public spaces to the co-digestion process with sewage sludge was evaluated by shredding experiments and laboratory-scale batch and continuous mesophilic anaerobic fermentation experiments. The ratio of the shredded grass with 20mm or less in length by a commercially available shredder was 93%. The methane production was around 0.2NL/gVS-grass in the batch experiment. The continuous experiment fed with sewage sludge and shredded grass was stably operated for 81days. The average methane production was 0.09NL/gVS-grass when the TS ratio of the sewage sludge and the grass was 10:1. This value was smaller than those of other reports using grass silage, but the grass species in this study were not managed, and the collected grass was just shredded and not ensiled before feeding to the reactor for simple operation. The addition of grass to a digester can improve the carbon/nitrogen ratio, methane production and dewaterability. Copyright © 2013 Elsevier Ltd. All rights reserved.

Characterization and multiplexing of EST-SSR primers in Cynodon (Poaceae) species1.

Science.gov (United States)

Jewell, Margaret C; Frere, Celine H; Prentis, Peter J; Lambrides, Christopher J; Godwin, Ian D

2010-10-01

Cynodon species are multiple-use grasses that display varying levels of adaptation to biotic and abiotic stress. Previously identified EST-SSR primers were characterized and multiplexed to assess the level of genetic diversity present within a collection of almost 1200 Cynodon accessions from across Australia. • Two multiplex reactions were developed comprising a total of 16 EST-SSR markers. All SSR markers amplified across different Cynodon species and different levels of ploidy. The number of alleles ranged from one to eight per locus and the total number of alleles for the germplasm collection was 79. • The 16 markers show sufficient variation for the characterization of Cynodon core collections and analysis of population genetic diversity in Cynodon grasses.

Assessment of some macromineral concentration of a grass/ legume ...

African Journals Online (AJOL)

Assessment of some macromineral concentration of a grass/ legume sward in ... Bulletin of Animal Health and Production in Africa ... The study aimed to determine the concentration of some macromineral elements in the grass/legume pasture ...

Environmental performance assessment of Napier grass for bioenergy production

DEFF Research Database (Denmark)

Nimmanterdwong, Prathana; Chalermsinsuwan, Benjapon; Østergård, Hanne

2017-01-01

equivalence. This idea provides the quantitative indicators involving the resource use and the percent renewability of the systems. For the proposed biorefinery model, Napier grass (Pennisetum purpureum) grown in Thailand was used as lignocellulosic feedstock. An emergy assessment was performed in two parts...... cultivation and biorefinery stages. For Napier grass cultivation, most of the emergy support came from local resources in term of evapotranspiration of Napier grass (33%) and the diesel consumption during the cultivation process (21%). The emergy sustainability indicator of the cultivation was 0...

Small mammal use of native warm-season and non-native cool-season grass forage fields

Science.gov (United States)

Ryan L Klimstra,; Christopher E Moorman,; Converse, Sarah J.; Royle, J. Andrew; Craig A Harper,

2015-01-01

Recent emphasis has been put on establishing native warm-season grasses for forage production because it is thought native warm-season grasses provide higher quality wildlife habitat than do non-native cool-season grasses. However, it is not clear whether native warm-season grass fields provide better resources for small mammals than currently are available in non-native cool-season grass forage production fields. We developed a hierarchical spatially explicit capture-recapture model to compare abundance of hispid cotton rats (Sigmodon hispidus), white-footed mice (Peromyscus leucopus), and house mice (Mus musculus) among 4 hayed non-native cool-season grass fields, 4 hayed native warm-season grass fields, and 4 native warm-season grass-forb ("wildlife") fields managed for wildlife during 2 summer trapping periods in 2009 and 2010 of the western piedmont of North Carolina, USA. Cotton rat abundance estimates were greater in wildlife fields than in native warm-season grass and non-native cool-season grass fields and greater in native warm-season grass fields than in non-native cool-season grass fields. Abundances of white-footed mouse and house mouse populations were lower in wildlife fields than in native warm-season grass and non-native cool-season grass fields, but the abundances were not different between the native warm-season grass and non-native cool-season grass fields. Lack of cover following haying in non-native cool-season grass and native warm-season grass fields likely was the key factor limiting small mammal abundance, especially cotton rats, in forage fields. Retention of vegetation structure in managed forage production systems, either by alternately resting cool-season and warm-season grass forage fields or by leaving unharvested field borders, should provide refugia for small mammals during haying events.

The dehydration stress of couch grass is associated with its lipid metabolism, the induction of transporters and the re-programming of development coordinated by ABA.

Science.gov (United States)

Janská, Anna; Svoboda, Pavel; Spiwok, Vojtěch; Kučera, Ladislav; Ovesná, Jaroslava

2018-05-02

The wild relatives of crop species represent a potentially valuable source of novel genetic variation, particularly in the context of improving the crop's level of tolerance to abiotic stress. The mechanistic basis of these tolerances remains largely unexplored. Here, the focus was to characterize the transcriptomic response of the nodes (meristematic tissue) of couch grass (a relative of barley) to dehydration stress, and to compare it to that of the barley crown formed by both a drought tolerant and a drought sensitive barley cultivar. Many of the genes up-regulated in the nodes by the stress were homologs of genes known to be mediated by abscisic acid during the response to drought, or were linked to either development or lipid metabolism. Transporters also featured prominently, as did genes acting on root architecture. The resilience of the couch grass node arise from both their capacity to develop an altered, more effective root architecture, but also from their formation of a lipid barrier on their outer surface and their ability to modify both their lipid metabolism and transporter activity when challenged by dehydration stress. Our analysis revealed the nature of dehydration stress response in couch grass. We suggested the tolerance is associated with lipid metabolism, the induction of transporters and the re-programming of development coordinated by ABA. We also proved the applicability of barley microarray for couch grass stress-response analysis.

Allelopathic activity of some grass species on Phleum pratense seed germination subject to their density

Directory of Open Access Journals (Sweden)

Halina Lipińska

2012-12-01

Full Text Available Efficient utilization of allelopathy in the agricultural practice requires searching for some species and developmental stages when the allelopathic substances are generated in bioactive concentrations. That also requires the knowledge of allelopathy mechanisms and primarily its separation from the other aspects of plant activity, mainly from competition for environmental resources. This task, however, has remained vital in the studies on plant interference, being extremely difficult to perform under field conditions. Therefore, the studies were conducted in the laboratory. To determine the activity of an allelopathic agent of the selected grass species, the density dependent phytotoxicity model was employed. The model is based on the fact that an increase of acceptor plants density evokes a decrease of their response to the allelopathic compounds, whereas the negative effects of the competition become more intense. A higher rate of acceptor plants growth accompanying their density increase in the given object does not agree with the competition rules and thus, it may imply an allelopathic background of the observed changes. In the presented studies, the allelopathic properties of grasses - donors were evaluated by studying the effect of two densities of the emerging seeds and two- and four weeks aged seedlings of F. arundinacea, L. multiflorum, L. perenne and P. pratensis. The tested species - acceptor Ph. pratensis was sown in the density of 10 and 20 seeds in a pan. The results revealed that the germination of acceptor seeds was differentiated depending on their density in the pan, and on the species, density and the age of the donor. Inhibition of Ph. pratense seed germination in objects with a lover density may prove allelopathic effects of the studied donor grasses.

Impact on Clover-Grass Yield from Wheel Load and Tyre Pressure

DEFF Research Database (Denmark)

Green, Ole; Jørgensen, Rasmus Nyholm; Sørensen, Claus Aage Grøn

2009-01-01

Traffic intensities have been shown to have a negative influence on the yield of grass and clover. A full scale grass-clover field trial was established to estimate the effect on clover-grass yields as a function of different wheel loads and tire pressures. The trial comprised 16 different traffi...

Symbolic logic and mechanical theorem proving

CERN Document Server

Chang, Chin-Liang

1969-01-01

This book contains an introduction to symbolic logic and a thorough discussion of mechanical theorem proving and its applications. The book consists of three major parts. Chapters 2 and 3 constitute an introduction to symbolic logic. Chapters 4-9 introduce several techniques in mechanical theorem proving, and Chapters 10 an 11 show how theorem proving can be applied to various areas such as question answering, problem solving, program analysis, and program synthesis.

Identification of grazed grasses using epidermal characters | R ...

African Journals Online (AJOL)

The use of anatomical features of the abaxial epidermis of grasses is discussed for the identification of fragments of epidermis present in samples of rumen. The reliability of this technique, and the variation of the epidermal characters in two widely distributed species of grass, is given. A "Key" to identity certain genera of ...

Rehabilitation experiment by phytoremediation using lawn grass

International Nuclear Information System (INIS)

2012-08-01

Measures against environmental contamination by radioactive materials originated from the Fukushima Nuclear Accident (May, 2011), are being conducted in Fukushima and surrounding prefectures. Regarding to the measures, a phytoremediation experiment with several types of lawn grasses in a field scale have been carried out. Lawn grasses are generally characterized by shallow rhizosphere, high density and root mat formation. Decontamination effectiveness of radioactive cesium by plant uptake and by sod removing was investigated. As a result, the range of decontamination factors by plant uptake was below than 1% because of low transfer rate form soil to plant. On the other hand, maximum decontamination factor by sod removing reached about 100%. Decontamination activities with various methods will be implemented according to the national decontamination policy and related plans in each municipality. The phytoremediation method with lawn grass would be applicable in limited circumstances. (author)

Ecological genetics of floret mass variation in Bromus tectorum (Poaceae)

Science.gov (United States)

Susan E. Meyer

2010-01-01

Bromus tectorum L. (cheatgrass, downy brome) is a highly invasive inbreeding annual grass that dominates millions of hectares of former shrubland in interior western North America. Factors contributing to its success include strong genetic regulation of key adaptive traits coupled with high phenotypic plasticity in response to resource availability (Meyer and Allen...

Turbulent transfer characteristics of radioiodine effluents from air to grass

Energy Technology Data Exchange (ETDEWEB)

Markee, E. H. [ARFRO, Environmental Science Services Administration, Idaho Falls, Idaho (United States)

1967-07-01

A total of 20 controlled field releases of radioiodine have been performed at the National Reactor Testing Station in Idaho as a portion of a program to study the transmission of gaseous radioiodine through the air-vegetation-cow-milk-human chain. Most of the releases were conducted over typical pasture grasses during different wind and stability conditions. Radioiodine adherence to grass and carbon plates was measured during most of the tests. Vertical air concentration profiles and turbulence parameters were measured to determine flux characteristics. Analysis of the data reveals the complex interdisciplinary nature of transfer of radioiodine from air to a natural surface. The data are in reasonable agreement with the deposition models of Sheppard and Chamberlain when corrections for the physical and biological receptiveness of the grass and grass density are made. The average ratios of momentum to mass flux were found to be 0.9 in stable conditions and 1.4 in unstable conditions. These ratios demonstrate the effect on mass flux in the lowest 4m by a surface that acts as a partial sink for gaseous effluents. This series of releases indicates the need for further research on the biological receptiveness of grass and turbulent transfer within a grass canopy. (author)

Determination of protein and carbohydrate fractions of Cynodon grasses in different cut age Determinação das frações de proteína e de carboidratos de gramíneas do gênero Cynodon em idades ao corte

Directory of Open Access Journals (Sweden)

Geane Dias Gonçalves

2001-05-01

Full Text Available Three Cynodon grasses (Poaceae (Tifton 85, Tifton 44 and Coast-cross harvested at ages 21, 42 and 63 days in the summer were evaluated for protein and carbohydrate fractions composition. Crude protein was divided into 5 fractions: A (non-protein nitrogen, B1 (soluble protein with fast rumen degradability, B2 (insoluble protein with intermediate rumen degradability, B3 (insoluble protein with slow rumen degradability and C (indigestible protein. Carbohydrates were divided into 3 fractions: A + B1 (fast and intermediate rumen digestibility, B2 (slow rumen digestibility and C (indigestible fiber. Experimental design consisted of a split-plot (grasses as plots and cut age as sub-plots with three repetitions. Cut age was analyzed by regression and models were chosen on the analysis of identity. There were no differences (p> 0,05 among grasses with regard to protein and carbohydrate fractions composition. C fraction of protein showed linear increase (p 1 fraction decreased (p 2 and C fractions increased (p O experimento teve por objetivos quantificar as frações de proteína e de carboidratos de três cultivares de Cynodon (Poaceae (Tifton 85, Tifton 44 e Coast-cross, colhidos com idades ao corte de 21, 42 e 63 dias no verão. Para a proteína bruta (PB, determinou-se a fração A (nitrogênio não-protéico, fração B1 (proteína solúvel de rápida degradabilidade no rúmen, fração B2 (proteína insolúvel com taxa de degradação intermediária, fração B3 (proteína com taxa de degradação lenta e fração C (proteína indigestível. Para os carboidratos, determinaram-se as frações A+B1 (frações de rápida e média degradação ruminal, fração B2 (fração lentamente degradada no rúmen e a fração C (carboidratos não digeríveis no rúmen. Utilizou-se o delineamento experimental de parcelas subdivididas (cultivares como parcelas e idade ao corte como subparcelas com três repetições. Para o fator idade ao corte, foi usada regress

Change Detection with GRASS GIS – Comparison of images taken by different sensors

Directory of Open Access Journals (Sweden)

Michael Fuchs

2009-04-01

Full Text Available Images of American military reconnaissance satellites of the Sixties (CORONA in combination with modern sensors (SPOT, QuickBird were used for detection of changes in land use. The pilot area was located about 40 km northwest of Yemen’s capital Sana’a and covered approximately 100 km2 . To produce comparable layers from images of distinctly different sources, the moving window technique was applied, using the diversity parameter. The resulting difference layers reveal plausible and interpretable change patterns, particularly in areas where urban sprawl occurs.The comparison of CORONA images with images taken by modern sensors proved to be an additional tool to visualize and quantify major changes in land use. The results should serve as additional basic data eg. in regional planning.The computation sequence was executed in GRASS GIS.

Sources of N2O in organic grass-clover pastures

OpenAIRE

Ambus, P.

2002-01-01

Organic farming practises, and in particular dairy production systems based on grass-clover pastures are becoming increasingly abundant within Danish agriculture. Grass-clover pastures may provide a mitigation option to reduce grassland nitrous oxide (N2O) emissions (Velthof et al. 1998). The objectives of this work was to examine the relationship between N2O emissions and transformations of inorganic N in organically managed grass-clover pastures of different ages. Results from the projec...

Management techniques for the control of Melinis minutiflora P. Beauv. (molasses grass: ten years of research on an invasive grass species in the Brazilian Cerrado

Directory of Open Access Journals (Sweden)

Carlos Romero Martins

2017-09-01

Full Text Available ABSTRACT The invasion of exotic species is considered to be a major threat to the preservation of biodiversity. In the Parque Nacional de Brasília (National Park of Brasília, the invasive Melinis minutiflora (molasses grass occupies more than 10 % of the area of the park. The present, long-term, study compared two treatments of exposure to molasses grass: 1 fire and 2 integrated management (fire + herbicide sprays + manual removal. The aerial biomass of molasses grass in the experimental area initially represented ca. 55 % of the total aerial biomass, a percentage that apparently did not influence native plant species richness at this site. Fire alone was not sufficient to control molasses grass, which attained its pre-treatment biomass values after two years. Integrated management reduced, and maintained, biomass to less than 1 % of its original value after ten years, and maintained this level throughout the study, demonstrating that it is a promising strategy for the recovery of areas invaded by molasses grass in the Cerrado. However, because of the recolonization by molasses grass, long-term monitoring efforts are targeting outbreaks, which would require immediate intervention in order to maintain the native biological diversity of the region.

Padrão de resposta de Mimosa pudica e Senna obtusifolia à atividade potencialmente alelopática de espécies de Poaceae Response pattern of Mimosa pudica e Senna obtusifolia to potentially allelopathic activity of Poaceae species

Directory of Open Access Journals (Sweden)

A.P.S. Souza Filho

2010-01-01

Full Text Available A alelopatia é um importante mediador de interferências que alteram a dinâmica de espécies de plantas em sistemas agrícolas. Neste trabalho, procurou-se determinar a existência de padrão de respostas das plantas daninhas Mimosa pudica e Senna obtusifolia a espécies da família Poaceae, via interação entre espécies e frações e ordenamento dos efeitos. Bioensaios de germinação de sementes e alongamento da radícula e do hipocótilo foram desenvolvidos, em condições controladas. Os testes foram realizados utilizando-se extratos hidroalcoólicos na concentração de 1,0% das frações folha, raiz e sementes de quatro espécies de Poaceae. Diferenças na intensidade dos efeitos para os fatores espécie e fração foram verificadas. O padrão de atividade observado foi de Paspalum maritimum apresentar as inibições mais intensas. Entre as espécies de Brachiaria, as inibições mais intensas foram produzidas por B. brizantha. Houve resposta efetiva para a especificidade entre espécies e fração para a germinação e alongamento da radícula, especialmente na espécie Mimosa pudica. Apenas para os extratos de P. maritimum foram observadas especificidade e efetividade em relação à germinação de sementes e alongamento da radícula da espécie Senna obtusifolia. A fração folha foi mais efetiva nas inibições, sobretudo na espécie P. maritimum. Comparativamente, a espécie Mimosa pudica foi mais sensível aos efeitos dos extratos, especialmente em relação ao desenvolvimento da radícula e do hipocótilo. A intensidade dos efeitos alelopáticos variou na seguinte ordem: alongamento da radícula > germinação de sementes > alongamento do hipocótilo. A ordenação dos resultados, para os indicadores de inibição, indicou discriminação no padrão para as espécies receptoras, o que sugere especificidade dos extratos.Allelopathy is an important device to measure interferences affecting the dynamics of plant species in

Nowcasting daily minimum air and grass temperature

Science.gov (United States)

Savage, M. J.

2016-02-01

Site-specific and accurate prediction of daily minimum air and grass temperatures, made available online several hours before their occurrence, would be of significant benefit to several economic sectors and for planning human activities. Site-specific and reasonably accurate nowcasts of daily minimum temperature several hours before its occurrence, using measured sub-hourly temperatures hours earlier in the morning as model inputs, was investigated. Various temperature models were tested for their ability to accurately nowcast daily minimum temperatures 2 or 4 h before sunrise. Temperature datasets used for the model nowcasts included sub-hourly grass and grass-surface (infrared) temperatures from one location in South Africa and air temperature from four subtropical sites varying in altitude (USA and South Africa) and from one site in central sub-Saharan Africa. Nowcast models used employed either exponential or square root functions to describe the rate of nighttime temperature decrease but inverted so as to determine the minimum temperature. The models were also applied in near real-time using an open web-based system to display the nowcasts. Extrapolation algorithms for the site-specific nowcasts were also implemented in a datalogger in an innovative and mathematically consistent manner. Comparison of model 1 (exponential) nowcasts vs measured daily minima air temperatures yielded root mean square errors (RMSEs) <1 °C for the 2-h ahead nowcasts. Model 2 (also exponential), for which a constant model coefficient ( b = 2.2) was used, was usually slightly less accurate but still with RMSEs <1 °C. Use of model 3 (square root) yielded increased RMSEs for the 2-h ahead comparisons between nowcasted and measured daily minima air temperature, increasing to 1.4 °C for some sites. For all sites for all models, the comparisons for the 4-h ahead air temperature nowcasts generally yielded increased RMSEs, <2.1 °C. Comparisons for all model nowcasts of the daily grass

Study of the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal

OpenAIRE

Diop, Serigne Mbacké; Guèye, Momar Talla; Ndiaye, Ibrahima; Diop, Michel Bakar; Ndiaye, El Hadji Barka; Thiam, Abdoulaye; Fauconnier, Marie-Laure; Lognay, Georges

2017-01-01

This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried out by GC/FID and GC/MS. Oils from Dakar were dominated by geranial which represented 46.0-43.9%, neral 31.8-31.0%, myrcene 10.8-11.7% and geraniol 2.7-4.2% in the fresh and d...

Autopolyploids in fodder grass breeding: induction and field performance

Energy Technology Data Exchange (ETDEWEB)

Dabkevičienė, G.; Kemešytė, V.; Statkevičiūtė, G.; Lemežienė, N.; Brazauskas, G.

2017-07-01

Doubling of chromosome set directly affects plant performance through increase of organ size, higher feeding value and increased resistance to adverse environmental factors. Therefore efficient methods of polyploid induction are needed in order to develop new varieties of naturally diploid fodder grass species. The efficiency of antimitotic agents as colchicine, amiprophos-methyl, trifluralin and oryzalin was compared in a series of tetraploid induction experiments in Lolium multiflorum, L. perenne and Festuca pratensis, while newly developed tetraploid plants were compared to standard tetraploid varieties in the field trials. Colchicine treatment proved to be the most efficient method for in vitro cultured embryos in comparison with the other agents. Induced tetraploids of F. pratensis produced higher dry matter and seed yield and could be used for the development of new varieties. Induced tetraploid plants of Lolium spp. were equal to the standard varieties in field trials, therefore they could be used as parental genotypes in crosses. Induced tetraploids of F. pratensis produced higher dry matter and seed yield and could be used for development of new variety.

Effects of conventional and grass-feeding systems on the nutrient composition of beef.

Science.gov (United States)

Leheska, J M; Thompson, L D; Howe, J C; Hentges, E; Boyce, J; Brooks, J C; Shriver, B; Hoover, L; Miller, M F

2008-12-01

The objectives of this study were to determine the nutrient composition of grass-fed beef in the United States for inclusion in the USDA National Nutrient Database for Standard Reference, and to compare the fatty acid composition of grass-fed and conventionally fed (control) beef. Ground beef (GB) and strip steaks (SS) were collected on 3 separate occasions from 15 grass-fed beef producers that represented 13 different states, whereas control beef samples were collected from 3 regions (Ohio, South Dakota, and Texas) of the United States on 3 separate occasions. Concentrations of minerals, choline, vitamin B(12), and thiamine were determined for grass-fed beef samples. Grass-fed GB samples had less Mg, P, and K (P < 0.05), and more Na, Zn, and vitamin B(12) (P < 0.05) than SS samples. Fat color, marbling, and pH were assessed for grass-fed and control SS. Subjective evaluation of the SS indicated that grass-fed beef had fat that was more yellow in color than control beef. Percentages of total fat, total cholesterol, and fatty acids along with trans fatty acids and CLA were determined for grass-fed and control SS and GB. Grass-fed SS had less total fat than control SS (P = 0.001), but both grass-fed and control SS were considered lean, because their total fat content was 4.3% or less. For both GB and SS, grass-fed beef had significantly less (P = 0.001 and P = 0.023, respectively) content of MUFA and a greater content of SFA, n-3 fatty acids, CLA, and trans-vaccenic acid than did the control samples. Concentrations of PUFA, trans fatty acids, n-6 fatty acids, and cholesterol did not differ between grass-fed and control ground beef. Trans-vaccenic acid (trans-11 18:1) made up the greatest concentration of the total trans fats in grass-fed beef, whereas CLA accounted for approximately 15% of the total trans fats. Although the fatty acid composition of grass-fed and conventionally fed beef was different, conclusions on the possible effects of these differences on human

Geographical distribution of present day Poaceae as evidence for the origin of African floras

Directory of Open Access Journals (Sweden)

W. D. Clayton

1983-11-01

Full Text Available The major tribes and sub-families of grasses occupy worldwide latitudinal belts, which can be related to an evolutionary sequence of climatic adaptations. However, genera tend to be confined to individual continents, suggesting that grasses do not easily cross the oceans, and that the worldwide distribution of the family may have been achieved when the continents were closer together. Species distributions are likewise strongly influenced by the effect of climatic adaptation and continental isolation, but they show a number of aberrations. These are probably a legacy of climatic disturbance during the Pleistocene.

Biogas and Methane Yield from Rye Grass

Directory of Open Access Journals (Sweden)

Tomáš Vítěz

2015-01-01

Full Text Available Biogas production in the Czech Republic has expanded substantially, including marginal regions for maize cultivation. Therefore, there are increasingly sought materials that could partially replace maize silage, as a basic feedstock, while secure both biogas production and its quality.Two samples of rye grass (Lolium multiflorum var. westerwoldicum silage with different solids content 21% and 15% were measured for biogas and methane yield. Rye grass silage with solid content of 15% reached an average specific biogas yield 0.431 m3·kg−1 of organic dry matter and an average specific methane yield 0.249 m3·kg−1 of organic dry matter. Rye grass silage with solid content 21% reached an average specific biogas yield 0.654 m3·kg−1 of organic dry matter and an average specific methane yield 0.399 m3·kg−1 of organic dry matter.

Effects of feeding dairy cows different legume-grass silages on milk phytoestrogen concentration

DEFF Research Database (Denmark)

Höjer, A; Adler, S; Purup, Stig

2012-01-01

interval of legume-grass silage on phytoestrogen intake and milk phytoestrogen concentrations. In one experiment, 15 Swedish Red dairy cows were fed 2- or 3-cut red clover-grass silage, or 2-cut birdsfoot trefoil-grass silage. In a second experiment, 16 Norwegian Red dairy cows were fed short-term ley...... red clover-grass silage diet (1,494μg/kg of milk). Because of the metabolism of biochanin A, genistein, and prunetin, their concentrations in milk and the apparent recovery were low. Coumestrol was detected in only short-term and long-term ley silage mixtures, and its milk concentration was low....... Concentrations of secoisolariciresinol and matairesinol were higher in 2-cut birdsfoot trefoil-grass and long-term ley silage mixtures, those with legume species other than red clover, and the highest grass proportions. The 2-cut birdsfoot trefoil-grass silage diet also resulted in higher enterolactone...

Results from the 5-year SQ grass sublingual immunotherapy tablet asthma prevention (GAP) trial in children with grass pollen allergy

DEFF Research Database (Denmark)

Valovirta, Erkka; Petersen, Thomas H; Piotrowska, Teresa

2018-01-01

BACKGROUND: Allergy immunotherapy targets the immunological cause of allergic rhinoconjunctivitis and allergic asthma and has the potential to alter the natural course of allergic disease. OBJECTIVE: The primary objective was to investigate the effect of the SQ grass sublingual immunotherapy tablet...... compared with placebo on the risk of developing asthma. METHODS: A total of 812 children (5-12 years), with a clinically relevant history of grass pollen allergic rhinoconjunctivitis and no medical history or signs of asthma, were included in the randomized, double-blind, placebo-controlled trial......, comprising 3 years of treatment and 2 years of follow-up. RESULTS: There was no difference in time to onset of asthma, defined by prespecified asthma criteria relying on documented reversible impairment of lung function (primary endpoint). Treatment with the SQ grass sublingual immunotherapy tablet...

A novel method to characterize silica bodies in grasses.

Science.gov (United States)

Dabney, Clemon; Ostergaard, Jason; Watkins, Eric; Chen, Changbin

2016-01-01

The deposition of silicon into epidermal cells of grass species is thought to be an important mechanism that plants use as a defense against pests and environmental stresses. There are a number of techniques available to study the size, density and distribution pattern of silica bodies in grass leaves. However, none of those techniques can provide a high-throughput analysis, especially for a great number of samples. We developed a method utilizing the autofluorescence of silica bodies to investigate their size and distribution, along with the number of carbon inclusions within the silica bodies of perennial grass species Koeleria macrantha. Fluorescence images were analyzed by image software Adobe Photoshop CS5 or ImageJ that remarkably facilitated the quantification of silica bodies in the dry ash. We observed three types of silica bodies or silica body related mineral structures. Silica bodies were detected on both abaxial and adaxial epidermis of K. macrantha leaves, although their sizes, density, and distribution patterns were different. No auto-fluorescence was detected from carbon inclusions. The combination of fluorescence microscopy and image processing software displayed efficient utilization in the identification and quantification of silica bodies in K. macrantha leaf tissues, which should applicable to biological, ecological and geological studies of grasses including forage, turf grasses and cereal crops.

Genetic engineering of grass cell wall polysaccharides for biorefining.

Science.gov (United States)

Bhatia, Rakesh; Gallagher, Joe A; Gomez, Leonardo D; Bosch, Maurice

2017-09-01

Grasses represent an abundant and widespread source of lignocellulosic biomass, which has yet to fulfil its potential as a feedstock for biorefining into renewable and sustainable biofuels and commodity chemicals. The inherent recalcitrance of lignocellulosic materials to deconstruction is the most crucial limitation for the commercial viability and economic feasibility of biomass biorefining. Over the last decade, the targeted genetic engineering of grasses has become more proficient, enabling rational approaches to modify lignocellulose with the aim of making it more amenable to bioconversion. In this review, we provide an overview of transgenic strategies and targets to tailor grass cell wall polysaccharides for biorefining applications. The bioengineering efforts and opportunities summarized here rely primarily on (A) reprogramming gene regulatory networks responsible for the biosynthesis of lignocellulose, (B) remodelling the chemical structure and substitution patterns of cell wall polysaccharides and (C) expressing lignocellulose degrading and/or modifying enzymes in planta. It is anticipated that outputs from the rational engineering of grass cell wall polysaccharides by such strategies could help in realizing an economically sustainable, grass-derived lignocellulose processing industry. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Performance of Vetiver Grass (Vetiveria zizanioides for Phytoremediation of Contaminated Water

Directory of Open Access Journals (Sweden)

Syed Hasan Sharifah Nur Munirah

2017-01-01

Full Text Available In tolerance towards metal uptake, there is a need to evaluate the performance of vetiver grass for metal removal to reduce water impurity. This study was aimed to evaluate contaminant removal by vetiver grass at varying root length and plant density and determine the metal uptake in vetiver plant biomass. Pollutant uptake of vetiver grass was conducted in laboratory experiment and heavy metal analysis was done using acid digestion and Atomic Absorption Spectrometry. Findings indicated that the removal of heavy metal was decreased in seven days of the experiment where iron shows the highest percentage (96%; 0.42 ppm of removal due to iron is highly required for growth of vetiver grass. Removal rate of heavy metals in water by vetiver grass is ranked in the order of Fe>Zn>Pb>Mn>Cu. Results also demonstrated greater removal of heavy metals (Cu, Fe, Mn, Pb, Zn at greater root length and higher density of vetiver grass because it increased the surface area for metal absorption by plant root into vetiver plant from contaminated water. However, findings indicated that accumulation of heavy metals in plant biomass was higher in vetiver shoot than in root due to metal translocation from root to the shoot. Therefore, the findings have shown effective performance of vetiver grass for metal removal in the phytoremediation of contaminated water.

Estimation of grass to cow's milk transfer coefficients for emergency situations

International Nuclear Information System (INIS)

Ujwal, P.; Karunakara, N.; Yashodhara, I.; Rao, Chetan; Kumara, Sudeep; Dileep, B.N.; Ravi, P.M.

2012-01-01

Several studies have been reported on soil to grass equilibrium transfer factors and grass to cow's milk transfer coefficients for 137 Cs for the environs of different nuclear power plants of both India and other parts of the world. In such studies, the activity concentration of 137 Cs is measured in grass collected from different places. Cow's milk samples are collected from nearby localities or from milk dairies and analyzed for 137 Cs and the grass to cow's milk transfer coefficient is estimated. In situation where 137 Cs is not present in measurable activity concentrations, its stable counterpart (Cs) is measured for the estimation of transfer coefficients. These transfer coefficient values are generally used in theoretical models to estimate the dose to the population for hypothetical situation of emergency. It should be noted that the transfer coefficients obtained for equilibrium conditions may not be totally applicable for emergency situation. However, studies aimed at evaluating transfer coefficients for emergency situations are sparse because nuclear power plants do not release 137 Cs during normal operating situations and therefore simulating situation of emergency release is not possible. Hence, the only method to estimate the grass to milk transfer coefficient for emergency situation is to spike the grass with small quantity of stable Cs. This paper reports the results of grass to milk transfer coefficients for stable isotope of Cesium (Cs) for emergency situation

Soil nitrogen mineralization not affected by grass species traits

Science.gov (United States)

Maged Ikram Nosshi; Jack Butler; M. J. Trlica

2007-01-01

Species N use traits was evaluated as a mechanism whereby Bromus inermis (Bromus), an established invasive, might alter soil N supply in a Northern mixed-grass prairie. We compared soils under stands of Bromus with those from three representative native grasses of different litter C/N: Andropogon...

Factors affecting palatability of four submerged macrophytes for grass carp Ctenopharyngodon idella.

Science.gov (United States)

Sun, Jian; Wang, Long; Ma, Lin; Min, Fenli; Huang, Tao; Zhang, Yi; Wu, Zhenbin; He, Feng

2017-12-01

Grass carp can weaken the growth and reproductive capacity of submerged macrophytes by consuming valuable tissues, but factors affecting palatability of submerged macrophytes for grass carp rarely are considered. In this study, relative consumption rate of grass carp with regard to submerged macrophytes was in the following order: Hydrilla verticillata > Vallisneria natans > Ceratophyllum demersum > Myriophyllum spicatum. Firmness of macrophytes was in the following order: M. spicatum > C. demersum > H. verticillata = V. natans, whereas shear force was M. spicatum > C. demersum > H. verticillata > V. natans. After crude extracts of M. spicatum were combined with H. verticillata, grass carp fed on fewer macrophyte pellets that contained more plant secondary metabolites (PSMs). This indicated that structure and PSMs affected palatability of macrophytes.PSMs do not contribute to reduction in palatability through inhibition of intestinal proteinases activity, but they can cause a decrease in the abundance of Exiguobacterium, Acinetobacter-yielding proteases, lipases, and cellulose activity, which in turn can weaken the metabolic capacity of grass carp and adversely affect their growth. Thus, the disadvantages to the growth and development of grass carp caused by PSMs may drive grass carp to feed on palatable submerged macrophytes with lower PSMs.

The design and development of GRASS file reservation system

International Nuclear Information System (INIS)

Huang Qiulan; Zhu Suijiang; Cheng Yaodong; Chen Gang

2010-01-01

GFRS (GRASS File Reservation System) is designed to improve the file access performance of GRASS (Grid-enabled Advanced Storage System) which is a Hierarchical Storage Management (HSM) system developed at Computing Center, Institute of High Energy Physics. GRASS can provide massive storage management and data migration, but the data migration policy is simply based factors such as pool water level, the intervals for migration and so on, so it is short of precise control over files. As for that, we design GFRS to implement user-based file reservation which is to reserve and keep the required files on disks for High Energy physicists. CFRS can improve file access speed for users by avoiding migrating frequently accessed files to tapes. In this paper we first give a brief introduction of GRASS system and then detailed architecture and implementation of GFRS. Experiments results from GFRS have shown good performance and a simple analysis is made based on it. (authors)

Designing a New Raster Sub-System for GRASS-7

Directory of Open Access Journals (Sweden)

Martin Hruby

2012-03-01

Full Text Available The paper deals with a design of a new raster sub-system intended for modern GIS systems open for client and server operation, database connection and strong application interface (API. Motivation for such a design comes from the current state of API working in GRASS 6. If found attractive, the here presented design and its implementation (referred as RG7 may be integrated to the future new generation of the GRASS Geographical Information System version 7-8. The paper describes in details the concept of raster tiling, computer storage of rasters and basic raster access procedures. Finally, the paper gives a simple benchmarking experiment of random read access to raster files imported from the Spearfish dataset. The experiment compares the early implementation of RG7 with the current implementation of rasters in GRASS 6. As the result, the experiment shows the RG7 to be significantly faster than GRASS in random read access to large raster files.

Anther and pollen development in some species of Poaceae (Poales Desenvolvimento da antera e do grão de pólen em espécies de Poaceae (Poales

Directory of Open Access Journals (Sweden)

AT. Nakamura

2010-05-01

Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.O desenvolvimento da antera e do grão de pólen de Olyra humilis Nees, Sucrea monophylla Soderstr. (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees and Chloris elata Desv. (Chloridoideae foi estudado visando caracterizar embriologicamente essas espécies de subfamílias consideradas basal, intermediária e derivada, respectivamente. As espécies são similares entre si e entre as demais Poaceae. Apresentam os seguintes caracteres: anteras tetrasporangiadas; desenvolvimento da parede da antera do tipo monocotiledôneo, endotécio com espessamento de parede anelar, tapete secretor; microsporogênese sucessiva; tétrades isobilaterais; grãos de

Comparative growth analysis of cool- and warm-season grasses in a cool-temperate environment

International Nuclear Information System (INIS)

Belesky, D.P.; Fedders, J.M.

1995-01-01

Using both cool-season (C3) and warm-season (C4) species is a viable means of optimizing herbage productivity over varying climatic conditions in temperate environments. Despite well-documented differences in water, N, and radiation use, no consistent evidence demonstrates productivity differences among C3 and C4 perennial grass species under identical management. A field study was conducted to determine relative growth rates (RGR), nitrogen productivity (NP), and mean radiation productivity (RP) (dry matter production as a function of incident radiation) of cool- and warm-season grasses managed identically. Results were used to identify management practices thd could lead to optimal productivity in combinations or mixtures of cool- and warm-season grasses. Dry matter yields of warm-season grasses equaled or surpassed those of cool-season grasses, despite a 40% shorter growth interval. Certain cool- and warm-season grasses appear to be suitable for use in mixtures, based on distribution of herbage production; however, actual compatibility may be altered by defoliation management. Relative growth rates varied among years and were about 40% lower for canopies clipped to a 10-cm residue height each time 20-cm of growth accumulated compared with other treatments. The RGR of warm-season grasses was twice that of cool-season grasses Nitrogen productivity (g DM g-1 N d -1) and mean radiation productivity (g DM MJ-1) for warm-season grasses was also more than twice that of cool-season grasses. Radiation productivity of cool-season grasses was dependent on N, while this was not always the case for warm-season grasses. The superior production capability of certain warm-season compared with cool-season grasses in a cool-temperate environment can be sustained under a range of defoliation treatments and demonstrates suitability for use in frequently defoliated situations

EBIPM | Finding the Tools to Manage Invasive Annual Grasses

Science.gov (United States)

management decisions for a given landscape based on ecological principles. Take a look at our video " Grass Management How much could prevention save you? Guidelines to Implement EBIPM Weed Prevention Areas Grass Facts/ID The EBIPM Model Crooked River Weed Management Area Guide Tools for Educators EBIPM High

Designing hybrid grass genomes to control runoff generation

Science.gov (United States)

MacLeod, C.; Binley, A.; Humphreys, M.; King, I. P.; O'Donovan, S.; Papadopoulos, A.; Turner, L. B.; Watts, C.; Whalley, W. R.; Haygarth, P.

2010-12-01

Sustainable management of water in landscapes requires balancing demands of agricultural production whilst moderating downstream effects like flooding. Pasture comprises 69% of global agricultural areas and is essential for producing food and fibre alongside environmental goods and services. Thus there is a need to breed forage grasses that deliver multiple benefits through increased levels of productivity whilst moderating fluxes of water. Here we show that a novel grass hybrid that combines the entire genomes of perennial ryegrass (Lolium perenne - the grass of choice for Europe’s forage agriculture) and meadow fescue (Festuca pratensis) has a significant role in flood prevention. Field plot experiments established differences in runoff generation with the hybrid cultivar reducing runoff by 50% compared to perennial ryegrass cultivar, and by 35% compared to a meadow fescue cultivar (34 events over two years, replicated randomized-block design, statistically significant differences). This important research outcome was the result of a project that combined plant genetics, soil physics and plot scale hydrology to identify novel grass genotypes that can reduce runoff from grassland systems. Through a coordinated series of experiments examining effects from the gene to plot scale, we have identified that the rapid growth and then turnover of roots in the L. perenne x F. pratensis hybrid is likely to be a key mechanism in reducing runoff generation. More broadly this is an exciting first step to realizing the potential to design grass genomes to achieve both food production, and to deliver flood control, a key ecosystem service.

DESIGN OF GRASS BRIQUETTE MACHINE

African Journals Online (AJOL)

user

E-mail addresses: 1 mike.ajieh@gmail.com, 2 dracigboanugo@yahoo.com, ... machine design was considered for processing biomass of grass origin. The machine operations include pulverization, compaction and extrusion of the briquettes.

Grass and weed killer poisoning

Science.gov (United States)

... medlineplus.gov/ency/article/002838.htm Grass and weed killer poisoning To use the sharing features on this page, please enable JavaScript. Many weed killers contain dangerous chemicals that are harmful if ...

Proving productivity in infinite data structures

NARCIS (Netherlands)

Zantema, H.; Raffelsieper, M.; Lynch, C.

2010-01-01

For a general class of infinite data structures including streams, binary trees, and the combination of finite and infinite lists, we investigate the notion of productivity. This generalizes stream productivity. We develop a general technique to prove productivity based on proving context-sensitive

Role of carbohydrate metabolism in grass tetany

Energy Technology Data Exchange (ETDEWEB)

Miller, J.K.; Madsen, F.C.; Lentz, D.E.; Hansard, S.L.

1977-01-01

Clinical hypomagnesemia is confined primarily to beef cattle in the United States but also occurs in dairy cattle in other countries, probably due to different management practices. During periods when grass tetany is likely, early vegetative temperate zone grasses are usually low in total readily available carbohydrates and magnesium but high in potassium and nitrogen. The tetany syndrome may include hypoglycemia and ketosis, suggesting an imbalance in intermediary energy metabolism. Many enzyme systems critical to cellular metabolism, including those which hydrolyze and transfer phosphate groups, are activated by Mg. Thus, by inference, Mg is required for normal glucose utilization, fat, protein, nucleic acid and coenzyme synthesis, muscle contraction, methyl group transfer, and sulfate, acetate, and formate activation. Numerous clinical and experimental studies suggest an intimate relationship between metabolism of Mg and that of carbohydrate, glucagon, and insulin. The objective is to review this literature and suggest ways in which these relationships might contribute to a chain of events leading to grass tetany.

IgE-binding capacity of recombinant timothy grass (Phleum pratense) pollen allergens

NARCIS (Netherlands)

Laffer, S.; Vrtala, S.; Duchêne, M.; van Ree, R.; Kraft, D.; Scheiner, O.; Valenta, R.

1994-01-01

A panel of 60 cDNA clones coding for IgE-binding proteins from timothy grass pollen was immunocharacterized with sera from 30 patients allergic to grass pollen and antibodies raised against natural grass pollen allergens. In the cases of five representative patients in whom the IgE reactivity

Status of exotic grasses and grass-like vegetation and potential impacts on wildlife in New England

Science.gov (United States)

DeStefano, Stephen

2013-01-01

The Northeastern section of the United States, known as New England, has seen vast changes in land cover and human population over the past 3 centuries. Much of the region is forested; grasslands and other open-land cover types are less common, but provide habitat for many species that are currently declining in abundance and distribution. New England also consists of some of the most densely populated and developed states in the country. The origin, distribution, and spread of exotic species are highly correlated with human development. As such, exotics are common throughout much of New England, including several species of graminoids (grasses and grass-like plants such as sedges and rushes). Several of the more invasive grass species can form expansive dense mats that exclude native plants, alter ecosystem structure and functions, and are perceived to provide little-to-no value as wildlife food or cover. Although little research has been conducted on direct impacts of exotic graminoids on wildlife populations in New England, several studies on the common reed (Phragmites australis) in salt marshes have shown this species to have variable effects as cover for birds and other wildlife, depending on the distribution of the plant (e.g., patches and borders of reeds are used more by wildlife than expansive densely growing stands). Direct impacts of other grasses on wildlife populations are largely unknown. However, many of the invasive graminoid species that are present in New England have the capability of outcompeting native plants and thereby potentially affecting associated fauna. Preservation, protection, and restoration of grassland and open-land cover types are complex but necessary challenges in the region to maintain biological and genetic diversity of grassland, wetland, and other open-land obligate species.

Growth and nutritional evaluation of napier grass hybrids as forage for ruminants

Directory of Open Access Journals (Sweden)

Brian Turano

2016-09-01

Full Text Available Napier grass is a perennial, tropical C-4 grass that can produce large amounts of forage. However, low temperatures and drought stress limit its productivity and nutritive value as a forage. To overcome these limitations, pearl millet × napier grass hybrids (PMN were developed. It was hypothesized that PMN hybrids were more drought-tolerant, produced higher yields, and had higher nutritive value than napier grass varieties. The yield and nutritive value of 4 napier grass varieties (Bana grass, Mott, MB4 and N51 and 4 PMN hybrids (PMN2, PMN3, 5344 and 4604 were determined with or without irrigation in a strip plot design in Hawaii. Hybrid PMN3 outperformed napier grass varieties and the other hybrids for yield, while 5344 showed higher nutritional content and digestibility than most other grasses. Dry matter yields during the 110-day study period ranged from 10.3 to 32.1 t/ha without irrigation and 19.6 to 55.8 t/ha with irrigation, indicating that moisture stress was limiting performance in raingrown pastures. Only hybrids PMN3 and PMN2 and variety MB4 showed significant growth responses to irrigation. Further work is needed to evaluate the hybrids in a range of environments over much longer periods to determine if these preliminary results can be reproduced over the long term. Similarly, feeding studies with animals are needed to determine if the in vitro data for digestibility are reflected in superior performance for the promising hybrids.Keywords: Biomass, cattle, in vitro digestion, nutrient content, Pennisetum, tropical grasses.DOI: 10.17138/TGFT(4168-178

Phylogenetic relationships in the Festuca-Lolium complex (Loliinae; Poaceae: New insights from chloroplast sequences

Directory of Open Access Journals (Sweden)

Yajuan Cheng

2016-07-01

Full Text Available The species within the Lolium/Festuca grass complex have dispersed and colonized large areas of temperate global grasslands both naturally and by human intervention. The species within this grass complex represent some of the most important grass species both for amenity and agricultural use worldwide. There has been renewed interest by grass breeders in producing hybrid combinations between these species and several countries now market Festulolium varieties as a combination of genes from both genera. The two genera have been differentiated by their inflorescence structure, but controversy has surrounded the taxonomic classification of the Lolium-Festuca complex species for several decades. In order to better understand the complexities within the Lolium/Festuca complex and their genetic background, the phylogeny of important examplers from the Lolium-Festuca complex were reconstructed. In total 40 taxa representing the Festuca and Lolium species with Vulpia myuros and Brachypodium distachyon as outgroups were sampled, using two noncoding intergenic spacers (trnQ-rps16, trnH-psbA and one coding gene (rbcL. Maximum parsimony (MP, Bayesian inference (BI analyses based on each partition and combined plastid DNA dataset, and median-jointing network analysis were employed. The outcomes strongly suggested that the subgen. Schedonorus has a close relationship to Lolium, and it is also proposed to move the sect. Leucopoa from subgen. Leucopoa to Subgen. Schedonorus and to separate sect. Breviaristatae from the subgen. Leucopoa. We found that F. californica could be a lineage of hybrid origin because of its intermediate placement between the broad-leaved and fine-leaved clade.

Evaluation of molecular basis of cross reactivity between rye and Bermuda grass pollen allergens.

Science.gov (United States)

Tiwari, Ruby; Bhalla, Prem L; Singh, Mohan B

2009-12-01

Allergenic cross reactivity between the members of the Pooids (Lolium perenne, Phleum pratense, and Poa pratensis) and Chloridoids (Cynodon dactylon and Paspalum notatum) is well established. Studies using crude extracts in the past have demonstrated limited cross reactivity between the Pooids and the Chloridoids suggesting separate diagnosis and therapy. However, little is known regarding the molecular basis for the limited cross reactivity observed between the 2 groups of grasses. The present study was undertaken to gain insights into the molecular basis of cross allergenicity between the major allergens from rye and Bermuda grass pollens. Immunoblot inhibition tests were carried out to determine the specificity of the proteins involved in cross reactivity. Crude pollen extract and bacterially expressed and purified recombinant Lol p 1and Lol p 5 from rye grass were subjected to cross inhibition experiments with crude and purified recombinant Cyn d 1 from Bermuda grass using sera from patients allergic to rye grass pollen. The immunoblot inhibition studies revealed a high degree of cross inhibition between the group 1 allergens. In contrast, a complete lack of inhibition was observed between Bermuda grass group 1 allergen rCyn d 1, and rye grass group 5 allergen rLol p 5. Crude rye grass extract strongly inhibited IgE reactivity to Bermuda grass, whereas crude Bermuda grass pollen extract showed a weaker inhibition. Our data suggests that a possible explanation for the limited cross reactivity between the Pooids and Chloridoids may, in part, be due to the absence of group 5 allergen from Chloridoid grasses. This approach of using purified proteins may be applied to better characterize the cross allergenicity patterns between different grass pollen allergens.

Grass defoliation affecting survival and growth of seedlings of ...

African Journals Online (AJOL)

Two experiments were conducted, one in the field and the other in the greenhouse, to investigate the effects of the intensity and frequency of grass defoliation on the survival and growth of Acacia karroo seedlings. In the greenhouse, seedlings growing with heavily clipped grasses had higher biomass production than those ...

Analysis of Some Heavy Metals in Grass ( Paspalum Orbiculare ...

African Journals Online (AJOL)

The increased deposition of trace metals from vehicle exhausts on plants has raised concerns about the risks of the quality of food consumed by humans since the heavy metals emitted through the exhaust by vehicles can enter food chain through deposition on grass grazed by animals. Grass (Paspalum Orbiculare) and ...

Proving relations between modular graph functions

International Nuclear Information System (INIS)

Basu, Anirban

2016-01-01

We consider modular graph functions that arise in the low energy expansion of the four graviton amplitude in type II string theory. The vertices of these graphs are the positions of insertions of vertex operators on the toroidal worldsheet, while the links are the scalar Green functions connecting the vertices. Graphs with four and five links satisfy several non-trivial relations, which have been proved recently. We prove these relations by using elementary properties of Green functions and the details of the graphs. We also prove a relation between modular graph functions with six links. (paper)

Whole rice bran for beef heifers raised on alexander grass pasture

Directory of Open Access Journals (Sweden)

P. R. Salvador

2016-09-01

Full Text Available The objective of this study was to evaluate the development of beef heifers exclusively fed alexander grass (Urochloa plantaginea (Link Hitch or alexander grass and whole rice meal as supplement offered from Monday to Friday. The experimental design was completely randomized, with repeated measures over time, and consisted of two treatments and three replications of area. Heifers receiving whole rice meal exhibited higher average daily gain after day 42 of pasture use and a 21% higher body weight at the end of the grazing period. The stocking rate, weight gain per area, hip height, weight-height ratio, and body condition score were similar for heifers exclusively fed alexander grass and alexander grass plus rice bran. Beef heifers raised exclusively on alexander grass from 15 to 18 months of age reached adequate body development, reproductive tract score (4.22 points and pelvic area (206.3 cm² to be bred at 18-20 months of age.

Toward Genomics-Based Breeding in C3 Cool-Season Perennial Grasses

Science.gov (United States)

Talukder, Shyamal K.; Saha, Malay C.

2017-01-01

Most important food and feed crops in the world belong to the C3 grass family. The future of food security is highly reliant on achieving genetic gains of those grasses. Conventional breeding methods have already reached a plateau for improving major crops. Genomics tools and resources have opened an avenue to explore genome-wide variability and make use of the variation for enhancing genetic gains in breeding programs. Major C3 annual cereal breeding programs are well equipped with genomic tools; however, genomic research of C3 cool-season perennial grasses is lagging behind. In this review, we discuss the currently available genomics tools and approaches useful for C3 cool-season perennial grass breeding. Along with a general review, we emphasize the discussion focusing on forage grasses that were considered orphan and have little or no genetic information available. Transcriptome sequencing and genotype-by-sequencing technology for genome-wide marker detection using next-generation sequencing (NGS) are very promising as genomics tools. Most C3 cool-season perennial grass members have no prior genetic information; thus NGS technology will enhance collinear study with other C3 model grasses like Brachypodium and rice. Transcriptomics data can be used for identification of functional genes and molecular markers, i.e., polymorphism markers and simple sequence repeats (SSRs). Genome-wide association study with NGS-based markers will facilitate marker identification for marker-assisted selection. With limited genetic information, genomic selection holds great promise to breeders for attaining maximum genetic gain of the cool-season C3 perennial grasses. Application of all these tools can ensure better genetic gains, reduce length of selection cycles, and facilitate cultivar development to meet the future demand for food and fodder. PMID:28798766

Toward Genomics-Based Breeding in C3 Cool-Season Perennial Grasses

Directory of Open Access Journals (Sweden)

Shyamal K. Talukder

2017-07-01

Full Text Available Most important food and feed crops in the world belong to the C3 grass family. The future of food security is highly reliant on achieving genetic gains of those grasses. Conventional breeding methods have already reached a plateau for improving major crops. Genomics tools and resources have opened an avenue to explore genome-wide variability and make use of the variation for enhancing genetic gains in breeding programs. Major C3 annual cereal breeding programs are well equipped with genomic tools; however, genomic research of C3 cool-season perennial grasses is lagging behind. In this review, we discuss the currently available genomics tools and approaches useful for C3 cool-season perennial grass breeding. Along with a general review, we emphasize the discussion focusing on forage grasses that were considered orphan and have little or no genetic information available. Transcriptome sequencing and genotype-by-sequencing technology for genome-wide marker detection using next-generation sequencing (NGS are very promising as genomics tools. Most C3 cool-season perennial grass members have no prior genetic information; thus NGS technology will enhance collinear study with other C3 model grasses like Brachypodium and rice. Transcriptomics data can be used for identification of functional genes and molecular markers, i.e., polymorphism markers and simple sequence repeats (SSRs. Genome-wide association study with NGS-based markers will facilitate marker identification for marker-assisted selection. With limited genetic information, genomic selection holds great promise to breeders for attaining maximum genetic gain of the cool-season C3 perennial grasses. Application of all these tools can ensure better genetic gains, reduce length of selection cycles, and facilitate cultivar development to meet the future demand for food and fodder.

Modelling of excess noise attnuation by grass and forest | Onuu ...

African Journals Online (AJOL)

, guinea grass (panicum maximum) and forest which comprises iroko (milicia ezcelea) and white afara (terminalia superba) trees in the ratio of 2:1 approximately. Excess noise attenuation spectra have been plotted for the grass and forest for ...

Effect of grass species on NDF ruminal degradability and ...

African Journals Online (AJOL)

uzivatel

Abstract. The objective of this study was to compare the ruminal degradability of neutral detergent fibre (NDF) .... Felina were evaluated in the present study. The grass was harvested from the primary growth of monocultured grasses on 19 and 26 May of 2004 and 27 May and 10 ...... Nutritional Ecology of the Ruminant.

Defoliation effects of perennial grasses – continuing confusion | DL ...

African Journals Online (AJOL)

Although an adequate knowledge of growth patterns and defoliation effects in perennial grasses is a prerequisite for the rational use of veld and pastures for animal production, our knowledge of this subject is far from adequate. The results of various physiological and clipping studies on tropical and sub-tropical grasses are ...

Seed production and establishment of western Oregon native grasses

Science.gov (United States)

Dale C. Darris

2005-01-01

It is well understood that native grasses are ecologically important and provide numerous benefits. However, unfavorable economics, low seed yields for some species, genetic issues, and a lack of experience behind the production and establishment of most western Oregon native grasses remain significant impediments for their expanded use. By necessity, adaptation of...

Grass as a C booster for manure-biogas in Estonia

DEFF Research Database (Denmark)

Pehme, Sirli; Hamelin, Lorie; Veromann, Eve

2014-01-01

The aim of this study was to assess the environmental consequences of using grass (from both unused and cultivated boreal grasslands) as a co-substrate to dairy cow manure for biogas production. Environmental impact categories assessed were global warming, acidification and nutrient enrichment...... (distinguishing between N and P). Scenarios studied were: traditional management of dairy cow manure, monodigestion of manure, manure co-digestion with reed canary grass and manure co-digestion with residual grass from semi-natural grasslands. The latter scenario showed the best environmental performance...... for the global warming category, for other categories it did not show clear benefits. Using reed canary grass specially produced for biogas purpose resulted in a climate change impact just as big as the reference manure management, mainly as a result of indirect land use changes. Increased impacts also occurred...

Reduction in clover-grass yield caused by different traffic intensities

DEFF Research Database (Denmark)

Green, Ole; Jørgensen, Rasmus Nyholm; Kristensen, Kristian

Different traffic intensities have been shown to have a negative influence on the yield of grass and clover. A full scale grass-clover field trial was established to estimate the effect on clover-grass yields as a function of different wheel loads and tire pressures. The trial comprised 16...... close to the north, south and east border of the field. No significant interactions were found between the timing of crop and soil damage as affected by wheel load and tire pressure. However, at specific times, there was a significant effect of wheel load and secondary by the tire pressure. At all...... measurement times, the yield was lower using a wheel load of 4745 kg than for a wheel load of 2865 kg.     Key words (for Electronic Reference Library) Traffic intensities, tire load/pressure, clover/grass, yield loss, ...

Napier Grass and Legume Silage for Smallholder Farmers in Coastal Kenya

International Nuclear Information System (INIS)

Muinga, R.W.; Mambo, L.C.; Bimbuzi, S.

1999-01-01

Inadequate feed during the dry season is a major cause of low dairy productivity in Kenya. Napier grass is grown by smallholder dairy farmers due to its high biomass yield especially during the rainy season when it can be ensiled to ensure feed available in the dry season.The objective of the study was to determine the silage quality of mixtures of Napier grass and Legume forages. Maize bran was used as the main source of readily available carbohydrates replacing molasses. The mixtures were compared to the conventional Napier grass/legume has higher nutritive value than silage made from Napier grass only and that maize bran could replace molasses as a source of readily available carbohydrates

Analyzing rasters, vectors and time series using new Python interfaces in GRASS GIS 7

Science.gov (United States)

Petras, Vaclav; Petrasova, Anna; Chemin, Yann; Zambelli, Pietro; Landa, Martin; Gebbert, Sören; Neteler, Markus; Löwe, Peter

2015-04-01

GRASS GIS 7 is a free and open source GIS software developed and used by many scientists (Neteler et al., 2012). While some users of GRASS GIS prefer its graphical user interface, significant part of the scientific community takes advantage of various scripting and programing interfaces offered by GRASS GIS to develop new models and algorithms. Here we will present different interfaces added to GRASS GIS 7 and available in Python, a popular programming language and environment in geosciences. These Python interfaces are designed to satisfy the needs of scientists and programmers under various circumstances. PyGRASS (Zambelli et al., 2013) is a new object-oriented interface to GRASS GIS modules and libraries. The GRASS GIS libraries are implemented in C to ensure maximum performance and the PyGRASS interface provides an intuitive, pythonic access to their functionality. GRASS GIS Python scripting library is another way of accessing GRASS GIS modules. It combines the simplicity of Bash and the efficiency of the Python syntax. When full access to all low-level and advanced functions and structures from GRASS GIS library is required, Python programmers can use an interface based on the Python ctypes package. Ctypes interface provides complete, direct access to all functionality as it would be available to C programmers. GRASS GIS provides specialized Python library for managing and analyzing spatio-temporal data (Gebbert and Pebesma, 2014). The temporal library introduces space time datasets representing time series of raster, 3D raster or vector maps and allows users to combine various spatio-temporal operations including queries, aggregation, sampling or the analysis of spatio-temporal topology. We will also discuss the advantages of implementing scientific algorithm as a GRASS GIS module and we will show how to write such module in Python. To facilitate the development of the module, GRASS GIS provides a Python library for testing (Petras and Gebbert, 2014) which

Phytochemical profile of sugarcane and its potential health aspects

OpenAIRE

Singh, Amandeep; Lal, Uma Ranjan; Mukhtar, Hayat Muhammad; Singh, Prabh Simran; Shah, Gagan; Dhawan, Ravi Kumar

2015-01-01

Sugarcane (Saccharum officinarum Linn.) is an important perennial grass of Poaceae family, indigenous to tropical South Asia and Southeast Asia. It is cultivated worldwide due to the economical and medicinal value of its high yielding products. Sugarcane juice is well known as a raw material for the production of refined sugar and its wax is considered as a potential substitute for the expensive carnauba wax, which is of cosmetic and pharmaceutical interest. Refined sugar is the primary produ...

Living life the natural way – Wheatgrass and Health

OpenAIRE

Jaspreet Kaur Kamboj; Satyavati Rana; Vandana Gandhi

2011-01-01

Abstract:The Human diet is enriched with young parts of plants (so called ―green foods‖), which can improve nutrient balance intake in natural way. Wheatgrass (Triticum aestivum) refers to young grass of the common wheat plant, which belongs to Poaceae family. This is the most commonly found herb in India, although its nativity is currently unknown. This plant is believed to have many nutritional values; it has been shown to have anti-inflammatory, antioxidant, anticarcinogenic, immunomodul...

Biotechnological application of sustainable biogas production through dry anaerobic digestion of Napier grass.

Science.gov (United States)

Dussadee, Natthawud; Ramaraj, Rameshprabu; Cheunbarn, Tapana

2017-05-01

Napier grass (Pennisetum purpureum), represents an interesting substrate for biogas production. The research project evaluated biogas potential production from dry anaerobic digestion of Napier grass using batch experiment. To enhance the biogas production from ensiled Napier grass, thermal and alkaline pre-treatments were performed in batch mode. Alkali hydrolysis of Napier grass was performed prior to batch dry anaerobic digestion at three different mild concentrations of sodium hydroxide (NaOH). The study results confirmed that NaOH pretreated sample produced high yield of biogas than untreated (raw) and hot water pretreated samples. Napier grass was used as the mono-substrate. The biogas composition of carbon dioxide (30.10%), methane (63.50%) and 5 ppm of H 2 S was estimated from the biogas. Therefore, fast-growing, high-yielding and organic matter-enriched of Napier grass was promising energy crop for biogas production.

Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna

Directory of Open Access Journals (Sweden)

Anna Maria Mercuri

2016-12-01

Full Text Available Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change.

Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna)

Science.gov (United States)

Mercuri, Anna Maria; Torri, Paola; Fornaciari, Rita; Florenzano, Assunta

2016-01-01

Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region) that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change. PMID:27929423

The incidence of Pyrenochaeta terrestris in root of different plant species in Serbia

Directory of Open Access Journals (Sweden)

Lević Jelena T.

2013-01-01

Full Text Available Root samples of cereals (oats, wheat, barley, maize and sorghum, vegetables (garlic, onion, pepper, cucumber, pumpkin, carrot and tomato, industrial plant (soya bean and weeds (Johnson grass, barnyard grass and green bristle-grass collected in different agroecological conditions in Serbia were analysed for the presence of Pyrenochaeta terrestris. The fungus was found in 42 out of 51 samples (82.4%, while the incidence varied from 2.5 to 72.5%. The highest incidence was detected in cereals (average 30.3%, and then in weeds of the Poaceae family (average 14.2%. Considering single species, maize (up to 72.5% in root and Johnson grass (up to 37.5% were mostly attacked by this fungus. The lowest incidence of the fungus was determined in vegetable crops (average 6.7%. Red to reddish discoloration of root was correlated with the incidence of the fungus. Obtained data indicate that P. terrestris is widespread in Serbia and conditions for its development are favourable. [Projekat Ministarstva nauke Republike Srbije, br. TR-31023

Effect of short-duration overnight cattle kraaling on grass production ...

African Journals Online (AJOL)

... grass species, such as Urochloa mosambicensis and Panicum maximum, were more abundant in abandoned kraal sites than the surrounding vegetation. We conclude that shortduration overnight cattle kraaling improves grass quality and biomass. Keywords: biomass, crude protein, diversity, fibre, nutrient hotspots ...

From schedonorus and micropyropsis to lolium (Poaceae: Loliinae): New combinations and typifications

Czech Academy of Sciences Publication Activity Database

Banfi, E.; Galasso, G.; Foggi, B.; Kopecký, David; Ardenghi, N.M.G.

2017-01-01

Roč. 66, č. 3 (2017), s. 708-717 ISSN 0040-0262 Institutional support: RVO:61389030 Keywords : Epitypification * Fescues * Grasses * Lectotypification * Nomenclature * Nothospecies * Taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.447, year: 2016

Conceptual model for reinforced grass on inner dike slopes

NARCIS (Netherlands)

Verhagen, H.J.; ComCoast

2005-01-01

A desk study has been carried out in order to develop a conceptual model for the erosion of inner dike slopes with reinforced grass cover. Based on the results the following can be concluded: The presence of a geosynthetic in a grass slope can be taken into account in the EPM method by increasing

Pesticide-contaminated feeds in integrated grass carp aquaculture: toxicology and bioaccumulation.

Science.gov (United States)

Pucher, J; Gut, T; Mayrhofer, R; El-Matbouli, M; Viet, P H; Ngoc, N T; Lamers, M; Streck, T; Focken, U

2014-02-19

Effects of dissolved pesticides on fish are widely described, but little is known about effects of pesticide-contaminated feeds taken up orally by fish. In integrated farms, pesticides used on crops may affect grass carp that feed on plants from these fields. In northern Vietnam, grass carp suffer seasonal mass mortalities which may be caused by pesticide-contaminated plants. To test effects of pesticide-contaminated feeds on health and bioaccumulation in grass carp, a net-cage trial was conducted with 5 differently contaminated grasses. Grass was spiked with 2 levels of trichlorfon/fenitrothion and fenobucarb. Unspiked grass was used as a control. Fish were fed at a daily rate of 20% of body mass for 10 d. The concentrations of fenitrothion and fenobucarb in pond water increased over time. Effects on fish mortality were not found. Fenobucarb in feed showed the strongest effects on fish by lowering feed uptake, deforming the liver, increasing blood glucose and reducing cholinesterase activity in blood serum, depending on feed uptake. Fenobucarb showed increased levels in flesh in all treatments, suggesting bio-concentration. Trichlorfon and fenitrothion did not significantly affect feed uptake but showed concentration-dependent reduction of cholinesterase activity and liver changes. Fenitrothion showed bioaccumulation in flesh which was dependant on feed uptake, whereas trichlorfon was only detected in very low concentrations in all treatments. Pesticide levels were all detected below the maximum residue levels in food. The pesticide-contaminated feeds tested did not cause mortality in grass carp but were associated with negative physiological responses and may increase susceptibility to diseases.

Microbiological Quality of Panicum maximum Grass Silage with Addition of Lactobacillus sp. as Starter

Science.gov (United States)

Sumarsih, S.; Sulistiyanto, B.; Utama, C. S.

2018-02-01

The aim of the research was to evaluate microbiological quality of Panicum maximum grass silage with addition Lactobacillus sp as starter. The completely randomized design was been used on this research with 4 treaments and 3 replications. The treatments were P0 ( Panicum maximum grass silage without addition Lactobacillus sp ), P1 ( Panicum maximum grass silage with 2% addition Lactobacillus sp), P2 (Panicum maximum grass silage with 4% addition Lactobacillus sp) and P3 (Panicum maximum grass silage with 6% addition Lactobacillus sp).The parameters were microbial populations of Panicum maximum grass silage (total lactic acid bacteria, total bacteria, total fungi, and Coliform bacteria. The data obtained were analyzed variance (ANOVA) and further tests performed Duncan’s Multiple Areas. The population of lactic acid bacteria was higher (PMicrobiological quality of Panicum maximum grass silage with addition Lactobacillus sp was better than no addition Lactobacillus sp.

Cosmogenic Be-7 in grass of Maamora site

International Nuclear Information System (INIS)

El-khoukhi, T.; Fidah, M.; Oublaid, B.

1994-01-01

Be-7 is one of the radionuclides produced by the nuclear reactions of protons and alpha particulates of galactic and solar cosmic rays as well as the secondary neutrons produced during those reactions. it is submitted, as soon as it is produced, to the physical and chemical laws of the environment, such as air motions or the fixing to the atmospheric aerosols. In the framework of environmental radioactivity monitoring programme of Maamora site (Morocco), samples of grass were collected, prepared and analyzed using gamma spectrometry. The preparation consists of drying and ashing the grass. The detector used is coaxial Ge HP with 20% efficiency. Samples were counted for more than 50000 s. The activity of Be-7 calculated for samples collected in 10 km around Maamora site varies between 4 and 20 Bq/g of ashed grass. 3 refs. (author)

Animal or plant: which is the better fog water collector?

Science.gov (United States)

Nørgaard, Thomas; Ebner, Martin; Dacke, Marie

2012-01-01

Occasional fog is a critical water source utilised by plants and animals in the Namib Desert. Fog basking beetles (Onymacris unguicularis, Tenebrionidae) and Namib dune bushman grass (Stipagrostris sabulicola, Poaceae) collect water directly from the fog. While the beetles position themselves optimally for fog water collection on dune ridges, the grass occurs predominantly at the dune base where less fog water is available. Differences in the fog-water collecting abilities in animals and plants have never been addressed. Here we place beetles and grass side-by-side in a fog chamber and measure the amount of water they collect over time. Based on the accumulated amount of water over a two hour period, grass is the better fog collector. However, in contrast to the episodic cascading water run-off from the grass, the beetles obtain water in a steady flow from their elytra. This steady trickle from the beetles' elytra to their mouth could ensure that even short periods of fog basking--while exposed to predators--will yield water. Up to now there is no indication of specialised surface properties on the grass leafs, but the steady run-off from the beetles could point to specific property adaptations of their elytra surface.

Animal or plant: which is the better fog water collector?

Directory of Open Access Journals (Sweden)

Thomas Nørgaard

Full Text Available Occasional fog is a critical water source utilised by plants and animals in the Namib Desert. Fog basking beetles (Onymacris unguicularis, Tenebrionidae and Namib dune bushman grass (Stipagrostris sabulicola, Poaceae collect water directly from the fog. While the beetles position themselves optimally for fog water collection on dune ridges, the grass occurs predominantly at the dune base where less fog water is available. Differences in the fog-water collecting abilities in animals and plants have never been addressed. Here we place beetles and grass side-by-side in a fog chamber and measure the amount of water they collect over time. Based on the accumulated amount of water over a two hour period, grass is the better fog collector. However, in contrast to the episodic cascading water run-off from the grass, the beetles obtain water in a steady flow from their elytra. This steady trickle from the beetles' elytra to their mouth could ensure that even short periods of fog basking--while exposed to predators--will yield water. Up to now there is no indication of specialised surface properties on the grass leafs, but the steady run-off from the beetles could point to specific property adaptations of their elytra surface.

Radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage

International Nuclear Information System (INIS)

Satish Rao, B.S.; Upadhya, D.; Adiga, S.K.

2007-01-01

The exposure of humans to ionizing radiations may be advertently by routine diagnostic and therapeutic purposes or inadvertently during natural, occupational and nuclear accident situations. Therefore, in order to overcome the deleterious biological effects of radiation several chemical agents have been studied for their radioprotective potential. The medicinal plants being one of the resources for such clinically important natural agents, used extensively in several drug discovery related research. Here the radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage was analyzed using Chinese hamster fibroblast cells (V79) and human peripheral blood lymphocytes (HPBLs) growing in vitro is reported

Hydrocarbon phytoremediation in the family Fabaceae--a review.

Science.gov (United States)

Hall, Jessica; Soole, Kathleen; Bentham, Richard

2011-04-01

Currently, studies often focus on the use of Poaceae species (grasses) for phytoremediation of hydrocarbon-contaminated soils. Research into the use of Fabaceae species (legumes) to remediate hydrocarbons in soils has been conducted, but these plants are commonly overlooked due to slower recorded rates of degradation compared with many grass species. Evidence in the literature suggests that in some cases Fabaceae species may increase total degradation of hydrocarbons and stimulate degradative capacity of the soil microbial community, particularly for contaminants which are normally more recalcitrant to degradation. As many recalcitrant hydrocarbons have negative impacts on human and ecosystem health, development of remediation options is crucial. Reconsideration of Fabaceae species for removal of such contaminants may lead to environmentally and economically sustainable technologies for remediation of contaminated sites.

Fructan accumulation and transcription of candidate genes during cold acclimation in three varieties of Poa pratensis

DEFF Research Database (Denmark)

Rao, R Shyama Prasad; Andersen, Jeppe Reitan; Dionisio, Giuseppe

2011-01-01

Poa pratensis, a type species for the grass family (Poaceae), is an important cool season grass that accumulates fructans as a polysaccharide reserve. We studied fructan contents and expression of candidate fructan metabolism genes during cold acclimation in three varieties of P. pratensis adapted...... to different environments: Northern Norway, Denmark, and the Netherlands. Fructan content increased significantly during cold acclimation and varieties showed significant differences in the level of fructan accumulation. cDNA sequences of putative fructosyltransferase (FT), fructan exohydrolase (FEH), and cold...... acclimation protein (CAP) genes were identified and cloned. In agreement with a function in fructan biosynthesis, transcription of a putative sucrose:fructan 6-fructosyltransferase (Pp6-SFT) gene was induced during cold acclimation and fructan accumulation in all three P. pratensis varieties. Transcription...

Effect of some adjuvants application on enhancing sulfosulfuron herbicide performance on Phalaris minor- Poaceae

Directory of Open Access Journals (Sweden)

Mohammad Mehdizadeh

2015-02-01

Full Text Available Nowadays environmental pollution by pesticides application is a major concern for health. Efficiency of many herbicides can be increased by adding adjuvants to the spray solution. Therefore greenhouse study was conducted during 2014 to determine the efficacy of three adjuvants (Citogate, Castor oil and Canola oil at concentrations of 0.1 and 0.2 (%v/v with 5, 10, 20, 30 and 40 g a.i\\ha of sulfosulfuron herbicide on littleseed canary grass. Results showed that the adjuvants enhanced the efficacy of sulfosulfuron in decreasing the dry weights of littleseed canary grass. Performance of herbicide was increased with enhancing its concentrations. Measured ED50 and ED90 concentrations of sulfosulfuron in control were 16.74 and 32.22 g a.i\\ha, respectively. Whereas the values for Citogate 0.2 (%v\\v, was 5.86 and 13.34 g a.i\\ha, respectively. The addition of Citogate and Castor oil had the highest and lowest effect on sulfosulfuron efficacy against Littleseed canary grass. In conclusion, the study revealed that Citogate concentrations had powerful effects on herbicide efficacy followed by Canola oil.

The combined effect of fertiliser nitrogen and phosphorus on herbage yield and change in soil nutrients of a grass/clover and grass-only sward

NARCIS (Netherlands)

Schils, R.L.M.; Snijders, P.J.M.

2004-01-01

The combined effect of reduced nitrogen ( N ) and phosphorus ( P ) application on the production of grass- only and grass/ clover swards was studied in a five- year cutting experiment on a marine clay soil, established on newly sown swards. Furthermore, changes in soil N, P and carbon ( C ) were

A capillary pumping device utilizing super-hydrophobic silicon grass

International Nuclear Information System (INIS)

Kung, Chun-Fei; Chang, Chien-Cheng; Chu, Chin-Chou

2011-01-01

In this study, we show that a compact silicon grass surface can be generated by utilizing the induced coupled plasma method with suitably chosen fabrication parameters. This super-hydrophobic structure suspends deionized water on top of the grass and keeps the contact angle at around 153°. The silicon grass is used to improve the driving efficiency of a capillary pumping micro-duct (without sidewalls), which is completely defined by a bottom hydrophilic stripe (adjacent to a Teflon substrate) and a fully top-covered hydrophobic Teflon surface which is coated on a glass substrate. The channel has a height of 3 µm and a width of 100 µm. In this work, the Teflon substrate is replaced with the silicon grass surface. When the fluid is flowing through the micro-duct on the stripe, the interface between the silicon grass and the hydrophilic stripe forms a stable air cushion barrier to the fluid, thus effectively reducing the frictional force. By changing only the interface with this replacement, we demonstrate that the average measured velocities of the new design show improvements of 21% and 17% in the driving efficiency over the original design for transporting deionized water and human blood, respectively. It is also shown that the measured data of the present design are closer to the values predicted by a theoretical analysis which relates the flow velocity to the contact angles, surface tension and fluid viscosity

Tree-grass interactions in savannas

CSIR Research Space (South Africa)

Scholes, RJ

1997-01-01

Full Text Available Savannas occur where trees and grasses interact to create a biome that is neither grassland nor forest. Woody and gramineous plants interact by many mechanisms, some negative (competition) and some positive (facilitation). The strength and sign...

Remote sensing of St. Augustine Decline (SAD) disease. [spectral reflectance of healthy and diseased grass

Science.gov (United States)

Odle, W. C.

1976-01-01

Laboratory and field spectral reflectance measurements of healthy and infected St. Augustine grass were made using several different instruments. Spectral differences between healthy and infected grass occured in the visible and near infrared regions. Multiband and color infrared photographs were taken of healthy and diseased turf from ground-based platforms and low altitude aircraft. Qualitative (density slicing) and quantitative (transmission densitometry) analyses revealed distinct tonal differences between healthy and St. Augustine disease (SAD) infected grass. Similar experiments are described for determining if healthy and diseased grass can be distinguished from waterstressed grass and grass deficient in either nitrogen or iron.

Diet Affects Muscle Quality and Growth Traits of Grass Carp (Ctenopharyngodon idellus): A Comparison Between Grass and Artificial Feed.

Science.gov (United States)

Zhao, Honghao; Xia, Jianguo; Zhang, Xi; He, Xugang; Li, Li; Tang, Rong; Chi, Wei; Li, Dapeng

2018-01-01

Fish muscle, the main edible parts with high protein level and low fat level, is consumed worldwide. Diet contributes greatly to fish growth performance and muscle quality. In order to elucidate the correlation between diet and muscle quality, the same batch of juvenile grass carp ( Ctenopharyngodon idellus ) were divided into two groups and fed with either grass ( Lolium perenne, Euphrasia pectinata and Sorghum sudanense ) or artificial feed, respectively. However, the different two diets didn't result in significant differences in all the detected water quality parameters (e.g., Tm, pH, DO, NH 3 /[Formula: see text]-N, [Formula: see text]-N, [Formula: see text], TN, TP, and TOC) between the two experimental groups. After a 4-month culture period, various indexes and expression of myogenic regulatory factor (MRFs) and their related genes were tested. The weight gain of the fish fed with artificial feed (AFG) was nearly 40% higher than the fish fed with grass (GFG). Significantly higher alkaline phosphatase, total cholestrol, high density cholestrol and total protein were detected in GFG as compared to AFG. GFG also showed increased hardness, resilience and shear force in texture profile analysis, with significantly bigger and compact muscle fibers in histologic slices. The fat accumulation was most serious in the abdomen muscle of AFG. Additionally, the expression levels of MyoG, MyoD, IGF - 1 , and MSTNs were higher, whereas Myf - 5, MRF4 , and IGF -2 were lower in most positional muscles of GFG as compared to AFG. Overall, these results suggested that feeding grass could promote muscle growth and development by stimulating muscle fiber hypertrophy, as well as significantly enhance the expression of CoL1A s. Feeding C. idellus with grass could also improve flesh quality by improving muscle characteristics, enhancing the production of collagen, meanthile, reducing fat accumulation and moisture in muscle, but at the cost of a slower growth.

Diet Affects Muscle Quality and Growth Traits of Grass Carp (Ctenopharyngodon idellus: A Comparison Between Grass and Artificial Feed

Directory of Open Access Journals (Sweden)

Honghao Zhao

2018-03-01

Full Text Available Fish muscle, the main edible parts with high protein level and low fat level, is consumed worldwide. Diet contributes greatly to fish growth performance and muscle quality. In order to elucidate the correlation between diet and muscle quality, the same batch of juvenile grass carp (Ctenopharyngodon idellus were divided into two groups and fed with either grass (Lolium perenne, Euphrasia pectinata and Sorghum sudanense or artificial feed, respectively. However, the different two diets didn't result in significant differences in all the detected water quality parameters (e.g., Tm, pH, DO, NH3/NH4+-N, NO3--N, NO2-, TN, TP, and TOC between the two experimental groups. After a 4-month culture period, various indexes and expression of myogenic regulatory factor (MRFs and their related genes were tested. The weight gain of the fish fed with artificial feed (AFG was nearly 40% higher than the fish fed with grass (GFG. Significantly higher alkaline phosphatase, total cholestrol, high density cholestrol and total protein were detected in GFG as compared to AFG. GFG also showed increased hardness, resilience and shear force in texture profile analysis, with significantly bigger and compact muscle fibers in histologic slices. The fat accumulation was most serious in the abdomen muscle of AFG. Additionally, the expression levels of MyoG, MyoD, IGF-1, and MSTNs were higher, whereas Myf-5, MRF4, and IGF-2 were lower in most positional muscles of GFG as compared to AFG. Overall, these results suggested that feeding grass could promote muscle growth and development by stimulating muscle fiber hypertrophy, as well as significantly enhance the expression of CoL1As. Feeding C. idellus with grass could also improve flesh quality by improving muscle characteristics, enhancing the production of collagen, meanthile, reducing fat accumulation and moisture in muscle, but at the cost of a slower growth.

Insects traversing grass-like vertical compliant beams

Science.gov (United States)

Li, Chen; Fearing, Ronald; Full, Robert

2014-03-01

Small running animals encounter many challenging terrains. These terrains can be filled with 3D, multi-component obstacles. Here, we study cockroaches (Blaberus discoidalis) moving through grass-like vertical compliant beams during escape. We created an apparatus to control and vary geometric parameters and mechanical properties of model grass including height, width, thickness, lateral and fore-aft spacings, angle, number of layers, stiffness, and damping. We observed a suite of novel locomotor behaviors not previously described on simpler 2D ground. When model grass height was >2 × body length and lateral spacing was test our hypothesis, we modified body shape by adding either a rectangular or an oval plate onto its dorsal surface, and found that P dropped by an order of magnitude and t more than doubled. Upon removal of either plate, both P and t recovered. Locomotor kinematics and geometry effectively coupled to terrain properties enables negotiation of 3D, multi-component obstacles, and provides inspiration for small robots to navigate such terrain with minimal sensing and control.

Hand-arm vibration disorder among grass-cutter workers in Malaysia.

Science.gov (United States)

Azmir, Nor Azali; Ghazali, Mohd Imran; Yahya, Musli Nizam; Ali, Mohamad Hanafi

2016-09-01

Prolonged exposure to hand-transmitted vibration from grass-cutting machines has been associated with increasing occurrences of symptoms and signs of occupational diseases related to hand-arm vibration syndrome (HAVS). A cross-sectional study was carried out using an adopted HAVS questionnaire on hand-arm vibration exposure and symptoms distributed to 168 male workers from the grass and turf maintenance industry who use hand-held grass-cutting machines as part of their work. The prevalence ratio and symptom correlation to HAVS between high and low-moderate exposure risk groups were evaluated. There were positive HAVS symptoms relationships between the low-moderate exposure group and the high exposure group among hand-held grass-cutting workers. The prevalence ratio was considered high because there were indicators that fingers turned white and felt numb, 3.63, 95% CI [1.41, 9.39] and 4.24, 95% CI [2.18, 8.27], respectively. Less than 14.3% of workers stated that they were aware of the occupational hand-arm vibration, and it seemed to be related to the finger blanching and numbness. The results suggest that HAVS is under-diagnosed in Malaysia, especially in the agricultural sectors. More information related to safety and health awareness programmes for HAVS exposure is required among hand-held grass-cutting workers.

Young, intact and nested retrotransposons are abundant in the onion and asparagus genomes.

Science.gov (United States)

Vitte, C; Estep, M C; Leebens-Mack, J; Bennetzen, J L

2013-09-01

Although monocotyledonous plants comprise one of the two major groups of angiosperms and include >65 000 species, comprehensive genome analysis has been focused mainly on the Poaceae (grass) family. Due to this bias, most of the conclusions that have been drawn for monocot genome evolution are based on grasses. It is not known whether these conclusions apply to many other monocots. To extend our understanding of genome evolution in the monocots, Asparagales genomic sequence data were acquired and the structural properties of asparagus and onion genomes were analysed. Specifically, several available onion and asparagus bacterial artificial chromosomes (BACs) with contig sizes >35 kb were annotated and analysed, with a particular focus on the characterization of long terminal repeat (LTR) retrotransposons. The results reveal that LTR retrotransposons are the major components of the onion and garden asparagus genomes. These elements are mostly intact (i.e. with two LTRs), have mainly inserted within the past 6 million years and are piled up into nested structures. Analysis of shotgun genomic sequence data and the observation of two copies for some transposable elements (TEs) in annotated BACs indicates that some families have become particularly abundant, as high as 4-5 % (asparagus) or 3-4 % (onion) of the genome for the most abundant families, as also seen in large grass genomes such as wheat and maize. Although previous annotations of contiguous genomic sequences have suggested that LTR retrotransposons were highly fragmented in these two Asparagales genomes, the results presented here show that this was largely due to the methodology used. In contrast, this current work indicates an ensemble of genomic features similar to those observed in the Poaceae.

Role of ammonia and biogenic amines in intake of grass silage by ruminants

NARCIS (Netherlands)

Os, van M.

1997-01-01

In Northern- and Western-Europe, grass silage is a major component in winter feeding rations for ruminants. The intake of ensiled grass is often lower than the intake of hay or the fresh grass of similar digestibility. This intake depression is attributed to the fermentation products

[Mechanisms of grass in slope erosion control in Loess sandy soil region of Northwest China].

Science.gov (United States)

Zhao, Chun-Hong; Gao, Jian-En; Xu, Zhen

2013-01-01

By adopting the method of simulated precipitation and from the viewpoint of slope hydrodynamics, in combining with the analysis of soil resistance to erosion, a quantitative study was made on the mechanisms of grass in controlling the slope erosion in the cross area of wind-water erosion in Loess Plateau of Northwest China under different combinations of rainfall intensity and slope gradient, aimed to provide basis to reveal the mechanisms of vegetation in controlling soil erosion and to select appropriate vegetation for the soil and water conservation in Loess Plateau. The grass Astragalus adsurgens with the coverage about 40% could effectively control the slope erosion. This grass had an efficiency of more than 70% in reducing sediment, and the grass root had a greater effect than grass canopy. On bare slope and on the slopes with the grass plant or only the grass root playing effect, there existed a functional relation between the flow velocity on the slopes and the rainfall intensity and slope gradient (V = DJ(0.33 i 0.5), where V is flow velocity, D is the comprehensive coefficient which varies with different underlying surfaces, i is rainfall intensity, and J is slope gradient). Both the grass root and the grass canopy could markedly decrease the flow velocity on the slopes, and increase the slope resistance, but the effect of grass root in decreasing flow velocity was greater while the effect in increasing resistance was smaller than that of grass canopy. The effect of grass root in increasing slope resistance was mainly achieved by increasing the sediment grain resistance, while the effect of canopy was mainly achieved by increasing the slope form resistance and wave resistance. The evaluation of the soil resistance to erosion by using a conceptual model of sediment generation by overland flow indicated that the critical shear stress value of bare slope and of the slopes with the grass plant or only the grass root playing effect was 0.533, 1.672 and 0

Postharvest residues from grass seed crops for bioenergy

OpenAIRE

Simić, Aleksandar; Čolić, Vladislava; Vučković, Savo; Dželetović, Željko; Bijelić, Zorica; Mandić, Violeta

2016-01-01

During grass seed production, a large amount of low forage quality biomass has been produced. Tall growing perennial grasses such as tall fescue (Festuca arundinacea L.) and Italian ryegrass (Lolium multiflorum Lam.) can be used as an alternative source for bioenergy production as they can be grown in less cultivated areas, their residues in seed production could be valuable energy source and can be potentially used as a dual purpose crop (bioenergy and forage). In this research, potentials o...

Analysis of Fusarium causing dermal toxicosis in marram grass planters

NARCIS (Netherlands)

Snijders, CHA; Samson, RA; Hoekstra, ES; Ouellet, T; Miller, JD; deRooijvanderGoes, PCEM; Baar, AJM; Dubois, AEJ; Kauffman, HF

1996-01-01

In the European coastal dunes, marram grass (Ammophila arenaria) is planted in order to control sand erosion. In the years 1986 to 1991, workers on the Wadden islands in the Netherlands planting marram grass showed lesions of skin and mucous membranes, suggesting a toxic reaction. Fusarium culmorum

Grass fields as reservoirs for polyphagous predators (Arthropoda) of aphids (Homopt., Aphididae)

DEFF Research Database (Denmark)

Gravesen, Eigil Vestergaard; Toft, Søren

1987-01-01

In a 4 ha grass field in Denmark three separate plots of 15 times 25 m were cultivated with barley. In each plot a central area of 5 times 5 m were fenced off by a plastic barrier. Thus, each plot consisted of an unfenced area, accessible for predators immigrating from the grass field, and an una......In a 4 ha grass field in Denmark three separate plots of 15 times 25 m were cultivated with barley. In each plot a central area of 5 times 5 m were fenced off by a plastic barrier. Thus, each plot consisted of an unfenced area, accessible for predators immigrating from the grass field...

Hyperspectral remote sensing techniques for grass nutrient estimations in savannah ecosystems

CSIR Research Space (South Africa)

Ramoelo, Abel

2010-03-01

Full Text Available Information on the distribution of grass quality (nutrient concentration) is crucial in understanding rangeland vitality and facilitates effective management of wildlife and livestock. The spatial distribution of grass nutrient concentration occurs...

Sinopse das espécies nativas e subespontâneas de Andropogoneae Dumort. (Poaceae na Ilha de Santa Catarina, Brasil A synopsis of the Andropogoneae Dumort. (Poaceae native and subspontaneous to the Island of Santa Catarina, Florianópolis, SC, Brazil

Directory of Open Access Journals (Sweden)

Bárbara Toncic Neves

2011-12-01

Full Text Available O presente trabalho consiste no levantamento dos táxons da tribo Andropogoneae (Panicoideae - Poaceae ocorrentes na Ilha de Santa Catarina, Florianópolis, Brasil. A partir da revisão de materiais de herbários e coletas a campo foi confirmada a ocorrência de 10 gêneros e 20 espécies, 17 nativas e duas subespontâneas: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 e Sorghum Moench (1. Os gêneros Bothriochloa e Rhytachne são registrados pela primeira vez para a Ilha de Santa Catarina. São apresentadas chaves de identificação para gêneros e espécies, ilustrações, informações sobre distribuição geográfica, habitat, período de floração e comentários para cada táxon.The present work is a survey of the taxa in the tribe Andropogoneae (Panicoideae - Poaceae that occur on the Island of Santa Catarina, Florianópolis, Brazil. Based on a review of herbarium specimens and fieldwork, 20 species were recorded in the following 10 genera: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 and Sorghum Moench (1. Seventeen of the species are native, and two species are subspontaneous. Bothriochloa and Rhytachne are recorded here, for the first time, for the Island of Santa Catarina. This work provides key to the genera and species, as well as illustrations, information about geographic distribution, habitat, phenology, and comments about each taxon presented in the study.

Bioenergy production from roadside grass

DEFF Research Database (Denmark)

Meyer, Ane Katharina Paarup; Ehimen, Ehiazesebhor Augustine; Holm-Nielsen, Jens Bo

2014-01-01

This paper presents a study of the feasibility of utilising roadside vegetation for biogas production in Denmark. The potential biomass yield, methane yields, and the energy balances of using roadside grass for biogas production was investigated based on spatial analysis. The results show...

Preemergence herbicides on weed control in elephant grass pasture

Directory of Open Access Journals (Sweden)

Alexandre Magno Brighenti

Full Text Available ABSTRACT Elephant grass (Pennisetum purpureum Schum. is an important forage crop that has been proposed as a potential feedstock for bioenergy production. However, weed interference is a major factor limiting elephant grass production. Field experiments were conducted in 2014 and 2015 to evaluate preemergence herbicides for selective weed control in an elephant grass pasture. Herbicide treatments included atrazine + S-metolachlor, atrazine + simazine, ametryn, ethoxysulfuron, S-metolachlor, diuron + hexazinone, sulfentrazone, imazethapyr, and atrazine at label use rates. Weedy and weed-free treatments were included. Atrazine + S-metolachlor, atrazine + simazine, ametryn, ethoxysulfuron, S-metolachlor, sulfentrazone, and atrazine did not cause phytotoxicity on elephantgrass 35 days after treatment (DAT. However, diuron + hexazinone and imazethapyr were the most phytotoxic on elephantgrass, resulting in 81 and 70% phytotoxicity in 2014, and 7 and 6% phytotoxicity in 2015 respectively 35 DAT. All treatments provided effective weed control (>81% with the exception of ethoxysulfuron (0 and 11% in 2014 and 2015, respectively, and atrazine (59% in 2014. These results show that atrazine + S-metolachlor, atrazine + simazine, ametryn, ethoxysulfuron, S-metolachlor, sulfentrazone, and atrazine were selectives when applied in preemergence in elephant grass pasture.

Complete chloroplast genome sequence of a major allogamous forage species, perennial ryegrass (Lolium perenne L.).

Science.gov (United States)

Diekmann, Kerstin; Hodkinson, Trevor R; Wolfe, Kenneth H; van den Bekerom, Rob; Dix, Philip J; Barth, Susanne

2009-06-01

Lolium perenne L. (perennial ryegrass) is globally one of the most important forage and grassland crops. We sequenced the chloroplast (cp) genome of Lolium perenne cultivar Cashel. The L. perenne cp genome is 135 282 bp with a typical quadripartite structure. It contains genes for 76 unique proteins, 30 tRNAs and four rRNAs. As in other grasses, the genes accD, ycf1 and ycf2 are absent. The genome is of average size within its subfamily Pooideae and of medium size within the Poaceae. Genome size differences are mainly due to length variations in non-coding regions. However, considerable length differences of 1-27 codons in comparison of L. perenne to other Poaceae and 1-68 codons among all Poaceae were also detected. Within the cp genome of this outcrossing cultivar, 10 insertion/deletion polymorphisms and 40 single nucleotide polymorphisms were detected. Two of the polymorphisms involve tiny inversions within hairpin structures. By comparing the genome sequence with RT-PCR products of transcripts for 33 genes, 31 mRNA editing sites were identified, five of them unique to Lolium. The cp genome sequence of L. perenne is available under Accession number AM777385 at the European Molecular Biology Laboratory, National Center for Biotechnology Information and DNA DataBank of Japan.

Pampas Grass - Orange Co. [ds351

Data.gov (United States)

California Natural Resource Agency — This dataset provides the known distribution of pampas grass (Cortaderia selloana) in southern Orange County. The surveys were conducted from May to June, 2007 and...

Urban Rights-of-Way as Reservoirs for Tall-Grass Prairie Plants and Butterflies

Science.gov (United States)

Leston, Lionel; Koper, Nicola

2016-03-01

Urban rights-of-way may be potential reservoirs of tall-grass prairie plants and butterflies. To determine if this is true, in 2007-2008, we conducted vegetation surveys of species richness and cover, and butterfly surveys of species richness and abundance, along 52 transmission lines and four remnant prairies in Winnipeg, Manitoba. We detected many prairie plants and butterflies within transmission lines. Some unmowed and infrequently managed transmission lines had native plant species richness and total percent cover of native plants comparable to that of similar-sized remnant tall-grass prairies in the region. Although we did not find significant differences in overall native butterfly numbers or species richness between rights-of-way and remnant prairies, we found lower numbers of some prairie butterflies along frequently mowed rights-of-way than within remnant tall-grass prairies. We also observed higher butterfly species richness along sites with more native plant species. By reducing mowing and spraying and reintroducing tall-grass prairie plants, urban rights-of-way could serve as extensive reservoirs for tall-grass prairie plants and butterflies in urban landscapes. Eventually, managing urban rights-of-way as reservoirs for tall-grass prairie plants and animals could contribute to the restoration of tall-grass prairie in the North American Midwest.

Urban Rights-of-Way as Reservoirs for Tall-Grass Prairie Plants and Butterflies.

Science.gov (United States)

Leston, Lionel; Koper, Nicola

2016-03-01

Urban rights-of-way may be potential reservoirs of tall-grass prairie plants and butterflies. To determine if this is true, in 2007-2008, we conducted vegetation surveys of species richness and cover, and butterfly surveys of species richness and abundance, along 52 transmission lines and four remnant prairies in Winnipeg, Manitoba. We detected many prairie plants and butterflies within transmission lines. Some unmowed and infrequently managed transmission lines had native plant species richness and total percent cover of native plants comparable to that of similar-sized remnant tall-grass prairies in the region. Although we did not find significant differences in overall native butterfly numbers or species richness between rights-of-way and remnant prairies, we found lower numbers of some prairie butterflies along frequently mowed rights-of-way than within remnant tall-grass prairies. We also observed higher butterfly species richness along sites with more native plant species. By reducing mowing and spraying and reintroducing tall-grass prairie plants, urban rights-of-way could serve as extensive reservoirs for tall-grass prairie plants and butterflies in urban landscapes. Eventually, managing urban rights-of-way as reservoirs for tall-grass prairie plants and animals could contribute to the restoration of tall-grass prairie in the North American Midwest.

Enhanced precipitation variability decreases grass- and increases shrub-productivity

Science.gov (United States)

Gherardi, Laureano A.; Sala, Osvaldo E.

2015-01-01

Although projections of precipitation change indicate increases in variability, most studies of impacts of climate change on ecosystems focused on effects of changes in amount of precipitation, overlooking precipitation variability effects, especially at the interannual scale. Here, we present results from a 6-y field experiment, where we applied sequences of wet and dry years, increasing interannual precipitation coefficient of variation while maintaining a precipitation amount constant. Increased precipitation variability significantly reduced ecosystem primary production. Dominant plant-functional types showed opposite responses: perennial-grass productivity decreased by 81%, whereas shrub productivity increased by 67%. This pattern was explained by different nonlinear responses to precipitation. Grass productivity presented a saturating response to precipitation where dry years had a larger negative effect than the positive effects of wet years. In contrast, shrubs showed an increasing response to precipitation that resulted in an increase in average productivity with increasing precipitation variability. In addition, the effects of precipitation variation increased through time. We argue that the differential responses of grasses and shrubs to precipitation variability and the amplification of this phenomenon through time result from contrasting root distributions of grasses and shrubs and competitive interactions among plant types, confirmed by structural equation analysis. Under drought conditions, grasses reduce their abundance and their ability to absorb water that then is transferred to deep soil layers that are exclusively explored by shrubs. Our work addresses an understudied dimension of climate change that might lead to widespread shrub encroachment reducing the provisioning of ecosystem services to society. PMID:26417095

Buffel grass morphoagronomic characterization from cenchrus germplasm active bank.

OpenAIRE

BRUNO, L. R. G. P.; ANTONIO, R. P.; ASSIS, J. G. de A.; MOREIRA, J. N.; LIRA, I. C. de S. A.

2017-01-01

his study aimed to characterize buffel grass accessions of the Cenchrus Germplasm Active Bank (CGAB) from Embrapa Semi - Arid in a morphoagronomic way, checking the descriptors variability and efficiency in accessions on two consecutive cuts. Twenty - five accessions and five buffel grass cultivars were used in randomized complete block design with three replications. Evaluations were conducted after two consecutive cuts, each evaluation performed 90 days after each ...

A molecular identification system for grasses: a novel technology for forensic botany.

Science.gov (United States)

Ward, J; Peakall, R; Gilmore, S R; Robertson, J

2005-09-10

Our present inability to rapidly, accurately and cost-effectively identify trace botanical evidence remains the major impediment to the routine application of forensic botany. Grasses are amongst the most likely plant species encountered as forensic trace evidence and have the potential to provide links between crime scenes and individuals or other vital crime scene information. We are designing a molecular DNA-based identification system for grasses consisting of several PCR assays that, like a traditional morphological taxonomic key, provide criteria that progressively identify an unknown grass sample to a given taxonomic rank. In a prior study of DNA sequences across 20 phylogenetically representative grass species, we identified a series of potentially informative indels in the grass mitochondrial genome. In this study we designed and tested five PCR assays spanning these indels and assessed the feasibility of these assays to aid identification of unknown grass samples. We confirmed that for our control set of 20 samples, on which the design of the PCR assays was based, the five primer combinations produced the expected results. Using these PCR assays in a 'blind test', we were able to identify 25 unknown grass samples with some restrictions. Species belonging to genera represented in our control set were all correctly identified to genus with one exception. Similarly, genera belonging to tribes in the control set were correctly identified to the tribal level. Finally, for those samples for which neither the tribal or genus specific PCR assays were designed, we could confidently exclude these samples from belonging to certain tribes and genera. The results confirmed the utility of the PCR assays and the feasibility of developing a robust full-scale usable grass identification system for forensic purposes.

Review of the integrated process for the production of grass biomethane.

Science.gov (United States)

Nizami, Abdul-Sattar; Korres, Nicholas E; Murphy, Jerry D

2009-11-15

Production of grass biomethane is an integrated process which involves numerous stages with numerous permutations. The grass grown can be of numerous species, and it can involve numerous cuts. The lignocellulosic content of grass increases with maturity of grass; the first cut offers more methane potential than the later cuts. Water-soluble carbohydrates (WSC) are higher (and as such methane potential is higher) for grass cut in the afternoon as opposed to that cut in the morning. The method of ensiling has a significant effect on the dry solids content of the grass silage. Pit or clamp silage in southern Germany and Austria has a solids content of about 40%; warm dry summers allow wilting of the grass before ensiling. In temperate oceanic climates like Ireland, pit silage has a solids content of about 21% while bale silage has a solids content of 32%. Biogas production is related to mass of volatile solids rather than mass of silage; typically one ton of volatile solid produces 300 m(3) of methane. The dry solids content of the silage has a significant impact on the biodigester configuration. Silage with a high solids content would lend itself to a two-stage process; a leach bed where volatile solids are converted to a leachate high in chemical oxygen demand (COD), followed by an upflow anaerobic sludge blanket where the COD can be converted efficiently to CH(4). Alternative configurations include wet continuous processes such as the ubiquitous continuously stirred tank reactor; this necessitates significant dilution of the feedstock to effect a solids content of 12%. Various pretreatment methods may be employed especially if the hydrolytic step is separated from the methanogenic step. Size reduction, thermal, and enzymatic methodologies are used. Good digester design is to seek to emulate the cow, thus rumen fluid offers great potential for hydrolysis.

Dichotomy in the NRT gene families of dicots and grass species.

Directory of Open Access Journals (Sweden)

Darren Plett

Full Text Available A large proportion of the nitrate (NO(3(- acquired by plants from soil is actively transported via members of the NRT families of NO(3(- transporters. In Arabidopsis, the NRT1 family has eight functionally characterised members and predominantly comprises low-affinity transporters; the NRT2 family contains seven members which appear to be high-affinity transporters; and there are two NRT3 (NAR2 family members which are known to participate in high-affinity transport. A modified reciprocal best hit (RBH approach was used to identify putative orthologues of the Arabidopsis NRT genes in the four fully sequenced grass genomes (maize, rice, sorghum, Brachypodium. We also included the poplar genome in our analysis to establish whether differences between Arabidopsis and the grasses may be generally applicable to monocots and dicots. Our analysis reveals fundamental differences between Arabidopsis and the grass species in the gene number and family structure of all three families of NRT transporters. All grass species possessed additional NRT1.1 orthologues and appear to lack NRT1.6/NRT1.7 orthologues. There is significant separation in the NRT2 phylogenetic tree between NRT2 genes from dicots and grass species. This indicates that determination of function of NRT2 genes in grass species will not be possible in cereals based simply on sequence homology to functionally characterised Arabidopsis NRT2 genes and that proper functional analysis will be required. Arabidopsis has a unique NRT3.2 gene which may be a fusion of the NRT3.1 and NRT3.2 genes present in all other species examined here. This work provides a framework for future analysis of NO(3(- transporters and NO(3(- transport in grass crop species.

Improving the energy balance of grass-based anaerobic digestion through harvesting optimization

DEFF Research Database (Denmark)

Tsapekos, Panagiotis; Kougias, Panagiotis; Egelund, H.

with a number of coarse barbs) to simultaneously mow and mechanically pretreat two different lignocellulosic substrates. Thus, ensiled meadow grass was initially examined at the first experimental set up. Regarding the second field test, an area sowed with regularly cultivated grass was harvested. In order......) protocol. The findings showed that methane production can efficiently be enhanced by mechanical pretreatment applied at the harvesting step. More specifically, the most effective treatment yielded more than 10% increase in the bioenergy production from both examined grass silages. Our study demonstrates...... that the appropriate harvester can improve the energy output by approximately 2.4 GJ/ha under optimal conditions and subsequently, the overall sustainability of grass-based AD....

Swine wastewater treatment using vertical subsurface flow constructed wetland planted with Napier grass

Directory of Open Access Journals (Sweden)

Pantip Klomjek

2016-09-01

Full Text Available This research aims to investigate the pollutant removal efficiencies in swine wastewater using a vertical subsurface flow constructed wetland (VSF CW planted with two species of Napier grass. The grass productivities were also cultivated and compared in order to provide information for species selection. Twelve treatment units were set up with the VSF CWs planted with Giant Napier grass (Pennisetum purpureum cv. King grass and Dwarf Napier grass (Pennisetum purpureum cv. Mott. with 2 and 5 cm d−1 of hydraulic loading rates (HLR. Comparisons of removal efficiency and grass productivity were analyzed using Duncan's Multiple Range Test and t-test at the significant level 0.05. Both species of Napier grass performed more than 70% of removal efficiency of BOD and TKN. The VSF CW planted with Giant Napier grass at 5 cm d−1 HLR performed the highest BOD removal efficiency of 94 ± 1%, while the 2 cm d−1 HLR removed COD with efficiency of 64 ± 6%. The results also showed the effluent from all treatment units contained averages of BOD, COD, TSS, TKN and pH that followed Thailand's swine wastewater quality standard. Average fresh yields and dry yields were between 4.6 ± 0.4 to 15.2 ± 1.2 and 0.5 ± 0.1 to 2.2 ± 0.1 kg m−2, respectively. The dry yields obtained from four cutting cycles in five months of CW system operation were higher than the ones planted with a traditional method, but declined continuously after each cutting cycle. Both species of Napier grass indicated their suitability to be used in the VSF CW for swine wastewater treatment.

Modelling nutrient concentration to determine the environmental factors influencing grass quality

CSIR Research Space (South Africa)

Dudeni-Tlhone, N

2010-10-01

Full Text Available This paper uses the spatial and the least squares (Analysis of Covariance-ANCOVA) regression methods to evaluate the important environmental factors in estimating quality grass for grazing (based on the nitrogen (N) content in grass...

Nutritive value of Tanzania grass for dairy cows under rotational grazing

Directory of Open Access Journals (Sweden)

Alberto Magno Fernandes

2014-08-01

Full Text Available A nutritional analysis of Tanzania grass (Megathyrsus maximus Jacquin cv. Tanzânia was conducted. Pasture was managed in a rotational grazing system with a 30-day resting period, three days of paddock occupation and two grazing cycles. Ten Holstein × Zebu crossbred cows were kept within a 2-ha area divided into 11 paddocks ha-1. Cows were fed 2 kg of corn meal daily and performance was evaluated by weighing the animals every 14 days and by recording milk production twice a day. Nutritional composition of the Tanzania grass was determined from forage (extrusa samples collected by esophageal fistulae from two animals. The nutritive value of Tanzania grass was estimated according to a modification of the CNCPS evaluation model. Tanzania grass supplemented with 2 kg of corn meal supplied 33.2% more net energy for lactation than required by the animals to produce 13.7 kg of milk day-1. Nevertheless, the amount of metabolizable protein met the daily protein requirement of the animals. Although the model used in the study requires adjustments, Tanzania grass has the potential to produce milk in a rotational grazing system.

The conditions for use of reed canary grass briquettes and chopped reed canary grass in small heating plants; Foerutsaettningar foer anvaendning av roerflensbriketter och hackad roerflen i mindre vaermecentraler

Energy Technology Data Exchange (ETDEWEB)

Paulrud, Susanne; Davidsson, Kent; Holmgren, Magnus A. (Swedish National Testing and Research Inst., Boraas (Sweden)); Hedman, Henry; Oehman, Rikard; Leffler, Joel (ETC, Piteaa (Sweden))

2010-09-15

The aim of this study was to test fuel blends of briquettes and chopped reed canary grass in three existing heating plants (50 kW - 500 kW) and elucidate the requirements for good performance and low emissions. In addition, the study investigated production of reed canary grass briquettes using a Polish screw press developed for straw. Some tests with a bale shredder were also undertaken. The screw press technique is of interest for reed canary grass because it is a simple technique, easy to handle, developed for small scale production, and for straw. The test with reed canary grass in this study showed that the technique worked well but that further adjustments and a longer test period are needed in order to achieve higher bulk density and mechanical strength. The test with chopped reed canary grass shows that a system with a forage harvester is slightly more effective than baling and cutting in a bale shredder. The study concluded that few existing heating plants of size 50 kW-1 MW that currently use wood fuels will be able to use reed canary grass without adjustment, conversion or replacement of the combustion equipment. Reed canary grass has 15-20 times higher ash content than wood briquettes and 2-3 times higher ash content than forest residue; the combustion equipment must be able to handle these properties. The boiler must be equipped with a continuously operating ashing system and it must be possible to move the ash bed mechanically. There is a risk of high content of unburned matter if the residence time in the boiler is too short, due to the structure and low bulk density of the reed canary grass ash. Using a blend of wood briquettes and reed canary briquettes results in lower ash content, but also affects the ash chemistry and tends to lower the initial ash fusion temperature compared to using 100 % reed canary grass. Blending chopped reed canary grass and wood chips in an existing small scale heating plant also requires measures to achieve an even fuel

Complementary DNA cloning of the major allergen Phl p I from timothy grass (Phleum pratense); recombinant Phl p I inhibits IgE binding to group I allergens from eight different grass species

NARCIS (Netherlands)

Laffer, S.; Valenta, R.; Vrtala, S.; Susani, M.; van Ree, R.; Kraft, D.; Scheiner, O.; Duchêne, M.

1994-01-01

BACKGROUND: Grass pollens, such as pollen from timothy grass (Phleum pratense), represent a major cause of type I allergy. OBJECTIVE: In this report we attempted to determine how cross-reactive allergenic components of grass pollens from different species can be represented by a minimum number of

Distribution, Diversity, and Long-Term Retention of Grass Short Interspersed Nuclear Elements (SINEs).

Science.gov (United States)

Mao, Hongliang; Wang, Hao

2017-08-01

Instances of highly conserved plant short interspersed nuclear element (SINE) families and their enrichment near genes have been well documented, but little is known about the general patterns of such conservation and enrichment and underlying mechanisms. Here, we perform a comprehensive investigation of the structure, distribution, and evolution of SINEs in the grass family by analyzing 14 grass and 5 other flowering plant genomes using comparative genomics methods. We identify 61 SINE families composed of 29,572 copies, in which 46 families are first described. We find that comparing with other grass TEs, grass SINEs show much higher level of conservation in terms of genomic retention: The origin of at least 26% families can be traced to early grass diversification and these families are among most abundant SINE families in 86% species. We find that these families show much higher level of enrichment near protein coding genes than families of relatively recent origin (51%:28%), and that 40% of all grass SINEs are near gene and the percentage is higher than other types of grass TEs. The pattern of enrichment suggests that differential removal of SINE copies in gene-poor regions plays an important role in shaping the genomic distribution of these elements. We also identify a sequence motif located at 3' SINE end which is shared in 17 families. In short, this study provides insights into structure and evolution of SINEs in the grass family. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Microsatellite markers for the native Texas perennial grass, Panicum hallii (Poaceae).

Science.gov (United States)

Lowry, David B; Purmal, Colin T; Meyer, Eli; Juenger, Thomas E

2012-03-01

We developed microsatellites for Panicum hallii for studies of gene flow, population structure, breeding experiments, and genetic mapping. Next-generation (454) genomic sequence data were used to design markers. Eighteen robust markers were discovered, 15 of which were polymorphic across six accessions of P. hallii var. hallii. Fourteen of the markers cross-amplified in a P. capillare accession. For the 15 polymorphic markers, the total number of alleles per locus ranged from two to 26 (mean: 11.0) across six populations (11-19 individuals per population). Observed heterozygosity (mean: 0.031) was 13.7 times lower than the expected heterozygosity (mean: 0.426). The deficit of heterozygous individuals is consistent with P. hallii having a high rate of self-fertilization. These markers will be useful for studies in P. hallii and related species.

Uptake of Radium by Grass and Shrubs Grown on Mineral Heaps: A Preliminary Study

International Nuclear Information System (INIS)

Laili, Z.; Omar, M.; Yusof, M.A. Wahab; Ibrahim, M.Z.

2015-01-01

A preliminary study of the uptake of 226 Ra and 228 Ra by grass and shrubs grown on mineral heaps was carried out. Activity concentrations of 226 Ra and 228 Ra in grass and shrubs were measured using gamma spectrometry. The result showed that grass and shrubs grown on mineral heaps contained elevated levels of radium compared to grass and shrubs grown on normal soils. Thus, these plants might be used for phytoremediation of radium contaminated soil. (author)

Potential of Cogon Grass as an Oil Sorbent

OpenAIRE

Wiloso, Edi Iswanto; Barlianti, Vera; Anggraini, Irni Fitria; Hendarsyah, Hendris

2012-01-01

Experiments on the potential of Cogon grass (lmperata cylindrica), a weed harmful to other plants, for use as a low-cost and biodegradable oil sorbent were carried out under various spill conditions. Flowers of Cogon grass adsorbed much larger amount of high-viscosity lubricating oil (57.9 g-oil/g-sorbent) than that adsorbed by Peat Sorb (7.7 g-oil/g-sorbent), a commercial oilsorbent based on peat. However, the flowers adsorbed only 27.9 g of low-viscosity crude oillgsorbent. In an oil-water ...

Botanical Composition, Grass Production, and Carrying Capacity of Pasture in Timor Tengah Selatan District

Directory of Open Access Journals (Sweden)

V. E. Se’u

2015-12-01

Full Text Available This study was conducted to analyze the botanical composition, grass production, carrying capacity, and potential production of nutrients in pasture located in Timor Tengah Selatan Regency. The experiment was conducted from February to July 2013, using field survey method. The botanical composition, grass production and carrying capacity on real condition were analyzed descriptively, while the grass production and carrying capacity based of cutting arrangement were analyzed by using randomized block factorial design with 3 altitude locations (Sub District of Mollo Utara with altitude of 1007 m above sea level; Sub District of Noebeba, 500 m ASL, and Sub District of Amanuban Selatan, 65 m ASL x 2 cutting intervals (1 and 2 month and 5 replications. The results showed that the grass type dominated the pasture in the Sub District of Mollo Utara, while legum type was more dominant in the pasture in the Sub Districts of Noebeba and Amanuban Selatan. The potential production of dry matter grass in Timor Tengah Selatan Regency based on real condition was 150 to 390 kg/ha/yr, this could accommodate 0.24 to 0.63 AU/ha/yr. The arrangement of cutting interval by 1 month in Mollo Utara and 2 months in Noebeba and Amanuban Selatan could increase (P<0.05 grass production and carrying capacity. The potential productions of grass nutrients were higher in Sub District of Mollo Utara, while potential production of grass dry matter was higher in Sub Districts of Noebeba and Amanuban Selatan. It was concluded that grass dry matter potential production and carrying capacity in Timor Tengah Selatan Regency were low. The arrangement of cutting interval could increase grass dry matter potential production, carrying capacity, nutrition production, and quality of nutrition.

Thermally treated grass fibers as colonizable substrate for beneficial bacterial inoculum

NARCIS (Netherlands)

Trifonova, R.D.; Postma, J.; Ketelaars, J.J.M.H.; Elsas, van J.D.

2008-01-01

This study investigates how thermally treated (i.e., torrefied) grass, a new prospective ingredient of potting soils, is colonized by microorganisms. Torrefied grass fibers (TGF) represent a specific colonizable niche, which is potentially useful to establish a beneficial microbial community that

Effects of urban grass coverage on rainfall-induced runoff in Xi'an loess region in China

Directory of Open Access Journals (Sweden)

Jing Li

2017-10-01

Full Text Available In this study, laboratory rainfall simulation experiments were conducted to investigate the regulatory effects of grass coverage on rainfall-runoff processes. A total of 80 grass blocks planted with well-grown manilagrass, together with their root systems, were sampled from an eastern suburban area of Xi'an City in the northwest arid area of China and sent to a laboratory for rainfall simulation experiments. The runoff and infiltration processes of a slope with different grass coverage ratios and vegetation patterns were analyzed. The results show that the runoff coefficient decreases with the increase of the grass coverage ratio, and the influence of grass coverage on the reduction of runoff shows a high degree of spatial variation. At a constant grass coverage ratio, as the area of grass coverage moves downward, the runoff coefficient, total runoff, and flood peak discharge gradually decrease, and the flood peak occurs later. With the increase of the grass coverage ratio, the flood peak discharge gradually decreases, and the flood peak occurs later as well. In conclusion, a high grass coverage ratio with the area of grass coverage located at the lower part of the slope will lead to satisfactory regulatory effects on rainfall-induced runoff.

Persistence of Overseeded Cool-Season Grasses in Bermudagrass Turf

OpenAIRE

Thomas Serensits; Matthew Cutulle; Jeffrey F. Derr

2011-01-01

Cool-season grass species are commonly overseeded into bermudagrass turf for winter color. When the overseeded grass persists beyond the spring; however, it becomes a weed. The ability of perennial ryegrass, Italian (annual) ryegrass, intermediate ryegrass, and hybrid bluegrass to persist in bermudagrass one year after seeding was determined. Perennial ryegrass, intermediate ryegrass, and Italian ryegrass produced acceptable ground cover in the spring after fall seeding. Hybrid bluegrass di...

BUFFEL GRASS MORPHOAGRONOMIC CHARACTERIZATION FROM Cenchrus GERMPLASM ACTIVE BANK

OpenAIRE

BRUNO, LEILA REGINA GOMES PASSOS; ANTONIO, RAFAELA PRISCILA; ASSIS, JOSÉ GERALDO DE AQUINO; MOREIRA, JOSÉ NILTON; LIRA, IRLANE CRISTINE DE SOUZA ANDRADE

2017-01-01

ABSTRACT This study aimed to characterize buffel grass accessions of the Cenchrus Germplasm Active Bank (CGAB) from Embrapa Semi-Arid in a morphoagronomic way, checking the descriptors variability and efficiency in accessions on two consecutive cuts. Twenty-five accessions and five buffel grass cultivars were used in randomized complete block design with three replications. Evaluations were conducted after two consecutive cuts, each evaluation performed 90 days after each cut. Characterizatio...

Nutritional composition and in vitro digestibility of grass and legume winter (cover) crops.

Science.gov (United States)

Brown, A N; Ferreira, G; Teets, C L; Thomason, W E; Teutsch, C D

2018-03-01

In dairy farming systems, growing winter crops for forage is frequently limited to annual grasses grown in monoculture. The objectives of this study were to determine how cropping grasses alone or in mixtures with legumes affects the yield, nutritional composition, and in vitro digestibility of fresh and ensiled winter crops and the yield, nutritional composition, and in vitro digestibility of the subsequent summer crops. Experimental plots were planted with 15 different winter crops at 3 locations in Virginia. At each site, 4 plots of each treatment were planted in a randomized complete block design. The 15 treatments included 5 winter annual grasses [barley (BA), ryegrass (RG), rye (RY), triticale (TR), and wheat (WT)] in monoculture [i.e., no legumes (NO)] or with 1 of 2 winter annual legumes [crimson clover (CC) and hairy vetch (HV)]. After harvesting the winter crops, corn and forage sorghum were planted within the same plots perpendicular to the winter crop plantings. The nutritional composition and the in vitro digestibility of winter and summer crops were determined for fresh and ensiled samples. Growing grasses in mixtures with CC increased forage dry matter (DM) yield (2.84 Mg/ha), but the yield of mixtures with HV (2.47 Mg/ha) was similar to that of grasses grown in monoculture (2.40 Mg/ha). Growing grasses in mixtures with legumes increased the crude protein concentration of the fresh forage from 13.0% to 15.5% for CC and to 17.3% for HV. For neutral detergent fiber (NDF) concentrations, the interaction between grasses and legumes was significant for both fresh and ensiled forages. Growing BA, RY, and TR in mixtures with legumes decreased NDF concentrations, whereas growing RG and WT with legumes did not affect the NDF concentrations of either the fresh or the ensiled forages. Growing grasses in mixtures with legumes decreased the concentration of sugars of fresh forages relative to grasses grown in monoculture. Primarily, this decrease can be

Interaction between Vetiver Grass Roots and Completely Decomposed Volcanic Tuff under Rainfall Infiltration Conditions

Directory of Open Access Journals (Sweden)

Ling Xu

2018-01-01

Full Text Available The important role of vetiver grass roots in preventing water erosion and mass movement has been well recognized, though the detailed influence of the grass roots on soil has not been addressed. Through planting vetiver grass at the Kadoorie Farm in Hong Kong and leaving it to grow without artificial maintenance, the paper studies the influence of vetiver grass roots on soil properties and slope stability. Under the natural conditions of Hong Kong, growth of the vetiver grass roots can reach 1.1 m depth after one and a half year from planting. The percentage of grain size which is less than 0.075 mm in rooted soil is more than that of the nonrooted soil. Vetiver grass roots can reduce soil erosion by locking the finer grain. The rooted soil of high finer grain content has a relatively small permeability. As a result, the increase in water content is therefore smaller than that of nonrooted soil in the same rainfall conditions. Shear box test reveals that the vetiver grass roots significantly increased the peak cohesion of the soil from 9.3 kPa to 18.9 kPa. The combined effects of grass roots on hydrological responses and shearing strength significantly stabilize the slope in local rainfall condition.

A proteomic style approach to characterize a grass mix product reveals potential immunotherapeutic benefit.

Science.gov (United States)

Bullimore, Alan; Swan, Nicola; Alawode, Wemimo; Skinner, Murray

2011-09-01

Grass allergy immunotherapies often consist of a mix of different grass extracts, each containing several proteins of different physiochemical properties; however, the subtle contributions of each protein are difficult to elucidate. This study aimed to identify and characterize the group 1 and 5 allergens in a 13 grass extract and to standardize the extraction method. The grass pollens were extracted in isolation and pooled and also in combination and analyzed using a variety of techniques including enzyme-linked immunosorbent assay, liquid chromatog-raphy-mass spectrometry, and sodium dodecyl sulfate-polyacrylam-ide gel electrophoresis. Gold-staining and IgE immunoblotting revealed a high degree of homology of protein bands between the 13 species and the presence of a densely stained doublet at 25-35 kD along with protein bands at approximately 12.5, 17, and 50 kD. The doublet from each grass species demonstrated a high level of group 1 and 5 interspecies homology. However, there were a number of bands unique to specific grasses consistent with evolutionary change and indicative that a grass mix immunotherapeutic could be considered broad spectrum. Sodium dodecyl sulfate-polyacrylamide gel electro-phoresis and IgE immunoblotting showed all 13 grasses share a high degree of homology, particularly in terms of group 1 and 5 allergens. IgE and IgG enzyme-linked immunosorbent assay potencies were shown to be independent of extraction method.

Proteolysis in tempeh-type products obtained with Rhizopus and Aspergillus strains from grass pea (Lathyrus sativus) seeds.

Science.gov (United States)

Starzyńska-Janiszewska, Anna; Stodolak, Bożena; Wikiera, Agnieszka

2015-01-01

Tempeh is a food product obtained from legumes by means of solid-state fermentation with Rhizopus sp. Our previous research proved that mixed-culture inoculum may also be successfully applied. The objective of present research was to study the proteolytic activity of R. microsporus var. chinensis and A. oryzae during tempeh-type fermentation of grass pea seeds, and the effect of inoculum composition on the protein level and in vitro protein bioavailability in products. Fermentation substrate were soaked and cooked grass pea seeds. Material was mixed with single- or mixed-culture inoculum, and incubated in perforated plastic bags at 30°C for 32 hrs. In the products, the proteolytic activity (pH 3, 5 and 7), glucosamine, total protein and free amino acids levels, as well as protein in vitro bioavailability and degree of protein hydrolysis were obtained. The significant correlation was found between glucosamine content and proteolytic activity in grass pea seeds fermented with Rhizopus or Aspergillus. The activities of Rhizopus proteases were higher than Aspergillus ones, which corresponded with the degree of seed protein hydrolysis. Both strains showed the highest activity of protease at pH 3. Tempeh made with pure culture of Rhizopus had 37% protein of 69% in-vitro bioavailability. Mixed-culture fermentation improved nutritional parameters of products only when the dose of Aspergillus spores in the inoculum was equal and lower than that of Rhizopus. This process resulted in higher in-vitro bioavailability of protein, slightly more efficient protein hydrolysis and higher level of free amino acids, as compared to standard tempeh. The activity of A. oryzae in tempeh-type fermentation is beneficial as long as it does not dominate the activity and/or growth of Rhizopus strain.

Invasive grasses change landscape structure and fire behavior in Hawaii

Science.gov (United States)

Lisa M. Ellsworth; Creighton M. Litton; Alexander P. Dale; Tomoaki Miura

2014-01-01

How does potential fire behavior differ in grass-invaded non-native forests vs open grasslands? How has land cover changed from 1950–2011 along two grassland/forest ecotones in Hawaii with repeated fires? A study on non-native forest with invasive grass understory and invasive grassland (Megathyrsus maximus) ecosystems on Oahu, Hawaii, USA was...

Ensiling as pretreatment of grass for lignocellulosic biomass conversion

DEFF Research Database (Denmark)

Ambye-Jensen, Morten

for subsequent enzymatic saccharification of cellulose and hemicellulose, by using the temperate grass Festulolium Hykor. The method was additionally combined with hydrothermal treatment, in order to decrease the required severity of an industrial applied pretreatment method. The first part of the project...... conditions providing the best possible pretreatment effect. The parameters were biomass composition, varied by ensiling of four seasonal cuts of grass, different dry matter (DM) content at ensiling, and an addition of different lactic acid bacteria species. First of all, the study confirmed that ensiling can...... act as a method of pretreatment and improve the enzymatic cellulose convertibility of grass. Furthermore, low DM ensiling was found to improve the effects of pretreatment due to a higher production of organic acids in the silage. The effect of applied lactic acid bacteria species was, however...

Cell wall composition throughout development for the model grass Brachypodium distanchyon

Directory of Open Access Journals (Sweden)

David eRancour

2012-12-01

Full Text Available Temperate perennial grasses are important worldwide as a livestock nutritive energy source and a potential feedstock for lignocellulosic biofuel production. The annual temperate grass Brachypodium distanchyon has been championed as a useful model system to facilitate biological research in agriculturally important temperate forage grasses based on phylogenetic relationships. To physically corroborate genetic predictions, we determined the chemical composition profiles of organ-specific cell walls throughout the development of two common diploid accessions of Brachypodium distanchyon, Bd21-3 and Bd21. Chemical analysis was performed on cell walls isolated from distinct organs (i.e. leaves, sheaths, stems and roots at three developmental stages of 1 12-day seedling, 2 vegetative-to-reproductive transition, and 3 mature seed-fill. In addition, we have included cell wall analysis of embryonic callus used for genetic transformations. Composition of cell walls based on components lignin, hydroxycinnamates, uronosyls, neutral sugars, and protein suggests that Brachypodium distanchyon is similar chemically to agriculturally important forage grasses. There were modest compositional differences in hydroxycinnamate profiles between accessions Bd21-3 and Bd21. In addition, when compared to agronomical important C3 grasses, more mature Brachypodium stem cell walls have a relative increase in glucose of 48% and a decrease in lignin of 36%. Though differences exists between Brachypodium and agronomical important C3 grasses, Brachypodium distanchyon should be still a useful model system for genetic manipulation of cell wall composition to determine the impact upon functional characteristics such as rumen digestibility or energy conversion efficiency for bioenergy production.

First evidence of grass carp recruitment in the Great Lakes Basin

Science.gov (United States)

Chapman, Duane C.; Davis, J. Jeremiah; Jenkins, Jill A.; Kocovsky, Patrick M.; Miner, Jeffrey G.; Farver, John; Jackson, P. Ryan

2013-01-01

We use aging techniques, ploidy analysis, and otolith microchemistry to assess whether four grass carp Ctenopharyngodon idella captured from the Sandusky River, Ohio were the result of natural reproduction within the Lake Erie Basin. All four fish were of age 1 +. Multiple lines of evidence indicate that these fish were not aquaculture-reared and that they were most likely the result of successful reproduction in the Sandusky River. First, at least two of the fish were diploid; diploid grass carp cannot legally be released in the Great Lakes Basin. Second, strontium:calcium (Sr:Ca) ratios were elevated in all four grass carp from the Sandusky River, with elevated Sr:Ca ratios throughout the otolith transect, compared to grass carp from Missouri and Arkansas ponds. This reflects the high Sr:Ca ratio of the Sandusky River, and indicates that these fish lived in a high-strontium environment throughout their entire lives. Third, Sandusky River fish were higher in Sr:Ca ratio variability than fish from ponds, reflecting the high but spatially and temporally variable strontium concentrations of southwestern Lake Erie tributaries, and not the stable environment of pond aquaculture. Fourth, Sr:Ca ratios in the grass carp from the Sandusky River were lower in their 2011 growth increment (a high water year) than the 2012 growth increment (a low water year), reflecting the observed inverse relationship between discharge and strontium concentration in these rivers. We conclude that these four grass carp captured from the Sandusky River are most likely the result of natural reproduction within the Lake Erie Basin.

Cell wall composition throughout development for the model grass Brachypodium distachyon

Science.gov (United States)

Rancour, David M.; Marita, Jane M.; Hatfield, Ronald D.

2012-01-01

Temperate perennial grasses are important worldwide as a livestock nutritive energy source and a potential feedstock for lignocellulosic biofuel production. The annual temperate grass Brachypodium distachyon has been championed as a useful model system to facilitate biological research in agriculturally important temperate forage grasses based on phylogenetic relationships. To physically corroborate genetic predictions, we determined the chemical composition profiles of organ-specific cell walls throughout the development of two common diploid accessions of Brachypodium distachyon, Bd21-3 and Bd21. Chemical analysis was performed on cell walls isolated from distinct organs (i.e., leaves, sheaths, stems, and roots) at three developmental stages of (1) 12-day seedling, (2) vegetative-to-reproductive transition, and (3) mature seed fill. In addition, we have included cell wall analysis of embryonic callus used for genetic transformations. Composition of cell walls based on components lignin, hydroxycinnamates, uronosyls, neutral sugars, and protein suggests that Brachypodium distachyon is similar chemically to agriculturally important forage grasses. There were modest compositional differences in hydroxycinnamate profiles between accessions Bd21-3 and Bd21. In addition, when compared to agronomical important C3 grasses, more mature Brachypodium stem cell walls have a relative increase in glucose of 48% and a decrease in lignin of 36%. Though differences exist between Brachypodium and agronomical important C3 grasses, Brachypodium distachyon should be still a useful model system for genetic manipulation of cell wall composition to determine the impact upon functional characteristics such as rumen digestibility or energy conversion efficiency for bioenergy production. PMID:23227028

Hygrothermal Properties and Performance of Sea Grass Insulation

DEFF Research Database (Denmark)

Eriksen, Marlene Stenberg Hagen; Laursen, Theresa Back; Rode, Carsten

2008-01-01

In the attempt to obtain knowledge of the hygrothermal properties of sea grass as thermal insulation, experiments have been carried out in the laboratory to determine the thermal conductivity, sorption properties and the water vapour permeability of the material. In order to investigate the hygro......In the attempt to obtain knowledge of the hygrothermal properties of sea grass as thermal insulation, experiments have been carried out in the laboratory to determine the thermal conductivity, sorption properties and the water vapour permeability of the material. In order to investigate...

Determination of 90Sr in grass and soil

International Nuclear Information System (INIS)

Bajo, S.; Keil, R.

1994-10-01

A radiochemical method for the determination of 90 Sr in non-contaminated grass and soil is presented. The method is based on the leaching of 90 Sr from the mineralized samples followed by liquid-liquid extraction of 90 Y, its short lived daughter, by tributylphosphate and precipitation of Y-oxalate, which is counted in a low-level proportional counter. Based on dried samples of 30 g of soil and 100 g of grass the limit of detection is about 0.1 Bq/kg for both materials. (author) figs., tabs., 43 refs

Current Models for Transcriptional Regulation of Secondary Cell Wall Biosynthesis in Grasses

Directory of Open Access Journals (Sweden)

Xiaolan Rao

2018-04-01

Full Text Available Secondary cell walls mediate many crucial biological processes in plants including mechanical support, water and nutrient transport and stress management. They also provide an abundant resource of renewable feed, fiber, and fuel. The grass family contains the most important food, forage, and biofuel crops. Understanding the regulatory mechanism of secondary wall formation in grasses is necessary for exploiting these plants for agriculture and industry. Previous research has established a detailed model of the secondary wall regulatory network in the dicot model species Arabidopsis thaliana. Grasses, branching off from the dicot ancestor 140–150 million years ago, display distinct cell wall morphology and composition, suggesting potential for a different secondary wall regulation program from that established for dicots. Recently, combined application of molecular, genetic and bioinformatics approaches have revealed more transcription factors involved in secondary cell wall biosynthesis in grasses. Compared with the dicots, grasses exhibit a relatively conserved but nevertheless divergent transcriptional regulatory program to activate their secondary cell wall development and to coordinate secondary wall biosynthesis with other physiological processes.

Endophytic Epichloë species and their grass hosts: from evolution to applications.

Science.gov (United States)

Saikkonen, Kari; Young, Carolyn A; Helander, Marjo; Schardl, Christopher L

2016-04-01

The closely linked fitness of the Epichloë symbiont and the host grass is presumed to align the coevolution of the species towards specialization and mutually beneficial cooperation. Ecological observations demonstrating that Epichloë-grass symbioses can modulate grassland ecosystems via both above- and belowground ecosystem processes support this. In many cases the detected ecological importance of Epichloë species is directly or indirectly linked to defensive mutualism attributable to alkaloids of fungal-origin. Now, modern genetic and molecular techniques enable the precise studies on evolutionary origin of endophytic Epichloë species, their coevolution with host grasses and identification the genetic variation that explains phenotypic diversity in ecologically relevant characteristics of Epichloë-grass associations. Here we briefly review the most recent findings in these areas of research using the present knowledge of the genetic variation that explains the biosynthetic pathways driving the diversity of alkaloids produced by the endophyte. These findings underscore the importance of genetic interplay between the fungus and the host in shaping their coevolution and ecological role in both natural grass ecosystems, and in the agricultural arena.

Aggressiveness of loose kernel smut isolate from Johnson grass on sorghum line BTx643

Science.gov (United States)

An isolate of loose kernel smut obtained from Johnson grass was inoculated unto six BTx643 sorghum plants in the greenhouse to determine its aggressiveness. All the BTx643 sorghum plants inoculated with the Johnson grass isolate were infected. Mean size of the teliospores from the Johnson grass, i...

Ultra-short-course booster is effective in recurrent grass pollen-induced allergic rhinoconjunctivitis.

Science.gov (United States)

Pfaar, O; Lang, S; Pieper-Fürst, U; Astvatsatourov, A; Gerich, F; Klimek, L; Kramer, M F; Reydelet, Y; Shah-Hosseini, K; Mösges, R

2018-01-01

A relevant proportion of allergic rhinoconjunctivitis (ARC) patients experience recurrent symptoms after successfully completing allergen immunotherapy (AIT). This prospective, controlled, noninterventional study used internationally standardized instruments to determine the clinical effects of a preseasonal, ultra-short-course booster AIT on clinical outcome parameters. This two-arm study included patients aged ≥12 years with recurrent grass pollen-induced seasonal AR who had completed a successful course of any grass pollen AIT at least 5 years before enrolment. Overall, 56 patients received one preseasonal short-course booster AIT using tyrosine-absorbed grass pollen allergoids containing the adjuvant monophosphoryl lipid A (MPL ® ); 51 control patients received symptomatic medication. The combined symptom and medication score (CSMS) was recorded in the (peak) grass pollen season. Furthermore, concomitant (antiallergic) medication use, the patients' state of health, Mini Rhinoconjunctivitis Quality of Life Questionnaire (MiniRQLQ) results and safety/tolerability of the treatment were assessed. The CSMS in the peak grass pollen season was significantly lower in the booster AIT group (Δ=38.4%, Pallergoids containing the adjuvant MPL ® effectively prevents re-occurrence of symptoms in patients with grass pollen-induced ARC. © 2017 The Authors. Allergy Published by John Wiley & Sons Ltd.

Phytophagous insect fauna tracks host plant responses to exotic grass invasion.

Science.gov (United States)

Almeida-Neto, Mário; Prado, Paulo I; Lewinsohn, Thomas M

2011-04-01

The high dependence of herbivorous insects on their host plants implies that plant invaders can affect these insects directly, by not providing a suitable habitat, or indirectly, by altering host plant availability. In this study, we sampled Asteraceae flower heads in cerrado remnants with varying levels of exotic grass invasion to evaluate whether invasive grasses have a direct effect on herbivore richness independent of the current disturbance level and host plant richness. By classifying herbivores according to the degree of host plant specialization, we also investigated whether invasive grasses reduce the uniqueness of the herbivorous assemblages. Herbivorous insect richness showed a unimodal relationship with invasive grass cover that was significantly explained only by way of the variation in host plant richness. The same result was found for polyphagous and oligophagous insects, but monophages showed a significant negative response to the intensity of the grass invasion that was independent of host plant richness. Our findings lend support to the hypothesis that the aggregate effect of invasive plants on herbivores tends to mirror the effects of invasive plants on host plants. In addition, exotic plants affect specialist insects differently from generalist insects; thus exotic plants affect not only the size but also the structural profile of herbivorous insect assemblages.

Group 5 allergens of timothy grass (Phl p 5) bear cross-reacting T cell epitopes with group 1 allergens of rye grass (Lol p 1).

Science.gov (United States)

Müller, W D; Karamfilov, T; Bufe, A; Fahlbush, B; Wolf, I; Jäger, L

1996-04-01

Selected human T cell clones reactive with group 5 allergens of timothy grass (Phl p 5) were cross-stimulated in specific proliferation assays with group 1 allergens of rye grass (Lol p 1). Such interspecies cross-reactivities result obviously from structural motifs presented on defined Phl p 5 fragments as shown with recombinant Phl p 5 products.

Phenology largely explains taller grass at successful nests in greater sage-grouse.

Science.gov (United States)

Smith, Joseph T; Tack, Jason D; Doherty, Kevin E; Allred, Brady W; Maestas, Jeremy D; Berkeley, Lorelle I; Dettenmaier, Seth J; Messmer, Terry A; Naugle, David E

2018-01-01

Much interest lies in the identification of manageable habitat variables that affect key vital rates for species of concern. For ground-nesting birds, vegetation surrounding the nest may play an important role in mediating nest success by providing concealment from predators. Height of grasses surrounding the nest is thought to be a driver of nest survival in greater sage-grouse ( Centrocercus urophasianus ; sage-grouse), a species that has experienced widespread population declines throughout their range. However, a growing body of the literature has found that widely used field methods can produce misleading inference on the relationship between grass height and nest success. Specifically, it has been demonstrated that measuring concealment following nest fate (failure or hatch) introduces a temporal bias whereby successful nests are measured later in the season, on average, than failed nests. This sampling bias can produce inference suggesting a positive effect of grass height on nest survival, though the relationship arises due to the confounding effect of plant phenology, not an effect on predation risk. To test the generality of this finding for sage-grouse, we reanalyzed existing datasets comprising >800 sage-grouse nests from three independent studies across the range where there was a positive relationship found between grass height and nest survival, including two using methods now known to be biased. Correcting for phenology produced equivocal relationships between grass height and sage-grouse nest survival. Viewed in total, evidence for a ubiquitous biological effect of grass height on sage-grouse nest success across time and space is lacking. In light of these findings, a reevaluation of land management guidelines emphasizing specific grass height targets to promote nest success may be merited.

Structural characterization of alkaline hydrogen peroxide pretreated grasses exhibiting diverse lignin phenotypes

Science.gov (United States)

2012-01-01

Background For cellulosic biofuels processes, suitable characterization of the lignin remaining within the cell wall and correlation of quantified properties of lignin to cell wall polysaccharide enzymatic deconstruction is underrepresented in the literature. This is particularly true for grasses which represent a number of promising bioenergy feedstocks where quantification of grass lignins is particularly problematic due to the high fraction of p-hydroxycinnamates. The main focus of this work is to use grasses with a diverse range of lignin properties, and applying multiple lignin characterization platforms, attempt to correlate the differences in these lignin properties to the susceptibility to alkaline hydrogen peroxide (AHP) pretreatment and subsequent enzymatic deconstruction. Results We were able to determine that the enzymatic hydrolysis of cellulose to to glucose (i.e. digestibility) of four grasses with relatively diverse lignin phenotypes could be correlated to total lignin content and the content of p-hydroxycinnamates, while S/G ratios did not appear to contribute to the enzymatic digestibility or delignification. The lignins of the brown midrib corn stovers tested were significantly more condensed than a typical commercial corn stover and a significant finding was that pretreatment with alkaline hydrogen peroxide increases the fraction of lignins involved in condensed linkages from 88–95% to ~99% for all the corn stovers tested, which is much more than has been reported in the literature for other pretreatments. This indicates significant scission of β-O-4 bonds by pretreatment and/or induction of lignin condensation reactions. The S/G ratios in grasses determined by analytical pyrolysis are significantly lower than values obtained using either thioacidolysis or 2DHSQC NMR due to presumed interference by ferulates. Conclusions It was found that grass cell wall polysaccharide hydrolysis by cellulolytic enzymes for grasses exhibiting a diversity of

Structural characterization of alkaline hydrogen peroxide pretreated grasses exhibiting diverse lignin phenotypes

Directory of Open Access Journals (Sweden)

Li Muyang

2012-06-01

Full Text Available Abstract Background For cellulosic biofuels processes, suitable characterization of the lignin remaining within the cell wall and correlation of quantified properties of lignin to cell wall polysaccharide enzymatic deconstruction is underrepresented in the literature. This is particularly true for grasses which represent a number of promising bioenergy feedstocks where quantification of grass lignins is particularly problematic due to the high fraction of p-hydroxycinnamates. The main focus of this work is to use grasses with a diverse range of lignin properties, and applying multiple lignin characterization platforms, attempt to correlate the differences in these lignin properties to the susceptibility to alkaline hydrogen peroxide (AHP pretreatment and subsequent enzymatic deconstruction. Results We were able to determine that the enzymatic hydrolysis of cellulose to to glucose (i.e. digestibility of four grasses with relatively diverse lignin phenotypes could be correlated to total lignin content and the content of p-hydroxycinnamates, while S/G ratios did not appear to contribute to the enzymatic digestibility or delignification. The lignins of the brown midrib corn stovers tested were significantly more condensed than a typical commercial corn stover and a significant finding was that pretreatment with alkaline hydrogen peroxide increases the fraction of lignins involved in condensed linkages from 88–95% to ~99% for all the corn stovers tested, which is much more than has been reported in the literature for other pretreatments. This indicates significant scission of β-O-4 bonds by pretreatment and/or induction of lignin condensation reactions. The S/G ratios in grasses determined by analytical pyrolysis are significantly lower than values obtained using either thioacidolysis or 2DHSQC NMR due to presumed interference by ferulates. Conclusions It was found that grass cell wall polysaccharide hydrolysis by cellulolytic enzymes for grasses

Explaining grass-nutrient patterns in a savanna rangeland of southern Africa

NARCIS (Netherlands)

Mutanga, O.; Prins, H.H.T.; Skidmore, A.K.; Wieren, van S.E.; Huizing, H.; Grant, R.; Peel, M.J.S.; Biggs, H.

2004-01-01

Aim The search for possible factors influencing the spatial variation of grass quality is an important step towards understanding the distribution of herbivores, as well as a step towards identifying crucial areas for conservation and restoration. A number of studies have shown that grass quality at

Identification of brome grass infestations in southwest Oklahoma using multi-temporal Landsat imagery

Science.gov (United States)

Yan, D.; de Beurs, K.

2013-12-01

The extensive infestation of brome grasses (Cheatgrass, Rye brome and Japanese brome) in southwest Oklahoma imposes negative impacts on local economy and ecosystem in terms of decreasing crop and forage production and increasing fire risk. Previously proposed methodologies on brome grass detection are found ill-suitable for southwest Oklahoma as a result of similar responses of background vegetation to inter-annual variability of rainfall. In this study, we aim to identify brome grass infestations by detecting senescent brome grasses using the 2011 Cultivated Land Cover Data Sets and the difference Normalized Difference Infrared Index (NDII) derived from multi-temporal Landsat imagery. Landsat imageries acquired on May 18th and June 10th 2013 by Operational Land Imager and Enhanced Thematic Mapper plus were used. The imagery acquisition dates correspond to the peak growth and senescent time of brome grasses, respectively. The difference NDII was calculated by subtracting the NDII image acquired in May from the June NDII image. Our hypotheses is that senescent brome grasses and crop/pasture fields harvested between the two image acquisition dates can be distinguished from background land cover classes because of their increases in NDII due to decreased water absorption by senescent vegetation in the shortwave infrared region. The Cultivated Land Cover Data Sets were used to further separate senescent brome grass patches from newly harvested crop/pasture fields. Ground truth data collected during field trips in June, July and August of 2013 were used to validate the detection results.

No positive feedback between fire and a nonnative perennial grass

Science.gov (United States)

Erika L. Geiger; Guy R. McPherson

2005-01-01

Semi-desert grasslands flank the “Sky Island” mountains in southern Arizona and Northern Mexico. Many of these grasslands are dominated by nonnative grasses, which potentially alter native biotic communities. One specific concern is the potential for a predicted feedback between nonnative grasses and fire. In a large-scale experiment in southern Arizona we investigated...

Herbaceous Legume Encroachment Reduces Grass Productivity and Density in Arid Rangelands.

Directory of Open Access Journals (Sweden)

Thomas C Wagner

Full Text Available Worldwide savannas and arid grasslands are mainly used for livestock grazing, providing livelihood to over a billion people. While normally dominated by perennial C4 grasses, these rangelands are increasingly affected by the massive spread of native, mainly woody legumes. The consequences are often a repression of grass cover and productivity, leading to a reduced carrying capacity. While such encroachment by woody plants has been extensively researched, studies on similar processes involving herbaceous species are rare. We studied the impact of a sustained and massive spread of the native herbaceous legume Crotalaria podocarpa in Namibia's escarpment region on the locally dominant fodder grasses Stipagrostis ciliata and Stipagrostis uniplumis. We measured tussock densities, biomass production of individual tussocks and tussock dormancy state of Stipagrostis on ten 10 m x 10 m plots affected and ten similarly-sized plots unaffected by C. podocarpa over eight consecutive years and under different seasonal rainfalls and estimated the potential relative productivity of the land. We found the percentage of active Stipagrostis tussocks and the biomass production of individual tussocks to increase asymptotically with higher seasonal rainfall reaching a maximum around 300 mm while the land's relative productivity under average local rainfall conditions reached only 40% of its potential. Crotalaria podocarpa encroachment had no effect on the proportion of productive grass tussocks, but reduced he productivity of individual Stipagrostis tussocks by a third. This effect of C. podocarpa on grass productivity was immediate and direct and was not compensated for by above-average rainfall. Besides this immediate effect, over time, the density of grass tussocks declined by more than 50% in areas encroached by C. podocarpa further and lastingly reducing the lands carrying capacity. The effects of C. podocarpa on grass productivity hereby resemble those of woody

The influence of short-term cold stress on the metabolism of non-structural carbohydrates in polar grasses

Directory of Open Access Journals (Sweden)

Łopieńska-Biernat Elżbieta

2017-06-01

Full Text Available Plants adapt to extremely low temperatures in polar regions by maximizing their photosynthetic efficiency and accumulating cryoprotective and osmoprotective compounds. Flowering plants of the family Poaceae growing in the Arctic and in the Antarctic were investigated. Their responses to cold stress were analyzed under laboratory conditions. Samples were collected after 24 h and 48 h of cold treatment. Quantitative and qualitative changes of sugars are found among different species, but they can differ within a genus of the family Poaceae. The values of the investigated parameters in Poa annua differed considerably depending to the biogeographic origin of plants. At the beginning of the experiment, Antarctic plants were acclimatized in greenhouse characterized by significantly higher content of sugars, including storage reserves, sucrose and starch, but lower total protein content. After 24 h of exposure to cold stress, much smaller changes in the examined parameters were noted in Antarctic plants than in locally grown specimens. Total sugar content and sucrose, starch and glucose levels were nearly constant in P. annua, but they varied significantly. Those changes are responsible for the high adaptability of P. annua to survive and develop in highly unsupportive environments and colonize new regions.

Differentiation of plant age in grasses using remote sensing

Science.gov (United States)

Knox, Nichola M.; Skidmore, Andrew K.; van der Werff, Harald M. A.; Groen, Thomas A.; de Boer, Willem F.; Prins, Herbert H. T.; Kohi, Edward; Peel, Mike

2013-10-01

Phenological or plant age classification across a landscape allows for examination of micro-topographical effects on plant growth, improvement in the accuracy of species discrimination, and will improve our understanding of the spatial variation in plant growth. In this paper six vegetation indices used in phenological studies (including the newly proposed PhIX index) were analysed for their ability to statistically differentiate grasses of different ages in the sequence of their development. Spectra of grasses of different ages were collected from a greenhouse study. These were used to determine if NDVI, NDWI, CAI, EVI, EVI2 and the newly proposed PhIX index could sequentially discriminate grasses of different ages, and subsequently classify grasses into their respective age category. The PhIX index was defined as: (AVNIRn+log(ASWIR2n))/(AVNIRn-log(ASWIR2n)), where AVNIRn and ASWIR2n are the respective normalised areas under the continuum removed reflectance curve within the VNIR (500-800 nm) and SWIR2 (2000-2210 nm) regions. The PhIX index was found to produce the highest phenological classification accuracy (Overall Accuracy: 79%, and Kappa Accuracy: 75%) and similar to the NDVI, EVI and EVI2 indices it statistically sequentially separates out the developmental age classes. Discrimination between seedling and dormant age classes and the adult and flowering classes was problematic for most of the tested indices. Combining information from the visible near infrared (VNIR) and shortwave infrared region (SWIR) region into a single phenological index captures the phenological changes associated with plant pigments and the ligno-cellulose absorption feature, providing a robust method to discriminate the age classes of grasses. This work provides a valuable contribution into mapping spatial variation and monitoring plant growth across savanna and grassland ecosystems.

Automated theorem proving theory and practice

CERN Document Server

Newborn, Monty

2001-01-01

As the 21st century begins, the power of our magical new tool and partner, the computer, is increasing at an astonishing rate. Computers that perform billions of operations per second are now commonplace. Multiprocessors with thousands of little computers - relatively little! -can now carry out parallel computations and solve problems in seconds that only a few years ago took days or months. Chess-playing programs are on an even footing with the world's best players. IBM's Deep Blue defeated world champion Garry Kasparov in a match several years ago. Increasingly computers are expected to be more intelligent, to reason, to be able to draw conclusions from given facts, or abstractly, to prove theorems-the subject of this book. Specifically, this book is about two theorem-proving programs, THEO and HERBY. The first four chapters contain introductory material about automated theorem proving and the two programs. This includes material on the language used to express theorems, predicate calculus, and the rules of...

Theorem Proving In Higher Order Logics

Science.gov (United States)

Carreno, Victor A. (Editor); Munoz, Cesar A.; Tahar, Sofiene

2002-01-01

The TPHOLs International Conference serves as a venue for the presentation of work in theorem proving in higher-order logics and related areas in deduction, formal specification, software and hardware verification, and other applications. Fourteen papers were submitted to Track B (Work in Progress), which are included in this volume. Authors of Track B papers gave short introductory talks that were followed by an open poster session. The FCM 2002 Workshop aimed to bring together researchers working on the formalisation of continuous mathematics in theorem proving systems with those needing such libraries for their applications. Many of the major higher order theorem proving systems now have a formalisation of the real numbers and various levels of real analysis support. This work is of interest in a number of application areas, such as formal methods development for hardware and software application and computer supported mathematics. The FCM 2002 consisted of three papers, presented by their authors at the workshop venue, and one invited talk.

Diet Switching by Mammalian Herbivores in Response to Exotic Grass Invasion.

Directory of Open Access Journals (Sweden)

Carolina Bremm

Full Text Available Invasion by exotic grasses is a severe threat to the integrity of grassland ecosystems all over the world. Because grasslands are typically grazed by livestock and wildlife, the invasion is a community process modulated by herbivory. We hypothesized that the invasion of native South American grasslands by Eragrostis plana Nees, an exotic tussock-forming grass from Africa, could be deterred by grazing if grazers switched dietary preferences and included the invasive grass as a large proportion of their diets. Bos taurus (heifers and Ovis aries (ewes grazed plots with varying degrees of invasion by E. plana in a replicated manipulative experiment. Animal positions and species grazed were observed every minute in 45-min grazing session. Proportion of bites and steps in and out of E. plana tussocks were measured and used to calculate several indices of selectivity. Both heifers and ewes exhibited increasing probability of grazing E. plana as the proportion of area covered by tussocks increased, but they behaved differently. In agreement with expectations based on the allometry of dietary preferences and morphology, ewes consumed a low proportion of E. plana, except in areas that had more than 90% E. plana cover. Heifers consumed proportionally more E. plana than ewes. Contrary to our hypothesis, herbivores did not exhibit dietary switching towards the invasive grass. Moreover, they exhibited avoidance of the invasive grass and preference for short-statured native species, both of which should tend to enhance invasion. Unless invasive plants are highly palatable to livestock, the effect of grazing to deter the invasion is limited, due to the inherent avoidance of the invasive grass by the main grazers in the ecosystem, particularly sheep.

Development of herbicide resistance in black-grass (Alopecurus myosuroides in Bavaria

Directory of Open Access Journals (Sweden)

Gehring, Klaus

2016-02-01

Full Text Available Black-grass (Alopecurus myosuroides is one of the most important grass weeds in Bavaria. Chemical weed control with high efficacy is very important in crops like winter cereals, oilseed rape and maize. Crop rotations with more winter cereals, reduced soil cultivation and e.g. contract harvesting enhanced distribution of blackgrass in arable farming regions. Effects of herbicide resistance were observed since the last 20 years. The blackgrass herbicide resistance is well observed by the official plant protection service of Bavaria. A wide experience of resistance tests shows the development of resistant black-grass and provides an opportunity for future prospects in resistance dynamics.

Effect of Two Oil Dispersants on Larval Grass Shrimp (Palaemonetes pugio) Development.

Science.gov (United States)

Betancourt, P.; Key, P. B.; Chung, K. W.; DeLorenzo, M. E.

2015-12-01

The study focused on the effects that two oil dispersants, Corexit® EC9500A and Finasol® OSR52, have on the development of larval grass shrimp, (Palaemonetes pugio). The hypothesis was that Finasol would have a greater effect on larval grass shrimp development than Corexit. The experiment was conducted using 300 grass shrimp larvae that were 24 hours old. Each larva was exposed individually. In total, five sub-lethal concentrations were tested for each dispersant (control, 1.25, 2.50, 5.0,10.0 mg/L). The larvae were exposed for five days then transferred to clean seawater until metamorphosis into the juvenile stage. Key data measurements recorded included number of days to become juveniles, number of instars, length, dry weight, and mortality. Data from exposed shrimp was compared to the results of the control for each dispersant concentration. Corexit and Finasol exposure treatments of 5 mg/L and 10 mg/L showed significantly higher values for number of days and number of instars to reach juvenile status than values obtained from unexposed, control shrimp. Overall, mortality was higher in the Finasol treatments but the two dispersants did not respond significantly different from one another. Future studies are needed to determine the long term effects of dispersant exposure on all grass shrimp life stages and how any dispersant exposure impacts grass shrimp populations. Grass shrimp serve as excellent toxicity indicators of estuaries, and further studies will help to develop better oil spill mitigation techniques.

Ensiling and hydrothermal pretreatment of grass: Consequences for enzymatic biomass conversion and total monosaccharide yields

DEFF Research Database (Denmark)

Ambye-Jensen, Morten; Johansen, Katja Salomon; Didion, Thomas

2014-01-01

Ensiling may act as a pretreatment of fresh grass biomass and increase the enzymatic conversion of structural carbohydrates to fermentable sugars. However, ensiling does not provide sufficient severity to be a standalone pretreatment method. Here, ensiling of grass is combined with hydrothermal...... treatment (HTT) with the aim of improving the enzymatic biomass convertibility and decrease the required temperature of the HTT. Results: Grass silage (Festulolium Hykor) was hydrothermally treated at temperatures of 170, 180, and 190°C for 10 minutes. Relative to HTT treated dry grass, ensiling increased...... convertibility). The effect of ensiling of grass prior to HTT improved the enzymatic conversion of cellulose for HTT at 170 and 180°C, but the increased glucose release did not make up for the loss of water soluble carbohydrates (WSC) during ensiling. Overall, sugar yields (C6 + C5) were similar for HTT of grass...

Taxonomic studies of grasses and their indigenous uses in the salt ...

African Journals Online (AJOL)

STORAGESEVER

2009-01-19

Jan 19, 2009 ... countries like United States, the principal sources of meat ... Many species of native and introduced grasses are utilized in improved ... turning northwest to cross the river Indus near Kalabagh. (Ahmad and ... Key to the identification of grasses of Salt Range of Pakistan. S. No ...... Under shade of trees.

Productivity and nutritive value of three grass-legume mixtures in the ...

African Journals Online (AJOL)

Productivity and nutritive value of three grass-legume mixtures in the Sudan savannah zone Kano state, Nigeria. ... Results of the study indicated that Sorghum almum-Lablab purpureus mixture recorded numerically higher dry matter yield (7806 kg dm/hectare) compared to other mixtures, similarly leaf area for grass (46.4) ...

Rumen fermentation profile and intestinal digestibility of maize and grass silages

NARCIS (Netherlands)

Ali, M.

2013-01-01

Maize and grass silages are commonly used as major feed materials for dairy cows in Europe and are becoming common parts of dairy cow rations in other parts of the world. Thenutritive value of maize and grass silages varies greatly due to variation in chemical composition. A combination of

The uptake of uranium from soil to vetiver grass (vetiver zizanioides (L.) nash)

International Nuclear Information System (INIS)

Luu Viet Hung; Bui Duy Cam; Dang Duc Nhan

2012-01-01

Uranium uptake of vetiver grass (Vetiveria zizanioides (L.) Nash) from Eutric Fluvisols (AK), Albic Acrisols (LP), Dystric Fluvisols (TT) and Ferralic Acrisols (TC) in northern Vietnam is assessed. The soils were mixed with aqueous solution of uranyl nitrate to make soils be contaminated with uranium at 0, 50, 100, 250 mg per kg before planting the grass. The efficiency of uranium uptake by the grass was assessed based on the soil-to-plant transfer factor (TF U , kg kg -1 ). It was found that the TF U values are dependent upon the soil properties. CEC facilitates the uptake and the increase soil pH could reduce the uptake and translocation of uranium in the plant. Organic matter content as well as ferrous and potassium inhibit the uranium uptake of the grass. It was revealed that the lower fertile soil the higher uranium uptake. The grass could tolerate to the high extent (up to 77%) of uranium in soils and could survive and grow well without fertilization. The translocation of uranium in root for all the soil types studies almost higher than that in its shoot. It seem that vetiver grass potentially be use for the purpose of phytoremediation of soils contaminated with uranium. (author)

Chemical composition of elephant grass silages supplemented with different levels of dehydrated cashew bagasse

Directory of Open Access Journals (Sweden)

Danillo Glaydson Farias Guerra

2016-04-01

Full Text Available The objective of the present study was to evaluate the chemical composition of elephant grass silages supplemented with different levels dried cashew bagasse (DCB. Our experiment used a randomized design replicated four times, each replicate consisting of the following five treatments: 100% elephant grass; 95% elephant grass + 5% DCB; 90% elephant grass + 10% DCB; 85% elephant grass + 15% DCB; and 80% elephant grass + 20% DCB. The elephant grass was cut manually to a residual height of 5 cm at 80 days of age, and cashew bagasse was obtained from the processing of cashew stalks used in fruit pulp manufacturing in Mossoró/RN. Plastic buckets were used as experimental silos, and 90 days after ensiling the experimental silos were opened and the contents analyzed. The addition of dried cashew bagasse to silage linearly increased the levels of dried matter and crude protein by 0.59% and 0.13%, respectively, for each 1% addition (P < 0.05. The neutral detergent fiber and acid detergent content of the silages was reduced by 0.22% and 0.09%, respectively, for each 1% addition of the bagasse. The total carbohydrate content was not influenced by the bagasse addition (P > 0.05, and averaged 82.29%. The levels of non-fiber carbohydrate showed linear growth (P < 0.05 as the dehydrated cashew bagasse was added, and pH and ammoniacal nitrogen levels were reduced. The addition of the dehydrated bagasse to elephant grass silage improves its chemical composition, and it can be effectively added up to the level of 20%.

Relevance of Allergenic Sensitization to Cynodon dactylon and Phragmites communis: Cross-reactivity With Pooideae Grasses.

Science.gov (United States)

López-Matas, M A; Moya, R; Cardona, V; Valero, A; Gaig, P; Malet, A; Viñas, M; García-Moral, A; Labrador, M; Alcoceba, E; Ibero, M; Carnés, J

The homologous group of sweet grasses belongs to the Pooideae subfamily, but grass pollen species from other subfamilies can also cause allergy, such as Cynodon dactylon (Chloridoideae) and Phragmites communis (Arundinoideae). C dactylon and P communis have not been included in the sweet grasses homologous group because of their low cross-reactivity with other grasses. The aims of this study were to investigate the profile of sensitization to C dactylon and P communis in patients sensitized to grasses and to analyze cross-reactivity between these 2 species and temperate grasses. Patients were skin prick tested with a grass mixture (GM). Specific IgE to GM, C dactylon, P communis, Cyn d 1, and Phl p 1 was measured by ImmunoCAP. A pool of sera was used for the immunoblot assays. Cross-reactivity was studied by ELISA and immunoblot inhibition. Thirty patients had sIgE to GM. Twenty-four (80%) had positive results for C dactylon, 27 (90%) for P communis, 22 (73.3%) for nCyn d 1, and 92.9% for rPhl p 1. Bands were detected in the 3 extracts by immunoblot. Inhibition of GM was not observed with C dactylon or P communis by immunoblot or ELISA inhibition. When C dactylon or P communis were used in the solid phase, GM produced almost complete inhibition. Eighty percent of patients sensitized to grasses were also sensitized to C dactylon and 90% were sensitized to P communis. Sensitization to these species seems to be induced by allergens different to those in sweet grasses.

POTENTIALS OF AGRICULTURAL WASTE AND GRASSES IN ...

African Journals Online (AJOL)

Shima

Potentials of some agricultural waste and grasses were investigated. ... to education, printing, publishing and ... technical form, paper is an aqueous deposit ..... Period of. Soaking. Overnight. Overnight. Overnight. Overnight. Overnight.

Determination of trace element contents in grass samples for cattle feeding using NAA techniques

Energy Technology Data Exchange (ETDEWEB)

Yusof, Alias Mohamad; Jagir Singh, Jasbir Kaur

1987-09-01

An investigation on trace elements contents in six types of grass samples used for cattle feeding have been carried out using NAA techniques. The grass samples, Mardi Digit, African Star, Signal, Guinea, Setaria and Setaria Splendida were found to contain at least 19 trace elements in varying concentrations. The results were compared to the figures obtained from available sources to ascertain the status as to whether the grass samples studied would satisfy the minimum requirements of trace elements present in grass for cattle feeding or otherwise. Preference made on the suitability of the grass samples for cattle feeding was based on the availability and abundance of the trace elements, taking into account factors such as the degree of toxicity, inadequate amounts and contamination due to the presence of other trace elements not essential for cattle feeding.

Determination of trace element contents in grass samples for cattle feeding using NAA techniques

International Nuclear Information System (INIS)

Alias Mohamad Yusof; Jasbir Kaur Jagir Singh

1987-01-01

An investigation on trace elements contents in six types of grass samples used for cattle feeding have been carried out using NAA techniques. The grass samples, Mardi Digit, African Star, Signal, Guinea, Setaria and Setaria Splendida were found to contain at least 19 trace elements in varying concentrations. The results were compared to the figures obtained from available sources to ascertain the status as to whether the grass samples studied would satisfy the minimum requirements of trace elements present in grass for cattle feeding or otherwise. Preference made on the suitability of the grass samples for cattle feeding was based on the availability and abundance of the trace elements, taking into account factors such as the degree of toxicity, inadequate amounts and contamination due to the presence of other trace elements not essential for cattle feeding. (author)

NITROGEN CONTENT AND DRY-MATTER DIGESTIBILITY OF GUINEA AND SABI GRASSES AS INFLUENCED BY TREE LEGUME CANOPY

Directory of Open Access Journals (Sweden)

Andi Lagaligo Amar

2012-08-01

Full Text Available A research study was undertaken to study the grass layer across a mini landscape dominated by tree legume Albizia lebbeck to explore the nutritional differences of two introduced grasses, guinea grass (Panicum maximum and sabi grass (Urochloa mosambicensis, paying particular attention to the presence or absence of tree legume canopy of Albizia lebbeck. The two grass species showed a tendency to replace the native spear grass (Heteropogon contortus; their dominance was more or less complete under tree canopies but was increasing in open areas between trees. Nutritional differences were examined by nitrogen concentration and dry matter digestibility. For comparison, Heteropogon contortus, a native species only found in the open, was included in the nutritional determination using the same methods as the guinea and sabi grasses. The quality parameters of the pasture species were statistically compared (LSD, P=0.05. The quality of herbage was different between the species. Urochloa mosambicensis was better than Panicum maximum. In the open, sabi grass has higher N content (0.62% than guinea grass (0.55%, but they were similar when grown under the canopy (0.69% and 0.72%, respectively. Sabi grass has consistently higher dry matter digestibility (41.39% and 36.83%, respectively under the canopy and in the open, than guinea grass (27.78% and 24.77%. These two species are much higher in both N concentration and dry matter digestibility than the native spear grass. The native species has contained 0.28% N, and 17.65% digestible dry matter. The feeding values of herbage were influenced by the canopy factor. Both guinea and sabi grasses have better quality when grown under the tree canopies than in between canopies. Nitrogen concentration and dry matter digestibility of the guinea grass under canopy were, 0.72% and 27.78%, respectively, significantly higher than those from the open area, 0.55% and 24.77%. Similarly, herbage of sabi grass under canopy has 0

Evaluating poverty grass (Danthonia spicata) for golf courses in the Midwest

Science.gov (United States)

Nadia E. Navarrete-Tindall; J.W. Van Sambeek

2010-01-01

Poverty grass (Danthonia spicata (L.) P. beauv. Ex Roem & Schult. ) results presented here are part of ongoing studies to evaluate its adaptation for golf courses as part of low maintenance natural communities at Lincoln University of Missouri. Because its natural adaptation to shade and poor soils, poverty grass could be established in golf...

PRODUCTION OF PRINTING AND WRITING PAPER GRADE PULP FROM ELEPHANT GRASS

Directory of Open Access Journals (Sweden)

Marcela Freitas Andrade

2016-09-01

Full Text Available The main goal of this study was to characterize chemically and morphologically elephant grass (Pennisetum purpureum, and evaluate the potential of its fibers for production of printing and writing paper grade pulp. The elephant grass was chemically and morphologically characterized and cooked by the soda process to two different degrees of delignification (kappa 17.5 and 10.6. The resulting pulps were fully bleached by the O-D*-(EP-D sequence and characterized for their beatability, drainability and physical-mechanical properties. The lignin content (20.2% was low, indicating that this grass should be easier to pulp. The morphological analyses of the elephant grass indicated a short fiber material, similar to hardwoods. The soda pulp from elephant grass cooked to kappa number 17.5 presented higher screened yield than 10.6 kappa pulp, with alkali demands of 15.0% and 20.0%, respectively. The total active chlorine required by the 17.5 and 10.6 kappa pulps, were 42.1 and 35.1 kg/odt pulp, respectively, to achieve an ISO brightness of approximately 90.0%. The bleached soda pulps cooked to 17.5 and 10.6 kappa number showed similar refinability and resistance to drainage, but the tensile and burst index were highest for the 17.5 kappa pulp at beating energy consumptions in the range of 0-6 Wh. It was concluded that both 10.6 and 17.5 kappa pulps from elephant grass are suitable for the production of printing and writing paper grade pulps, but the highest kappa 17.5 pulp is more economically attractive given its highest pulping yield, despite the significantly increased of chemical demand for bleaching A produção de papel para impressão e escrita Grau de celulose a partir de capim-elefante.

'Bio-energy Schaffhausen': biogas, proteins and fibres, all three from grass

International Nuclear Information System (INIS)

Widmer, F.; Mueller, P.H.

2002-01-01

Bioenergie Schaffhausen Ltd., Switzerland, has commissioned the first industrial bio-refinery for processing grass. This unique grass refinery process provides a new industrial utilisation of grass. The products are green power and technical fibres for heat and sound insulation. The green electricity and green gas are made and sold by Etawatt Ltd. and Schaffhausen City Works, the green heat is used internally as process heat. All plant components are utilised for generation of value-added products, which makes the plant economically profitable even at a relatively small scale. The fully continuous and automated plant includes raw material reception, pre-treatment, fractionation, separation, and drying of fibres; separation of protein; juice treatment and conversion to biogas in a so-called UASB reactor; gas cleaning and conversion to electricity and process heat in a combined heat and power plant. The design capacity of the plant is 20,000 t fresh grass or 5,000 t dry substance input per year in two shifts. The plant supplier is '2B Biorefineries' (www.2bio.ch). The start up was in October 2001. Over 500 tons of grass have been processed. The grass refinery has produced so far 78,000 m 3 biogas, 150,000 kWh green electricity and 250,000 kWh green heat. Further, 80 tons of insulation fibres have been produced and sold in the market under the brand name '2B Gratec'. Over 30 buildings have been insulated. The washer and drier have not reached production capacity. The drying is a critical process for fibre quality. The drier is being modified and a new washer is being installed. It is planned to run at design capacity from May 2003. (author)

Estimating the content of clover and grass in the sward using a consumer camera and image processing

DEFF Research Database (Denmark)

Mortensen, Anders Krogh; Karstoft, Henrik; Søegaard, Karen

the dry matter ratio of clover and grass in clover grass fields from sparse close up images. First, the light conditions is determined, which is used for selecting model parameters to estimate the coverage of both clover and grass. Next, the clover and grass coverage are transformed to give the dry matter...

Evaluation of six candidate DNA barcode loci for identification of five important invasive grasses in eastern Australia.

Directory of Open Access Journals (Sweden)

Aisuo Wang

Full Text Available Invasive grass weeds reduce farm productivity, threaten biodiversity, and increase weed control costs. Identification of invasive grasses from native grasses has generally relied on the morphological examination of grass floral material. DNA barcoding may provide an alternative means to identify co-occurring native and invasive grasses, particularly during early growth stages when floral characters are unavailable for analysis. However, there are no universal loci available for grass barcoding. We herein evaluated the utility of six candidate loci (atpF intron, matK, ndhK-ndhC, psbE-petL, ETS and ITS for barcode identification of several economically important invasive grass species frequently found among native grasses in eastern Australia. We evaluated these loci in 66 specimens representing five invasive grass species (Chloris gayana, Eragrostis curvula, Hyparrhenia hirta, Nassella neesiana, Nassella trichotoma and seven native grass species. Our results indicated that, while no single locus can be universally used as a DNA barcode for distinguishing the grass species examined in this study, two plastid loci (atpF and matK showed good distinguishing power to separate most of the taxa examined, and could be used as a dual locus to distinguish several of the invasive from the native species. Low PCR success rates were evidenced among two nuclear loci (ETS and ITS, and few species were amplified at these loci, however ETS was able to genetically distinguish the two important invasive Nassella species. Multiple loci analyses also suggested that ETS played a crucial role in allowing identification of the two Nassella species in the multiple loci combinations.

The effects of energy grass plantations on biodiversity. 2nd annual report

Energy Technology Data Exchange (ETDEWEB)

Semere, T.; Slater, F.

2004-07-01

This report, which covers the year 2003 growing season, is the second annual report about a project to investigate the ecological impact on biodiversity of plantations of biomass grass crops grown in Hertfordshire in the UK. Wildlife monitoring was carried out at five field sites growing the perennial rhizomatous grass crops Miscanthus, reed canary grass and switch grass. The report covers the findings from wildlife surveys for the 2003 season, the final results from the invertebrate identification from the 2002 season, data entry from the 2002 and 2003 seasons, and the continued invertebrate identification during the 2003 season. Butterfly assessments and an evaluation of crop characteristics such as plant height, plant/stem density and biomass yield were also performed. Results are presented with respect to crop field characteristics, pests and diseases, ground flora, ground beetles, birds, small mammals, butterflies and epigeal invertebrates. Plans for the next growing season are outlined.

Climate change and the invasion of California by grasses

DEFF Research Database (Denmark)

Sandel, Brody Steven; Dangremond, Emily

2012-01-01

Over the next century, changes in the global climate are expected to have major consequences for plant communities, possibly including the exacerbation of species invasions. We evaluated this possibility in the grass flora of California, which is economically and ecologically important and heavily...... invaded. We used a novel, trait-based approach involving two components: identifying differences in trait composition between native and exotic components of the grass flora and evaluating contemporary trait–climate relationships across the state. The combination of trait–climate relationships and trait...

Monitoring the Distribution and Dynamics of an Invasive Grass in Tropical Savanna Using Airborne LiDAR

Directory of Open Access Journals (Sweden)

Shaun R. Levick

2015-04-01

Full Text Available The spread of an alien invasive grass (gamba grass—Andropogon gayanus in the tropical savannas of Northern Australia is a major threat to habitat quality and biodiversity in the region, primarily through its influence on fire intensity. Effective control and eradication of this invader requires better insight into its spatial distribution and rate of spread to inform management actions. We used full-waveform airborne LiDAR to map areas of known A. gayanus invasion in the Batchelor region of the Northern Territory, Australia. Our stratified sampling campaign included wooded savanna areas with differing degrees of A. gayanus invasion and adjacent areas of native grass and woody tree mixtures. We used height and spatial contiguity based metrics to classify returns from A. gayanus and developed spatial representations of A. gayanus occurrence (1 m resolution and canopy cover (10 m resolution. The cover classification proved robust against two independent field-based investigations at 500 m2 (R2 = 0.87, RMSE = 12.53 and 100 m2 (R2 = 0.79, RMSE = 14.13 scale. Our mapping results provide a solid benchmark for evaluating the rate and pattern of A. gayanus spread from future LiDAR campaigns. In addition, this high-resolution mapping can be used to inform satellite image analysis for the evaluation of A. gayanus invasion over broader regional scales. Our research highlights the huge potential that airborne LiDAR holds for facilitating the monitoring and management of savanna habitat condition.

Immunochemical Analysis of Paxilline and Ergot Alkaloid Mycotoxins in Grass Seeds and Plants.

Science.gov (United States)

Bauer, Julia I; Gross, Madeleine; Cramer, Benedikt; Humpf, Hans-Ulrich; Hamscher, Gerd; Usleber, Ewald

2018-01-10

Limited availability of toxin standards for lolitrem B and ergovaline impedes routine control of grasses for endophyte toxins. This study aimed at assessing the applicability of an enzyme immunoassay (EIA) for the indole-diterpene mycotoxin paxilline, in combination with a generic EIA for ergot alkaloids, as alternative parameters for screening purposes. Analysis of grass seeds and model pastures of four different grass species showed that both EIAs yielded highly positive results for paxilline and ergot alkaloids in perennial ryegrass seeds. Furthermore, evidence for natural occurrence of paxilline in grass in Germany was obtained. High performance liquid chromatography-tandem mass spectrometry analysis qualitatively confirmed the paxilline EIA results but showed that paxilline analogues 1'-O-acetylpaxilline and 13-desoxypaxilline were the predominant compounds in seeds and grass. In the absence of easily accessible reference standards for specific analysis of some major endophyte toxins, analysis of paxilline and ergot alkaloids by EIA may be suitable substitute parameters. The major advantage of this approach is its ease of use and speed, providing an analytical tool which could enhance routine screening for endophyte toxins in pasture.

Effects of soil microorganisms on uptake of 89Sr by ryegrass and bahia grass

International Nuclear Information System (INIS)

Zhong Weiliang; Liu Kexing

2006-01-01

In present study, 60 Co γ-rays was used to irradiate soil with doses of 3.0 kGy and 25.0 kGy, respectively, to discriminate between arbuscular mycorrhizal (AM) fungi and other soil microorganisms, while soil without irradiation was used as control to study the effects of soil microorganisms on uptake of 89 Sr by ryegrass and bahia grass. The results showed that the AM infection rates in ryegrass and bahia grass were 48.0% and 28.0% in the control soil, respectively which indicated that both grass species were prone to forming AM symbiosis with AM fungi. Although AM fungi and other soil microorganisms had no significant effect on above ground biomass in ryegrass and bahia grass, both AM fungi and other soil microorganisms decreased the uptake of 89 Sr in the two grass species, though to a more or less extant. (authors)

Models and Techniques for Proving Data Structure Lower Bounds

DEFF Research Database (Denmark)

Larsen, Kasper Green

In this dissertation, we present a number of new techniques and tools for proving lower bounds on the operational time of data structures. These techniques provide new lines of attack for proving lower bounds in both the cell probe model, the group model, the pointer machine model and the I...... bound of tutq = (lgd􀀀1 n). For ball range searching, we get a lower bound of tutq = (n1􀀀1=d). The highest previous lower bound proved in the group model does not exceed ((lg n= lg lg n)2) on the maximum of tu and tq. Finally, we present a new technique for proving lower bounds....../O-model. In all cases, we push the frontiers further by proving lower bounds higher than what could possibly be proved using previously known techniques. For the cell probe model, our results have the following consequences: The rst (lg n) query time lower bound for linear space static data structures...

Induced mutations in highly heterozygous vegetatively propagated grasses

International Nuclear Information System (INIS)

Powell, J.B.

1976-01-01

Experience with mutation induction of turf and forage grasses indicates that much progress can be achieved by this method. More than 300 mutations have been produced in our laboratory in the cultivars Tifgreen and Tifdwarf bermudagrass (Cynodon sp.). In the Tifway and Tifcote bermudagrasses we have demonstrated similar mutation responses. The first three clones are triploids and Tifcote is a probable tetraploid. No seeds are set on these clones. Two clones of bermudagrass, Coastal and Coastcross-1, occupy millions of hectares in the USA. Both are mutable and are known to be hybrids with 36 chromosomes. Biotypes of dallisgrass (Paspalum dilatatum Poir.) exist with 40 and 50 chromosomes and reproduce as sexual and obligate apomictic forms. Gamma-ray and thermal-neutron treatment of seed of these biotypes produced mutants that maintained the maternal characteristics in subsequent generations. Bahiagrass (Paspalum notatum Fluegge) also has sexual and apomictic biotypes. Some success was indicated for increased seed set by mutagen treatment. Kentucky bluegrass (Poa pratensis L.) is a facultative apomict with varying numbers of chromosomes in different cultivars. Gamma-ray mutagen treatment of rhizomes produced numerous mutations for plant type and disease reaction. Most mutations perpetuate themselves through the seed. The characteristic in common with all these grasses is their heterozygosity, which is maintained by the vegetative propagation or apomictic mode of reproduction. The experience in using ionizing radiation to induce heritable changes in these vegetatively propagated grasses is one of considerable success. Mutation rates in some of these irradiated grasses exceeded 65% and aberrant plants with characteristics previously never observed were found. Numerous hemizygous and heterozygous loci seem to be a sensitive target for mutagens. (author)

Effects of field-grown genetically modified Zoysia grass on bacterial community structure.

Science.gov (United States)

Lee, Yong-Eok; Yang, Sang-Hwan; Bae, Tae-Woong; Kang, Hong-Gyu; Lim, Pyung-Ok; Lee, Hyo-Yeon

2011-04-01

Herbicide-tolerant Zoysia grass has been previously developed through Agrobacterium-mediated transformation. We investigated the effects of genetically modified (GM) Zoysia grass and the associated herbicide application on bacterial community structure by using culture-independent approaches. To assess the possible horizontal gene transfer (HGT) of transgenic DNA to soil microorganisms, total soil DNAs were amplified by PCR with two primer sets for the bar and hpt genes, which were introduced into the GM Zoysia grass by a callus-type transformation. The transgenic genes were not detected from the total genomic DNAs extracted from 1.5 g of each rhizosphere soils of GM and non-GM Zoysia grasses. The structures and diversities of the bacterial communities in rhizosphere soils of GM and non-GM Zoysia grasses were investigated by constructing 16S rDNA clone libraries. Classifier, provided in the RDP II, assigned 100 clones in the 16S rRNA gene sequences library into 11 bacterial phyla. The most abundant phyla in both clone libraries were Acidobacteria and Proteobacteria. The bacterial diversity of the GM clone library was lower than that of the non- GM library. The former contained four phyla, whereas the latter had seven phyla. Phylogenetic trees were constructed to confirm these results. Phylogenetic analyses of the two clone libraries revealed considerable difference from each other. The significance of difference between clone libraries was examined with LIBSHUFF statistics. LIBSHUFF analysis revealed that the two clone libraries differed significantly (P〈0.025), suggesting alterations in the composition of the microbial community associated with GM Zoysia grass.

A genomic approach to elucidating grass flower development

Directory of Open Access Journals (Sweden)

Dornelas Marcelo C.

2001-01-01

Full Text Available In sugarcane (Saccharum sp as with other species of grass, at a certain moment of its life cycle the vegetative meristem is converted into an inflorescence meristem which has at least two distinct inflorescence branching steps before the spikelet meristem terminates in the production of a flower (floret. In model dicotyledonous species such successive conversions of meristem identities and the concentric arrangement of floral organs in specific whorls have both been shown to be genetically controlled. Using data from the Sugarcane Expressed Sequence Tag (EST Project (SUCEST database, we have identified all sugarcane proteins and genes putatively involved in reproductive meristem and flower development. Sequence comparisons of known flower-related genes have uncovered conserved evolutionary pathways of flower development and flower pattern formation between dicotyledons and monocotyledons, such as some grass species. We have paid special attention to the analysis of the MADS-box multigene family of transcription factors that together with the APETALA2 (AP2 family are the key elements of the transcriptional networks controlling plant reproductive development. Considerations on the evolutionary developmental genetics of grass flowers and their relation to the ABC homeotic gene activity model of flower development are also presented.

Effect of microwave freeze drying on quality and energy supply in drying of barley grass.

Science.gov (United States)

Cao, Xiaohuang; Zhang, Min; Mujumdar, Arun S; Zhong, Qifeng; Wang, Zhushang

2018-03-01

Young barley grass leaves are well-known for containing the antioxidant substances flavonoid and chlorophyll. However, low product quality and energy efficiency exist with respect to the dehydration of barley grass leaves. To improve energy supply and the quality of barley grass, microwave heating instead of contact heat was applied for the freeze drying of barley grass at a pilot scale at 1, 1.5 and 2 W g -1 , respectively; After drying, energy supply and quality parameters of color, moisture content, chlorophyll, flavonoids, odors of dried barley grass were determined to evaluate the feasibility of the study. Microwave freeze drying (MFD) allowed a low energy supply and high contents of chlorophyll and flavonoids. A lightness value of 60.0, a green value of -11.5 and an energy supply of 0.61 kW h -1  g -1 were observed in 1.5 W g -1 MFD; whereas drying time (7 h) decreased by 42% compared to contact heating. Maximum content of flavonoid and chlorophyll was 11.7 and 12.8 g kg -1 barley grass. Microwave heating leads to an odor change larger than that for contact heating observed for the freeze drying of barley grass. MFD retains chlorophyll and flavonoids, as well as colors and odors of samples, and also decreases energy consumption in the freeze drying of barley grass. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Status and use of important native grasses adapted to sagebrush communities

Science.gov (United States)

Thomas A. Jones; Steven R. Larson

2005-01-01

Due to the emphasis on restoration, native cool-season grass species are increasing in importance in the commercial seed trade in the Western U.S. Cultivated seed production of these native grasses has often been hampered by seed dormancy, seed shattering, and pernicious awns that are advantageous outside of cultivation. Relatively low seed yields and poor seedling...

Using SPIRAL (Single Pollen Isotope Ratio AnaLysis) to estimate C 3- and C 4-grass abundance in the paleorecord

Science.gov (United States)

Nelson, David M.; Hu, Feng Sheng; Scholes, Daniel R.; Joshi, Neeraj; Pearson, Ann

2008-05-01

C 3 and C 4 grasses differ greatly in their responses to environmental controls and influences on biogeochemical processes (e.g. water, carbon, and nutrient cycling). Difficulties in distinguishing between these two functional groups of grasses have hindered paleoecological studies of grass-dominated ecosystems. Stable carbon isotopic analysis of individual grains of grass pollen using a spooling-wire microcombustion device interfaced with an isotope-ratio mass spectrometer holds promise for improving C 3 and C 4 grass reconstructions. This technique, SPIRAL (Single Pollen Isotope Ratio AnaLysis), has only been evaluated using pollen of known C 3 and C 4 grasses. To test the ability of SPIRAL to reproduce the abundance of C 3 and C 4 grasses on the landscape, we measured δ13C values of > 1500 individual grains of grass pollen isolated from the surface sediments of ten lakes in areas that span a large gradient of C 3- and C 4-grass abundance, as determined from vegetation surveys. Results indicate a strong positive correlation between the δ13C-based estimates of % C 4-grass pollen and the abundance of C 4 grasses on the landscape. The % C 4-grass pollen slightly underestimates the actual abundance of C 4 grasses at sites with high proportions of C 4 grasses, which can be corrected using regression analysis. Comparison of the % C 4-grass pollen with C/N and δ13C measurements of bulk organic matter illustrates the distinct advantages of grass-pollen δ13C as a proxy for distinguishing C 3 and C 4 shifts within the grass family. Thus SPIRAL promises to advance our understanding of grassland ecology and evolution.

Mass spectrometric analysis of electrophoretically separated allergens and proteases in grass pollen diffusates

Directory of Open Access Journals (Sweden)

Geczy Carolyn L

2003-09-01

Full Text Available Abstract Background Pollens are important triggers for allergic asthma and seasonal rhinitis, and proteases released by major allergenic pollens can injure airway epithelial cells in vitro. Disruption of mucosal epithelial integrity by proteases released by inhaled pollens could promote allergic sensitisation. Methods Pollen diffusates from Kentucky blue grass (Poa pratensis, rye grass (Lolium perenne and Bermuda grass (Cynodon dactylon were assessed for peptidase activity using a fluorogenic substrate, as well as by gelatin zymography. Following one- or two-dimensional gel electrophoresis, Coomassie-stained individual bands/spots were excised, subjected to tryptic digestion and analysed by mass spectrometry, either MALDI reflectron TOF or microcapillary liquid chromatography MS-MS. Database searches were used to identify allergens and other plant proteins in pollen diffusates. Results All pollen diffusates tested exhibited peptidase activity. Gelatin zymography revealed high Mr proteolytic activity at ~ 95,000 in all diffusates and additional proteolytic bands in rye and Bermuda grass diffusates, which appeared to be serine proteases on the basis of inhibition studies. A proteolytic band at Mr ~ 35,000 in Bermuda grass diffusate, which corresponded to an intense band detected by Western blotting using a monoclonal antibody to the timothy grass (Phleum pratense group 1 allergen Phl p 1, was identified by mass spectrometric analysis as the group 1 allergen Cyn d 1. Two-dimensional analysis similarly demonstrated proteolytic activity corresponding to protein spots identified as Cyn d 1. Conclusion One- and two-dimensional electrophoretic separation, combined with analysis by mass spectrometry, is useful for rapid determination of the identities of pollen proteins. A component of the proteolytic activity in Bermuda grass diffusate is likely to be related to the allergen Cyn d 1.

Overlap in nitrogen sources and redistribution of nitrogen between trees and grasses in a semi-arid savanna.

Science.gov (United States)

Priyadarshini, K V R; Prins, Herbert H T; de Bie, Steven; Heitkönig, Ignas M A; Woodborne, Stephan; Gort, Gerrit; Kirkman, Kevin; Fry, Brian; de Kroon, Hans

2014-04-01

A key question in savanna ecology is how trees and grasses coexist under N limitation. We used N stable isotopes and N content to study N source partitioning across seasons from trees and associated grasses in a semi-arid savanna. We also used (15)N tracer additions to investigate possible redistribution of N by trees to grasses. Foliar stable N isotope ratio (δ(15)N) values were consistent with trees and grasses using mycorrhiza-supplied N in all seasons except in the wet season when they switched to microbially fixed N. The dependence of trees and grasses on mineralized soil N seemed highly unlikely based on seasonal variation in mineralization rates in the Kruger Park region. Remarkably, foliar δ(15)N values were similar for all three tree species differing in the potential for N fixation through nodulation. The tracer experiment showed that N was redistributed by trees to understory grasses in all seasons. Our results suggest that the redistribution of N from trees to grasses and uptake of N was independent of water redistribution. Although there is overlap of N sources between trees and grasses, dependence on biological sources of N coupled with redistribution of subsoil N by trees may contribute to the coexistence of trees and grasses in semi-arid savannas.

Identifying urban sources as cause of elevated grass pollen concentrations using GIS and remote sensing

DEFF Research Database (Denmark)

Skjøth, Carsten Ambelas; Ørby, Pia Viuf; Becker, Thomas

2013-01-01

available remote sensing data combined with management information for local grass areas. The inventory has identified a number of grass pollen source areas present within the city domain. The comparison of the measured pollen concentrations with the inventory shows that the atmospheric concentrations......We examine here the hypothesis that during flowering, the grass pollen concentrations at a specific site reflect the distribution of grass pollen sources within a few kilometres of this site. We perform this analysis on data from a measurement campaign in the city of Aarhus (Denmark) using three...

Sonoran Desert ecosystem transformation by a C4 grass without the grass/fire cycle

Science.gov (United States)

Olsson, Aaryn D.; Betancourt, Julio; McClaran, Mitchel P.; Marsh, Stuart E.

2012-01-01

Aim Biological invasions facilitate ecosystem transformation by altering the structure and function, diversity, dominance and disturbance regimes. A classic case is the grass–fire cycle in which grass invasion increases the frequency, scale and/or intensity of wildfires and promotes the continued invasion of invasive grasses. Despite wide acceptance of the grass–fire cycle, questions linger about the relative roles that interspecific plant competition and fire play in ecosystem transformations. Location Sonoran Desert Arizona Upland of the Santa Catalina Mountains, Arizona, USA. Methods We measured species cover, density and saguaro (Carnegiea gigantea) size structure along gradients of Pennisetum ciliare invasion at 10 unburned/ungrazed P. ciliare patches. Regression models quantified differences in diversity, cover and density with respect to P. ciliare cover, and residence time and a Fisher's exact test detected demographic changes in saguaro populations. Because P. ciliare may have initially invaded locations that were both more invasible and less diverse, we ran analyses with and without the plots in which initial infestations were located. Results Richness and diversity decreased with P. ciliare cover as did cover and density of most dominant species. Richness and diversity declined with increasing time since invasion, suggesting an ongoing transformation. The proportion of old-to-young Carnegiea gigantea was significantly lower in plots with dominant P. ciliare cover. Main conclusions Rich desert scrub (15–25 species per plot) was transformed into depauperate grassland (2–5 species per plot) within 20 years following P. ciliare invasion without changes to the fire regime. While the onset of a grass–fire cycle may drive ecosystem change in the later stages and larger scales of grass invasions of arid lands, competition by P. ciliare can drive small-scale transformations earlier in the invasion. Linking competition-induced transformation rates with

Seedbed preparation influence on morphometric characteristics of perennial grasses of a semi-arid rangeland in Kenya

OpenAIRE

Opiyo, Francis EO; Ekaya, Wellington N; Nyariki, Dickson M; Mureithi, Stephen Mwangi

2011-01-01

Semi-arid rangelands in Kenya are an important source of forage for both domestic and wild animals. However, indigenous perennial grasses notably Cenchrus ciliaris (African foxtail grass), Eragrostis superba (Maasai love grass) and Enteropogon macrostachyus (Bush rye grass) are disappearing at an alarming rate. Efforts to re-introduce them through restoration programs have often yielded little success. This can partly be attributed to failure of topsoil to capture and store scarce water to me...

Ecophysiological Responses of Invasive and Native Grass Communities with Simulated Warming

Science.gov (United States)

Quade, B.; Ravi, S.; Huxman, T. E.

2010-12-01

William Quade1, Sujith Ravi2, Ashley Weide2, Greg Barron-Gafford2, Katerina Dontsova2 and Travis E Huxman2 1Carthage College, WI 2 B2 Earthscience & UA Biosphere 2, University of Arizona, Tucson. Abstract Climate change, anthropogenic disturbances and lack of proper management practices have rendered many arid regions susceptible to invasions by exotic grasses with consequent ecohydrological, biogeochemical and socio economic implications. Thus, understanding the ecophysiological processes driving these large-scale vegetation shifts in drylands, in the context of rising temperatures and recurrent droughts is fundamental to global change research. Using the Biosphere 2 facility to maintain distinct temperature treatments of ambient and predicted warmer conditions (+ 4o C) inside, we compared the physiological (e.g. photosynthesis, stomatal conductance, biomass) responses of a native grass - Heteropogan contortus (Tanglehead) and an invasive grass - Pennisetum ciliare (Buffelgrass) growing in single and mixed communities. The results indicate that Buffelgrass can assimilate more CO2 per unit leaf area under current conditions, though warming seems to inhibit the performance when looking at biomass, photosynthesis and stomatal conductance. Under similar moisture regimes Buffelgrass performed better than Tangle head in mixed communities regardless of the temperature. Both grasses had decrease in stomatal conductance with warmer conditions, however the Buffel grass did not have the same decrease of conductance when planted in a mixed communities. Key words: Buffelgrass, Tanglehead, Biosphere 2, stomatal conductance, climate change

Double-blind, placebo-controlled immunotherapy with mixed grass-pollen allergoids. I. Rush immunotherapy with allergoids and standardized orchard grass-pollen extract.

Science.gov (United States)

Bousquet, J; Hejjaoui, A; Skassa-Brociek, W; Guérin, B; Maasch, H J; Dhivert, H; Michel, F B

1987-10-01

Forty-five grass pollen-allergic patients were randomly assigned to three groups according to their skin test and RAST sensitivities and the severity of seasonal rhinitis. Eleven patients were treated with placebo (group 1), 19 patients (group 2) were treated with a six-mixed grass-pollen allergoid prepared by mild formalinization with a two-step procedure, and 15 other patients were treated with a standardized orchard grass-pollen extract (group 3). Because of a different immunotherapy schedule, only patients placed in groups 1 and 2 received the extracts in a double-blind fashion. Rush immunotherapy was performed in 3 to 6 days, and the maintenance dose was subsequently administered weekly for 4 weeks and every 2 weeks until the end of the grass-pollen season. During the season, a coseasonal treatment was administered. Systemic reactions occurred during the rush protocol in 36.8% of patients treated with allergoid and 20% of patients who received the standardized extract. Only patients treated with allergoid had systemic reactions during maintenance dose. The reactions observed with the standardized extract were more severe. Total doses of allergoid ranged from 2350 to 13,500 protein nitrogen units. Symptoms and medication scores during the peak of the season were analyzed. Patients treated with the standardized allergen had a significant reduction of the number of days of symptoms during the month of June (9.5 +/- 6.7 days; p less than 0.005) and of medication scores (1.3 +/- 1.4; p less than 0.01) compared to patients receiving placebo (19.4 +/- 8.1 days; medication score, 2.8 +/- 2.1).(ABSTRACT TRUNCATED AT 250 WORDS)

Budget impact analysis of two immunotherapy products for treatment of grass pollen-induced allergic rhinoconjunctivitis

Directory of Open Access Journals (Sweden)

Rønborg SM

2012-09-01

Full Text Available Steen M Rønborg,1 Ulrik G Svendsen,2 Jesper S Micheelsen,3 Lars Ytte,4 Jakob N Andreasen,5 Lars Ehlers61The Pulmonology and Allergy Clinic of Copenhagen, Copenhagen, 2Bispebjerg Hospital, Copenhagen, 3Private ENT practice, Aalborg, 4General Practice Aalborg, 5ALK, Hørsholm, 6Aalborg University, Aalborg, DenmarkBackground: Grass pollen-induced allergic rhinoconjunctivitis constitutes a large burden for society. Up to 20% of European and United States (US populations suffer from respiratory allergies, including grass pollen-induced allergic rhinoconjunctivitis. The majority of patients are treated with symptomatic medications; however, a large proportion remains uncontrolled despite use of such treatments. Specific immunotherapy is the only treatment documented to target the underlying cause of the disease, leading to a sustained effect after completion of treatment. The aim of this study was to compare the economic consequences of treating patients suffering from allergic rhinoconjunctivitis with either a grass allergy immunotherapy tablet (AIT or subcutaneous immunotherapy (SCIT.Methods: A budget impact analysis was applied comparing SQ-standardized grass AIT (Grazax®; Phleum pratense, 75,000 SQ-T/2,800 BAU; ALK, Denmark with SCIT (Alutard®; P. pratense, 100,000 SQ-U/mL; ALK, Denmark. Budget impact analysis included health care utilization measured in physical units based on systematic literature reviews, guidelines, and expert opinions, as well as valuation in unit costs based on drug tariffs, physician fees, and wage statistics. Budget impact analysis was conducted from a Danish health care perspective.Results: Treating patients suffering from allergic rhinoconjunctivitis with grass AIT instead of grass SCIT resulted in a total reduction in treatment costs of €1291 per patient during a treatment course. This cost saving implies that approximately 40% more patients could be treated with grass AIT per year without influencing the cost of

Tree-grass interactions on an East African savanna : the effects of facilitation, competition, and hydraulic lift

NARCIS (Netherlands)

Ludwig, F.

2001-01-01

Keywords: Rangelands, Semi-arid areas, stable isotopes, Acacia, C _4- grasses, plant nutrients, soil nutrients, soil water, plant water relations

Savanna trees can either increase or decrease the productivity of understorey grasses. Trees reduce grass

Study of Plant Species Composition of Grasslands in Mugla Village Region (Western Rhodopes, South Bulgaria

Directory of Open Access Journals (Sweden)

Plamen S. Stoyanov

2016-06-01

Full Text Available The study presents data on the diversity of grass species in the region of the village of Mugla (the Western Rhodopes. One hundred forty-one species of higher plants belonging to 40families were registered. (Apiaceae, Aspleniaceae, Asteraceae, Boraginaceae, Brassicaceae,Campanulaceae, Caryophyllaceae, Cistaceae, Cyperaceae, Dipsacaceae, Equisetaceae, Ericaceae,Euphorbiaceae, Fabaceae, Gentianaceae, Geraniaceae, Gesneriaceae, Hypericaceae, Juncaceae,Lamiaceae, Lemnaceae, Liliaceae, Linaceae, Menyanthaceae, Oleacea, Onagraceae, Orchidaceae,Parnassiaceae, Plantaginaceae, Plumbaginaceae, Poaceae, Polygalaceae, Primulaceae,Ranunculaceae, Rosaceae, Rubiaceae, Saxifragaceae, Scrophulariaceae, Valerianaceae andViolaceae. Their conservation status was presented, as well as medicinal plants.

Feed intake and milk production in dairy cows fed different grass and legume species: a meta-analysis

DEFF Research Database (Denmark)

Johansen, Marianne; Lund, Peter; Weisbjerg, Martin Riis

2018-01-01

The aim of this meta-analysis was to compare feed intake, milk production, milk composition and organic matter (OM) digestibility in dairy cows fed different grass and legume species. Data from the literature was collected and different data sets were made to compare families (grasses v. legumes...... tannins in birdsfoot trefoil. None of the included grass species differed in DMI, milk production, milk composition or OM digestibility, indicating that different grass species have the same value for milk production, if OM digestibility is comparable. However, the comparison of different grass species...

CHAWS user`s guide: System description and standard operating procedures, Lexington-Blue Grass Army Depot

Energy Technology Data Exchange (ETDEWEB)

Martins, S.A.; Shinn, J.H. [eds.

1993-05-01

The Chemical Hazard Warning System (CHAWS) is designed to collect meteorological data and to display, in real time, the dispersion of hazardous chemicals that may result from an accidental release. Meteorological sensors have been placed strategically around the Lexington-Blue Grass Army Depot and are used to calculate direction and hazard distance for the release. Based on these data, arrows depicting the release direction and distance traveled are graphically displayed on a computer screen showing a site map of the facility. The objectives of CHAWS are as follows: To determine the trajectory of the center of mass of released material from the measured wind field; to calculate the dispersion of the released material based on the measured lateral turbulence intensity (sigma theta); to determine the height of the mixing zone by measurement of the inversion height and wind profiles up to an altitude of about 1 km at sites that have SODAR units installed; to archive meteorological data for potential use in climatological descriptions for emergency planning; to archive air-quality data for preparation of compliance reports; and to provide access to the data for near real time hazard analysis purposes. CHAWS sites are located at the Pine Bluff Arsenal, Arkansas, Edgewood area of Aberdeen Proving Ground, Maryland, Tooele Depot, Utah, Lexington-Blue Grass Depot, Kentucky, and Johnston Island in the Pacific. The systems vary between sites with different features and various types of hardware. The basic system, however, is the same. Nonetheless, we have tailored the manuals to the equipment found at each site.

Pretreatment of grass waste using combined ionizing radiation-acid treatment for enhancing fermentative hydrogen production.

Science.gov (United States)

Yang, Guang; Wang, Jianlong

2018-05-01

In this study, the combined ionizing radiation-acid pretreatment process was firstly applied to enhance hydrogen fermentation of grass waste. Results showed that the combined pretreatment synergistically enhanced hydrogen fermentation of grass waste. The SCOD and soluble polysaccharide contents of grass waste increased by 1.6 and 2.91 times after the combined pretreatment, respectively. SEM observation and crystallinity test showed the combined pretreatment effectively disrupted the grass structure. Owing to the more favorable substrate conditions, the hydrogen yield achieved 68 mL/g-dry grass added after the combined pretreatment, which was 161.5%, 112.5% and 28.3% higher than those from raw, ionizing radiation pretreated and acid pretreated grass waste, respectively. The VS removal also increased from 13.9% to 25.6% by the combined pretreatment. Microbial community analysis showed that the abundance of dominant hydrogen producing genus Clostridium sensu stricto 1 increased from 37.9% to 69.4% after the combined pretreatment, which contributed to more efficient hydrogen fermentation. Copyright © 2018 Elsevier Ltd. All rights reserved.

Imaging spectroscopy for characterisation of grass swards

NARCIS (Netherlands)

Schut, A.G.T.

2003-01-01

Keywords: Imaging spectroscopy, imaging spectrometry, remote sensing, reflection, reflectance, grass sward, white clover, recognition, characterisation, ground cover, growth monitoring, stress detection, heterogeneity quantification

The potential of imaging spectroscopy as a tool for

Evaluation of three ancillary treatments in the management of equine grass sickness.

Science.gov (United States)

Fintl, C; McGorum, B C

2002-09-28

Brotizolam, acetylcysteine and aloe vera gel were evaluated as ancillary treatments for 29 cases of equine grass sickness. None of the treatments had any significant beneficial effect on the survival of the horses. However, 11 of 13 horses with mild chronic grass sickness survived solely with intensive nursing care.

Congo grass grown in rotation with soybean affects phosphorus bound to soil carbon

Directory of Open Access Journals (Sweden)

Alexandre Merlin

2014-06-01

Full Text Available The phosphorus supply to crops in tropical soils is deficient due to its somewhat insoluble nature in soil, and addition of P fertilizers has been necessary to achieve high yields. The objective of this study was to examine the mechanisms through which a cover crop (Congo grass - Brachiaria ruziziensis in rotation with soybean can enhance soil and fertilizer P availability using long-term field trials and laboratory chemical fractionation approaches. The experimental field had been cropped to soybean in rotation with several species under no-till for six years. An application rate of no P or 240 kg ha-1 of P2O5 had been applied as triple superphosphate or as Arad rock phosphate. In April 2009, once more 0.0 or 80.0 kg ha-1 of P2O5 was applied to the same plots when Congo grass was planted. In November 2009, after Congo grass desiccation, soil samples were taken from the 0-5 and 5-10 cm depth layer and soil P was fractionated. Soil-available P increased to the depth of 10 cm through growing Congo grass when P fertilizers were applied. The C:P ratio was also increased by the cover crop. Congo grass cultivation increased P content in the soil humic fraction to the depth of 10 cm. Congo grass increases soil P availability by preventing fertilizer from being adsorbed and by increasing soil organic P.

Responses of three grass species to creosote during phytoremediation

International Nuclear Information System (INIS)

Huang Xiaodong; El-Alawi, Yousef; Penrose, Donna M.; Glick, Bernard R.; Greenberg, Bruce M.

2004-01-01

Phytoremediation of creosote-contaminated soil was monitored in the presence of Tall fescue, Kentucky blue grass, or Wild rye. For all three grass species, plant growth promoting rhizobacteria (PGPR) were evaluated for plant growth promotion and protection of plants from contaminant toxicity. A number of parameters were monitored including plant tissue water content, root growth, plant chlorophyll content and the chlorophyll a/b ratio. The observed physiological data indicate that some plants mitigated the toxic effects of contaminants. In addition, in agreement with our previous experiments reported in the accompanying paper (Huang, X.-D., El-Alawi, Y., Penrose, D.M., Glick, B.R., Greenberg, B.M., 2004. A multi-process phytoremediation system for removal of polycyclic aromatic hydrocarbons from contaminated soil. Environ. Poll. doi: 10.1016/j.envpol.2003.09.031), PGPR were able to greatly enhance phytoremediation. PGPR accelerated plant growth, especially roots, in heavily contaminated soils, diminishing the toxic effects of contaminants to plants. Thus, the increased root biomass in PGPR-treated plants led to more effective remediation. - Plant growth promoting rhizobacteria enhanced growth and remediation of three grass species

The potential of C4 grasses for cellulosic biofuel production

Directory of Open Access Journals (Sweden)

Tim eWeijde

2013-05-01

Full Text Available With the advent of biorefinery technologies enabling plant biomass to be processed into biofuel, many researchers set out to study and improve candidate biomass crops. Many of these candidates are C4 grasses, characterized by a high productivity and resource use efficiency. In this review the potential of five C4 grasses as lignocellulose feedstock for biofuel production is discussed. These include three important field crops - maize, sugarcane and sorghum - and two undomesticated perennial energy grasses - miscanthus and switchgrass. Although all these grasses are high yielding, they produce different products. While miscanthus and switchgrass are exploited exclusively for lignocellulosic biomass, maize, sorghum and sugarcane are dual-purpose crops. It is unlikely that all the prerequisites for the sustainable and economic production of biomass for a global cellulosic biofuel industry will be fulfilled by a single crop. High and stable yields of lignocellulose are required in diverse environments worldwide, to sustain a year-round production of biofuel. A high resource use efficiency is indispensable to allow cultivation with minimal inputs of nutrients and water and the exploitation of marginal soils for biomass production. Finally, the lignocellulose composition of the feedstock should be optimized to allow its efficient conversion into biofuel and other by-products. Breeding for these objectives should encompass diverse crops, to meet the demands of local biorefineries and provide adaptability to different environments. Collectively, these C4 grasses are likely to play a central role in the supply of lignocellulose for the cellulosic ethanol industry. Moreover, as these species are evolutionary closely related, advances in each of these crops will expedite improvements in the other crops. This review aims to provide an overview of their potential, prospects and research needs as lignocellulose feedstocks for the commercial production of

Nutritional value of grass silage of mombasa associated with additives agroindustrial

Directory of Open Access Journals (Sweden)

Euclides Reuter de Oliveira

2014-06-01

Full Text Available It was aimed to evaluate the chemical composition of grass silage-mombasa associated with different additives in four times of opening the silo. The experiment was conducted in UFGD. After harvesting the forage, biomass in natura crushed, was taken to the lab, homogenized and enriched on the basis of natural mass, with the following additives: 5% wheat bran, 5% of waste (broken grain and soy ice cream cone of soybean, 5% urea in natural matter and the witness (without additive.The silos were opened after (unprocessed material, 15, 30 and 45 days, for the analysis of chemical composition. The data obtained were analyzed through the statistical programme SISVAR and averages were compared to 5% of probability, by Skott-Knot. The grass silage- mombasa without additive presented major (P0.05 of grass silage- mombasa associated with 5 of urea in 15 days and 45 of silage. The grass silage-mombasa with 5% urea showed the highest crude protein content at time 0 and differed from other treatments. The silage of mombasa associated with 5% urea provided greater in vitro digestibility of dry matter to 15 days of silage.

Production cost of biomasses from eucalyptus and elefant grass for energy

Directory of Open Access Journals (Sweden)

Laurent Marie Roger Quéno

2011-09-01

Full Text Available This work established the unit energy cost generated from biomass of eucalyptus (Eucalyptus sp. and elephant grass (Pennisetum sp. and applied a sensitivity analysis to verify the influences of factors such as the silviculture of eucalyptus, production volume of each species, the cost of land and the interest rate. It was shown that the treatment of eucalyptus in very short rotation of 2 years with reform of stand every 6 years has a average cost of production higher than the traditional treatment of short rotation of 6 years with reform only at the age of 18. It was also observed that eucalyptus has a Production Cost on average of R$ 4,41 /Gj, lower than the elephant grass which is on average of R$ 5,44/Gj, which however has a higher annual capacity of dry matter production. The elephant grass has the possibility to compete with eucalyptus when a set of conditions is met: discount rate higher than or equal to 8%, High price of land, and elephant grass high volume production, greater than or equal to 35 tonnes of dry matter per hectare and year.

Comparative assessment of the phytomeliorative efficiency of perennial grasses on chernozems in the transural part of Bashkortostan

Science.gov (United States)

Khasanova, R. F.; Suyundukov, Ya. T.; Suyundukova, M. B.

2010-01-01

The phytomeliorative efficiency of different groups of perennial herbs was studied. The agrophysical properties of soils under natural grasses (the feather grasses Stipa pennata, S. zalesskii, and S. Lessingiana; the fescue grass Festuca pseudovina; and quack grass), sawn herbs (awnless brome, crested wheat grass, purple alfalfa, the holy clover Onobrychis sibirica, the galega Galega orientalis, and yellow sweet clover), and cereal crops (winter rye and spring wheat) were compared. The formation of the aboveground and underground phytomass and the influence of phytomeliorative herbs on the aggregate state of leached, ordinary, and southern chernozems in the Transural part of Bashkortostan were analyzed.

The determination of radionuclides in grass ecosystem samples

International Nuclear Information System (INIS)

LaBrecque, J.J.; Schelenz, R.; Perkins, R.W.

1987-07-01

The radioactive debris cloud from the Chernobyl reactor accident resulted in some deposition over essentially all of the Northern Hemisphere. Shortly after the accident invitations were sent out by the IAEA to Member States to collect grass samples according to specific instructions so that the ratio of the various radionuclides in the fallout debris could be established over a wide area of Europe. In response to this request, 20 grass samples were provided by Member States. To establish a protocol for analysis of these valuable samples and to recommend a protocol for future sample collection, a Consultants Meeting was called by the IAEA for 23-25 September 1986. This document contains the considerations and recommendations of the consultants

Karl Konrad Grass jumalainimeste uurijana / Alar Laats

Index Scriptorium Estoniae

Laats, Alar

2006-01-01

Karl Konrad Grass oli 19. sajandil Dorpati keiserliku ülikooli usuteaduskonna Uue Testamendi õppejõud, kes tegeles hobi korras idakristluse (vene sektid) uurimisega. Tema peateoseks on uurimus "Die russischen Sekten". Ettekanne konverentsil 15.-16. aprill 2005. a.

Marandu palisade grass intercropped with densely spaced teak in silvopastoral system

Directory of Open Access Journals (Sweden)

Carlos Eduardo Avelino Cabral

2017-08-01

Full Text Available This study was conducted to evaluate two systems of production: integration between teak and forage (silvopastoral system and forage only (monoculture. The forage species used was Marandu palisade grass (Urochloa brizantha cv. Marandu. In January 2009, part of the pasture was desiccated and the teak (Tectona grandis was implemented in a 3 × 4 m spacing arrangement, and at every five rows, a space between rows of 6 m was established, providing a population of 750 trees per hectare. Alongside the development of the trees, the Marandu palisade grass pasture was reestablished. In February 2015, the animals were removed from the experimental area and, in March, the pasture degradation, the density and the mass of tillers was assessed. The following variables were evaluated: sward height; forage mass, percentage of leaf blade, stem+sheath and senescent material; leaf blade:stem+sheath ratio; and live:dead material ratio. The experimental design was completely randomized, with 12 replicates. Treatments consisted of two systems (silvopastoral and monoculture. The total forage accumulation was higher in the monoculture system. The sward height and the percentage of stem+sheath were higher in the integrated system, while the percentage of leaf blade and the leaf blade:stem+sheath ratio were higher in the system exclusively with forage. In conclusion, Marandu palisade grass tolerates shading in a high density spacing silvopastoral system, but the degradation process is more intense compared to grass in monoculture, and the use of Marandu palisade grass in silvopastoral systems changes the forage mass and the structure of the produced forage.

De novo transcriptome assembly for the tropical grass Panicum maximum Jacq.

Directory of Open Access Journals (Sweden)

Guilherme Toledo-Silva

Full Text Available Guinea grass (Panicum maximum Jacq. is a tropical African grass often used to feed beef cattle, which is an important economic activity in Brazil. Brazil is the leader in global meat exportation because of its exclusively pasture-raised bovine herds. Guinea grass also has potential uses in bioenergy production due to its elevated biomass generation through the C4 photosynthesis pathway. We generated approximately 13 Gb of data from Illumina sequencing of P. maximum leaves. Four different genotypes were sequenced, and the combined reads were assembled de novo into 38,192 unigenes and annotated; approximately 63% of the unigenes had homology to other proteins in the NCBI non-redundant protein database. Functional classification through COG (Clusters of Orthologous Groups, GO (Gene Ontology and KEGG (Kyoto Encyclopedia of Genes and Genomes analyses showed that the unigenes from Guinea grass leaves are involved in a wide range of biological processes and metabolic pathways, including C4 photosynthesis and lignocellulose generation, which are important for cattle grazing and bioenergy production. The most abundant transcripts were involved in carbon fixation, photosynthesis, RNA translation and heavy metal cellular homeostasis. Finally, we identified a number of potential molecular markers, including 5,035 microsatellites (SSRs and 346,456 single nucleotide polymorphisms (SNPs. To the best of our knowledge, this is the first study to characterize the complete leaf transcriptome of P. maximum using high-throughput sequencing. The biological information provided here will aid in gene expression studies and marker-assisted selection-based breeding research in tropical grasses.

The influence of short-term cold stress on the metabolism of non-structural carbohydrates in polar grasses

OpenAIRE

Łopieńska-Biernat Elżbieta; Pastorczyk Marta; Giełwanowska Irena; Żółtowska Krystyna; Stryiński Robert; Zaobidna Ewa

2017-01-01

Plants adapt to extremely low temperatures in polar regions by maximizing their photosynthetic efficiency and accumulating cryoprotective and osmoprotective compounds. Flowering plants of the family Poaceae growing in the Arctic and in the Antarctic were investigated. Their responses to cold stress were analyzed under laboratory conditions. Samples were collected after 24 h and 48 h of cold treatment. Quantitative and qualitative changes of sugars are found among different species, but they c...

Immunological comparison of allergen immunotherapy tablet treatment and subcutaneous immunotherapy against grass allergy

DEFF Research Database (Denmark)

Aasbjerg, K; Backer, V; Lund, G

2014-01-01

BACKGROUND: IgE-mediated allergic rhinitis to grass pollen can successfully be treated with either allergen immunotherapy tablets (SLIT tablet) or SQ-standardized subcutaneous immunotherapy (SCIT). The efficacy of these two treatment modalities for grass allergy is comparable, but the immunological...

Ocorrência e controle de lesmas do gênero Omalonyx (Gastropoda, Succineidae, pragas de capim-elefante Pennisetum purpureum (Poaceae em Rio Preto da Eva, Amazonas Occurrence and control of Omalonyx slugs (Gastropoda, Succineidae, pests of the elephant-grass Pennisetum purpureum (Poaceae in Rio Preto da Eva, Amazonas

Directory of Open Access Journals (Sweden)

Marcos Vinicius Bastos Garcia

2012-06-01

Full Text Available Lesmas do gênero Omalonyx d'Orbigny, 1837 são hermafroditas, herbívoras, de distribuição neotropical e vivem em plantas aquáticas, nas demais vegetações adjacentes e em solo úmido próximo a ambientes de água doce. No presente trabalho reporta-se a ocorrência atípica de O. pattersonae Tillier, 1981 e de Omalonyx sp. em área de terra firme, distante de ambiente aquático. Estas espécies aqui reportadas são simpátricas e devido à alta densidade populacional e prejuízos causados às folhas do capim-elefante Pennisetum purpureum Schumach, são caracterizadas como pragas agrícolas. No período da noite as lesmas se alimentavam das folhas do capim elefante e durante o dia permaneciam escondidas na base do caule, próximo a superfície úmida do solo. A aplicação de cal hidratada sobre agregados de indivíduos de Omalonyx spp foi um método efetivo para o controle das populações. As alterações ambientais dos ecossistemas amazônicos para uso agrícola e/ou urbanização tem promovido o aumento populacional de espécies que se adaptam a novos habitats e geralmente se tornam pragas de difícil controle.Slugs of the genus Omalonyx d'Orbigny, 1837 are hermaphrodites, herbivorous, distributed on Neotropical regions, living on aquatic plants, moist soil and terrestrial vegetation close to freshwater systems. The present paper reports the atypical occurrence of O. pattersonae Tillier, 1981 and Omalonyx sp. in an upland area far from any aquatic environment. Both species reported here are sympatric and due to the high populations density and damages caused on leaves of elephant-grass Pennisetum purpureum Schumach, they are recognized as agricultural pests. During the night, the slugs feed on the grass leaves and at the daylight they stayed hidden in the base of stems, near the moist soil surface. The use of hydrated lime distributed over the aggregations of Omalonyx spp. showed to be an effective method to control the populations. The

Invasive Andropogon gayanus (gamba grass) is an ecosystem transformer of nitrogen relations in Australian savanna.

Science.gov (United States)

Rossiter-Rachor, N A; Setterfield, S A; Douglas, M M; Hutley, L B; Cook, G D; Schmidt, S

2009-09-01

Invasion by the African grass Andropogon gayanus is drastically altering the understory structure of oligotrophic savannas in tropical Australia. We compared nitrogen (N) relations and phenology of A. gayanus and native grasses to examine the impact of invasion on N cycling and to determine possible reasons for invasiveness of A. gayanus. Andropogon gayanus produced up to 10 and four times more shoot phytomass and root biomass, with up to seven and 2.5 times greater shoot and root N pools than native grass understory. These pronounced differences in phytomass and N pools between A. gayanus and native grasses were associated with an altered N cycle. Most growth occurs in the wet season when, compared with native grasses, dominance of A. gayanus was associated with significantly lower total soil N pools, lower nitrification rates, up to three times lower soil nitrate availability, and up to three times higher soil ammonium availability. Uptake kinetics for different N sources were studied with excised roots of three grass species ex situ. Excised roots of A. gayanus had an over six times higher-uptake rate of ammonium than roots of native grasses, while native grass Eriachne triseta had a three times higher uptake rate of nitrate than A. gayanus. We hypothesize that A. gayanus stimulates ammonification but inhibits nitrification, as was shown to occur in its native range in Africa, and that this modification of the soil N cycle is linked to the species' preference for ammonium as an N source. This mechanism could result in altered soil N relations and could enhance the competitive superiority and persistence of A. gayanus in Australian savannas.

The energy balance of utilising meadow grass in Danish biogas production

DEFF Research Database (Denmark)

Meyer, Ane Katharina Paarup; Raju, Chitra Sangaraju; Kucheryavskiy, Sergey V.

2015-01-01

of meadow areas, different relevant geo-datasets, spatial analyses, and various statistical analyses. The results show that values for the energy return on energy invested (EROEI) ranging from 1.7 to 3.3 can be obtained when utilising meadow grasses in local biogas production. The total national net energy......This paper presents a study of the energy balance of utilising nature conservation biomass from meadow habitats in Danish biogas production. Utilisation of nature conservation grass in biogas production in Denmark represents an interesting perspective for enhancing nature conservation of the open...... grassland habitats, while introducing an alternative to the use of intensively cultivated energy crops as co-substrates in manure based biogas plants. The energy balance of utilising nature conservation grass was investigated by using: data collected from previous investigations on the productivity...

Adverse Events During Immunotherapy Against Grass Pollen-Induced Allergic Rhinitis

DEFF Research Database (Denmark)

Aasbjerg, Kristian; Dalhoff, Kim Peder; Backer, Vibeke

2015-01-01

Allergic rhinitis (AR) triggered by grass pollen is a common disease, affecting millions of people worldwide. Treatment consists of symptom-alleviating drugs, such as topical corticosteroids or antihistamines. Another option is potentially curative immunotherapy, currently available as sublingual...... and subcutaneous treatment. We investigated the potential differences in the prevalence and severity of adverse events related to subcutaneous and sublingual immunotherapy (SLIT) against grass pollen-induced AR. A thorough literature search was performed with PubMed and EMBASE. The findings were compared...

Grass buffers for playas in agricultural landscapes: An annotated bibliography

Science.gov (United States)

Melcher, Cynthia P.; Skagen, Susan K.

2005-01-01

This bibliography and associated literature synthesis (Melcher and Skagen, 2005) was developed for the Playa Lakes Joint Venture (PLJV). The PLJV sought compilation and annotation of the literature on grass buffers for protecting playas from runoff containing sediments, nutrients, pesticides, and other contaminants. In addition, PLJV sought information regarding the extent to which buffers may attenuate the precipitation runoff needed to fill playas, and avian use of buffers. We emphasize grass buffers, but we also provide information on other buffer types.

Sox genes in grass carp (Ctenopharyngodon idella with their implications for genome duplication and evolution

Directory of Open Access Journals (Sweden)

Tong Jingou

2006-11-01

Full Text Available Abstract The Sox gene family is found in a broad range of animal taxa and encodes important gene regulatory proteins involved in a variety of developmental processes. We have obtained clones representing the HMG boxes of twelve Sox genes from grass carp (Ctenopharyngodon idella, one of the four major domestic carps in China. The cloned Sox genes belong to group B1, B2 and C. Our analyses show that whereas the human genome contains a single copy of Sox4, Sox11 and Sox14, each of these genes has two co-orthologs in grass carp, and the duplication of Sox4 and Sox11 occurred before the divergence of grass carp and zebrafish, which support the "fish-specific whole-genome duplication" theory. An estimation for the origin of grass carp based on the molecular clock using Sox1, Sox3 and Sox11 genes as markers indicates that grass carp (subfamily Leuciscinae and zebrafish (subfamily Danioninae diverged approximately 60 million years ago. The potential uses of Sox genes as markers in revealing the evolutionary history of grass carp are discussed.

Proving termination of logic programs with delay declarations

NARCIS (Netherlands)

E. Marchiori; F. Teusink (Frank)

1996-01-01

textabstractIn this paper we propose a method for proving termination of logic programs with delay declarations. The method is based on the notion of recurrent logic program, which is used to prove programs terminating wrt an arbitrary selection rule. Most importantly, we use the notion of bound

On the number of genes controlling the grass stage in longleaf pine

Science.gov (United States)

C. Dana Nelson; C. Weng; Thomas L. Kubisiak; M. Stine; C.L. Brown

2003-01-01

The grass stage is an inherent and distinctive developmental trait of longleaf pine (Pinus palustris), in which height growth in the first few years after germination is suppressed. In operational forestry practice the grass stage extends for nvo to several years and often plays a role in planting failures and decisions to plant alternative species....

Green grasses as light harvesters in dye sensitized solar cells

Science.gov (United States)

Shanmugam, Vinoth; Manoharan, Subbaiah; Sharafali, A.; Anandan, Sambandam; Murugan, Ramaswamy

2015-01-01

Chlorophylls, the major pigments presented in plants are responsible for the process of photosynthesis. The working principle of dye sensitized solar cell (DSSC) is analogous to natural photosynthesis in light-harvesting and charge separation. In a similar way, natural dyes extracted from three types of grasses viz. Hierochloe Odorata (HO), Torulinium Odoratum (TO) and Dactyloctenium Aegyptium (DA) were used as light harvesters in dye sensitized solar cells (DSSCs). The UV-Vis absorption spectroscopy, Fourier transform infrared (FT-IR), and liquid chromatography-mass spectrometry (LC-MS) were used to characterize the dyes. The electron transport mechanism and internal resistance of the DSSCs were investigated by the electrochemical impedance spectroscopy (EIS). The performance of the cells fabricated with the grass extract shows comparable efficiencies with the reported natural dyes. Among the three types of grasses, the DSSC fabricated with the dye extracted from Hierochloe Odorata (HO) exhibited the maximum efficiency. LC-MS investigations indicated that the dominant pigment present in HO dye was pheophytin a (Pheo a).

Comparison of phytoremediation potential of three grass species in soil contaminated with cadmium

Directory of Open Access Journals (Sweden)

Gołda Sylwia

2016-03-01

Full Text Available The aim of the study was to compare the toleration of Poa pratensis, Lolium perenne and Festuca rubra to cadmium contamination as well as the phytoremediation potential of these three species of grass. The pot experiment was conducted in four replications in pots containing 2.0 kg of soil. The soil was contaminated with three doses of Cd – 30, 60 and 120 mg·kg−1. After two months, the aerial parts of plants were harvested. The roots were dug up, brushed off from the remaining soil and washed with water. The biomass was defined and the cadmium concentration was determined in aerial parts and roots. The phytoremediation potential of grasses was evaluated using biomass of grasses, bioaccumulation factor (BF and translocation factor (TF. All three tested species of grasses had TF 1. It indicates their suitability for phytostabilisation and makes them unsuitable for phytoextraction of Cd from the soil. Comparing the usefulness of the tested grasses for phytoremediation has shown that the phytostabilisation potential of P. pratensis was lower than that of L. perenne and F. rubra. P. pratensis was distinguished by higher TF, smaller root biomass and lower tolerance for Cd excess in the soil in comparison with the two other test grasses. At the same time, L. perenne was characterised by the smallest decrease in biomass and the largest Cd accumulation in roots at the lowest dose of Cd. It indicates good usefulness for phytostabilisation of soils characterised by a relatively small pollution by cadmium.

A model for backscattering characteristics of tall prairie grass canopies at microwave frequencies

International Nuclear Information System (INIS)

Bakhtiari, S.; Zoughi, R.

1991-01-01

We have developed a discrete microwave scattering model, describing the radar backscattering coefficient from two treatments (burned and unburned) of tall prairie grass canopies at VV (electric field vector of the transmitted and received signals are vertically oriented) and HH (electric field vector of the transmitted and received signals and horizontally oriented) polarizations, based on the physical, biophysical, and geometrical characteristics of such canopies. Grass blades are modeled as thin and finite dielectric ellipsoids with arbitrary orientations. Scattering by an individual grass blade is formulated using a generalization of the Rayleigh—Gans approximation with a quasistatic solution for the expansion of the interior field. By associating, with each grass blade, various appropriate distribution functions, the relative orientation, location, height, cross section, and permittivity of each grass blade is taken into account. This makes for a more realistic overall description of the canopy. Kirchhoff's surface scattering is used to model the backscatter from the soil surface. An incoherent summation of the effect of grass blades and soil surface is adopted to obtain the total canopy backscattering coefficient, taking into account the attenuation experienced by the signal as it travels through the canopy. The results of this model are given for 1.5, 5, and 10 GHz (L-, C-, and X-band). Although for the shorter wavelengths (X-band) the Rayleigh—Gans criteria is not totally satisfied, nevertheless, the limited available measured X-band data compare relatively well with the results of this model both quantitatively and qualitatively. (author)

Improving our understanding of environmental controls on the distribution of C3 and C4 grasses.

Science.gov (United States)

Pau, Stephanie; Edwards, Erika J; Still, Christopher J

2013-01-01

A number of studies have demonstrated the ecological sorting of C3 and C4 grasses along temperature and moisture gradients. However, previous studies of C3 and C4 grass biogeography have often inadvertently compared species in different and relatively unrelated lineages, which are associated with different environmental settings and distinct adaptive traits. Such confounded comparisons of C3 and C4 grasses may bias our understanding of ecological sorting imposed strictly by photosynthetic pathway. Here, we used MaxEnt species distribution modeling in combination with satellite data to understand the functional diversity of C3 and C4 grasses by comparing both large clades and closely related sister taxa. Similar to previous work, we found that C4 grasses showed a preference for regions with higher temperatures and lower precipitation compared with grasses using the C3 pathway. However, air temperature differences were smaller (2 °C vs. 4 °C) and precipitation and % tree cover differences were larger (1783 mm vs. 755 mm, 21.3% vs. 7.7%, respectively) when comparing C3 and C4 grasses within the same clade vs. comparing all C4 and all C3 grasses (i.e., ignoring phylogenetic structure). These results were due to important differences in the environmental preferences of C3 BEP and PACMAD clades (the two main grass clades). Winter precipitation was found to be more important for understanding the distribution and environmental niche of C3 PACMADs in comparison with both C3 BEPs and C4 taxa, for which temperature was much more important. Results comparing closely related C3 -C4 sister taxa supported the patterns derived from our modeling of the larger clade groupings. Our findings, which are novel in comparing the distribution and niches of clades, demonstrate that the evolutionary history of taxa is important for understanding the functional diversity of C3 and C4 grasses, and should have implications for how grasslands will respond to global change. © 2012

DISTRIBUTION AND DIVERSITY OF FUSARIUM SPECIES ASSOCIATED WITH GRASSES IN TEN STATES THROUGHOUT PENINSULAR MALAYSIA

Directory of Open Access Journals (Sweden)

NUR AIN IZZATI, M.Z

2009-01-01

Full Text Available Fusarium is one of the important genera associated with grasses as saprophytes, endophytes and pathogens. A study was carried out on distribution and diversity of Fusarium species associated with two groups of grasses in 10 states throughout Peninsular Malaysia i.e. agricultural grasses (Oryza sativa and Saccharum officinarum and non-agricultural grasses (Axonopus compressus, Centhotheca lappacea, Chloris barbata, Crysopogon aciculatus, Cyanadon dactylon, Dactyloctenium aegyptium, Digitaria ciliaris, Echinochloa colona, Eleusine indica, Eragrostis amabilis, Eragrostis malayana, Eragrostis uniloides, Ischaemum magnum, Panicum brevifolium, Panicum millaneum, Panicum repens, Paspalum commersonii, Paspalum conjugatum, Paspalum orbiculare, Pennisetum purpureum, Sacciolepis indica, Sporobolus diander and Sporobolus indicus. A total of 474 isolates were single-spored and identified by morphological characteristics. F. semitectum was frequently isolated (23.6%, followed by F. sacchari and F. fujikuroi with 15.4% and 14.6%, respectively. The other nine species were F. solani (10.3%, F. proliferatum (8.9%, F. oxysporum (7.4%, F. subglutinans (6.5%, F. equiseti (5.5%, F. verticillioides (3.4%, F. compactum (2.5%, F. chlamydosporum (1.1% and F. longipes (0.8%. Based on the Shannon-Weiner Index, F. solani was the highest (H' = 2.62 isolated from grasses. Species of Fusarium from O. sativa were widely diverse with 11 species, followed by non-agricultural grasses with nine species and S. officinarum with only six species. This is the first report on diversity of Fusarium associated with grasses in Malaysia.

Rooting depth varies differentially in trees and grasses as a function of mean annual rainfall in an African savanna.

Science.gov (United States)

Holdo, Ricardo M; Nippert, Jesse B; Mack, Michelle C

2018-01-01

A significant fraction of the terrestrial biosphere comprises biomes containing tree-grass mixtures. Forecasting vegetation dynamics in these environments requires a thorough understanding of how trees and grasses use and compete for key belowground resources. There is disagreement about the extent to which tree-grass vertical root separation occurs in these ecosystems, how this overlap varies across large-scale environmental gradients, and what these rooting differences imply for water resource availability and tree-grass competition and coexistence. To assess the extent of tree-grass rooting overlap and how tree and grass rooting patterns vary across resource gradients, we examined landscape-level patterns of tree and grass functional rooting depth along a mean annual precipitation (MAP) gradient extending from ~ 450 to ~ 750 mm year -1 in Kruger National Park, South Africa. We used stable isotopes from soil and stem water to make inferences about relative differences in rooting depth between these two functional groups. We found clear differences in rooting depth between grasses and trees across the MAP gradient, with grasses generally exhibiting shallower rooting profiles than trees. We also found that trees tended to become more shallow-rooted as a function of MAP, to the point that trees and grasses largely overlapped in terms of rooting depth at the wettest sites. Our results reconcile previously conflicting evidence for rooting overlap in this system, and have important implications for understanding tree-grass dynamics under altered precipitation scenarios.

Effect of high-sugar grasses on methane emissions simulated using a dynamic model

NARCIS (Netherlands)

St-Pierre, J.L.; Dijkstra, J.; France, J.; Parsons, A.J.; Edwards, G.R.; Rasmussen, S.; Kebreab, E.; Bannink, A.

2012-01-01

High-sugar grass varieties have received considerable attention for their potential ability to decrease N excretion in cattle. However, feeding high-sugar grasses alters the pattern of rumen fermentation, and no in vivo studies to date have examined this strategy with respect to another

GRASS-SST, Fission Products Gas Release and Fuel Swelling in Steady-State and Transients

International Nuclear Information System (INIS)

Zawadzki, S.

2001-01-01

1 - Description of program or function: GRASS-SST is a comprehensive, mechanistic model for the prediction of fission-gas behaviour in UO 2 -base fuels during steady-state and transient conditions. GRASS-SST treats fission-gas release and fuel swelling on an equal basis and simultaneously treats all major mechanisms that influence fission-gas behaviour. Models are included for intra- and inter-granular fission-gas bubble behaviour as well as a mechanistic description of the role of grain-edge inter-linked porosity on fission-gas release and swelling. GRASS-SST calculations include the effects of gas production from fissioning uranium atoms, bubble nucleation, a realistic equation of state for xenon, lattice bubble diffusivities based on experimental observations, bubble migration, bubble coalescence, re-solution, temperature and temperature gradients, inter-linked porosity, and fission-gas interaction with structural defects (dislocations and grain boundaries) on both the distribution of fission-gas within the fuel and on the amount of fission-gas released from the fuel. GRASS-SST includes the effects of the degree of nonequilibrium in the UO 2 lattice on fission-gas bubble mobility and bubble coalescence and also accounts for the observed formation of grain-surface channels. GRASS-SST also includes mechanistic models for grain-growth/grain boundary sweeping and for the behaviour of fission gas during liquefaction/dissolution and fuel melting conditions. 2 - Method of solution: A system of coupled equations for the evolution of the fission-gas bubble-size distributions in the lattice, on dislocations, on grain faces, and grain edges is derived based on the GRASS-SST models. Given a set of operating conditions, GRASS-SST calculates the bubble radii for the size classes of bubbles under consideration using a realistic equation of state for xenon as well as a generalised capillary relation. 3 - Restrictions on the complexity of the problem: Maxima of : 1 axial section

Influence of grass pellet production on pyrrolizidine alkaloids occurring in Senecio aquaticus-infested grassland.

Science.gov (United States)

Gottschalk, Christoph; Ostertag, Johannes; Meyer, Karsten; Gehring, Klaus; Thyssen, Stefan; Gareis, Manfred

2018-04-01

1,2-Dehydro-pyrrolizidine alkaloids (PA) and their N-oxides (PANO) exhibit acute and chronic toxic effects on the liver and other organs and therefore are a hazard for animal and human health. In certain regions of Germany, an increasing spread of Senecio spp. (ragwort) on grassland and farmland areas has been observed during the last years leading to a PA/PANO-contamination of feed and food of animal and plant origin. This project was carried out to elucidate whether the process of grass pellet production applying hot air drying influences the content of PA and PANO. Samples of hay (n = 22) and grass pellets (n = 28) originated from naturally infested grassland (around 10% and 30% dominance of Senecio aquaticus) and from a trial plot with around 50% dominance. Grass pellets were prepared from grass originating from exactly the same plots as the hay samples. The samples were analysed by liquid chromatography-tandem mass spectrometry for PA/PANO typically produced by this weed. The results of the study revealed that PA/PANO levels (predominantly sum of senecionine, seneciphylline, erucifoline and their N-oxides) in hay ranged between 2.1 and 12.6 mg kg -1 dry matter in samples with 10% and 30% dominance of S. aquaticus, respectively. Samples from the trial plot (50% dominance) had levels of up to 52.9 mg kg -1 . Notably, the hot air drying process during the production of grass pellets did not lead to a reduction of PA/PANO levels. Instead, the levels in grass pellets with 10% and 30% S. aquaticus ranged from 3.1 to 55.1 mg kg -1 . Grass pellets from the trial plot contained up to 96.8 mg kg -1 . In conclusion, hot air drying and grass pellet production did not affect PA/PANO contents in plant material and therefore, heat-dried products cannot be regarded as safe in view of the toxic potential of 1,2-dehydro-pyrrolizidine alkaloids.

Simple Web-based interactive key development software (WEBiKEY) and an example key for Kuruna (Poaceae: Bambusoideae).

Science.gov (United States)

Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G

2016-04-01

Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.

Acid hydrolysis of kallar grass (leptochloa fusca) for the production

International Nuclear Information System (INIS)

Chughtai, F.A.; Shah, M.H.

1993-01-01

Acid hydrolysis of kallar grass (leptochloa fusca) was carried of with various concentrations of sulphuric acid, ortho phosphoric acid and hydrochloric acid to produce furfural. The study revealed that activity of various hydrolysing acids to produce furfural from kallar grass was of the following order H/sub 2/SO/sub 4/ > H/sub 3/PO/sub 4/ > HCl. Optimum yield (4.78%) of the produce was obtained when the material was digested with 19% H/sub 2/SO/sub 4/ for a period of 20 minutes. (author)

The study of size and stability of n-butylcyanoacrylate nanocapsule suspensions encapsulating green grass fragrance

Science.gov (United States)

Zhu, G. Y.; Lin, C. T.; Chen, J. M.; Lei, D. M.; Zhu, G. X.

2018-01-01

Green grass fragrance has been widely used in many fields. However, fragrances are volatile compounds that do not last long. In order to prolong its odor, nanocapsules encapsulated green grass fragrance were prepared. The paper deals with the preparation of green grass fragrance nanocapsules by emulsion polymerization. N-butylcyanoacrylate (BCA) with excellent biocompatibility and biodegradability was used as encapsulant. The nanocapsule suspension systems were characterized and its stability was investigated. The physicochemical properties of polymeric nanocapsules (average diameter and polydispersity) were evaluated as a function of time to assess the system stability. The result showed that the system (containing 0.8% of green grass fragrance, with a polydispersity index (PDI) near 0.1 and an average diameter in the range of 20-30 nm) was an ideal state and relatively stable. Besides, the distinction of stability of three nanocapsule suspensions with different green grass fragrance content was also obvious from scanning electron microscopy (SEM).

Diversity of alkane hydroxylase genes on the rhizoplane of grasses planted in petroleum-contaminated soils

OpenAIRE

Tsuboi, Shun; Yamamura, Shigeki; Nakajima-Kambe, Toshiaki; Iwasaki, Kazuhiro

2015-01-01

The study investigated the diversity and genotypic features of alkane hydroxylase genes on rhizoplanes of grasses planted in artificial petroleum-contaminated soils to acquire new insights into the bacterial communities responsible for petroleum degradation in phytoremediation. Four types of grass (Cynodon dactylon, two phenotypes of Zoysia japonica, and Z. matrella) were used. The concentrations of total petroleum hydrocarbon effectively decreased in the grass-planted systems compared with t...

A consensus linkage map of the grass carp (Ctenopharyngodon idella based on microsatellites and SNPs

Directory of Open Access Journals (Sweden)

Li Jiale

2010-02-01

Full Text Available Abstract Background Grass carp (Ctenopharyngodon idella belongs to the family Cyprinidae which includes more than 2000 fish species. It is one of the most important freshwater food fish species in world aquaculture. A linkage map is an essential framework for mapping traits of interest and is often the first step towards understanding genome evolution. The aim of this study is to construct a first generation genetic map of grass carp using microsatellites and SNPs to generate a new resource for mapping QTL for economically important traits and to conduct a comparative mapping analysis to shed new insights into the evolution of fish genomes. Results We constructed a first generation linkage map of grass carp with a mapping panel containing two F1 families including 192 progenies. Sixteen SNPs in genes and 263 microsatellite markers were mapped to twenty-four linkage groups (LGs. The number of LGs was corresponding to the haploid chromosome number of grass carp. The sex-specific map was 1149.4 and 888.8 cM long in females and males respectively whereas the sex-averaged map spanned 1176.1 cM. The average resolution of the map was 4.2 cM/locus. BLAST searches of sequences of mapped markers of grass carp against the whole genome sequence of zebrafish revealed substantial macrosynteny relationship and extensive colinearity of markers between grass carp and zebrafish. Conclusions The linkage map of grass carp presented here is the first linkage map of a food fish species based on co-dominant markers in the family Cyprinidae. This map provides a valuable resource for mapping phenotypic variations and serves as a reference to approach comparative genomics and understand the evolution of fish genomes and could be complementary to grass carp genome sequencing project.

Dynamics of forage accumulation in Elephant grass subjected to rotational grazing intensities

Directory of Open Access Journals (Sweden)

Braulio Maia de Lana Sousa

2013-09-01

Full Text Available We assessed the accumulation dynamics of forage and its components in Elephant grass cv. Napier (Pennisetum purpureum Schum. that were subjected to three post-grazing height treatments (30, 50, and 70 cm from February through May 2009 (experiment one and December 2009 through May 2010 (experiment two. In experiment one, the grazing events started when the light interception by the canopy reached 95%. The same was adopted for experiment two, except for the first grazing event, which was based on the height of the apical meristems of basal tillers. The experimental design for both experiments was a randomized complete block with three replications. The pastures that were managed at a post-grazing height of 30 cm exhibited lower rates of leaf and stem growth, total growth and forage accumulation than those that were managed at 50 or 70 cm, indicating that post-grazing height affects Elephant grass. The pastures that were managed at 50 cm exhibited relatively stable accumulation rates and less stem accumulation. Pastures managed at 70 cm of pos-grazing height presented more leaf and stem accumulation. Most apical meristems of Elephant grass should be removed in the first grazing when they reach the post-grazing target height of 50 cm. The elevation in the residual post-grazing height, especially in the summer, raises the regrowth vigor in the Elephant grass cv. Napier pasture. The post-grazing height of 30 cm reduces the growth of the Elephant grass cv. Napier.

Grass Pollen Pollution from Biofuels Farming

Czech Academy of Sciences Publication Activity Database

Ratajová, A.; Tříska, Jan; Vrchotová, Naděžda; Kolář, L.; Kužel, S.

2013-01-01

Roč. 26, č. 4 (2013), s. 199-203 ISSN 2151-321X R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : grass pollen pollution * biofuels farming * temperate climate * PK-fertilization * N-fertilization * phenolic Subject RIV: EH - Ecology, Behaviour Impact factor: 0.556, year: 2013

Evaluating the Capability of Grass Swale for the Rainfall Runoff Reduction from an Urban Parking Lot, Seoul, Korea

Directory of Open Access Journals (Sweden)

Muhammad Shafique

2018-03-01

Full Text Available This field study elaborates the role of grass swale in the management of stormwater in an urban parking lot. Grass swale was constructed by using different vegetations and local soil media in the parking lot of Mapu-gu Seoul, Korea. In this study, rainfall runoff was first retained in soil and the vegetation layers of the grass swale, and then infiltrated rainwater was collected with the help of underground perforated pipe, and passed to an underground storage trench. In this way, grass swale detained a large amount of rainwater for a longer period of time and delayed peak discharge. In this field study, various real storm events were monitored and the research results were analyzed to evaluate the performance of grass swale for managing rainfall runoff in an urban area. From the analysis of field experiments, grass swale showed the significant rainfall runoff retention in different rain events. Grass swale markedly reduced total rainfall runoff volume and peak flow during the small storm events of intensity about 30 mm/h. From the analysis, on average rainfall runoff retention from the grass swale was found around 40 to 75% during the various small rain events. From the results, we can say that grass swale is a stormwater mitigation practice which can help avoid flash flooding problems in urban areas.

Evaluating the Capability of Grass Swale for the Rainfall Runoff Reduction from an Urban Parking Lot, Seoul, Korea.

Science.gov (United States)

Shafique, Muhammad; Kim, Reeho; Kyung-Ho, Kwon

2018-03-16

This field study elaborates the role of grass swale in the management of stormwater in an urban parking lot. Grass swale was constructed by using different vegetations and local soil media in the parking lot of Mapu-gu Seoul, Korea. In this study, rainfall runoff was first retained in soil and the vegetation layers of the grass swale, and then infiltrated rainwater was collected with the help of underground perforated pipe, and passed to an underground storage trench. In this way, grass swale detained a large amount of rainwater for a longer period of time and delayed peak discharge. In this field study, various real storm events were monitored and the research results were analyzed to evaluate the performance of grass swale for managing rainfall runoff in an urban area. From the analysis of field experiments, grass swale showed the significant rainfall runoff retention in different rain events. Grass swale markedly reduced total rainfall runoff volume and peak flow during the small storm events of intensity about 30 mm/h. From the analysis, on average rainfall runoff retention from the grass swale was found around 40 to 75% during the various small rain events. From the results, we can say that grass swale is a stormwater mitigation practice which can help avoid flash flooding problems in urban areas.

Evaluating the Capability of Grass Swale for the Rainfall Runoff Reduction from an Urban Parking Lot, Seoul, Korea

Science.gov (United States)

Shafique, Muhammad; Kim, Reeho; Kyung-Ho, Kwon

2018-01-01

This field study elaborates the role of grass swale in the management of stormwater in an urban parking lot. Grass swale was constructed by using different vegetations and local soil media in the parking lot of Mapu-gu Seoul, Korea. In this study, rainfall runoff was first retained in soil and the vegetation layers of the grass swale, and then infiltrated rainwater was collected with the help of underground perforated pipe, and passed to an underground storage trench. In this way, grass swale detained a large amount of rainwater for a longer period of time and delayed peak discharge. In this field study, various real storm events were monitored and the research results were analyzed to evaluate the performance of grass swale for managing rainfall runoff in an urban area. From the analysis of field experiments, grass swale showed the significant rainfall runoff retention in different rain events. Grass swale markedly reduced total rainfall runoff volume and peak flow during the small storm events of intensity about 30 mm/h. From the analysis, on average rainfall runoff retention from the grass swale was found around 40 to 75% during the various small rain events. From the results, we can say that grass swale is a stormwater mitigation practice which can help avoid flash flooding problems in urban areas. PMID:29547567

Gene capture from across the grass family in the allohexaploid Elymus repens (L.) Gould (Poaceae, Triticeae) as evidenced by ITS, GBSSI, and molecular cytogenetics.

Science.gov (United States)

Mahelka, Václav; Kopecký, David

2010-06-01

Four accessions of hexaploid Elymus repens from its native Central European distribution area were analyzed using sequencing of multicopy (internal transcribed spacer, ITS) and single-copy (granule-bound starch synthase I, GBSSI) DNA in concert with genomic and fluorescent in situ hybridization (GISH and FISH) to disentangle its allopolyploid origin. Despite extensive ITS homogenization, nrDNA in E. repens allowed us to identify at least four distinct lineages. Apart from Pseudoroegneria and Hordeum, representing the major genome constituents, the presence of further unexpected alien genetic material, originating from species outside the Triticeae and close to Panicum (Paniceae) and Bromus (Bromeae), was revealed. GBSSI sequences provided information complementary to the ITS. Apart from Pseudoroegneria and Hordeum, two additional gene variants from within the Triticeae were discovered: One was Taeniatherum-like, but the other did not have a close relationship with any of the diploids sampled. GISH results were largely congruent with the sequence-based markers. GISH clearly confirmed Pseudoroegneria and Hordeum as major genome constituents and further showed the presence of a small chromosome segment corresponding to Panicum. It resided in the Hordeum subgenome and probably represents an old acquisition of a Hordeum progenitor. Spotty hybridization signals across all chromosomes after GISH with Taeniatherum and Bromus probes suggested that gene acquisition from these species is more likely due to common ancestry of the grasses or early introgression than to recent hybridization or allopolyploid origin of E. repens. Physical mapping of rDNA loci using FISH revealed that all rDNA loci except one minor were located on Pseudoroegneria-derived chromosomes, which suggests the loss of all Hordeum-derived loci but one. Because homogenization mechanisms seem to operate effectively among Pseudoroegneria-like copies in this species, incomplete ITS homogenization in our samples

Bioethanol production from recovered napier grass with heavy metals.

Science.gov (United States)

Ko, Chun-Han; Yu, Fan-Chun; Chang, Fang-Chih; Yang, Bing-Yuan; Chen, Wen-Hua; Hwang, Wen-Song; Tu, Ta-Chih

2017-12-01

Using plants to absorb and accumulate heavy metals from polluted soil, followed by the recycling of explants containing heavy metals, can help achieve the goal of reverting contaminated soil to low heavy-metal content soil. However, the re-use of recovered explants can also be problematic. Meanwhile, bioethanol has become a popular energy source. In this study, napier grass was used for the remediation of soil contaminated with heavy metals (artificially contaminated soil). The influence of bioethanol production from napier grass after phytoremediation was also investigated. The concentration of Zn, Cd, and Cr in the contaminated soil was 1000, 100, and 250 mg/kg, respectively. After napier grass phytoremediation, the concentration (dry biomass) of Zn, Cd, and Cr in the explants was 2701.97 ± 173.49, 6.1 ± 2.3, and 74.24 ± 1.42 mg/kg, respectively. Biomass production in the unpolluted soil was 861.13 ± 4.23 g. The biomass production ratio in high Zn-polluted soil was only 3.89%, while it was 4.68% for Cd and 21.4% for Cr. The biomass obtained after napier grass phytoremediation was pretreated using the steam explosion conditions of 180 °C, for 10 min, with 1.5% H 2 SO 2 , followed by enzymatic hydrolysis. The efficiency of enzymatic hydrolysis for Zn-polluted biomass was 90% of the unpolluted biomass, while it was 77% for Cd, and approximately the same for Cr. The fermentation efficiency of the heavy-metal-containing biomass was higher than the control biomass. The fermentation ethanol concentration obtained was 8.69-12.68, 13.03-15.50, and 18.48-19.31 g/L in Zn, Cd, and Cr environments, respectively. Results show that the heavy metals had a positive effect on bacteria fermentation. However, the fermentation efficiency was lower for biomass with severe heavy metal pollution. Thus, the utilization of napier grass phytoremediation for bioethanol production has a positive effect on the sustainability of environmental resources. Copyright © 2017

Forage tree legumes. II. Investigation of nitrogen transfer to an associated grass using a split-root technique

International Nuclear Information System (INIS)

Catchpoole, D.W.; Blair, G.J.

1990-01-01

The glasshouse study reported, employed a split-root technique, whereby trees of leucaena and gliricidia were grown in boxes with 15 N fed to one half of the root system and the transfer of N to the other half of the box was measured by sampling tree and planted grass. Detection of 15 N in the grass tops and roots from the unlabelled half of the box was used to indicate N transfer from the tree roots to the grass. Transfer of labelled N to the grass amounted to 4.1% in the first 6 week period when 15 N was being injected in the tree root zone. A harvest of the tree and grass was made at 6 weeks and both allowed to regrow for a further 6 weeks with no further addition of 15 N. Over the entire 12 week experimental period 7.6% of the labelled N from the tree was transferred to the grass. The low proportion of N transferred from tree legume to the grass in this experiment, where herbage was cut and removed, is similar to the findings in the earlier field experiment and indicates that, in such a system, little direct beneficial effect of N fixation would be expected in an understorey grass or food crop. 24 refs., 4 tabs

Predicting Dry Matter Composition of Clover Grass Leys Using Data Simulation and Camera-based Segmentation of Field Canopies into White Clover, Red Clover, Grass and Weeds

DEFF Research Database (Denmark)

Skovsen, Søren; Dyrmann, Mads; Eriksen, Jørgen

2018-01-01

species in the biomass. In our setup, we exploit the top-down canopy view of the clover grass ley to estimate the volumetric composition of the yield, and predict the composition of the dry matter of the forage. Using a deep learning approach, the canopy image is automatically pixel-wise segmented....... The biggest hindrance to training a fully convolutional deep neural network is the requirement of labeled data. Due to the complexity, the high number of leaves and high levels of occlusions in clover grass canopies, hand labeling the data requires roughly 20 hours of manual labor per image. The need...... for hundreds or thousands labeled training images renders this approach unfeasible. We have shown that implementation of image simulation of distinct clover grass fields can reduce the labeling task significantly. Investing less than 20 hours of labor, thousands of simulated images and corresponding labels can...

Preventive and Therapeutic Role of Functional Ingredients of Barley Grass for Chronic Diseases in Human Beings

Directory of Open Access Journals (Sweden)

Yawen Zeng

2018-01-01

Full Text Available Barley grass powder is the best functional food that provides nutrition and eliminates toxins from cells in human beings; however, its functional ingredients have played an important role as health benefit. In order to better cognize the preventive and therapeutic role of barley grass for chronic diseases, we carried out the systematic strategies for functional ingredients of barley grass, based on the comprehensive databases, especially the PubMed, Baidu, ISI Web of Science, and CNKI, between 2008 and 2017. Barley grass is rich in functional ingredients, such as gamma-aminobutyric acid (GABA, flavonoids, saponarin, lutonarin, superoxide dismutase (SOD, K, Ca, Se, tryptophan, chlorophyll, vitamins (A, B1, C, and E, dietary fiber, polysaccharide, alkaloid, metallothioneins, and polyphenols. Barley grass promotes sleep; has antidiabetic effect; regulates blood pressure; enhances immunity; protects liver; has anti-acne/detoxifying and antidepressant effects; improves gastrointestinal function; has anticancer, anti-inflammatory, antioxidant, hypolipidemic, and antigout effects; reduces hyperuricemia; prevents hypoxia, cardiovascular diseases, fatigue, and constipation; alleviates atopic dermatitis; is a calcium supplement; improves cognition; and so on. These results support that barley grass may be one of the best functional foods for preventive chronic diseases and the best raw material of modern diet structure in promoting the development of large health industry and further reveal that GABA, flavonoids, SOD, K-Ca, vitamins, and tryptophan mechanism of barley grass have preventive and therapeutic role for chronic diseases. This paper can be used as a scientific evidence for developing functional foods and novel drugs for barley grass for preventive chronic diseases.

Anaerobic Mono- and Co-digestion of Mechanically Pretreated Meadow Grass for Biogas Production

DEFF Research Database (Denmark)

Tsapekos, Panagiotis; Kougias, Panagiotis; Angelidaki, Irini

2015-01-01

), was investigated. The grass silage was mechanically pretreated with different methods to increase its biodegradability. It was found that the early cut of non-treated meadow grass silage led to higher methane production [294 mL of CH4/g of volatile solids (VS)] compared to the corresponding non-treated meadow...... grass silage from the late cut (282 mL of CH4/g of VS). Moreover, it was found that the application of two mesh grating plates, as the pretreatment method, greatly enhanced the methane production in early and late cut silage in a range of 15 and 17%, respectively, compared to the non-treated grass...... ratios in terms of organic matter. The results showed that the optimum silage concentration in the co-digestion mixture with manure, for the highest methane yield, was strongly dependent upon the chemical composition of the manure. More specifically, the ammonia concentration of manure and the C/N ratio...

Feeding Dairy Cows to Increase Performance on Rhodes Grass Ley

International Nuclear Information System (INIS)

Irungu, K.R.G.; Mbugua, P.N.

1999-01-01

Majority of dairy farmers in Kenya produce milk from cows fed on roughage. The cow performance follows seasonal variability in quality and quantity of roughage. The objective of the current study was to increase cow performance and maintain productivity of a rhodes grass (chloris gayana) ley. Twenty-four Freisian cows in their second to third lactation were strip grazed on fertilized irrigated Rhodes grass at a stocking rate of 0.034 ha per cow. Four dietary groups of six cows were allocated to one of our diets. one group got no dairy meal while the other three groups were supplemented at a 1kg of dairy meal per 10, 5 and 2.5 kg of 4% fat corrected milk dairy. this amount to 0, 386, 750 and 1542 kg dairy meal (89.4%, DM, 93.7 OM, 16.8, CP and CF) during the lactation. during the 43 - week lactation, records on pasture nutrient yield, nutrient intake, milk yield, liveweight, reproduction and subsequent calf birth weight were collected. The Rhodes grass ley produced 20.7 (ranging from 16.7 to 28.7) t of dry matter (DM) per hectare and cows harvested 16.0 (12.0 to 24.0) t during the 43 weeks.The Rhodes grass contained 32.1, 87.7, 10.8, and 32.3% DM, organic matter (OM), crude protein (CP) and crude fiber (CF) respectively. Mean stubble of 4.7 (3.9 to 6.0) t DM per hectare was left at pasture. Feeding dairy meals significantly increased (P 0.05) affect batter fat content (3.78 to 3.96%). It maintained (P > 0.05) cow liveweight and increased (P < 0.05) calf birth weight from 32.7 to 37.2 kg. Feeding dairy meal did not affect oestrus cycling. Extreme supplementation, 1542 kg dairy meal, decreased (P < 0.05) fertility. Insemination per conception and calving interval increased (P < 0.05) from 1.5 to 3.5 and 522 days. The findings in the current study show that pasture yield can be increased by over 590% dry matter from 3.5 t obtained from natural pasture containing Kikuyu and Star grasses. The Rhodes grass yield can be increased to 232% of national average yield of 1300

Proving Non-Deterministic Computations in Agda

Directory of Open Access Journals (Sweden)

Sergio Antoy

2017-01-01

Full Text Available We investigate proving properties of Curry programs using Agda. First, we address the functional correctness of Curry functions that, apart from some syntactic and semantic differences, are in the intersection of the two languages. Second, we use Agda to model non-deterministic functions with two distinct and competitive approaches incorporating the non-determinism. The first approach eliminates non-determinism by considering the set of all non-deterministic values produced by an application. The second approach encodes every non-deterministic choice that the application could perform. We consider our initial experiment a success. Although proving properties of programs is a notoriously difficult task, the functional logic paradigm does not seem to add any significant layer of difficulty or complexity to the task.

Production of tropical forage grasses under different shading levels

Directory of Open Access Journals (Sweden)

Francisco Eduardo Torres

2017-12-01

Full Text Available This study aimed to evaluate the forage production of three tropical forage grasses under different shading levels. The experiment was conducted in a greenhouse at Universidade Estadual de Mato Grosso do Sul, University Unit of Aquidauana (UEMS/UUA, in a soil classified as Ultisol sandy loam texture. The treatments consisted of three grasses species combinations (B. brizantha cv. Marandu, B. decumbens cv. Basilisck and Panicum maximum cv. Tanzania, submitted to four shading levels (0, 30, 50 and 75%, arranged in a completely randomized blocks design in a factorial 3 x 4, with eight replications. After harvest, the plants were separated into shoot and roots for determination of shoot fresh mass (SFM, shoot dry mass (SDM and roots dry mass production. After analysis of variance, the qualitative factor was subjected to comparison of averages by Tukey’s test, and the quantitative factor to analysis of polynomial regression, being interactions appropriately unfolded. It was verified that B. decumbens, by its linearly increasing production of forage and less decrease of root formation, is the most recommended for shading conditions compared to grasses Tanzania and Marandu.

Morphology and anatomy of the diaspores and seedling of Paspalum (Poaceae, Poales

Directory of Open Access Journals (Sweden)

MAYRA T. EICHEMBERG

2013-09-01

Full Text Available ABSTRACT The knowledge regarding of the diaspore and post-seminal development of Paspalum L. is important for grassland biodiversity conservation, based on their representativeness and genetic improvement of forage. The morphology of the diaspore and the post-seminal development of Paspalum dilatatum Poir. (rhizomatous, P. mandiocanum Trin. var. subaequiglume Barreto (stoloniferous, P. pumilum Nees. (decumbent caespitose and P. urvillei Steud. (erect caespitose was described to distinguish species with different growth forms and to survey the characters useful for taxonomy. P. dilatatum differs by presenting oval diaspores larger than the others, with five prominent nerves and trichomes; P. urvillei presents diaspores with one central nerve that is more developed than the two lateral nerves and trichomes; P. mandiocanum var. subaequiglume presents diaspores with trichomes only in the margin; and P. pumilum differs by presenting glabrous diaspores. The caryopsis involves the seed that presents the differentiated embryo and disposed laterally, an elliptical hilum in all of the studied species and a rostellum in P. dilatatum and P. mandiocanum var. subaequiglume. The post-seminal development is similar in the four species and begins with germination that is marked by the emergence of the coleorhiza, followed by the coleoptile. These characteristics are common to other Poaceae previously studied, indicating a pattern to the family and do not distinguish the growth forms.

Comparison between Urea and Goat Manure as Sources of Nitrogen for Napier Grass Grown on Terraced Hill

Directory of Open Access Journals (Sweden)

Rahman, M.M.

2016-12-01

Full Text Available Effects of two nitrogen (N sources on dry matter (DM yield and nutritive value of Napier grass were evaluated. The nitrogen (N fertiliser (at rate of 300 kg N ha?1 year?1 was applied by dividing the terraces of a hill under two treatments: T1 (urea and T2 (goat manure. There were three replicates of each treatment arranged within three blocks in a completely randomised design. Grass was cut at about 60?day interval. In the first to fourth harvests, grass receiving manure had higher plant height than those with urea application. Grass receiving manure had higher DM yield than urea in almost all of the cuttings. In the fourth harvest, grass receiving urea contained higher DM and organic matter (OM than manure. Similar result was found for fifth harvest where urea gave higher crude protein (CP than manure. Irrespective of harvesting frequencies, average DM, OM, CP and neutral detergent fibre contents were not significantly different between grasses fertilised with manure and urea. In conclusion, manure is recommended for economical cultivation of Napier grass on terrace of hill.

20 CFR 219.23 - Evidence to prove death.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...

Optimization of Pretreatment and Enzymatic Saccharification of Cogon Grass Prior Ethanol Production

OpenAIRE

Jhalique Jane R. Fojas; Ernesto J. Del Rosario

2013-01-01

The dilute acid pretreatment and enzymatic saccharification of lignocellulosic substrate, cogon grass (Imperata cylindrical, L.) was optimized prior ethanol fermentation using simultaneous saccharification and fermentation (SSF) method. The optimum pretreatment conditions, temperature, sulfuric acid concentration, and reaction time were evaluated by determining the maximum sugar yield at constant enzyme loading. Cogon grass, at 10% w/v substrate loading, has optimum pretr...

Satellite Phenology Observations Inform Peak Season of Allergenic Grass Pollen Aerobiology across Two Continents

Science.gov (United States)

Huete, A. R.; Devadas, R.; Davies, J.

2015-12-01

Pollen exposure and prevalence of allergenic diseases have increased in many parts of the world during the last 30 years, with exposure to aeroallergen grass pollen expected to intensify with climate change, raising increased concerns for allergic diseases. The primary contributing factors to higher allergenic plant species presence are thought to be climate change, land conversion, and biotic mixing of species. Conventional methods for monitoring airborne pollen are hampered by a lack of sampling sites and heavily rely on meteorology with less attention to land cover updates and monitoring of key allergenic species phenology stages. Satellite remote sensing offers an alternative method to overcome the restrictive coverage afforded by in situ pollen networks by virtue of its synoptic coverage and repeatability of measurements that enable timely updates of land cover and land use information and monitoring landscape dynamics and interactions with human activity and climate. In this study, we assessed the potential of satellite observations of urban/peri-urban environments to directly inform landscape conditions conducive to pollen emissions. We found satellite measurements of grass cover phenological evolution to be highly correlated with in situ aerobiological grass pollen concentrations in five urban centres located across two hemispheres (Australia and France). Satellite greenness data from the Moderate Resolution Imaging Spectroradiometer (MODIS) were found to be strongly synchronous with grass pollen aerobiology in both temperate grass dominated sites (France and Melbourne), as well as in Sydney, where multiple pollen peaks coincided with the presence of subtropical grasses. Employing general additive models (GAM), the satellite phenology data provided strong predictive capabilities to inform airborne pollen levels and forecast periods of grass pollen emissions at all five sites. Satellite phenology offer promising opportunities of improving public health risk

Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae) affected by environmental factors.

Science.gov (United States)

Wang, Qiuxia; Liu, Huitao; Gao, Ainong; Yang, Xinming; Liu, Weihua; Li, Xiuquan; Li, Lihui

2012-01-01

Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae) are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng) J.L.Yang et al. (2n = 6x = 42, StStPPYY), collected from different environments, were studied using genome in situ hybridization (GISH). We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15%) and Y (22.22%), in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05). The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01). Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae affected by environmental factors.

Directory of Open Access Journals (Sweden)

Qiuxia Wang

Full Text Available Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng J.L.Yang et al. (2n = 6x = 42, StStPPYY, collected from different environments, were studied using genome in situ hybridization (GISH. We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15% and Y (22.22%, in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05. The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01. Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

Towards regional mapping of grass nutrients using remote sensing in Greater Kruger National Park

CSIR Research Space (South Africa)

Ramoelo, Abel

2011-03-01

Full Text Available Regional maps of grass nutrients are important to inform decision making regarding the management of savanna ecosystems. Grass nutrients plays a crucial role in understanding the distribution, densities and feeding patterns of both wild herbivores...

Dynamic model for the transfer of CS-137 through the soil-grass-lamb foodchain

DEFF Research Database (Denmark)

Nielsen, S.P.

1994-01-01

A dynamic radioecological model for the transfer of radiocaesium through the soil-grass-lamb foodchain was constructed on the basis of field data collected in 1990–1993 from the Nordic countries: Denmark, Faroe Islands, Finland, Iceland, Norway and Sweden. The model assumes an initial soil...... contamination of one kilobecquerel of 137Cs per square metre and simulates the transfer to grass through root uptake in addition to direct contamination from resuspended activity. The model covers two different soil types: clay-loam and organic, with significantly different transfers of radiocaesium to grass...

Spatial and temporal soil moisture resource partitioning by trees and grasses in a temperate savanna, Arizona, USA.

Science.gov (United States)

Weltzin, Jake F; McPherson, Guy R

1997-10-01

Stable isotope analysis was used to determine sources of water used by coexisting trees and grasses in a temperate savanna dominated by Quercus emoryi Torr. We predicted that (1) tree seedlings and bunchgrasses utilize shallow sources of soil water, (2) mature savanna trees use deeper sources of water, and (3) trees switch from shallow to deep water sources within 1 year of germination. We found that Q. emoryi trees, saplings, and seedlings (about 2 months, 1 year, and 2 years old), and the dominant bunchgrass [Trachypogon montufari (H.B.K.) Nees.] utilized seasonally available moisture from different depths within the soil profile depending on size/age relationships. Sapling and mature Q. emoryi acquired water from >50 cm deep, 2-month-old seedlings utilized water from emoryi within extant stands of native grasses. The potential for subsequent interaction between Q. emoryi and native grasses was evidenced by similar patterns of soil water use by 1- and 2-year-old seedlings and grasses. Q. emoryi seedlings did not switch from shallow to deep sources of soil water within 2 years of germination: water use by these seedlings apparently becomes independent of water use by grasses after 2 years of age. Finally, older trees (saplings, mature trees) use water from deeper soil layers than grasses, which may facilitate the stable coexistence of mature trees and grasses. Potential shifts in the seasonality of precipitation may alter interactions between woody plants and grasses within temperate savannas characterized by bimodal precipitation regimes: reductions in summer precipitation or soil moisture may be particularly detrimental to warm-season grasses and seedlings of Q. emoryi.

Does crotalaria (Crotalaria breviflora or pumpkin (Cucurbita moschata inter-row cultivation in restoration plantings control invasive grasses?

Directory of Open Access Journals (Sweden)

Ricardo Gomes César

2013-08-01

Full Text Available Alternative methods to control invasive fodder grasses are necessary to reduce the use of herbicides in forest restoration, which has been carried out primarily in riparian zones. We sought to investigate if inter-row cultivation of crotalaria (Crotalaria breviflora DC or pumpkin (Cucurbita moschata Duschene ex. Poir with native tree species is an efficient strategy to control invasive fodder grasses in restoration plantings. We tested five treatments in a randomized block design, namely (1 control of brachiaria grass (Urochloa decumbens (Stapf. Webster with glyphosate in the implementation and post-planting grass control of the reforestation, (2 and 3 glyphosate use in the implementation and inter-row sowing of crotalaria (2 or pumpkin (3, and control of brachiaria by mowing in the post-planting phase, (4 and 5 mowing in the implementation and inter-row sowing of crotalaria (4 or pumpkin (5, and control of brachiaria by mowing in the post-planting phase. Post-planting grass control was carried out four and nine months after tree seedling planting. Throughout 13 months, we evaluated the percentage of ground cover by brachiaria grass, pumpkin production, and native tree seedling mortality, height and crown cover. The exclusive use of glyphosate, without inter-row sowing of pumpkin or crotalaria showed the most favorable results for controlling brachiaria grass and, consequently, for tree seedling development. Hence, inter-row cultivation of green manure or short-lived crop species is not enough to control invasive grasses in restoration plantings, and complementary weeding is necessary to reduce the highly competitive potential of C4 grasses for supporting native species seedlings growth.

Elliptic curves and primality proving

Science.gov (United States)

Atkin, A. O. L.; Morain, F.

1993-07-01

The aim of this paper is to describe the theory and implementation of the Elliptic Curve Primality Proving algorithm. Problema, numeros primos a compositis dignoscendi, hosque in factores suos primos resolvendi, ad gravissima ac utilissima totius arithmeticae pertinere, et geometrarum tum veterum tum recentiorum industriam ac sagacitatem occupavisse, tam notum est, ut de hac re copiose loqui superfluum foret.

Lignin and etherified ferulates impact digestibility and structural composition of three temperate perennial grasses

Science.gov (United States)

Breeding grasses for increased digestibility increases their value and profitability in ruminant livestock production systems. Digestibility can be improved in grasses by either increasing the concentration of soluble and readily fermentable carbohydrates or by altering the plant cell wall to create...

Tree-grass interaction dynamics and pulsed fires : mathematical and numerical studies

OpenAIRE

Tamen, A. T.; Dumont, Y.; Tewa, J. J.; Bowong, S.; Couteron, Pierre

2016-01-01

Savannas are dynamical systems where grasses and trees can either dominate or coexist. Fires are known to be central in the functioning of the savanna biome although their characteristics are expected to vary along the rainfall gradients as observed in Sub-Saharan Africa. In this paper, we model the tree-grass dynamics using impulsive differential equations that consider fires as discrete events. This framework allows us to carry out a comprehensive qualitative mathematical analysis that reve...

Tree-Grass interactions dynamics and Pulse Fires: mathematical and numerical studies

OpenAIRE

Tamen, A. Tchuinté; Dumont, Y.; Bowong, S.; Tewa, J. J.; Couteron, P.

2015-01-01

Savannas are dynamical systems where grasses and trees can either dominate or coexist. Fires are known to be central in the functioning of the savanna biome though their characteristics are expected to vary along the rainfall gradients as observed in Sub-Saharan Africa. In this paper, we model the tree-grass dynamics using impulsive differential equations that consider fires as discrete events. This framework allows us to carry out a comprehensive qualitative mathematical analysis that reveal...

Photosynthetic pathways and the geographical distribution of grasses in South West Africa/Namibia

International Nuclear Information System (INIS)

Ellis, R.P.; Vogel, J.C.; Fuls, A.

1980-01-01

Analysis of floristic lists for South West Africa/Namibia shows that, throughout the territory, more than 95% of the grass species occurring in any given area display the C 4 photosynthetic pathway. Exceptions are areas in the north-east and southwest where between 5% and 18% of the grass species are of the C 3 type. The south-western district of Luderitz falls within the winter rainfall area and it is only here that temperate C 3 genera are found. The C 3 species in the north-east belong to tropical groups. Most of the South West African C 3 grasses grow in specialized habitats and are either hydrophytes or sciophytes. Subdivision of the C 4 grasses into the three subtypes of the C 4 pathway reveals distinctive distributional trends. Malate formers or NADP-me species clearly become more abundant with increasing rainfall, whereas the aspartate formers show the opposite tendency. However, within the aspartate forming group the results show that it is specifically the NAD-me type of species which dominate in areas of very low precipitation, notably in the Namib and pre-Namib areas where rainfall is less than 200 mm/yr. The PEP-ck species form a group intermediate between the malate formers and the NAD-me grasses, especially as far as their water requirements are concerned [af

Photosynthetic pathways and the geographical distribution of grasses in South West Africa/Namibia

Energy Technology Data Exchange (ETDEWEB)

Ellis, R P [Department of Agriculture and Fisheries, Pretoria (South Africa). Botanical Research Institute; Vogel, J C; Fuls, A [Council for Scientific and Industrial Research, Pretoria (South Africa). National Physical Research Lab.

1980-07-01

Analysis of floristic lists for South West Africa/Namibia shows that, throughout the territory, more than 95% of the grass species occurring in any given area display the C/sub 4/ photosynthetic pathway. Exceptions are areas in the north-east and southwest where between 5% and 18% of the grass species are of the C/sub 3/ type. The south-western district of Luderitz falls within the winter rainfall area and it is only here that temperate C/sub 3/ genera are found. The C/sub 3/ species in the north-east belong to tropical groups. Most of the South West African C/sub 3/ grasses grow in specialized habitats and are either hydrophytes or sciophytes. Subdivision of the C/sub 4/ grasses into the three subtypes of the C/sub 4/ pathway reveals distinctive distributional trends. Malate formers or NADP-me species clearly become more abundant with increasing rainfall, whereas the aspartate formers show the opposite tendency. However, within the aspartate forming group the results show that it is specifically the NAD-me type of species which dominate in areas of very low precipitation, notably in the Namib and pre-Namib areas where rainfall is less than 200 mm/yr. The PEP-ck species form a group intermediate between the malate formers and the NAD-me grasses, especially as far as their water requirements are concerned.

Mixing less palatable grasses with urea, molasses and effective microorganisms and its effect on chemical composition and digestibility in goats

International Nuclear Information System (INIS)

Batool, N.

2013-01-01

Abstract:- A study was carried out at National Agricultural Research Centre, Islamabad to find out impacts of supplementation of low palatable grasses with urea, molasses and Effective Microorganisms (EM) on chemical composition and digestibility in goats. Heteropogon contortus (HC), Chrysopogon aucheri(CA), sorghum halpense (SH) and Desmostachya bipinnata (DB) were used and the combinations were grass + 4% molasses, grass + 4% urea, grass + 4% urea + 4% molasses, grass + 4% urea + 1:100 EM, grass + 1:100 EM + 4% molasses, grass +1:100 EM + 4% molasses + 4% urea. Proximate analysis of samples was carried out. Crude protein content of mixtures improved as compared with sole grasses. Digestibility of HC supplemented with urea, molasses and EM in various combinations was also studied in growing goats. The highest digestibility of DM in goats was recorded in HC + 4% urea + 4% molasses treatment (85.51%) followed by HC + 4% urea (78.57%) and HC + 4% urea + 4% molasses + 1:100 EM (78.00%). (author)