Energy Technology Data Exchange (ETDEWEB)
Gardner, R M [Great Minister House, London (United Kingdom). Dept. of Transfert London
1998-12-31
Results of the ANCAT/EC 2 inventory produced by the European ANCAT/EC emissions inventory group is reported. The base year inventory has been completed and is currently being written up for report publication. The ANCAT/EC 2 inventory in the base year, 1991/92, has accounted for a total fuel burn of 132.5 Tg/yr and a NO{sub x} mass of 1.82 Tg/yr. The civil subsonic fleet average emissions index is EI NO{sub x} 13.9. The inventory has accounted for 80% of the IEA refined jet fuel total for 1992. The forecast 2015 inventory accounts for 289.4 Tg/yr fuel and 3.48 Tg/yr NO{sub x}, increases of 118% and 91% respectively. Both datasets will be reported fully in the next few months. (author) 5 refs.
Energy Technology Data Exchange (ETDEWEB)
Gardner, R.M. [Great Minister House, London (United Kingdom). Dept. of Transfert London
1997-12-31
Results of the ANCAT/EC 2 inventory produced by the European ANCAT/EC emissions inventory group is reported. The base year inventory has been completed and is currently being written up for report publication. The ANCAT/EC 2 inventory in the base year, 1991/92, has accounted for a total fuel burn of 132.5 Tg/yr and a NO{sub x} mass of 1.82 Tg/yr. The civil subsonic fleet average emissions index is EI NO{sub x} 13.9. The inventory has accounted for 80% of the IEA refined jet fuel total for 1992. The forecast 2015 inventory accounts for 289.4 Tg/yr fuel and 3.48 Tg/yr NO{sub x}, increases of 118% and 91% respectively. Both datasets will be reported fully in the next few months. (author) 5 refs.
Application and expression of HSV gG1 protein from a recombinant strain.
Yan, Hua; Yan, Huishen; Huang, Tao; Li, Guocai; Gong, Weijuan; Jiao, Hongmei; Chen, Hongju; Ji, Mingchun
2010-11-01
According to the homologous sequence of glycoprotein G1 (gG1) genes from different strains of herpes simplex virus type 1 (HSV-1), a pair of primers was designed to amplify the gG1 gene fragment by PCR. Both the PCR product and the pGEX-4T-1 vector were digested with EcoR I and Sal I. The gG1 gene fragment was subcloned into the digested pGEX-4T-1 vector to construct a recombinant plasmid (pGEX-4T-1-gG1). The resultant plasmid was identified by dual-enzyme digestion and sequence analysis, and then transformed into Escherichia coli BL21 for expression under the induction of isopropyl β-D-1-thiogalactoside (IPTG). The expressed GST-gG1 fragment was detected by SDS-PAGE and purified by affinity chromatography. The properties of GST-gG1 fragment were evaluated by immunoblot analysis. Enzyme-linked immunosorbent assays (ELISAs) based on the GST-gG1 fragment were used for determining IgG or IgM to HSV-1. The GST-gG1 fragment-specific ELISA was also compared with ELISA with whole-HSV-1 antigen and commercial ELISA kits. The gG1-specific IgG and IFN-γ producing CD8+ T cells were induced in mice immunized with the GST-gG1 fragment. These results indicated that the GST-gG1 fragment could be used for replacing whole-virus antigen to detect IgM and IgG to HSV-1 in human sera, which provided a strategy for developing vaccines to protect HSV-1 infection using gG1 fragment. Copyright © 2010 Elsevier B.V. All rights reserved.
DYNAMICS OF CIRCUMSTELLAR DISKS. III. THE CASE OF GG Tau A
International Nuclear Information System (INIS)
Nelson, Andrew F.; Marzari, F.
2016-01-01
We present two-dimensional hydrodynamic simulations using the Smoothed Particle Hydrodynamic code, VINE, to model a self-gravitating binary system. We model configurations in which a circumbinary torus+disk surrounds a pair of stars in orbit around each other and a circumstellar disk surrounds each star, similar to that observed for the GG Tau A system. We assume that the disks cool as blackbodies, using rates determined independently at each location in the disk by the time dependent temperature of the photosphere there. We assume heating due to hydrodynamical processes and to radiation from the two stars, using rates approximated from a measure of the radiation intercepted by the disk at its photosphere. We simulate a suite of systems configured with semimajor axes of either a = 62 AU (“wide”) or a = 32 AU (“close”), and with assumed orbital eccentricity of either e = 0 or e = 0.3. Each simulation follows the evolution for ∼6500–7500 yr, corresponding to about three orbits of the torus around the center of mass. Our simulations show that strong, sharply defined spiral structures are generated from the stirring action of the binary and that, in some cases, these structures fragment into 1–2 massive clumps. The torus quickly fragments into several dozen such fragments in configurations in which either the binary is replaced by a single star of equal mass, or radiative heating is neglected. The spiral structures extend inwards to the circumstellar environment as large scale material streams for which most material is found on trajectories that return it to the torus on a timescale of 1–200 yr, with only a small fraction accreting into the circumstellar environment. The spiral structures also propagate outwards through the torus, generating net outwards mass flow, and eventually losing coherence at large distances from the stars. The torus becomes significantly eccentric in shape over most of its evolution. In all configurations, accretion onto the
DYNAMICS OF CIRCUMSTELLAR DISKS. III. THE CASE OF GG Tau A
Energy Technology Data Exchange (ETDEWEB)
Nelson, Andrew F. [XCP-2, Mailstop T082, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Marzari, F., E-mail: andy.nelson@lanl.gov, E-mail: francesco.marzari@pd.infn.it [Università di Padova, Dipartimento di Fisica, via Marzolo 8, 35131 Padova (Italy)
2016-08-20
We present two-dimensional hydrodynamic simulations using the Smoothed Particle Hydrodynamic code, VINE, to model a self-gravitating binary system. We model configurations in which a circumbinary torus+disk surrounds a pair of stars in orbit around each other and a circumstellar disk surrounds each star, similar to that observed for the GG Tau A system. We assume that the disks cool as blackbodies, using rates determined independently at each location in the disk by the time dependent temperature of the photosphere there. We assume heating due to hydrodynamical processes and to radiation from the two stars, using rates approximated from a measure of the radiation intercepted by the disk at its photosphere. We simulate a suite of systems configured with semimajor axes of either a = 62 AU (“wide”) or a = 32 AU (“close”), and with assumed orbital eccentricity of either e = 0 or e = 0.3. Each simulation follows the evolution for ∼6500–7500 yr, corresponding to about three orbits of the torus around the center of mass. Our simulations show that strong, sharply defined spiral structures are generated from the stirring action of the binary and that, in some cases, these structures fragment into 1–2 massive clumps. The torus quickly fragments into several dozen such fragments in configurations in which either the binary is replaced by a single star of equal mass, or radiative heating is neglected. The spiral structures extend inwards to the circumstellar environment as large scale material streams for which most material is found on trajectories that return it to the torus on a timescale of 1–200 yr, with only a small fraction accreting into the circumstellar environment. The spiral structures also propagate outwards through the torus, generating net outwards mass flow, and eventually losing coherence at large distances from the stars. The torus becomes significantly eccentric in shape over most of its evolution. In all configurations, accretion onto the
Gluz, O; Liedtke, C; Huober, J; Peyro-Saint-Paul, H; Kates, R E; Kreipe, H H; Hartmann, A; Pelz, E; Erber, R; Mohrmann, S; Möbus, V; Augustin, D; Hoffmann, G; Thomssen, C; Jänicke, F; Kiechle, M; Wallwiener, D; Kuhn, W; Nitz, U; Harbeck, N
2016-06-01
Potential prognostic and predictive markers in early, intermediate-risk breast cancer (BC) include histological grade, Ki-67, genomic signatures, e.g. genomic grade index (GGI), and intrinsic subtypes. Their prognostic/predictive impact in hormone receptor (HR: ER and/or PR) positive/HER2- BC is controversial. WSG-AGO EC-Doc demonstrated superior event-free survival (EFS) in patients with 1-3 positive lymph node receiving epirubicin/cyclophosphamide-docetaxel (EC-Doc) versus 5-fluoruracil/epirubicin/cyclophosphamide (FEC). In a representative trial subset, we quantify concordance among factors used for clinical chemotherapy indication. We investigate the impact of central histology (n = 772), immunohistochemistry for intrinsic subtyping and IHC4, and dichotomous (GG) or continuous (GGI) genomic grade (n = 472) on patient outcome and benefit from taxane chemotherapy, focusing on HR+/HER2- patients (n = 459). Concordance of local grade (LG) with central (CG) or genomic grade was modest. In HR+/HER2- patients, low (GG-1: 16%), equivocal (GG-EQ: 17%), and high (GG-3: 67%) GG were associated with respective 5-year EFS of 100%, 93%, and 85%. GGI was prognostic for EFS within all LG subgroups and within CG3, whereas IHC4 was prognostic only in CG3 tumors.In unselected and HR+/HER2- patients, CG3 and luminal-A-like subtype entered the multivariate EFS model, but not IHC4 or GG. In the whole population, continuous GGI entered the model [hazard ratio (H.R.) of 75th versus 25th = 2.79; P = 0.01], displacing luminal-A-like subtype; within HR+/HER2- (H.R. = 5.36; P Doc versus FEC in unselected but not in HR+/HER2- patients. In the WSG-AGO EC-Doc trial for intermediate-risk BC, CG, intrinsic subtype (by IHC), and GG provide prognostic information. Continuous GGI (but not IHC4) adds prognostic information even when IHC subtype and CG are available. Finally, the high interobserver variability for histological grade and the still missing validation of Ki-67 preclude indicating or
Whole-Cell Biocatalysis for Producing Ginsenoside Rd from Rb1 Using Lactobacillus rhamnosus GG.
Ku, Seockmo; You, Hyun Ju; Park, Myeong Soo; Ji, Geun Eog
2016-07-28
Ginsenosides are the major active ingredients in ginseng used for human therapeutic plant medicines. One of the most well-known probiotic bacteria among the various strains on the functional food market is Lactobacillus rhamnosus GG. Biocatalytic methods using probiotic enzymes for producing deglycosylated ginsenosides such as Rd have a growing significance in the functional food industry. The addition of 2% cellobiose (w/v) to glucose-free de Man-Rogosa-Sharpe broths notably induced β-glucosidase production from L. rhamnosus GG. Enzyme production and activity were optimized at a pH, temperature, and cellobiose concentration of 6.0, 40°C, and 2% (w/v), respectively. Under these controlled conditions, β-glucosidase production in L. rhamnosus GG was enhanced by 25-fold. Additionally, whole-cell homogenates showed the highest β-glucosidase activity when compared with disrupted cell suspensions; the cell disruption step significantly decreased the β-glucosidase activity. Based on the optimized enzyme conditions, whole-cell L. rhamnosus GG was successfully used to convert ginsenoside Rb1 into Rd.
Radiation-induced damage and recovery effects in GG17 glass irradiated by 1 MeV electrons
International Nuclear Information System (INIS)
Wang Qingyan; Zhang Zhonghua; Geng Hongbin; Sun Chengyue; Yang Dezhuang; He Shiyu; Hu Zhaochu
2012-01-01
The optical properties and microstructural damage of GG17 glasses, as well as their recovery during annealing at room temperature, are investigated after exposure to 1 MeV electrons with various fluences. Experimental results show that the electrons lead to severe optical degradation in the GG17 glass, and induce the formation of paramagnetic defects which can be mainly attributed to the boron–oxygen hole centers. With increasing annealing time at room temperature their decay serves as long-lived defects following first order kinetics. Except for the strong absorption bands located at 334–352 nm and 480 nm that corresponds to the boron–oxygen hole centers, weaker absorption bands appear at 780 nm or 794.6 nm after irradiation, inducing a decrease in transmittance by approximately 17% for a fluence of 1 × 10 16 cm −2 . It is shown that electron irradiation could cause a harmful effect on rubidium lamps when GG17 glass is used as the lamp envelope material.
Simmonds, P. G.; Rigby, M.; Manning, A. J.; Lunt, M. F.; O'Doherty, S.; McCulloch, A.; Fraser, P. J.; Henne, S.; Vollmer, M. K.; Mühle, J.; Weiss, R. F.; Salameh, P. K.; Young, D.; Reimann, S.; Wenger, A.; Arnold, T.; Harth, C. M.; Krummel, P. B.; Steele, L. P.; Dunse, B. L.; Miller, B. R.; Lunder, C. R.; Hermansen, O.; Schmidbauer, N.; Saito, T.; Yokouchi, Y.; Park, S.; Li, S.; Yao, B.; Zhou, L. X.; Arduini, J.; Maione, M.; Wang, R. H. J.; Ivy, D.; Prinn, R. G.
2016-01-01
High frequency, in situ observations from 11 globally distributed sites for the period 1994-2014 and archived air measurements dating from 1978 onward have been used to determine the global growth rate of 1,1-difluoroethane (HFC-152a, CH3CHF2). These observations have been combined with a range of atmospheric transport models to derive global emission estimates in a top-down approach. HFC-152a is a greenhouse gas with a short atmospheric lifetime of about 1.5 years. Since it does not contain chlorine or bromine, HFC-152a makes no direct contribution to the destruction of stratospheric ozone and is therefore used as a substitute for the ozone depleting chlorofluorocarbons (CFCs) and hydrochlorofluorocarbons (HCFCs). The concentration of HFC-152a has grown substantially since the first direct measurements in 1994, reaching a maximum annual global growth rate of 0.84 ± 0.05 ppt yr-1 in 2006, implying a substantial increase in emissions up to 2006. However, since 2007, the annual rate of growth has slowed to 0.38 ± 0.04 ppt yr-1 in 2010 with a further decline to an annual average rate of growth in 2013-2014 of -0.06 ± 0.05 ppt yr-1. The annual average Northern Hemisphere (NH) mole fraction in 1994 was 1.2 ppt rising to an annual average mole fraction of 10.1 ppt in 2014. Average annual mole fractions in the Southern Hemisphere (SH) in 1998 and 2014 were 0.84 and 4.5 ppt, respectively. We estimate global emissions of HFC-152a have risen from 7.3 ± 5.6 Gg yr-1 in 1994 to a maximum of 54.4 ± 17.1 Gg yr-1 in 2011, declining to 52.5 ± 20.1 Gg yr-1 in 2014 or 7.2 ± 2.8 Tg-CO2 eq yr-1. Analysis of mole fraction enhancements above regional background atmospheric levels suggests substantial emissions from North America, Asia, and Europe. Global HFC emissions (so called "bottom up" emissions) reported by the United Nations Framework Convention on Climate Change (UNFCCC) are based on cumulative national emission data reported to the UNFCCC, which in turn are based on
and alanine (EC. 2.6.1.2) transaminases, and alkaline phosphatase
African Journals Online (AJOL)
The activities of aspartate (E.C. 2.6.1.1) and alanine (E.C. 2.6.1.2) transaminases (AST and ALT, respectively), and alkaline phosphatase (ALP) (E.C. 3.1.3.1) were determined in erythrocytes obtained from 20 HbAA, 15 HbAS and 12 HbSS human subjects. The results showed that the three enzymes had different levels of ...
Genome instability in Lactobacillus rhamnosus GG
Sybesma, W.; Molenaar, D.; IJcken, W. van; Venema, K.; Korta, R.
2013-01-01
We describe here a comparative genome analysis of three dairy product isolates of Lactobacillus rhamnosus GG (LGG) and the ATCC 53103 reference strain to the published genome sequence of L. rhamnosus GG. The analysis showed that in two of three isolates, major DNA segments were missing from the
The UGT1A6_19_GG genotype is a breast cancer risk factor
Directory of Open Access Journals (Sweden)
Christina eJustenhoven
2013-06-01
Full Text Available Validation of an association between the UGT1A6_19_T>G (rs6759892 polymorphism and overall breast cancer risk. A pilot study included two population-based case-control studies from Germany (MARIE-GENICA. An independent validation study comprised four independent breast cancer case-control studies from Finland (KBCP, OBCS, Germany (BBCC and Sweden (SASBAC. The pooled analysis included 7,418 cases and 8,720 controls from all six studies. Participants were of European descent. Genotyping was done by MALDI-TOF MS and statistical analysis was performed by logistic regression adjusted for age and study. The increased overall breast cancer risk for women with the UGT1A6_19_GG genotype which was observed in the pilot study was confirmed in the set of four independent study collections (OR 1.13, 95% CI 1.05-1.22; p = 0.001. The pooled study showed a similar effect (OR 1.09, 95% CI 1.04-1.14; p = 0.001. We confirmed the association of UGT1A6_19_GG with increased overall breast cancer risk and conclude that our result from a well powered multi-stage study adds a novel candidate to the panel of validated breast cancer susceptibility loci.
Egg cell-secreted EC1 triggers sperm cell activation during double fertilization.
Sprunck, Stefanie; Rademacher, Svenja; Vogler, Frank; Gheyselinck, Jacqueline; Grossniklaus, Ueli; Dresselhaus, Thomas
2012-11-23
Double fertilization is the defining characteristic of flowering plants. However, the molecular mechanisms regulating the fusion of one sperm with the egg and the second sperm with the central cell are largely unknown. We show that gamete interactions in Arabidopsis depend on small cysteine-rich EC1 (EGG CELL 1) proteins accumulating in storage vesicles of the egg cell. Upon sperm arrival, EC1-containing vesicles are exocytosed. The sperm endomembrane system responds to exogenously applied EC1 peptides by redistributing the potential gamete fusogen HAP2/GCS1 (HAPLESS 2/GENERATIVE CELL SPECIFIC 1) to the cell surface. Furthermore, fertilization studies with ec1 quintuple mutants show that successful male-female gamete interactions are necessary to prevent multiple-sperm cell delivery. Our findings provide evidence that mutual gamete activation, regulated exocytosis, and sperm plasma membrane modifications govern flowering plant gamete interactions.
Near-Infrared Polarimetry of the GG Tauri A Binary System
Itoh, Yoichi; Oasa, Yumiko; Kudo, Tomoyuki; Kusakabe, Nobuhiko; Hashimoto, Jun; Abe, Lyu; Brandner, Wolfgang; Brandt, Timothy D.; Carson, Joseph C.; Egner, Sebastian;
2014-01-01
A high angular resolution near-infrared image that shows the intensity of polarization for the GG Tau A binary system was obtained with the Subaru Telescope. The image shows a circumbinary disk scattering the light from the central binary. The azimuthal profile of the intensity of polarization for the circumbinary disk is roughly reproduced by a simple disk model with the Henyey-Greenstein phase function and the Rayleigh function, indicating there are small dust grains at the surface of the disk. Combined with a previous observation of the circumbinary disk, our image indicates that the gap structure in the circumbinary disk orbits counterclockwise, but material in the disk orbits clockwise. We propose that there is a shadow caused by material located between the central binary and the circumbinary disk. The separations and position angles of the stellar components of the binary in the past 20 yr are consistent with the binary orbit with a = 33.4 AU and e = 0.34.
Álvarez, Beatriz; Krogh-Andersen, Kasper; Tellgren-Roth, Christian; Martínez, Noelia; Günaydın, Gökçe; Lin, Yin; Martín, M Cruz; Álvarez, Miguel A; Hammarström, Lennart; Marcotte, Harold
2015-09-01
Rotavirus is the leading cause of infantile diarrhea in developing countries, where it causes a high number of deaths among infants. Two vaccines are available, being highly effective in developed countries although markedly less efficient in developing countries. As a complementary treatment to the vaccines, a Lactobacillus strain producing an anti-rotavirus antibody fragment in the gastrointestinal tract could potentially be used. In order to develop such an alternative therapy, the effectiveness of Lactobacillus rhamnosus GG to produce and display a VHH antibody fragment (referred to as anti-rotavirus protein 1 [ARP1]) on the surface was investigated. L. rhamnosus GG is one of the best-characterized probiotic bacteria and has intrinsic antirotavirus activity. Among four L. rhamnosus GG strains [GG (CMC), GG (ATCC 53103), GG (NCC 3003), and GG (UT)] originating from different sources, only GG (UT) was able to display ARP1 on the bacterial surface. The genomic analysis of strain GG (UT) showed that the genes welE and welF of the EPS cluster are inactivated, which causes a defect in exopolysaccharide (EPS) production, allowing efficient display of ARP1 on its surface. Finally, GG (UT) seemed to confer a level of protection against rotavirus-induced diarrhea similar to that of wild-type GG (NCC 3003) in a mouse pup model, indicating that the EPS may not be involved in the intrinsic antirotavirus activity. Most important, GG (EM233), a derivative of GG (UT) producing ARP1, was significantly more protective than the control strain L. casei BL23. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
[Characteristics and sources apportionment of OC and EC in PM1.1 from Nanjing].
Jiang, Wen-juan; Guo, Zhao-bing; Liu, Feng-ling; Rui, Mao-ling; Shi, Lei; Zeng, Gang; Guo, Zi-yan
2015-03-01
The concentrations of OC and EC in PM1.1 collected from Nanshi (NS) and Nanhua (NH) in 2011 were analyzed using DRI Model 2001A Thermal Optical Carbon Analyzer. In addition, source apportionment was simultaneously evaluated. The results showed that the annual average concentrations of OC and EC in PM1.1 were 10. 10 μg x m(-3) and 2.52 μg x m(-3) in NS area, and 11.22 μg x m(-3) and 3.12 μg x m(-3) in NH area, respectively. This result indicated that OC and EC pollution in NH was more serious than that in NS area. Meanwhile, the concentrations of OC and EC in winter and spring were obviously higher compared to those in summer in these two sampling sites, which was mainly ascribed to the increased coal combustion and the unfavorable emission condition of air pollutants in summer and spring. We noted that the SOC/TOC value was the highest in summer and the lowest in winter. In addition, the SOC concentration was observed to show a positive correlation with ozone concentrations, which indicated that the photochemical reaction was a main way of SOC formation in autumn.
International Nuclear Information System (INIS)
Boyd, Mark R.; Winters, Jennifer G.; Henry, Todd J.; Jao, Wei-Chun; Finch, Charlie T.; Subasavage, John P.; Hambly, Nigel C.
2011-01-01
We present 2817 new southern proper motion systems with 0.''40 yr -1 > μ ≥ 0.''18 yr -1 and declination between -47 0 and 00 0 . This is a continuation of the SuperCOSMOS-RECONS (SCR) proper motion searches of the southern sky. We use the same photometric relations as previous searches to provide distance estimates based on the assumption that the objects are single main-sequence stars. We find 79 new red dwarf systems predicted to be within 25 pc, including a few new components of previously known systems. Two systems-SCR 1731-2452 at 9.5 pc and SCR 1746-3214 at 9.9 pc-are anticipated to be within 10 pc. We also find 23 new white dwarf (WD) candidates with distance estimates of 15-66 pc, as well as 360 new red subdwarf candidates. With this search, we complete the SCR sweep of the southern sky for stars with μ ≥ 0.''18 yr -1 and R 59F ≤ 16.5, resulting in a total of 5042 objects in 4724 previously unreported proper motion systems. Here we provide selected comprehensive lists from our SCR proper motion search to date, including 152 red dwarf systems estimated to be within 25 pc (9 within 10 pc), 46 WDs (10 within 25 pc), and 598 subdwarf candidates. The results of this search suggest that there are more nearby systems to be found at fainter magnitudes and lower proper motion limits than those probed so far.
Chitinase Production by Serratia marcescens GG5
SINGH, Gursharan; SHARMA, Joginder Ram; HOONDAL, Gurinder Singh
2008-01-01
Swollen chitin, flake chitin, powder chitin, and mushroom paste were used as substrates for chitinase production by Serratia marcescens GG5 in submerged fermentation. Enzyme production was 0.3 U/ml when the organism was grown in M9 medium supplemented with 0.5% swollen chitin and 0.5% soluble starch. Scanning electron microscopy revealed that Serratia marcescens GG5 digested the chitin flakes by producing chitinase.
Douillard, François P; Ribbera, Angela; Xiao, Kun; Ritari, Jarmo; Rasinkangas, Pia; Paulin, Lars; Palva, Airi; Hao, Yanling; de Vos, Willem M
2016-07-01
Lactobacillus rhamnosus GG is a lactic acid bacterium widely marketed by the food industry. Its genomic analysis led to the identification of a gene cluster encoding mucus-binding SpaCBA pili, which is located in a genomic island enriched in insertion sequence (IS) elements. In the present study, we analyzed by genome-wide resequencing the genomic integrity of L. rhamnosus GG in four distinct evolutionary experiments conducted for approximately 1,000 generations under conditions of no stress or salt, bile, and repetitive-shearing stress. Under both stress-free and salt-induced stress conditions, the GG population (excluding the mutator lineage in the stress-free series [see below]) accumulated only a few single nucleotide polymorphisms (SNPs) and no frequent chromosomal rearrangements. In contrast, in the presence of bile salts or repetitive shearing stress, some IS elements were found to be activated, resulting in the deletion of large chromosomal segments that include the spaCBA-srtC1 pilus gene cluster. Remarkably, a high number of SNPs were found in three strains obtained after 900 generations of stress-free growth. Detailed analysis showed that these three strains derived from a founder mutant with an altered DNA polymerase subunit that resulted in a mutator phenotype. The present work confirms the stability of the pilus production phenotype in L. rhamnosus GG under stress-free conditions, highlights the possible evolutionary scenarios that may occur when this probiotic strain is extensively cultured, and identifies external factors that affect the chromosomal integrity of GG. The results provide mechanistic insights into the stability of GG in regard to its extensive use in probiotic and other functional food products. Lactobacillus rhamnosus GG is a widely marketed probiotic strain that has been used in numerous clinical studies to assess its health-promoting properties. Hence, the stability of the probiotic functions of L. rhamnosus GG is of importance, and
Directory of Open Access Journals (Sweden)
Andrea Lauková
2014-08-01
Full Text Available Cow lump cheese represents a traditional Slovak cheese. It belongs to fresh types of cheeses. The aim of this study was to test surviving of commercial probiotic strain Lactobacillus rhamnosus GG in cow lump cheese experimentally infected with L. innocua; (listeriae are contaminants and to check the suitability of GG strain as additive for this product. The counts of GG strain in cow lump cheeses were well balanced during whole experiment. It was found in the counts from 5.48 ± 0.15 to 7.77 ±1.50 log10 cfu/g. Its maximum in cheese was 7.77 ± 1.30 log10 cfu/g on day 7 with stability up to day 14. The identity of GG strain isolated from cheeses was confirmed by PCR. The counts of other lactic acid bacteria were also well balanced during the whole experiment in the experimental cheeses with stability up to day 14. Only in E1/GG cheese, the highest number of LAB was detected (10.60 ±1.26 log10 cfu/g. The count of L. innocua LMG 13568 was not influenced. The pH and lactic acid values were not negatively influenced. Visually, the GG cheese provided a good structure (consistency.It can be disputed that shelf-life of the product could be maintained by this way and/or the product itself with GG strain can be consumed as afunctional food or to serve as a probiotic strain carrier.
Nitrous oxide emission inventory of German forest soils
Schulte-Bisping, Hubert; Brumme, Rainer; Priesack, Eckart
2003-02-01
Annual fluxes of N2O trace gas emissions were assessed after stratifying German forest soils into Seasonal Emission Pattern (SEP) and Background Emission Pattern (BEP). Broad-leaved forests with soil pH(KCl) ≤ 3.3 were assigned to have SEP, broad-leaved forests with soil pH(KCl) > 3.3 and all needle-leaved forests to have BEP. BEPs were estimated by a relationship between annual N2O emissions and carbon content of the O-horizon. SEPs were primarily controlled by temperature and moisture and simulated by the model Expert-N after calibration to a 9-year record of N2O measurements. Analysis with different climate and soil properties indicated that the model reacts highly sensitive to changes in soil temperature, soil moisture, and soil texture. A geographic information system (ARC/INFO) was used for a spatial resolution of 1 km × 1 km grid where land cover, dominant soil units, and hygro climate classes were combined. The mean annual N2O emission flux from German forest soils was estimated as 0.32 kg ha-1 yr-1. Broad-leaved forests with SEP had the highest emissions (2.05 kg ha-1 yr-1) followed by mixed forests (0.38 kg ha-1 yr-1), broad-leaved forests (0.37 kg ha-1 yr-1), and needle-leaved forests with BEP (0.17 kg ha-1 yr-1). The annual N2O emission from German forest soils was calculated as 3.26 Gg N2O-N yr-1. Although needle-leaved trees cover about 57% of the entire forest area in Germany, their contribution is low (0.96 Gg N2O-N yr-1). Broad-leaved forests cover about 22% of the forest area but have 55% higher emissions (1.49 Gg N2O-N yr-1) than needle-leaved. Mixed forests cover 21% of the area and contribute 0.81 Gg N2O-N yr-1. Compared to the total N2O emissions in Germany of 170 Gg N yr-1, forest soils contribute only 1.9%. However, there are some uncertainties in this emission inventory, which are intensely discussed.
'Galileo Galilei-GG': design, requirements, error budget and significance of the ground prototype
International Nuclear Information System (INIS)
Nobili, A.M.; Bramanti, D.; Comandi, G.L.; Toncelli, R.; Polacco, E.; Chiofalo, M.L.
2003-01-01
'Galileo Galilei-GG' is a proposed experiment in low orbit around the Earth aiming to test the equivalence principle to the level of 1 part in 10 17 at room temperature. A unique feature of GG, which is pivotal to achieve high accuracy at room temperature, is fast rotation in supercritical regime around the symmetry axis of the test cylinders, with very weak coupling in the plane perpendicular to it. Another unique feature of GG is the possibility to fly 2 concentric pairs of test cylinders, the outer pair being made of the same material for detection of spurious effects. GG was originally designed for an equatorial orbit. The much lower launching cost for higher inclinations has made it worth redesigning the experiment for a sun-synchronous orbit. We report the main conclusions of this study, which confirms the feasibility of the original goal of the mission also at high inclination, and conclude by stressing the significance of the ground based prototype of the apparatus proposed for space
Directory of Open Access Journals (Sweden)
Malathesha Ganachari
2010-01-01
Full Text Available We previously reported that the -2518 MCP-1 genotype GG increases the likelihood of developing tuberculosis (TB in non-BCG-vaccinated Mexicans and Koreans. Here, we tested the hypothesis that this genotype, alone or together with the -1607 MMP-1 functional polymorphism, increases the likelihood of developing TB in BCG-vaccinated individuals. We conducted population-based case-control studies of BCG-vaccinated individuals in Mexico and Peru that included 193 TB cases and 243 healthy tuberculin-positive controls from Mexico and 701 TB cases and 796 controls from Peru. We also performed immunohistochemistry (IHC analysis of lymph nodes from carriers of relevant two-locus genotypes and in vitro studies to determine how these variants may operate to increase the risk of developing active disease. We report that a joint effect between the -2518 MCP-1 genotype GG and the -1607 MMP-1 genotype 2G/2G consistently increases the odds of developing TB 3.59-fold in Mexicans and 3.9-fold in Peruvians. IHC analysis of lymph nodes indicated that carriers of the two-locus genotype MCP-1 GG MMP-1 2G/2G express the highest levels of both MCP-1 and MMP-1. Carriers of these susceptibility genotypes might be at increased risk of developing TB because they produce high levels of MCP-1, which enhances the induction of MMP-1 production by M. tuberculosis-sonicate antigens to higher levels than in carriers of the other two-locus MCP-1 MMP-1 genotypes studied. This notion was supported by in vitro experiments and luciferase based promoter activity assay. MMP-1 may destabilize granuloma formation and promote tissue damage and disease progression early in the infection. Our findings may foster the development of new and personalized therapeutic approaches targeting MCP-1 and/or MMP-1.
Ganachari, Malathesha; Ruiz-Morales, Jorge A; Gomez de la Torre Pretell, Juan C; Dinh, Jeffrey; Granados, Julio; Flores-Villanueva, Pedro O
2010-01-25
We previously reported that the -2518 MCP-1 genotype GG increases the likelihood of developing tuberculosis (TB) in non-BCG-vaccinated Mexicans and Koreans. Here, we tested the hypothesis that this genotype, alone or together with the -1607 MMP-1 functional polymorphism, increases the likelihood of developing TB in BCG-vaccinated individuals. We conducted population-based case-control studies of BCG-vaccinated individuals in Mexico and Peru that included 193 TB cases and 243 healthy tuberculin-positive controls from Mexico and 701 TB cases and 796 controls from Peru. We also performed immunohistochemistry (IHC) analysis of lymph nodes from carriers of relevant two-locus genotypes and in vitro studies to determine how these variants may operate to increase the risk of developing active disease. We report that a joint effect between the -2518 MCP-1 genotype GG and the -1607 MMP-1 genotype 2G/2G consistently increases the odds of developing TB 3.59-fold in Mexicans and 3.9-fold in Peruvians. IHC analysis of lymph nodes indicated that carriers of the two-locus genotype MCP-1 GG MMP-1 2G/2G express the highest levels of both MCP-1 and MMP-1. Carriers of these susceptibility genotypes might be at increased risk of developing TB because they produce high levels of MCP-1, which enhances the induction of MMP-1 production by M. tuberculosis-sonicate antigens to higher levels than in carriers of the other two-locus MCP-1 MMP-1 genotypes studied. This notion was supported by in vitro experiments and luciferase based promoter activity assay. MMP-1 may destabilize granuloma formation and promote tissue damage and disease progression early in the infection. Our findings may foster the development of new and personalized therapeutic approaches targeting MCP-1 and/or MMP-1.
Non-weight-bearing status compromises the functional level up to 1 yr after hip fracture surgery
DEFF Research Database (Denmark)
Ariza-Vega, Patrocinio; Jiménez-Moleón, José Juan; Kristensen, Morten Tange
2014-01-01
, age, health status, and cognitive impairment of the patient were associated negatively with the 1-yr functional outcome (P ≤ 0.03). Prefracture functional level and non-WB status were the strongest determinants of functional level (β = 0.599 and -0.204, respectively; P ... after surgery, in addition to prefracture function, cognitive status, health status, age and fracture type, was found to be an independent predictor of the 1-yr functional outcome in hip fracture patients....
The role of the IGF-1 Ec in myoskeletal system and osteosarcoma pathophysiology.
Armakolas, Nikolaos; Armakolas, Athanasios; Antonopoulos, Athanasios; Dimakakos, Andreas; Stathaki, Martha; Koutsilieris, Michael
2016-12-01
Growth hormone (GH) regulated mainly liver-produced insulin-like growth factor 1 (IGF-1) is a key molecule in embryonic & post embryonic development that is also involved in cancer biology. Herein we review new insights of the role of igf-1 gene products and of the IGF-1Ec isoform in muscle and bone development/repair and its role in osteosarcoma pathophysiology, underlying the possible role of the Ec peptide as a future therapeutic target. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Completion Report for Well ER-EC-1
International Nuclear Information System (INIS)
Townsend, M.J.
2000-01-01
Well ER-EC-1 was drilled for the U.S. Department of Energy, Nevada Operations Office in support of the Nevada Environmental Restoration Project at the Nevada Test Site, Nye County, Nevada. This well was drilled in the spring of 1999 as part of the U.S. Department of Energy's hydrogeologic investigation well program in the Western Pahute Mesa - Oasis Valley region just west of the Test Site. A 44.5-centimeter surface hole was drilled and cased off to the depth 675.1 meters below the surface. The hole diameter was then decreased to 31.1 centimeters for drilling to a total depth of 1,524.0 meters. A preliminary composite, static, water level was measured at the depth of approximately 566.3 meters prior to installation of the completion string. One completion string with three isolated, slotted intervals was installed in the well. Detailed lithologic descriptions with preliminary stratigraphic assignments are included in the report. These are based on composite drill cuttings collected every 3 meters and 31 sidewall samples taken at various depths below 680 meters, supplemented by geophysical log data. Detailed chemical and mineralogical studies of rock samples are in progress. The well penetrated Tertiary-age lava and tuff of the Timber Mountain Group, the Paintbrush Group, the Calico Hills Formation, the Crater Flat Group, and the Volcanics of Quartz Mountain. The preliminary geologic interpretation of data from Well ER-EC-1 indicates the presence of a structural trough or bench filled with a thick section of post-Rainier Mesa lava. These data also suggest that this site is located on a buried structural ridge that may separate the Silent Canyon and Timber Mountain caldera complexes
Assessment of the magnitude of ammonia emissions in the United Kingdom
Sutton, M. A.; Place, C. J.; Eager, M.; Fowler, D.; Smith, R. I.
Estimates of ammonia emission in the U.K. have been critically reviewed with the aim of establishing the magnitude and uncertainty of each of the sources. European studies are also reviewed, with the U.K. providing a useful case study to highlight the uncertainties common to all ammonia emission inventories. This analysis of the emission factors and their application to U.K. sources supports an emission of 450 (231-715) Gg NH 3 yr -1. Agricultural activities are confirmed as the major source, providing 406 (215-630) Gg NH 3yr -1 (90% of the total), and therefore dominate uncertainties. Non-agricultural sources include sewage, pets, horses, humans, combustion and wild animals, though these contribute only 44 (16-85) Gg yr -1. Cattle represent the largest single uncertainty, accounting for 245 (119-389) Gg yr -1. The major uncertainties for cattle derive from estimation of the amount of nitrogen (N) excreted, the % N volatilized from land spreading of wastes, and the % N volatilized from stored farm-yard manure. Similar relative uncertainties apply to each of sheep, pigs and poultry, as well as fertilized crops, though these are quantitatively less important. Accounting; for regional differences in livestock demography, emission of 347, 63 and 40 Gg yr -1 are estimated for England & Wales, Scotland, and Northern Ireland, respectively. Though very uncertain, the total is in good agreement with estimates required to balance the U.K. atmospheric NH. budget.
Lactobacillus rhamnosus GG (ATCC 53103) and platelet aggregation in vitro.
Korpela, R; Moilanen, E; Saxelin, M; Vapaatalo, H
1997-06-17
Lactobacillus rhamnosus GG is an experimentally and clinically well documented probiotic used in different dairy products. The present study aimed to investigate the safety aspects of Lactobacillus rhamnosus GG, particularly with respect to platelet aggregation, the initiating event in thrombosis. Platelet rich plasma was separated from the blood of healthy volunteers, and the effects of Lactobacillus rhamnosus GG (ATCC 53103), Lactobacillus rhamnosus (ATCC 7469) and Enterococcus faecium T2L6 in different dilutions on spontaneous, ADP- and adrenaline-induced aggregation were tested. The bacteria did not influence spontaneous aggregation. Only Enterococcus faecium T2L6 enhanced the adrenaline-induced aggregation, with a less clear effect on ADP-induced aggregation.
Application of ECS to a hybrid automobile; `ECS` no hybrid jidosha eno tekiyo
Energy Technology Data Exchange (ETDEWEB)
Shimizu, M.; Okamura, T.
1997-01-30
This paper describes a simulation for a case when an energy capacitor system (ECS) is mounted in a hybrid electric vehicle in place of secondary batteries. The ECS is electric power storage equipment consisted of capacitors and electronic circuits, and capable of quick charge and discharge at high efficiency. Its energy density per unit weight is about the same as lead-acid batteries, but its output density is greater than any type of batteries. Being free of deterioration due to charge and discharge, its cycle life is almost limitless. In order to suppress heat generation, a switching converter is used to control the output to about 300W. However, internal resistance of an ECS is smaller than in an equivalent secondary battery, and internal loss and heat generation stay as low as 1/5 to 1/10. Discussions have been given on cases of using the ECS in small passenger cars, small buses/trucks, and large buses. Since the ECS can use the stored power to about 94% of the capacity, and its cycle life is sufficiently long, it can operate with charge capacity as small as 1/4 of a lead-acid battery. The weight can also be reduced largely. Regenerative power storage efficiency is high, fuel consumption can be improved, heat generation is less, and no forced cooling is required. 9 refs., 4 figs., 1 tab.
INFLUENCE OF PROBIOTIC CULTURE LACTOBACILLUS RHAMNOSUS GG (LGG) ON IMMUNE RESPONSE OF ORGANISM
A.V. Surzhik
2009-01-01
This article presents review of data of influence of probiotic culture Lactobacillus rhamnosus GG on intestinal biocenosis. Main attention was given to influence of L. rhamnosus GG on functions of immune system.Key words: probiotics, Lactobacillus rhamnosus GG, immune response.(Voprosy sovremennoi pediatrii — Current Pediatrics. 2009;8(2):54-58)
Directory of Open Access Journals (Sweden)
Venkategowda Ramegowda
Full Text Available NAC (NAM, ATAF1-2, and CUC2 proteins constitute one of the largest families of plant-specific transcription factors and have been shown to be involved in diverse plant processes including plant growth, development, and stress-tolerance. In this study, a stress-responsive NAC gene, EcNAC1, was isolated from the subtracted stress cDNA library generated from a drought adapted crop, finger millet, and characterized for its role in stress-tolerance. The expression analysis showed that EcNAC1 was highly induced during water-deficit and salt stress. EcNAC1 shares high amino acid similarity with rice genes that have been phylogenetically classified into stress-related NAC genes. Our results demonstrated that tobacco transgenic plants expressing EcNAC1 exhibit tolerance to various abiotic stresses like simulated osmotic stress, by polyethylene glycol (PEG and mannitol, and salinity stress. The transgenic plants also showed enhanced tolerance to methyl-viologen (MV induced oxidative stress. Reduced levels of reactive oxygen species (ROS and ROS-induced damage were noticed in pot grown transgenic lines under water-deficit and natural high light conditions. Root growth under stress and recovery growth after stress alleviation was more in transgenic plants. Many stress-responsive genes were found to be up-regulated in transgenic lines expressing EcNAC1. Our results suggest that EcNAC1 overexpression confers tolerance against abiotic stress in susceptible species, tobacco.
PM2.5 emissions and source profiles from open burning of crop residues
Ni, Haiyan; Tian, Jie; Wang, Xiaoliang; Wang, Qiyuan; Han, Yongming; Cao, Junji; Long, Xin; Chen, L.-W. Antony; Chow, Judith C.; Watson, John G.; Huang, Ru-Jin; Dusek, Ulrike
2017-11-01
Wheat straw, rice straw, and corn stalks, the major agricultural crop residues in China, were collected from six major crop producing regions, and burned in a laboratory combustion chamber to determine PM2.5 source profiles and speciated emission factors (EFs). Organic carbon (OC) and water-soluble ions (the sum of NH4+, Na+, K+, Mg2+, Ca2+, Cl-, NO3- and SO42-) are major constituents, accounting for 43.1 ± 8.3% and 27.4 ± 14.6% of PM2.5, respectively. Chloride (Cl-) and water-soluble potassium (K+) are the dominant ionic species, with an average abundance of 14.5 ± 8.2% and 6.4 ± 4.4% in PM2.5, respectively. The average K+/Cl- ratio is ∼0.4, lower than 2.8-5.4 for wood combustion. Similarity measures (i.e., Student's t-test, coefficient of divergence, correlations, and residual to uncertainty ratios) show the crop profiles are too similar for the species measured to be resolved from one another by receptor modeling. The largest difference was found between rice straw and corn stalk emissions, with higher OC and lower Cl- and K+ abundances (50%, 8%, and 3% of PM2.5, respectively) for corn stalks; lower OC, and higher Cl- and K+ abundances (38%, 21%, and 10% of PM2.5, respectively) for rice straw. Average EFs were 4.8 ± 3.1 g kg-1 for OC, 1.3 ± 0.8 g kg-1 for Cl- and 0.59 ± 0.56 g kg-1 for K+. Flaming and smoldering combustions resulted in an average modified combustion efficiency (MCE) of 0.92 ± 0.03, and low elemental carbon (EC) EFs (0.24 ± 0.12 g kg-1). OC/EC ratios from individual source profiles ranged from 12.9 ± 4.3 for rice straw to 24.1 ± 13.5 for wheat straw. The average K+/EC ratio was 2.4 ± 1.5, an order of magnitude higher than those from residential wood combustion (0.2-0.76). Elevated emission rates were found for OC (387 Gg yr-1) and Cl- (122 Gg yr-1), accounting for 44% and 14% of 2008 PM2.5 emissions in China.
International Nuclear Information System (INIS)
Sun, Weihua; Chen, Lujun; Tian, Jinping; Wang, Jianlong; He, Shijun
2013-01-01
The irradiation-induced degradation of an azo dye, Alizarin Yellow GG (AY-GG), was investigated in aqueous solution under gamma irradiation using a 60 Cobalt source at a dose rate of 113 Gy/min. The decolorization percentage of AY-GG reached 65% when its initial concentration was 100 mg/l and the absorbed dose was 9 kGy. The decolorization process could be described by first-order kinetic equation. In addition, specific oxygen uptake rate (SOUR, mg O 2 (g MLVSS) −1 h −1 ) of activated sludge using the irradiated azo dye solutions was 8.1 mg O 2 (g MLVSS) −1 h −1 after 9 kGy irradiation, indicating that the biodegradability of AY-GG could be enhanced by 30%. However, toxic intermediates including heterocyclic aromatic amines and cyanides were detected during the irradiation process, which inhibited the complete biological degradation of azo dye. Fortunately, the inhibition could be eliminated by further irradiation. The azo dye solution became amenable to biodegradation and can be further treated by biological treatment process. - Highlights: ► Decolorization process by radiation conformed to first-order kinetics. ► Biodegradability of AY-GG could be enhanced 30% after 9 kGy radiation. ► Radiation can be used as a pretreatment technology for azo dye-containing wastewater. ► Combining radiation with aerobic biological treatment is a feasible strategy.
Barletta, B.; Nissenson, P.; Meinardi, S.; Dabdub, D.; Sherwood Rowland, F.; Vancuren, R. A.; Pederson, J.; Diskin, G. S.; Blake, D. R.
2011-03-01
This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS) study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB), which includes much of Los Angeles (LA) County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg) and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg) in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO) enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr-1 for HFC-152a and 2.12 ± 0.28 Gg yr-1 for HFC-134a) and then extrapolated to the United States (32 ± 4 Gg yr-1 for HFC-152a and 43 ± 6 Gg yr-1 for HFC-134a) using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.
Critical pollutant emissions from the Indian telecom network
Sahu, S. K.; Schultz, M. G.; Beig, G.
2015-02-01
In recent years, India developed the world's 2nd largest telecom network based largely on mobile phone connections. The energy demand of the telecom sector especially in rural areas is mainly fueled by diesel combustion in mid-size generators due to either lack of grid power or unstable provision of electricity. This study quantifies the magnitude of emissions from the Indian telecom sector and presents a gridded inventory for the year 2011 with a spatial distribution derived on the provincial level including information on urban versus rural telecom installations. The estimated total NOx, PM, CO, BC, SO2, HC and CO2 emissions are found to be 295 ± 196 Gg/yr, 155 ± 108 Gg/yr, 61 ± 41 Gg/yr, 28 ± 18 Gg/yr, 114 ± 12 Gg/yr 19.50 ± 13 Gg/yr and 27.9 ± 12 million tons/yr, respectively. The future development of emissions from this sector will depend on the rate of electrification and possible market saturation. Air quality in rural areas of India could be improved by replacing diesel generators with renewable energy sources or electricity from the grid.
Walker, John F.; Hay, Lauren E.; Markstrom, Steven L.; Dettinger, Michael D.
2011-01-01
The U.S. Geological Survey Precipitation-Runoff Modeling System (PRMS) model was applied to basins in 14 different hydroclimatic regions to determine the sensitivity and variability of the freshwater resources of the United States in the face of current climate-change projections. Rather than attempting to choose a most likely scenario from the results of the Intergovernmental Panel on Climate Change, an ensemble of climate simulations from five models under three emissions scenarios each was used to drive the basin models. Climate-change scenarios were generated for PRMS by modifying historical precipitation and temperature inputs; mean monthly climate change was derived by calculating changes in mean climates from current to various future decades in the ensemble of climate projections. Empirical orthogonal functions (EOFs) were fitted to the PRMS model output driven by the ensemble of climate projections and provided a basis for randomly (but representatively) generating realizations of hydrologic response to future climates. For each realization, the 1.5-yr flood was calculated to represent a flow important for sediment transport and channel geomorphology. The empirical probability density function (pdf) of the 1.5-yr flood was estimated using the results across the realizations for each basin. Of the 14 basins studied, 9 showed clear temporal shifts in the pdfs of the 1.5-yr flood projected into the twenty-first century. In the western United States, where the annual peak discharges are heavily influenced by snowmelt, three basins show at least a 10% increase in the 1.5-yr flood in the twenty-first century; the remaining two basins demonstrate increases in the 1.5-yr flood, but the temporal shifts in the pdfs and the percent changes are not as distinct. Four basins in the eastern Rockies/central United States show at least a 10% decrease in the 1.5-yr flood; the remaining two basins demonstrate decreases in the 1.5-yr flood, but the temporal shifts in the pdfs
Effects of feeding lactobacillus GG on lethal irradiation in mice
International Nuclear Information System (INIS)
Dong, M.Y.; Chang, T.W.; Gorbach, S.L.
1987-01-01
Mice exposed to 1400 rads of total body irradiation experienced 80%-100% mortality in 2 wk. Bacteremia was demonstrated in all dead animals. Feeding Lactobacillus GG strain reduced Pseudomonas bacteremia and prolonged survival time in animals colonized with this organism. In animals not colonized with Pseudomonas, feeding Lactobacillus GG also produced some reduction in early deaths, and there was less Gram-negative bacteremia in these animals compared with controls
Incidence of type 1 diabetes mellitus in 0 to 14-yr-old children in Croatia--2004 to 2012 study.
Rojnic Putarek, Natasa; Ille, Jasenka; Spehar Uroic, Anita; Skrabic, Veselin; Stipancic, Gordana; Krnic, Nevena; Radica, Ana; Marjanac, Igor; Severinski, Srecko; Svigir, Alen; Bogdanic, Ana; Dumic, Miroslav
2015-09-01
The incidence of type 1 diabetes mellitus (T1DM) among children and adolescents increased during the last 50 yr. The T1DM incidence in Croatia was 8.87/100.000/yr over 1995-2003, with an annual increase of 9%, which placed Croatia among countries with moderate risk for T1DM. To investigate incidence rates and trends of T1DM from 2004 to 2012 in 0 to 14-yr-old Croatian children, and to compare the results with previous studies in Croatia and other European countries. T1DM crude incidence rates are estimated for the entire group and three subgroups: 0-4, 5-9, and 10-14 yr. Standardized incidence is calculated using the method of direct standardization according to World Health Organization (WHO) standard world population. The incidence rates by gender, age groups, seasonality, and calendar year, and their interactions were analyzed using Poisson regression model. A total of 1066 cases were ascertained over 2004-2012. The standardized incidence was 17.23/100.000/yr (95% CI: 16.19-18.26), with no significant differences in incidence rates or trends between boys and girls. Statistically significant annual increase of 5.87% (p Croatia, thus placing Croatia among countries with high risk for T1DM. The annual increment of 5.87% is considerably lower than 9.0% reported earlier, but still higher than the European average (3.9%). The increase in incidence ceased in youngest children. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
B. Barletta
2011-03-01
Full Text Available This work presents results from the NASA Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS study. Whole air samples were obtained on board research flights that flew over California during June 2008 and analyzed for selected volatile organic compounds, including several halogenated species. Samples collected over the South Coast Air Basin of California (SoCAB, which includes much of Los Angeles (LA County, were compared with samples from inflow air masses over the Pacific Ocean. The levels of many halocarbon species were enhanced significantly over the SoCAB, including compounds regulated by the Montreal Protocol and subsequent amendments. Emissions estimates of HFC-152a (1,1-difluoroethane, CH3CHF2; 0.82 ± 0.11 Gg and HFC-134a (1,1,1,2-tetrafluoroethane, CH2FCF3; 1.16 ± 0.22 Gg in LA County for 2008 were obtained using the observed HFC:carbon monoxide (CO enhancement ratio. Emission rates also were calculated for the SoCAB (1.60 ± 0.22 Gg yr−1 for HFC-152a and 2.12 ± 0.28 Gg yr−1 for HFC-134a and then extrapolated to the United States (32 ± 4 Gg yr−1 for HFC-152a and 43 ± 6 Gg yr−1 for HFC-134a using population data. In addition, emission rates of the two HFCs in LA County and SoCAB were calculated by a second method that utilizes air quality modeling. Emissions estimates obtained using both methods differ by less than 25% for the LA County and less than 45% for the SoCAB.
Directory of Open Access Journals (Sweden)
François P Douillard
Full Text Available Predominantly identified in pathogenic Gram-positive bacteria, sortase-dependent pili are also found in commensal species, such as the probiotic-marketed strain Lactobacillus rhamnosus strain GG. Pili are typically associated with host colonization, immune signalling and biofilm formation. Comparative analysis of the N-terminal domains of pilin-specific sortases from various piliated Gram-positive bacteria identified a conserved motif, called GYPSY, within the signal sequence. We investigated the function and role of the GYPSY residues by directed mutagenesis in homologous (rod-shaped and heterologous (coccoid-shaped expression systems for pilus formation. Substitutions of some of the GYPSY residues, and more specifically the proline residue, were found to have a direct impact on the degree of piliation of Lb. rhamnosus GG. The present findings uncover a new signalling element involved in the functionality of pilin-specific sortases controlling the pilus biogenesis of Lb. rhamnosus GG and related piliated Gram-positive species.
Douillard, François P.; Rasinkangas, Pia; Bhattacharjee, Arnab; Palva, Airi; de Vos, Willem M.
2016-01-01
Predominantly identified in pathogenic Gram-positive bacteria, sortase-dependent pili are also found in commensal species, such as the probiotic-marketed strain Lactobacillus rhamnosus strain GG. Pili are typically associated with host colonization, immune signalling and biofilm formation. Comparative analysis of the N-terminal domains of pilin-specific sortases from various piliated Gram-positive bacteria identified a conserved motif, called GYPSY, within the signal sequence. We investigated the function and role of the GYPSY residues by directed mutagenesis in homologous (rod-shaped) and heterologous (coccoid-shaped) expression systems for pilus formation. Substitutions of some of the GYPSY residues, and more specifically the proline residue, were found to have a direct impact on the degree of piliation of Lb. rhamnosus GG. The present findings uncover a new signalling element involved in the functionality of pilin-specific sortases controlling the pilus biogenesis of Lb. rhamnosus GG and related piliated Gram-positive species. PMID:27070897
30 CFR 250.214 - What geological and geophysical (G&G) information must accompany the EP?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... and Information Contents of Exploration Plans (ep) § 250.214 What geological and geophysical (G&G) information must accompany the EP? The following G&G information must accompany your EP: (a) Geological...
Hudault, S; Liévin, V; Bernet-Camard, M F; Servin, A L
1997-02-01
The aim of this study was to compare the antagonistic properties of Lactobacillus casei GG exerted in vitro against Salmonella typhimurium C5 in a cellular model, cultured enterocyte-like Caco-2 cells, to those exerted in vivo in an animal model, C3H/He/Oujco mice. Our results show that a 1-h contact between the invading strain C5 and either the culture or the supernatant of L. casei GG impeded the invasion by the Salmonella strain in Caco-2 cells, without modifying the viability of the strain. After neutralization at pH 7, no inhibition of the invasion by C5 was observed. The antagonistic activity of L. casei GG was examined in C3H/He/Oujco mice orally infected with C5 as follows: (i) L. casei GG was given daily to conventional animals as a probiotic, and (ii) it was given once to germ-free animals in order to study the effect of the population of L. casei GG established in the different segments of the gut. In vivo experiments show that after a single challenge with C5, this strain survives and persists at a higher level in the feces of the untreated conventional mice than in those of the treated group. In L. casei GG germ-free mice, establishment of L. casei GG in the gut significantly delayed the occurrence of 100% mortality of the animals (15 days after C5 challenge versus 9 days in germ-free mice [P L. casei GG population level in the gut dramatically decreased in these animals.
Two major secreted proteins as probiotic effectors of Lactobacillus rhamnosus GG
Claes, I.; Segers, M.; Ossowski, von I.; Reunanen, J.; Palva, A.; Vos, de W.M.
2011-01-01
The well-documented probiotic bacterium Lactobacillus rhamnosus GG (LGG) produces two major secreted proteins, named Msp1 (LGG_00324 or p75) and Msp2 (LGG_00031 or p40), which have been previously reported to promote the survival and growth of intestinal epithelial cells. We could demonstrate that
Emissions estimates of carbon tetrachloride for 1992-2014 in China.
Bie, Pengju; Fang, Xuekun; Li, Zhifang; Wang, Ziyuan; Hu, Jianxin
2017-05-01
Discrepancies in emission estimates of carbon tetrachloride (CCl 4 , CTC), between bottom-up and top-down methods, have been shown since the 1990s at both the global and regional scale. This study estimates the emissions of China from 1992 to 2014 based on emission functions and aggregated activity information given reasonable uncertainties. The results show that emissions increase from 7.3 Gg/yr (5.6-9.1 Gg/yr at 95% confidential interval) to 14.0 (9.1-19.5) Gg/yr with a growth rate of 6.7 (1.9-11.4) %/yr during 1992-2002 and then decrease to a minimum of 4.3 (1.9-8.0) Gg/yr in 2011. More than 54% of the emissions during 1992-2009 are from the process agents sector. The estimates are comparable with those of other studies and those in this study based on observations during 2011-2014 using the interspecies correlation method. China's contribution to global emissions increases from 7.5% to 19.5% during 1992-2009, but the contribution is reduced to 9.9% and 8.0% in 2010 and 2011, respectively, indicating the effectiveness of compliance with the Montreal Protocol and its subsequent Amendments and Adjustments, whereby CTC emissions are phased-out. The results of this study are beneficial for narrowing the gap between bottom-up estimates and top-down emission calculations of CTC in China. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Dykhuizen, R.C.; Eaton, R.R.; Hopkins, P.L.; Martinez, M.J.
1991-12-01
Numerical results are presented for the Performance Assessment Calculational Exercise (PACE-90). One- and two-dimensional water and solute transport are presented for steady infiltration into Yucca Mountain. Evenly distributed infiltration rates of 0.01, 0.1, and 0.5 mm/yr were considered. The calculations of solute transport show that significant amounts of radionuclides can reach the water table over 100,000 yr at the 0.5 mm/yr rate. For time periods less than 10,000 yr or infiltrations less than 0.1 mm/yr very little solute reaches the water table. The numerical simulations clearly demonstrate that multi-dimensional effects can result in significant decreases in the travel time of solute through the modeled domain. Dual continuum effects are shown to be negligible for the low steady state fluxes considered. However, material heterogeneities may cause local amplification of the flux level in multi-dimensional flows. These higher flux levels may then require modeling of a dual continuum porous medium
Near-Infrared Imaging Polarimetry of Inner Region of GG Tau A Disk
Yang, Yi; Hashimoto, Jun; Hayashi, Saeko S.; Tamura, Motohide; Mayama, Satoshi; Rafikov, Roman; Akiyama, Eiji; Carson, Joseph C.; Janson, Markus; Kwon, Jungmi;
2016-01-01
By performing non-masked polarization imaging with Subaru HiCIAO, polarized scattered light from the inner region of the disk around the GGTau A system was successfully detected in the H band, with a spatial resolution of approximately0 07, revealing the complicated inner disk structures around this young binary. This paper reports the observation of an arc-like structure to the north of GG Tau Ab, and part of a circumstellar structure that is noticeable around GG Tau Aa, extending to a distance of approximately 28 au from the primary star. The speckle noise around GG Tau Ab constrains its disk radius to 13 au. Based on the size of the circumbinary ring and the circumstellar disk around GG Tau Aa, these mimajor axis of the binary's orbit is likely to be 62 au. A comparison of the present observations with previous Atacama Large Millimeter Array and near-infrared H2 emission observations suggests that the north arc could be part of a large streamer flowing from the circumbinary ring to sustain the circumstellar disks. According to the previous studies,the circumstellar disk around GG Tau Aa has enough mass and can sustain itself for a duration sufficient for planet formation; thus, our study indicates that planets can form within close (separation 100 au) young binary systems.
Analysis of Well ER-EC-1 Testing, Western Pahute Mesa-Oasis Valley FY 2000 Testing Program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-EC-1 during the Western Pahute Mesa - Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program is documented in Appendix A, Western Pahute Mesa - Oasis Valley, Well ER-EC-1 Data Report for Development and Hydraulic Testing.
Mohammedsaeed, Walaa; Cruickshank, Sheena; McBain, Andrew J; O'Neill, Catherine A
2015-11-05
A limited number of studies have investigated the potential of probiotics to promote wound healing in the digestive tract. The aim of the current investigation was to determine whether probiotic bacteria or their extracts could be beneficial in cutaneous wound healing. A keratinocyte monolayer scratch assay was used to assess re-epithelialization; which comprises keratinocyte proliferation and migration. Primary human keratinocyte monolayers were scratched then exposed to lysates of Lactobacillus (L) rhamnosus GG, L. reuteri, L. plantarum or L. fermentum. Re-epithelialization of treated monolayers was compared to that of untreated controls. Lysates of L. rhamnosus GG and L. reuteri significantly increased the rate of re-epithelialization, with L. rhamnosus GG being the most efficacious. L. reuteri increased keratinocyte proliferation while L. rhamnosus GG lysate significantly increased proliferation and migration. Microarray analysis of L. rhamnosus GG treated scratches showed increased expression of multiple genes including the chemokine CXCL2 and its receptor CXCR2. These are involved in normal wound healing where they stimulate keratinocyte proliferation and/or migration. Increased protein expression of both CXCL2 and CXCR2 were confirmed by ELISA and immunoblotting. These data demonstrate that L. rhamnosus GG lysate accelerates re-epithelialization of keratinocyte scratch assays, potentially via chemokine receptor pairs that induce keratinocyte migration.
Xiaolong He; Qing Zeng; Santhosh Puthiyakunnon; Zhijie Zeng; Weijun Yang; Jiawen Qiu; Lei Du; Swapna Boddu; Tongwei Wu; Danxian Cai; Sheng-He Huang; Hong Cao
2017-01-01
The objective of this study was to determine whether Lactobacillus rhamnosus GG culture supernatant (LCS) has a preventive effect against gut-derived systemic neonatal Escherichia coli (E. coli) K1 infection. The preventive effects were evaluated in human colonic carcinoma cell line Caco-2 and neonatal rat models. Our in vitro results showed that LCS could block adhesion, invasion and translocation of E. coli K1 to Caco-2 monolayer via up-regulating mucin production and maintaining intestinal...
Li, Zhifang; Bie, Pengju; Wang, Ziyuan; Zhang, Zhaoyang; Jiang, Hanyu; Xu, Weiguang; Zhang, Jianbo; Hu, Jianxin
2016-05-01
Chlorodifluoromethane (CHClF2, HCFC-22) is a widely used refrigerant and foaming agent that is not only an ozone-depleting substance (ozone depletion potential (ODP), 0.04) but also a greenhouse gas (global warming potential (GWP), 1780). A comprehensive historical emission inventory for 1990-2014 was produced using a bottom-up method, and a projection through to 2050 was made for China. The results demonstrated that historical emissions increased sharply from 0.2 Gg/yr in 1990 to 127.2 Gg/yr in 2014. Room air-conditioners (RACs), industrial and commercial refrigeration (ICR), and extruded polystyrene (XPS) were three primary emission sources, and accounted for an average of 95.4% of the total emissions over the period studied. The percentage of global HCFC-22 emissions originating from China significantly increased from 0.1% in 1990 to 31.6% in 2012, with an average growth rate of 1.4% per year. Under the Montreal Protocol phasing-out (MPPO) scenario, future emissions were expected to reach a peak of 133.5 Gg/yr in 2016 and then continuously decline to 10.2 Gg/yr in 2050. The accumulative reduction for 2015-2050 would be 5533.8 Gg (equivalent to 221.4 CFC-11-eq Gg and 9850.1 CO2-eq Tg), which is approximately equivalent to the total CO2 emission for China in 2012 (9900 Tg) (Olivier et al., 2013), compared with the no Montreal Protocol scenario (NMP). Under the MPPO scenario, two cases were analyzed to explore the future emission ranges in China. A comparison between the two cases implied that the choice of emission reduction policy will have a considerable impact on HCFC-22 emissions.
Characterization of the SpaCBA Pilus Fibers in the Probiotic Lactobacillus rhamnosus GG
Reunanen, J.; Ossowski, von I.; Hendrickx, A.P.; Palva, A.; Vos, de W.M.
2012-01-01
Lactobacillus rhamnosus GG is a human intestinal isolate that has been studied intensively because of its probiotic properties. We have previously shown that L. rhamnosus GG produces proteinaceous pili that earlier had been observed only in Gram-positive pathogens (M. Kankainen et al., Proc. Natl.
International Nuclear Information System (INIS)
Sahu, S K; Ohara, T; Nagashima, T; Beig, G; Kurokawa, J
2015-01-01
In the recent past, the emerging India economy is highly dependent on conventional as well as renewable energy to deal with energy security. Keeping the potential of biomass and its plentiful availability, the Indian government has been encouraging various industrial sectors to generate their own energy from it. The Indian sugar industry has adopted and made impressive growth in bagasse (a renewable biomass, i.e. left after sugercane is crushed) based cogeneration power to fulfil their energy need, as well as to export a big chunk of energy to grid power. Like fossil fuel, bagasse combustion also generates various critical pollutants. This article provides the first ever estimation, current status and overview of magnitude of air pollutant emissions from rapidly growing bagasse based cogeneration technology in Indian sugar mills. The estimated emission from the world’s second largest sugar industry in India for particulate matter, NO X, SO 2 , CO and CO 2 is estimated to be 444 ± 225 Gg yr −1 , 188 ± 95 Gg yr −1 , 43 ± 22 Gg yr −1 , 463 ± 240 Gg yr −1 and 47.4 ± 9 Tg yr −1 , respectively in 2014. The studies also analyze and identify potential hot spot regions across the country and explore the possible further potential growth for this sector. This first ever estimation not only improves the existing national emission inventory, but is also useful in chemical transport modeling studies, as well as for policy makers. (letter)
Energy Technology Data Exchange (ETDEWEB)
1978-06-01
OVG Muenster, decision dated Aug. 18th, 1977 - VII A 338/74: 'Section 7 of the Atomic Energy Act disagrees with the constitution in as far as it also allows the licensing of FBR type reactores'. The grounds upon which the judgment is based are given in detail: According to the opinion of the Senate, section 7 of the Atomic Energy Act does not conform to the principle of separation of powers (section 20, sub-section 2, sentence 2 GG), to the principle of parliamentary democracy (section 20, sub-section 1 and 2 GG) and to the principles of the law and order state (section 20, sub-section 3 GG) in as far as the present version enables the licensing of fast breeders.
Petrova, Mariya I; Imholz, Nicole C E; Verhoeven, Tine L A; Balzarini, Jan; Van Damme, Els J M; Schols, Dominique; Vanderleyden, Jos; Lebeer, Sarah
2016-01-01
Increased antibiotic resistance has catalyzed the research on new antibacterial molecules and alternative strategies, such as the application of beneficial bacteria. Since lectin molecules have unique sugar-recognizing capacities, and pathogens are often decorated with sugars that affect their survival and infectivity, we explored whether lectins from the probiotic strain Lactobacillus rhamnosus GG have antipathogenic properties. The genome sequence of L. rhamnosus GG was screened for the presence of lectin-like proteins. Two genes, LGG_RS02780 and LGG_RS02750, encoding for polypeptides with an N-terminal conserved L-type lectin domain were detected and designated Llp1 (lectin-like protein 1) and Llp2. The capacity of Llp1 and Llp2 to inhibit biofilm formation of various pathogens was investigated. Sugar specificity was determined by Sepharose beads assays and glycan array screening. The isolated lectin domains of Llp1 and Llp2 possess pronounced inhibitory activity against biofilm formation by various pathogens, including clinical Salmonella species and uropathogenic E. coli, with Llp2 being more active than Llp1. In addition, sugar binding assays with Llp1 and Llp2 indicate specificity for complex glycans. Both proteins are also involved in the adhesion capacity of L. rhamnosus GG to gastrointestinal and vaginal epithelial cells. Lectins isolated from or expressed by beneficial lactobacilli could be considered promising bio-active ingredients for improved prophylaxis of urogenital and gastrointestinal infections.
The spectroscopic orbits and physical parameters of GG Carinae
Marchiano, P.; Brandi, E.; Muratore, M. F.; Quiroga, C.; Ferrer, O. E.; García, L. G.
2012-04-01
GG Car, we obtain Teff = 23 000 K and log g = 3. The central star is surrounded by a spherical envelope consisting of a layer of 3.5 stellar radii composed of ionized gas and other outermost dust layers with EB - V = 0.39. These calculations are not strongly modified if we consider two similar B-type stars instead of a central star, provided our model suggests that the second star might contribute less than 10% of the primary flux. The calculated effective temperature is consistent with an spectral type B0-B2 and a distance to the object of 5 ± 1 kpc was determined. Based on observations taken at Complejo Astronómico EL LEONCITO, operated under agreement between the Consejo Nacional de Investigaciones Científicas y Técnicas de la República Argentina and the National Universities of La Plata, Córdoba, and San Juan.
Remapping of the stripe rust resistance gene Yr10 in common wheat.
Yuan, Cuiling; Wu, Jingzheng; Yan, Baiqiang; Hao, Qunqun; Zhang, Chaozhong; Lyu, Bo; Ni, Fei; Caplan, Allan; Wu, Jiajie; Fu, Daolin
2018-02-23
Yr10 is an important gene to control wheat stripe rust, and the search for Yr10 needs to be continued. Wheat stripe rust or yellow rust is a devastating fungal disease caused by Puccinia striiformis f. sp. tritici (Pst). Host disease resistance offers a primary source for controlling wheat stripe rust. The stripe rust resistance gene Yr10 confers the race-specific resistance to most tested Pst races in China including CYR29. Early studies proposed that Yr10 was a nucleotide-binding site, leucine-rich repeat gene archived as GenBank accession AF149112 (hereafter designated the Yr10 candidate gene or Yr10 CG ). In this study, we revealed that 15 Chinese wheat cultivars positive for Yr10 CG are susceptible to CYR29. We then expressed the Yr10 CG cDNA in the common wheat 'Bobwhite'. The Yr10 CG -cDNA positive transgenic plants were also susceptible to CYR29. Thus, it is highly unlikely that Yr10 CG corresponds to the Yr10 resistance gene. Using the Yr10 donor 'Moro' and the Pst-susceptible wheat 'Huixianhong', we generated two F 3 populations that displayed a single Mendelian segregation on the Yr10 gene, and used them to remap the Yr10 gene. Six markers were placed in the Yr10 region, with the Yr10 CG gene now mapping about 1.2-cM proximal to the Yr10 locus and the Xsdauw79 marker is completely linked to the Yr10 locus. Apparently, the Yr10 gene has not yet been identified. Fine mapping and positional cloning of Yr10 is important for gene pyramiding for stripe rust resistance in wheat.
Flanking bases influence the nature of DNA distortion by platinum 1,2-intrastrand (GG cross-links.
Directory of Open Access Journals (Sweden)
Debadeep Bhattacharyya
Full Text Available The differences in efficacy and molecular mechanisms of platinum anti-cancer drugs cisplatin (CP and oxaliplatin (OX are thought to be partially due to the differences in the DNA conformations of the CP and OX adducts that form on adjacent guanines on DNA, which in turn influence the binding of damage-recognition proteins that control downstream effects of the adducts. Here we report a comprehensive comparison of the structural distortion of DNA caused by CP and OX adducts in the TGGT sequence context using nuclear magnetic resonance (NMR spectroscopy and molecular dynamics (MD simulations. When compared to our previous studies in other sequence contexts, these structural studies help us understand the effect of the sequence context on the conformation of Pt-GG DNA adducts. We find that both the sequence context and the type of Pt-GG DNA adduct (CP vs. OX play an important role in the conformation and the conformational dynamics of Pt-DNA adducts, possibly explaining their influence on the ability of many damage-recognition proteins to bind to Pt-DNA adducts.
Jiao, Y.; Acdan, J.; Xu, R.; Deventer, M. J.; Rhew, R. C.
2017-12-01
A precise quantification of global methyl halide budgets is needed to evaluate the ozone depletion potential of these compounds and to predict future changes of stratospheric ozone. However, the global budgets of methyl halides are not balanced between currently identified and quantified sources and sinks. Our study re-evaluated the methyl bromide budget from global cultivated rapeseed (Brassica napus) through life-cycle flux measurements both in the greenhouse and in the field, yielding a methyl bromide emission rate that scales globally to 1.0 - 1.2 Gg yr-1. While this indicates a globally significant source, it is much smaller than the previously widely cited value of 5 - 6 Gg yr-1(Mead et al., 2008), even taking into account the near tripling of annual global yield of rapeseed since the previous evaluation was conducted. Our study also evaluated the methyl chloride and methyl iodide emission levels from rapeseed, yielding emission rates that scale to 5.4 Gg yr-1 for methyl chloride and 1.8 Gg yr-1 of methyl iodide. The concentrations of the methyl donor SAM (S-adenosyl methionine) and the resultant product SAH (S-Adenosyl-L-homocysteine) were also analyzed to explore their role in biogenic methyl halide formation. Halide gradient incubations showed that the magnitude of methyl halide emissions from rapeseed is highly correlated to soil halide levels, thus raising the concern that the heterogeneity of soil halide contents geographically should be considered when extrapolating to global budget.
Tytgat, Hanne L P; Douillard, François P; Reunanen, Justus; Rasinkangas, Pia; Hendrickx, Antoni P A; Laine, Pia K; Paulin, Lars; Satokari, Reetta; de Vos, Willem M
2016-10-01
Vancomycin-resistant enterococci (VRE) have become a major nosocomial threat. Enterococcus faecium is of special concern, as it can easily acquire new antibiotic resistances and is an excellent colonizer of the human intestinal tract. Several clinical studies have explored the potential use of beneficial bacteria to weed out opportunistic pathogens. Specifically, the widely studied Lactobacillus rhamnosus strain GG has been applied successfully in the context of VRE infections. Here, we provide new insight into the molecular mechanism underlying the effects of this model probiotic on VRE decolonization. Both clinical VRE isolates and L. rhamnosus GG express pili on their cell walls, which are the key modulators of their highly efficient colonization of the intestinal mucosa. We found that one of the VRE pilus clusters shares considerable sequence similarity with the SpaCBA-SrtC1 pilus cluster of L. rhamnosus GG. Remarkable immunological and functional similarities were discovered between the mucus-binding pili of L. rhamnosus GG and those of the clinical E. faecium strain E1165, which was characterized at the genome level. Moreover, E. faecium strain E1165 bound efficiently to mucus, which may be prevented by the presence of the mucus-binding SpaC protein or antibodies against L. rhamnosus GG or SpaC. These results present experimental support for a novel probiotic mechanism, in which the mucus-binding pili of L. rhamnosus GG prevent the binding of a potential pathogen to the host. Hence, we provide a molecular basis for the further exploitation of L. rhamnosus GG and its pilins for prophylaxis and treatment of VRE infections. Concern about vancomycin-resistant Enterococcus faecium causing nosocomial infections is rising globally. The arsenal of antibiotic strategies to treat these infections is nearly exhausted, and hence, new treatment strategies are urgently needed. Here, we provide molecular evidence to underpin reports of the successful clinical application of
EC-fans and fan control systems; EC-ventilatoren en ventilatorregelsystemen
Energy Technology Data Exchange (ETDEWEB)
Havenaar, D.
2011-07-15
Saving of energy can be achieved by the design and application of energy efficient components such as EC-fans (EC stands for Electronically Commutated technology), which are used in different types of cooling-refrigeration and air conditioning systems. In this article attention is paid to two products of Ziehl-Abigg: the Icontrol and the Fcontrol frequency converters. [Dutch] Het beperken van het energiegebruik en het verminderen van de uitstoot van het broeikasgas CO2 is voor de sector een belangrijke opgave. Door het ontwerpen en toepassen van energie-efficiente componenten zoals EC-ventilatoren (EC staat voor Electronically Commutated technologie) in allerlei koel-, vries- en luchtbehandelingsinstallaties kan veel bespaard worden in het energiegebruik. In dit artikel wordt aandacht besteed aan 2 producten van Ziehl-Abigg: de Icontrol en de Fcontrol frequentie omvormers.
PNPLA3 GG genotype and carotid atherosclerosis in patients with non-alcoholic fatty liver disease.
Directory of Open Access Journals (Sweden)
Salvatore Petta
Full Text Available BACKGROUND AND AIM: To evaluate if the presence of carotid atherosclerosis in patients with NAFLD, could be related to gene variants influencing hepatic fat accumulation and the severity of liver damage. METHODS: We recorded anthropometric, metabolic and histological data(Kleiner score of 162 consecutive, biopsy-proven Sicilian NAFLD patients. Intima-media thickness(IMT, IMT thickening(IMT≥1 mm and carotid plaques(focal thickening of >1.3 mm at the level of common carotid artery were evaluated using ultrasonography. IL28B rs12979860 C>T, PNPLA3 rs738409 C>G, GCKR rs780094 C>T, LYPLAL1 rs12137855 C>T, and NCAN rs2228603 C>T single nucleotide polymorphisms were also assessed. The results were validated in a cohort of 267 subjects with clinical or histological diagnosis of NAFLD from Northern Italy, 63 of whom had follow-up examinations. RESULTS: Carotid plaques, IMT thickening and mean maximum IMT were similar in the two cohorts, whereas the prevalence of diabetes, obesity, NASH, and PNPLA3 GG polymorphism(21%vs.13%, p = 0.02 were significantly higher in the Sicilian cohort. In this cohort, the prevalence of carotid plaques and IMT thickening was higher in PNPLA3 GG compared to CC/CG genotype(53%vs.32%, p = 0.02; 62%vs.28%, p<0.001, respectively. These associations were confirmed at multivariate analyses (OR2.94;95%C.I. 1.12-7.71, p = 0.02, and OR4.11;95%C.I. 1.69-9.96, p = 0.002, respectively, although have been observed only in patients <50years. Also in the validation cohort, PNPLA3 GG genotype was independently associated with IMT thickening in younger patients only (OR: 6.00,95%C.I. 1.36-29, p = 0.01, and to IMT progression (p = 0.05 in patients with follow-up examinations. CONCLUSION: PNPLA3 GG genotype is associated with higher severity of carotid atherosclerosis in younger patients with NAFLD. Mechanisms underlying this association, and its clinical relevance need further investigations.
Directory of Open Access Journals (Sweden)
Tathyana Rachel Palo Mello
2014-12-01
Full Text Available Major developmental transitions in multicellular organisms are driven by steroid hormones. In insects, these, together with juvenile hormone (JH, control development, metamorphosis, reproduction and aging, and are also suggested to play an important role in caste differentiation of social insects. Here, we aimed to determine how EcR transcription and ecdysteroid titers are related during honeybee postembryonic development and what may actually be the role of EcR in caste development of this social insect. In addition, we expected that knocking-down EcR gene expression would give us information on the participation of the respective protein in regulating downstream targets of EcR. We found that in Apis mellifera females, EcR-A is the predominantly expressed variant in postembryonic development, while EcR-B transcript levels are higher in embryos, indicating an early developmental switch in EcR function. During larval and pupal stages, EcR-B expression levels are very low, while EcR-A transcripts are more variable and abundant in workers compared to queens. Strikingly, these transcript levels are opposite to the ecdysteroid titer profile. 20-hydroxyecdysone (20E application experiments revealed that low 20E levels induce EcR expression during development, whereas high ecdysteroid titers seem to be repressive. By means of RNAi-mediated knockdown (KD of both EcR transcript variants we detected the differential expression of 234 poly-A+ transcripts encoding genes such as CYPs, MRJPs and certain hormone response genes (Kr-h1 and ftz-f1. EcR-KD also promoted the differential expression of 70 miRNAs, including highly conserved ones (e.g. miR-133 and miR-375, as well honeybee-specific ones (e.g. miR-3745 and miR-3761. Our results put in evidence a broad spectrum of EcR-controlled gene expression during postembryonic development of honeybees, revealing new facets of EcR biology in this social insect.
Petrova, Mariya I.; Imholz, Nicole C. E.; Verhoeven, Tine L. A.; Balzarini, Jan; Van Damme, Els J. M.; Schols, Dominique; Vanderleyden, Jos; Lebeer, Sarah
2016-01-01
Objectives Increased antibiotic resistance has catalyzed the research on new antibacterial molecules and alternative strategies, such as the application of beneficial bacteria. Since lectin molecules have unique sugar-recognizing capacities, and pathogens are often decorated with sugars that affect their survival and infectivity, we explored whether lectins from the probiotic strain Lactobacillus rhamnosus GG have antipathogenic properties. Methods The genome sequence of L. rhamnosus GG was screened for the presence of lectin-like proteins. Two genes, LGG_RS02780 and LGG_RS02750, encoding for polypeptides with an N-terminal conserved L-type lectin domain were detected and designated Llp1 (lectin-like protein 1) and Llp2. The capacity of Llp1 and Llp2 to inhibit biofilm formation of various pathogens was investigated. Sugar specificity was determined by Sepharose beads assays and glycan array screening. Results The isolated lectin domains of Llp1 and Llp2 possess pronounced inhibitory activity against biofilm formation by various pathogens, including clinical Salmonella species and uropathogenic E. coli, with Llp2 being more active than Llp1. In addition, sugar binding assays with Llp1 and Llp2 indicate specificity for complex glycans. Both proteins are also involved in the adhesion capacity of L. rhamnosus GG to gastrointestinal and vaginal epithelial cells. Conclusions Lectins isolated from or expressed by beneficial lactobacilli could be considered promising bio-active ingredients for improved prophylaxis of urogenital and gastrointestinal infections. PMID:27537843
30 CFR 250.244 - What geological and geophysical (G&G) information must accompany the DPP or DOCD?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... Operations Coordination Documents (docd) § 250.244 What geological and geophysical (G&G) information must accompany the DPP or DOCD? The following G&G information must accompany your DPP or DOCD: (a) Geological...
'Galileo Galilei (GG) on the Ground-GGG': experimental results and perspectives
International Nuclear Information System (INIS)
Comandi, G.L.; Nobili, A.M.; Bramanti, D.; Toncelli, R.; Polacco, E.; Chiofalo, M.L.
2003-01-01
The GGG differential accelerometer is made of concentric coaxial test cylinders weakly coupled in the horizontal plane and spinning in supercritical regime around their symmetry axis. GGG is built as a full scale ground based prototype for the proposed 'Galileo Galilei-GG' space experiment aiming to test the equivalence principle (EP) to 10 -17 at room temperature. We report measured Q values of 95000 at 1.4 Hz, and expect even better ones at typical spin frequencies of a few Hz. An EP violation signal in the field of the Sun would appear as a low frequency displacement in the horizontal plane of the laboratory, and it can be separated out from a much larger whirl motion of the test masses at their natural differential frequency. So far we have managed to reduce the amplitude of this whirl to about 0.1 μm. We discuss how to improve these results in view of the very high accuracy GG experiment in space, and/or to reach a 10 -13 sensitivity in the lab which would allow us to either confirm or rule out recent predictions of violation to this level
Xu, Jian-Zhong; Yang, Han-Kun; Liu, Li-Ming; Wang, Ying-Yu; Zhang, Wei-Guo
2018-03-25
l-lysine is an important amino acid in animals and humans and NADPH is a vital cofactor for maximizing the efficiency of l-lysine fermentation. Dihydrodipicolinate reductase (DHDPR), an NAD(P)H-dependent enzyme, shows a variance in nucleotide-cofactor affinity in bacteria. In this study, we rationally engineered Corynebacterium glutamicum DHDPR (CgDHDPR) to switch its nucleotide-cofactor specificity resulting in an increase in final titer (from 82.6 to 117.3 g L -1 ), carbon yield (from 0.35 to 0.44 g [g glucose] -1 ) and productivity (from 2.07 to 2.93 g L -1 hr -1 ) of l-lysine in JL-6 ΔdapB::Ec-dapB C115G,G116C in fed-batch fermentation. To do this, we comparatively analyzed the characteristics of CgDHDPR and Escherichia coli DHDPR (EcDHDPR), indicating that hetero-expression of NADH-dependent EcDHDPR increased l-lysine production. Subsequently, we rationally modified the conserved structure of cofactor-binding motif, and results indicated that introducing the mutation K11A or R13A in CgDHDPR and introducing the mutation R16A or R39A in EcDHDPR modifies the nucleotide-cofactor affinity of DHDPR. Lastly, the effects of these mutated DHDPRs on l-lysine production were investigated. The highest increase (26.2%) in l-lysine production was observed for JL-6 ΔdapB::Ec-dapB C115G,G116C , followed by JL-6 Cg-dapB C37G,G38C (21.4%) and JL-6 ΔdapB::Ec-dapB C46G,G47C (15.2%). This is the first report of a rational modification of DHDPR that enhances the l-lysine production and yield through the modulation of nucleotide-cofactor specificity. © 2018 Wiley Periodicals, Inc.
Annihilation of S-wave charmonium state into γγγ, γgg, ggg in CPPν model
International Nuclear Information System (INIS)
Parmar, Arpit; Vinodkumar, P.C.; Patel, Bhavin
2011-01-01
The simplest three body decay of vector quarkonia are to γγγ, γgg and ggg. Experimental study of γγγ, γgg and ggg quarkonium decays has progressed substantially, but has not entered the realm of precision. This motivates theorists to study these decay in a great detail. For the present study focussed on γγγ, γgg and ggg decays of charmonium states
Directory of Open Access Journals (Sweden)
H.M. Yupi
2016-06-01
Full Text Available Tropical peat swamp forest (PSF stores large quantities of carbon. To estimate how much organic C is released from this type of landscape we determined organic carbon (C concentrations, loads and yields in two contrasting watercourses draining from PSF in Riau Province, Sumatra (Indonesia. Meranti Ditch (MD is an artificial watercourse whose small catchment (estimated area 4.8 km2 is in semi-intact condition, whereas Turip River (TR has a large natural catchment (estimated area 458 km2 covered with fairly intact PSF where > 75 % of the original canopy trees remain. The organic C load (Gg C yr-1 of each watercourse was calculated by combining TOC concentration with water discharge rate to give organic C yield (g C m-2 yr-1. Dissolved organic carbon (DOC was the dominant (95.0–99.8 % component of total organic carbon (TOC in the water. TOC concentration was 85–94 mg C L-1 in MD and 50–58 mg C L-1 in TR. The high concentration in MD was not surprising because this catchment had been disturbed by repeated phases of logging and a dense network of ditches was excavated ten years ago. The TOC loads were 0.23 Gg C yr-1 in MD and 14.0 Gg C yr-1 in TR. TOC yields (i.e. TOC fluxes through the fluvial system were 41.6–55.5 g C m-2 yr-1 in MD and 26.2–34.9 g C m-2 yr-1 in TR.
Directory of Open Access Journals (Sweden)
Marisa Cristina Guimarães Rocha
2015-02-01
Full Text Available LDPE blends based on PHB and GG biodegradable polymers were prepared by melt mixing in a twin screw extruder. The mechanical properties of the materials were evaluated. Preliminary information about the biodegradation behavior of the specimens was obtained by visual observation of samples removed from the simulated soil in 90 days. The results indicated that LDPE/PHB blends may be used for designing LDPE based materials with increased susceptibility to degradation, if elongation at break and impact properties are not determinant factors of their performance. LDPE based materials on GG present values of flexural and mechanical strength lower than those of LDPE/PHB blends. LDPE/PHB/GG blends exhibit unsatisfactory properties. Apparently, the effect of addition of GG to LDPE on the biodegradation behavior of LDPE/GG blends was less intense than the effect caused by addition of PHB to the blends. Similar observation has occurred with the partial replacement of GG by PHB in the ternary blends.
Müller, Holger S. P.; Christen, Dines
2004-12-01
The rotation-tunneling spectrum of the second most stable gGg' conformer of ethylene glycol (1,2-ethanediol) in its ground vibrational state has been studied in selected regions between 77 and 579 GHz. Compared to the study of the more stable aGg' conformer, a much larger frequency range was studied, resulting in a much extended frequency list covering similar quantum numbers, J⩽55 and Ka⩽19. While the input data were reproduced within experimental uncertainties up to moderately high values of J and Ka larger residuals remain at higher quantum numbers. The severe mixing of the states caused by the Coriolis interaction between the two tunneling substates is suggested to provide a considerable part of the explanation. In addition, a Coriolis interaction of the gGg' ground vibrational state with an excited state of the aGg' conformer may also contribute. Relative intensities of closely spaced lines have been investigated to determine the signs of the Coriolis constants between the two tunneling substates relative to the dipole moment components and to estimate the magnitudes of the dipole moment components and the energy difference between the gGg' and the aGg' conformers. Results of ab initio calculations on the total dipole moment and the vibrational spectrum were needed for these estimates. The current analysis is limited to transitions with quantum numbers J⩽40 and Ka⩽6 plus those having J⩽22 and Ka⩽17 which could be reproduced within experimental uncertainties. The results are aimed at aiding radioastronomers to search for gGg' ethylene glycol in comets and in interstellar space.
Suitability of cereal porridges as substrate for probiotic strain Lactobacillus rhamnosus GG
Directory of Open Access Journals (Sweden)
Ľubomír Valík
2013-02-01
Full Text Available The aim of this work was to find new substrates suitable for growth and metabolism of probiotic strain Lactobacillus rhamnosus GG, which would be interesting for development of new functional food. The growth and metabolic activity of Lb. rhamnosus GG in cereal (rye, barley, oat and millet porridges were monitored during fermentation process. Cereal and porridges, were inoculated with this strain at two initial levels to obtain approximately 5 or 6 log colony form units per gram of suspension after sterilization and cooling,. Fermentation was led stationary at 37 °C for 48 hours and viable cell count, pH value, titratable acidity and organic acids were analysed. Metabolic activity of Lb. rhamnosus GG was influenced by inoculation level and by the type of cereal used. The cereals fermented by lactic acid bacteria, especially probiotic strains, might broaden the offer of probiotic products for those suffering from milk allergy.doi:10.5219/242 Normal 0 21 false false false SK X-NONE X-NONE
Mohammedsaeed, Walaa; McBain, Andrew J.; Cruickshank, Sheena M.
2014-01-01
Few studies have evaluated the potential benefits of the topical application of probiotic bacteria or material derived from them. We have investigated whether a probiotic bacterium, Lactobacillus rhamnosus GG, can inhibit Staphylococcus aureus infection of human primary keratinocytes in culture. When primary human keratinocytes were exposed to S. aureus, only 25% of the keratinocytes remained viable following 24 h of incubation. However, in the presence of 108 CFU/ml of live L. rhamnosus GG, the viability of the infected keratinocytes increased to 57% (P = 0.01). L. rhamnosus GG lysates and spent culture fluid also provided significant protection to keratinocytes, with 65% (P = 0.006) and 57% (P = 0.01) of cells, respectively, being viable following 24 h of incubation. Keratinocyte survival was significantly enhanced regardless of whether the probiotic was applied in the viable form or as cell lysates 2 h before or simultaneously with (P = 0.005) or 12 h after (P = 0.01) S. aureus infection. However, spent culture fluid was protective only if added before or simultaneously with S. aureus. With respect to mechanism, both L. rhamnosus GG lysate and spent culture fluid apparently inhibited adherence of S. aureus to keratinocytes by competitive exclusion, but only viable bacteria or the lysate could displace S. aureus (P = 0.04 and 0.01, respectively). Furthermore, growth of S. aureus was inhibited by either live bacteria or lysate but not spent culture fluid. Together, these data suggest at least two separate activities involved in the protective effects of L. rhamnosus GG against S. aureus, growth inhibition and reduction of bacterial adhesion. PMID:25015889
GPM GROUND VALIDATION ENVIRONMENT CANADA (EC) RADIOSONDE GCPEX V1
National Aeronautics and Space Administration — The GPM Ground Validation Environment Canada (EC) Radiosonde GCPEx dataset provides measurements of pressure, temperature, humidity, and winds collected by Vaisala...
Rapid procedure to calibrate EC-10 and EC-20 capacitance sensors ...
African Journals Online (AJOL)
A rapid calibration procedure for EC-10 and EC-20 sensors is introduced to promote the commercial use of these sensors for hydroponic irrigation management in coir. The method is comprised of taking one sensor reading, by a sensor installed under hydroponic crop production conditions, and one gravimetric sample, ...
Soukoulis, Christos; Singh, Poonam; Macnaughtan, William; Parmenter, Christopher; Fisk, Ian D.
2016-01-01
Probiotic incorporation in edible films and coatings has been shown recently to be an efficient strategy for the delivery of probiotics in foods. In the present work, the impact of the compositional, physicochemical and structural properties of binary starch-protein edible films on Lactobacillus rhamnosus GG viability and stability was evaluated. Native rice and corn starch, as well as bovine skin gelatine, sodium caseinate and soy protein concentrate were used for the fabrication of the probiotic edible films. Starch and protein type both impacted the structural, mechanical, optical and thermal properties of the films, and the process loss of L. rhamnosus GG during evaporation-dehydration was significantly lower in the presence of proteins (0.91–1.07 log CFU/g) compared to solely starch based systems (1.71 log CFU/g). A synergistic action between rice starch and proteins was detected when monitoring the viability of L. rhamnosus GG over four weeks at fridge and room temperature conditions. In particular, a 3- to 7-fold increase in the viability of L. rhamnosus GG was observed in the presence of proteins, with sodium caseinate – rice starch based films offering the most enhanced stability. The film's shelf-life (as calculated using the FAO/WHO (2011) basis of 6 log viable CFU/g) ranged between 27-96 and 15–24 days for systems stored at fridge or room temperature conditions respectively. PMID:26726280
Effects of Lactobacillus rhamnosus GG on saliva-derived microcosms
Pham, L.C.; Hoogenkamp, M.A.; Exterkate, R.A.M.; Terefework, Z.; de Soet, J.J.; ten Cate, J.M.; Crielaard, W.; Zaura, E.
2011-01-01
Objective The probiotic strain Lactobacillus rhamnosus GG (LGG) is shown to hamper the presence of mutans streptococci in saliva and may have positive effects on oral health. We investigated the effects of LGG on the cariogenic potential and microbial composition of saliva-derived microcosms. Design
Directory of Open Access Journals (Sweden)
C. Wu
2016-05-01
Full Text Available Elemental carbon (EC has been widely used as a tracer to track the portion of co-emitted primary organic carbon (OC and, by extension, to estimate secondary OC (SOC from ambient observations of EC and OC. Key to this EC tracer method is to determine an appropriate OC / EC ratio that represents primary combustion emission sources (i.e., (OC / ECpri at the observation site. The conventional approaches include regressing OC against EC within a fixed percentile of the lowest (OC / EC ratio data (usually 5–20 % or relying on a subset of sampling days with low photochemical activity and dominated by local emissions. The drawback of these approaches is rooted in its empirical nature, i.e., a lack of clear quantitative criteria in the selection of data subsets for the (OC / ECpri determination. We examine here a method that derives (OC / ECpri through calculating a hypothetical set of (OC / ECpri and SOC followed by seeking the minimum of the coefficient of correlation (R2 between SOC and EC. The hypothetical (OC / ECpri that generates the minimum R2(SOC,EC then represents the actual (OC / ECpri ratio if variations of EC and SOC are independent and (OC / ECpri is relatively constant in the study period. This Minimum R Squared (MRS method has a clear quantitative criterion for the (OC / ECpri calculation. This work uses numerically simulated data to evaluate the accuracy of SOC estimation by the MRS method and to compare with two commonly used methods: minimum OC / EC (OC / ECmin and OC / EC percentile (OC / EC10 %. Log-normally distributed EC and OC concentrations with known proportion of SOC are numerically produced through a pseudorandom number generator. Three scenarios are considered, including a single primary source, two independent primary sources, and two correlated primary sources. The MRS method consistently yields the most accurate SOC estimation. Unbiased SOC estimation by OC
Costa, Mayra Garcia Maia; Ooki, Gabriela Namur; Vieira, Antônio Diogo Silva; Bedani, Raquel; Saad, Susana Marta Isay
2017-02-22
The effect of açai pulp ice cream and of its supplementation with inulin (I), whey protein concentrate (WC), and/or whey protein isolate (WI) on the viability and resistance to simulated gastrointestinal stress of the probiotic Lactobacillus (Lb.) rhamnosus GG strain throughout storage at -18 °C for up to 112 days was evaluated and morphological changes during stress were monitored. Lb. rhamnosus GG viability was stable in all formulations for up to 112 days of storage, preserving populations around 9 log CFU g -1 . Compared to the fresh culture, Lb. rhamnosus GG showed higher survival under simulated gastrointestinal conditions when incorporated into açai ice cream, indicating that the presence of the food matrix contributed to the microorganism survival. A reduction of at least 5 log cycles of Lb. rhamnosus GG was observed in all formulations after the gastrointestinal simulation in all storage periods assessed. The addition of I, WC, and/or WI did not show any significant effect on the probiotic survival under simulated gastrointestinal stress (p ice cream. Thus, the açai pulp ice cream was shown to be a suitable matrix for Lb. rhamnosus GG, improving its survival under in vitro simulated gastrointestinal conditions.
Douillard, François P.; Rasinkangas, Pia; Bhattacharjee, Arnab; Palva, Airi; Vos, De Willem M.
2016-01-01
Predominantly identified in pathogenic Gram-positive bacteria, sortase-dependent pili are also found in commensal species, such as the probiotic-marketed strain Lactobacillus rhamnosus strain GG. Pili are typically associated with host colonization, immune signalling and biofilm formation.
Lactobacillus rhamnosus GG suspected infection in a newborn with intrauterine growth restriction.
Sadowska-Krawczenko, I; Paprzycka, M; Korbal, P; Wiatrzyk, A; Krysztopa-Grzybowska, K; Polak, M; Czajka, U; Lutyńska, A
2014-12-01
A disseminated Lactobacillus rhamnosus GG ATCC 53103 infection was suspected in a 6 day-old newborn with intrauterine growth restriction (IUGR) symptoms, treated empirically with antibiotics and given L. rhamnosus GG with the aim of preventing antibiotic-associated gastrointestinal complications. The level of C-reactive protein on day 5 compared with day 2 was increased in spite of negative urine and cerebrospinal fluid cultures. The blood sampled on day 6 was found to be positive for lactobacilli, and the isolate was pre-identified as L. rhamnosus or Lactobacillus casei on day 11. The strain identity was then verified as L. rhamnosus GG through PCR and 16S rRNA sequencing. Genotyping with the rep-PCR and AFLP methods confirmed the 100% genetic similarity for both the strain isolated from patient blood and the probiotic product. The newborn became touch-sensitive, cried a lot, had worsening laboratory test results, and increased inflammation parameters, but no fever was observed. After a further 9 days of antibiotic therapy, blood cultures became negative, and laboratory tests improved on day 25. The patient was discharged from the hospital after 27 days. IUGR with a possible link to L. rhamnosus GG bacteraemia might be a new potential risk group, beside patients with organ failure, immunocompromised status and dysfunctional gut barrier mechanisms, for which safe use of probiotics needs careful attention. Universally accepted or improved guidelines for the safer administration of probiotics in risk groups are urgently needed. This report should not discourage the use of probiotics, but should highlight the need for their careful use in IUGR patients.
Haga, Monika; Gísladóttír, Thórdís; Sigmundsson, Hermundur
2015-12-01
Developing motor competence and physical fitness can affect the maintenance of a sufficient level of physical activity in children and adolescents. This study assesses the relationship between motor competence and physical fitness from childhood through early adolescence. A cross-sectional sample of 194 participants from 4 to 16 years old were divided into three groups; 4-6 yr. (n=42, M age=5.2, SD 0.6), 11-12 yr. (n=58, M age=12.4, SD=0.3), and 15-16 yr. (n=94, M age=15.9, SD=0.4). To assess motor competence, each child completed the Movement Assessment Battery for Children (MABC). To measure physical fitness, three tasks (strength, speed, and endurance) were selected from the Test of Physical Fitness (TPF). To analyze the significance of the difference between the correlation coefficient in the three age groups (samples) (4-6, 11-12, and 15-16 yr.), Fischer r-to-z transformation was used. The correlation (Pearson's) between motor competence and physical fitness in the age groups was statistically higher for the youngest age groups (4-6 and 11-12 yr.) and the adolescent group (age 15-16). The differences between the two youngest age groups were not statistically significant. The results demonstrate that the correlation between motor competence and physical fitness decreases with age.
30 CFR 280.21 - What must I do in conducting G&G prospecting or scientific research?
2010-07-01
... scientific research? 280.21 Section 280.21 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... prospecting or scientific research? While conducting G&G prospecting or scientific research activities under a... you are prospecting or conducting scientific research activities. (b) Consult and coordinate your G&G...
Costabile, Adele; Bergillos-Meca, Triana; Rasinkangas, Pia; Korpela, Katri; de Vos, Willem M; Gibson, Glenn R
2017-01-01
The aging process leads to a potential decline in immune function and adversely affects the gut microbiota. To date, many in vitro and in vivo studies focused on the application of synbiotics (prebiotics combined with probiotics) as a promising dietary approach to affect gut microbiota composition and improved functioning of the immune system. However, studies using synbiotic preparations often have the limitation that it remains unclear whether any effect observed is a result of the prebiotic or probiotic or a synergistic effect of the combined supplement. We investigated the effects of a probiotic Lactobacillus rhamnosus GG and pilus-deficient L. rhamnosus GG-PB12 combined with Promitor™ Soluble Corn Fiber (SCF, a candidate prebiotic) on fecal microbiota, metabolism, immunity, and blood lipids in healthy elderly persons. A prospective, double-blind, placebo controlled, randomized, single-centered, crossover study in 40 healthy elderly subjects (aged 60-80 years) was carried out. Volunteers were randomized to consume either probiotic and prebiotic as synbiotic, prebiotic or placebo (maltodextrin) during 3 weeks. Three-week washout periods separated all the treatments. We assessed effects upon blood lipids, glucose, cytokines, natural killer (NK) cell activity, phenotype, and intestinal microbiota composition. SCF decreased IL-6, which was not observed with the synbiotics. Consumption of L. rhamnosus GG combined with SCF increased NK cell activity compared to baseline in females and the older group. In the fecal microbiota analyses, the strongest community shifts were due to L. rhamnosus GG combined with SCF and SCF treatments. L. rhamnosus GG combined with SCF and L. rhamnosus GG-PB12 combined with SCF significantly increased the genus Parabacteroides . L. rhamnosus GG combined with SCF and SCF increased concentrations of Ruminococcaceae Incertae Sedis . Oscillospira and Desulfovibrio slightly decreased in the L. rhamnosus GG combined with SCF group, whereas
Tapiovaara, Laura; Kumpu, Minna; Mäkivuokko, Harri; Waris, Matti; Korpela, Riitta; Pitkäranta, Anne; Winther, Birgit
2016-08-01
Data has emerged on possible beneficial effects of probiotics in respiratory tract viral infections, but it is unclear if the promising positive effects evidenced are due to a reduced viral load during infections. The aims of this work were to investigate the effect of peroral probiotic Lactobacillus rhamnosus GG (American Type Culture Collection [ATCC], Accession No. 53103) consumption on human rhinovirus (HRV) load in nasopharyngeal lavage samples in experimental HRV infection, and to correlate viral load to clinical symptoms. Intranasal HRV A39 inoculation was performed on 59 adults, who had consumed juice enriched with live or heat-inactivated L. rhamnosus GG or control juice for 3 weeks prior to inoculation in a randomized, controlled, pilot trial setting. Nasopharyngeal lavage samples and symptom data were analyzed on day 0 before inoculation, and on days 2 and 5. Samples were subjected to quantitative HRV detection by polymerase chain reaction (PCR). Before inoculation 9 of 59 (15%) samples presented with another HRV strain than the studied A39. There was a tendency toward the lowest HRV loads in the L. rhamnosus GG groups and the highest in placebo group (log10 copies/mL, 95% confidence interval [CI], 6.20 [5.18 to 7.40] in live, 6.30 [4.91 to 7.08] in inactivated L. rhamnosus GG, and 7.25 [5.81 to 7.52] in placebo group, p = 0.57 in day 2) in the wild-type excluded population. The HRV load positively correlated with the symptom scores on days 2 and 5 (correlation coefficient 0.61 [p rhamnosus GG when compared to placebo. HRV load positively correlated with the total symptom scores. © 2016 ARS-AAOA, LLC.
DEFF Research Database (Denmark)
Tetens, Inge
claim related to Lactobacillus rhamnosus GG and maintenance of normal defecation during antibiotic treatment. The food constituent, Lactobacillus rhamnosus GG, which is the subject of the health claim, is sufficiently characterised. The claimed effect proposed by the applicant is “help to maintain...... normal defecation during antibiotic treatment” and the target population proposed by the applicant is “healthy outpatient adults and children on oral antibiotic treatment”. Maintenance of normal defecation during antibiotic treatment is a beneficial physiological effect. The Panel notes...... human intervention studies, from which conclusions could be drawn for the scientific substantiation of the claim, did not show an effect of Lactobacillus rhamnosus GG on the incidence of diarrhoea resulting from antibiotic treatment. The Panel concludes that a cause and effect relationship has not been...
Nolde, Svetlana B.; Vassilevski, Alexander A.; Rogozhin, Eugene A.; Barinov, Nikolay A.; Balashova, Tamara A.; Samsonova, Olga V.; Baranov, Yuri V.; Feofanov, Alexey V.; Egorov, Tsezi A.; Arseniev, Alexander S.; Grishin, Eugene V.
2011-01-01
This study presents purification, activity characterization, and 1H NMR study of the novel antifungal peptide EcAMP1 from kernels of barnyard grass Echinochloa crus-galli. The peptide adopts a disulfide-stabilized α-helical hairpin structure in aqueous solution and thus represents a novel fold among naturally occurring antimicrobial peptides. Micromolar concentrations of EcAMP1 were shown to inhibit growth of several fungal phytopathogens. Confocal microscopy revealed intensive EcAMP1 binding to the surface of fungal conidia followed by internalization and accumulation in the cytoplasm without disturbance of membrane integrity. Close spatial structure similarity between EcAMP1, the trypsin inhibitor VhTI from seeds of Veronica hederifolia, and some scorpion and cone snail toxins suggests natural elaboration of different functions on a common fold. PMID:21561864
Nolde, Svetlana B; Vassilevski, Alexander A; Rogozhin, Eugene A; Barinov, Nikolay A; Balashova, Tamara A; Samsonova, Olga V; Baranov, Yuri V; Feofanov, Alexey V; Egorov, Tsezi A; Arseniev, Alexander S; Grishin, Eugene V
2011-07-15
This study presents purification, activity characterization, and (1)H NMR study of the novel antifungal peptide EcAMP1 from kernels of barnyard grass Echinochloa crus-galli. The peptide adopts a disulfide-stabilized α-helical hairpin structure in aqueous solution and thus represents a novel fold among naturally occurring antimicrobial peptides. Micromolar concentrations of EcAMP1 were shown to inhibit growth of several fungal phytopathogens. Confocal microscopy revealed intensive EcAMP1 binding to the surface of fungal conidia followed by internalization and accumulation in the cytoplasm without disturbance of membrane integrity. Close spatial structure similarity between EcAMP1, the trypsin inhibitor VhTI from seeds of Veronica hederifolia, and some scorpion and cone snail toxins suggests natural elaboration of different functions on a common fold.
NNLO computational techniques: The cases H→γγ and H→gg
Actis, Stefano; Passarino, Giampiero; Sturm, Christian; Uccirati, Sandro
2009-04-01
A large set of techniques needed to compute decay rates at the two-loop level are derived and systematized. The main emphasis of the paper is on the two Standard Model decays H→γγ and H→gg. The techniques, however, have a much wider range of application: they give practical examples of general rules for two-loop renormalization; they introduce simple recipes for handling internal unstable particles in two-loop processes; they illustrate simple procedures for the extraction of collinear logarithms from the amplitude. The latter is particularly relevant to show cancellations, e.g. cancellation of collinear divergencies. Furthermore, the paper deals with the proper treatment of non-enhanced two-loop QCD and electroweak contributions to different physical (pseudo-)observables, showing how they can be transformed in a way that allows for a stable numerical integration. Numerical results for the two-loop percentage corrections to H→γγ,gg are presented and discussed. When applied to the process pp→gg+X→H+X, the results show that the electroweak scaling factor for the cross section is between -4% and +6% in the range 100 GeV500 GeV, without incongruent large effects around the physical electroweak thresholds, thereby showing that only a complete implementation of the computational scheme keeps two-loop corrections under control.
Identification of high-efficiency 3′GG gRNA motifs in indexed FASTA files with ngg2
Directory of Open Access Journals (Sweden)
Elisha D. Roberson
2015-11-01
Full Text Available CRISPR/Cas9 is emerging as one of the most-used methods of genome modification in organisms ranging from bacteria to human cells. However, the efficiency of editing varies tremendously site-to-site. A recent report identified a novel motif, called the 3′GG motif, which substantially increases the efficiency of editing at all sites tested in C. elegans. Furthermore, they highlighted that previously published gRNAs with high editing efficiency also had this motif. I designed a Python command-line tool, ngg2, to identify 3′GG gRNA sites from indexed FASTA files. As a proof-of-concept, I screened for these motifs in six model genomes: Saccharomyces cerevisiae, Caenorhabditis elegans, Drosophila melanogaster, Danio rerio, Mus musculus, and Homo sapiens. I also scanned the genomes of pig (Sus scrofa and African elephant (Loxodonta africana to demonstrate the utility in non-model organisms. I identified more than 60 million single match 3′GG motifs in these genomes. Greater than 61% of all protein coding genes in the reference genomes had at least one unique 3′GG gRNA site overlapping an exon. In particular, more than 96% of mouse and 93% of human protein coding genes have at least one unique, overlapping 3′GG gRNA. These identified sites can be used as a starting point in gRNA selection, and the ngg2 tool provides an important ability to identify 3′GG editing sites in any species with an available genome sequence.
Koh, Ji Hoon; Choi, Seung Hye; Park, Seung Won; Choi, Nag-Jin; Kim, Younghoon; Kim, Sae Hun
2013-10-01
Synbiotics, the combination of prebiotics and probiotics, has been shown to produce synergistic effects that promote gastrointestinal well-being of host. Tagatose is a low calorie food ingredient with putative health-promoting benefits. Herein, we investigated its synbiotic impact on the viability of Lactobacillus casei 01 and Lactobacillus rhamnosus strain GG and the potential mechanism involved. Tagatose, as a synbiotic substrate, enhanced the growth of L. casei 01 and L. rhamnosus strain GG compared to other prebiotics. Other gut-indigenous such as Clostridium spp. readily utilized fructooligosaccharide (FOS), the most widely used functional prebiotics, but not tagatose. Additionally, tagatose enhanced probiotic functions of L. casei 01 and L. rhamnosus strain GG by reinforcing their attachment on HT-29 intestine epithelial cells and enhancing their cholesterol-lowering activities. Whole transcriptome study and quantitative real-time polymerase chain reaction (qRT-PCR) test showed that the presence of tagatose in L. rhamnosus strain GG caused induction of a large number of genes associated with carbohydrate metabolism including the phosphotransferase system (PTS). Collectively, these results indicate the tagatose enhanced the growth of L. casei 01 and L. rhamnosus strain GG and their probiotic activities by activating tagatose-associated PTS networks. Importantly, this study highlights the potential application of tagatose and L. casei 01 and/or L. rhamnosus strain GG as a synbiotic partner in functional dairy foods (i.e. yogurt and cheese) and therapeutic dietary supplements. Copyright © 2013 Elsevier Ltd. All rights reserved.
Chemical Composition of Pyroligneous Acid Obtained from Eucalyptus GG100 Clone
Directory of Open Access Journals (Sweden)
Alexandre S. Pimenta
2018-02-01
Full Text Available The present study aimed to characterize the chemical composition of pyroligneous acid (PA obtained from slow pyrolysis of the clone GG100 of Eucalyptus urophylla × Eucalyptus grandis. The efficiency of extraction of organic compounds by using different solvents—dichloromethane (DCM, diethyl ether (DE and ethyl acetate (EA—was evaluated. Wood discs were collected and carbonized at a heating rate of 1.25 °C/min until 450 °C. Pyrolysis gases were trapped and condensed, yielding a crude liquid product (CLP, which was refined to obtain pure PA. Then liquid–liquid extraction was carried out. Each extracted fraction was analyzed by GC-MS and the chemical compounds were identified. Experimental results showed that a larger number of chemical compounds could be extracted by using DCM and EA in comparison to diethyl ether DE. A total number of 93 compounds were identified, with phenolic compounds being the major group, followed by aldehydes and ketones, furans, pyrans and esters. Higher contents of guaiacol, phenol, cresols and furfural seem to explain the antibacterial and antifungal activity shown by PA, as reported previously in the literature. Experimental data indicated that the organic phase extracted from GG100 PA consists of a mixture of compounds similar to liquid smokes regularly used in the food industry.
Vassilakos, George; Philippou, Anastassios; Koutsilieris, Michael
2017-02-01
Insulin-like growth factor-1 (IGF-1) is a pleiotropic factor expressed in various tissues and plays a critical role in skeletal muscle physiology. Alternative splicing of the IGF-1 gene gives rise to different precursor polypeptides (isoforms) which could undergo post-translational cleavage, generating the common mature IGF-1 peptide and different carboxyl terminal extension (E-) peptides, with the fate of the latter being, so far, unknown. The objective if this study was to identify the IGF-1Ec forms or processing product(s), other than mature IGF-1, generated in different human and rodent tissues and particularly in human skeletal muscle after exercise-induced damage. Protein lysates from a wide range of human and rodent tissues were immunoblotted with a rabbit anti-human Ec polyclonal antibody raised against the last 24 amino acids of the C-terminal of the Ec peptide. This antibody can recognize the Ec peptide, both as part of IGF-1Ec and alone, and also the corresponding rodent forms, due to the high homology that the human Ec shares with the rodent Eb. We were able to confirm, for the first time, that the human Ec peptide and its rodent homologous Eb peptide are produced simultaneously with their precursor protein (pro-IGF-1Ec/Eb) in vivo, in a wide range of tissues (e.g. muscle, liver, heart). Proprotein convertase furin digestion of human muscle and liver protein lysates confirmed that the higher molecular form, pro-IGF-1Ec, can be cleaved to produce the free Ec peptide. Furthermore, initial evidence is provided that Ec peptide is differentially regulated during the process of muscle regeneration after exercise-induced damage in humans. The findings of this study possibly imply that the post-translational modification of the IGF-1Ec pro-peptide may regulate the bioavailability and activity of the processing product(s). Copyright © 2016. Published by Elsevier Ltd.
GPM GROUND VALIDATION ENVIRONMENT CANADA (EC) VAISALA CEILOMETER GCPEX V1
National Aeronautics and Space Administration — The GPM Ground Validation Environment Canada (EC) VAISALA Ceilometer GCPEx dataset was collected during the GPM Cold-season Precipitation Experiment (GCPEx) in...
The methane sink associated to soils of natural and agricultural ecosystems in Italy.
Castaldi, Simona; Costantini, Massimo; Cenciarelli, Pietro; Ciccioli, Paolo; Valentini, Riccardo
2007-01-01
In the present work, the CH4 sink associated to Italian soils was calculated by using a process-based model controlled by gas diffusivity and microbial activity, which was run by using a raster-based geographical information system. Georeferenced data included land cover CLC2000, soil properties from the European Soil Database, climatic data from the MARS-STAT database, plus several derived soils properties based on published algorithms applied to the above mentioned databases. Overall CH4 consumption from natural and agricultural sources accounted for a total of 43.3 Gg CH4 yr(-1), with 28.1 Gg CH4 yr(-1) removed in natural ecosystems and 15.1 Gg CH4 yr(-1) in agricultural ecosystems. The highest CH4 uptake rates were obtained for natural areas of Southern Apennines and islands of Sardinia and Sicily, and were mainly associated to areas covered by sclerophyllous vegetation (259.7+/-30.2 mg CH4 m(-2) yr(-1)) and broad-leaved forest (237.5 mg CH4 m(-2) yr(-1)). In terms of total sink strength broad-leaved forests were the dominant ecosystem. The overall contribution of each ecosystem type to the whole CH4 sink depended on the total area covered by the specific ecosystem and on its exact geographic distribution. The latter determines the type of climate present in the area and the dominant soil type, both factors which showed to have a strong influence on CH4 uptake rates. The aggregated CH4 sink, calculated for natural ecosystems present in the Italian region, is significantly higher than previously reported estimates, which were extrapolated from fluxes measured in other temperate ecosystems.
Lunar Module ECS (Environmental Control System) - Design Considerations and Failure Modes. Part 1
Interbartolo, Michael
2009-01-01
Design considerations and failure modes for the Lunar Module (LM) Environmental Control System (ECS) are described. An overview of the the oxygen supply and cabin pressurization, atmosphere revitalization, water management and heat transport systems are provided. Design considerations including reliability, flight instrumentation, modularization and the change to the use of batteries instead of fuel cells are discussed. A summary is provided for the LM ECS general testing regime.
Expresión de efectores RXLR en el linaje clonal EC-1 de Phytophthora infestans en Perú
Directory of Open Access Journals (Sweden)
Myriam Izarra
2016-12-01
Full Text Available La papa (Solanum tuberosum L. es en nuestros días uno de los cultivos alimenticios más importantes. Esta es propensa a la enfermedad de Tizón Tardío, causada por el oomiceto patógeno Phytophthora infestans, el cual secreta cientos de efectores que actúan como factores de virulencia. Poco se conoce sobre la diversidad de genes de virulencia de las cepas pertenecientes al linaje de reproducción clonal EC-1. En el presente estudio, mediante el secuenciamiento del transcriptoma de la interacción de la papa y P. infestans durante los primeros días después de la infección en las hojas de papa, se identificó la expresión diferencial de genes efectores tipo RXLR en dos cepas de P. infestans EC-1, siendo confirmados por qRT-PCR. Estas cepas, aisladas de papas cultivadas en el centro de los Andes peruanos, tienen diferentes patrones de virulencia. Los genes efectores, fueron silenciados en una cepa, para Avr-vnt1 en POX109 y para el homólogo Avh9.1 en POX067, pero expresados en la otra. Los resultados de transcriptoma fueron comparados con tres cepas adicionales del linaje EC-1. La información del repertorio de los efectores del patógeno y su expresión podrían ser informativos para el mejoramiento genético de la resistencia. El descubrimiento de efectores silenciados en las poblaciones del patógeno pueden guiar al uso de genes R específicos en los programas de mejoramiento genético. Por ejemplo, en el contexto de los Andes, donde el linaje clonal EC-1 predomina, el gen Rpi-vnt1 podría no ser recomendado.
von Ossowski, Ingemar; Satokari, Reetta; Reunanen, Justus; Lebeer, Sarah; De Keersmaecker, Sigrid C. J.; Vanderleyden, Jos; de Vos, Willem M.; Palva, Airi
2011-01-01
In spite of the wealth of clinical evidence supporting the health benefits of Lactobacillus rhamnosus GG in humans, there is still a lack of understanding of the molecular mechanisms behind its probiosis. Current knowledge suggests that the health-promoting effects of this probiotic strain might be partly dependent on its persistence in the intestine and adhesion to mucosal surfaces. Moreover, L. rhamnosus GG contains mucus-binding pili that might also explain the occupation of its ecological niche as a comparatively less stringent allochthonous intestine-dwelling bacterium. To uncover additional surface proteins involved in mucosal adhesion, we investigated the adherence properties of the only predicted protein (LGG_02337) in L. rhamnosus GG that exhibits homology with a known mucus-binding domain. We cloned a recombinant form of the gene for this putative mucus adhesin and established that the purified protein readily adheres to human intestinal mucus. We also showed that this mucus adhesin is visibly distributed throughout the cell surface and participates in the adhesive interaction between L. rhamnosus GG and mucus, although less prominently than the mucus-binding pili in this strain. Based on primary structural comparisons, we concluded that the current annotation of the LGG_02337 protein likely does not accurately reflect its predicted properties, and we propose that this mucus-specific adhesin be called the mucus-binding factor (MBF). Finally, we interpret our results to mean that L. rhamnosus GG MBF, as an active mucus-specific surface adhesin with a presumed ancillary involvement in pilus-mediated mucosal adhesion, plays a part in the adherent mechanisms during intestinal colonization by this probiotic. PMID:21602388
Yr10 gene polymorphism in bread wheat varieties
African Journals Online (AJOL)
STORAGESEVER
2008-07-18
Jul 18, 2008 ... Yellow rust resistance locus Yr10 located on chromosome 1B in Moro and originated from the Turkish line PI178383 was investigated ... analysis proved that there has been single nucleotide changes especially in the second exon. The most ..... Successes in breeding for and managing durable resistance ...
[Construction of Lactobacillus rhamnosus GG particles surface display system].
Su, Runyu; Nie, Boyao; Yuan, Shengling; Tao, Haoxia; Liu, Chunjie; Yang, Bailiang; Wang, Yanchun
2017-01-25
To describe a novel particles surface display system which is consisted of gram-positive enhancer matrix (GEM) particles and anchor proteins for bacteria-like particles vaccines, we treated Lactobacillus rhamnosus GG bacteria with 10% heated-TCA for preparing GEM particles, and then identified the harvested GEM particles by electron microscopy, RT-PCR and SDS-PAGE. Meanwhile, Escherichia coli was induced to express hybrid proteins PA3-EGFP and P60-EGFP, and GEM particles were incubated with them. Then binding of anchor proteins were determined by Western blotting, transmission electron microscopy, fluorescence microscopy and spectrofluorometry. GEM particles preserved original size and shape, and proteins and DNA contents of GEM particles were released substantially. The two anchor proteins both had efficiently immobilized on the surface of GEM. GEM particles that were bounded by anchor proteins were brushy. The fluorescence of GEM particles anchoring PA3 was slightly brighter than P60, but the difference was not significant (P>0.05). GEM particles prepared from L. rhamnosus GG have a good binding efficiency with anchor proteins PA3-EGFP and P60-EGFP. Therefore, this novel foreign protein surface display system could be used for bacteria-like particle vaccines.
Jia, Ru; Chen, Han; Chen, Hui; Ding, Wu
2016-01-01
The effect of fermentation with Lactobacillus rhamnosus GG on the product quality of goat milk yogurt using traditional yogurt starter was studied through single-factor experiments and orthogonal experiments. The optimum fermentation condition was evaluated by the titratable acidity of goat milk yogurt, water-retaining capability, sensory score, and texture properties; the fatty acids of the fermented goat milk were determined by a gas chromatograph. Results indicate that high product quality of goat milk yogurt can be obtained and the content of short-chain and medium-chain fatty acids can be decreased significantly when amount of sugar added was 7%, inoculation amount was 3%, the ratio of 3 lactic acid bacteria--Lactobacillus delbrueckii ssp. bulgaricus, Streptococcus thermophilus, and L. rhamnosus GG--was 1:1:3, and fermentation temperature was 42°C. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Sheng-He Huang; Lina He; Yanhong Zhou; Chun-Hua Wu; Ambrose Jong
2009-01-01
The purpose of this study was to examine prophylactic efficacy of probiotics in neonatal sepsis and meningitis caused by E. coli K1. The potential inhibitory effect of Lactobacillus rhamnosus GG (LGG) on meningitic E. coli K1 infection was examined by using (i) in vitro inhibition assays with E44 (a CSF isolate from a newborn baby with E. coli meningitis), and (ii) the neonatal rat model of E. coli sepsis and meningitis. The in vitro studies demonstrated that LGG blocked E44 adhesion, invasio...
Colon-specific delivery of lactobacillus rhamnosus GG using pectin hydrogel beads
The probiotic bacteria, Lactobacillus rhamnosus GG (LGG), has shown beneficial effects on human health, and is accepted by increasing populations for the prevention and treatment of irritable bowel diseases. To increase the bioavailability and efficacy of LGG, the probiotic was encapsulated in hydro...
A spectroscopic survey of EC4, an extended cluster in Andromeda's halo
Collins, M. L. M.; Chapman, S. C.; Irwin, M.; Ibata, R.; Martin, N. F.; Ferguson, A. M. N.; Huxor, A.; Lewis, G. F.; Mackey, A. D.; McConnachie, A. W.; Tanvir, N.
2009-07-01
We present a spectroscopic survey of candidate red giant branch stars in the extended star cluster, EC4, discovered in the halo of M31 from our Canada-France-Hawaii Telescope/MegaCam survey, overlapping the tidal streams, Streams`Cp' and `Cr'. These observations used the DEep Imaging Multi-Object Spectrograph mounted on the Keck II telescope to obtain spectra around the CaII triplet region with ~1.3 Å resolution. Six stars lying on the red giant branch within two core radii of the centre of EC4 are found to have an average vr = -287.9+1.9-2.4kms-1 and σv,corr = 2.7+4.2-2.7kms-1, taking instrumental errors into account. The resulting mass-to-light ratio for EC4 is M/L = 6.7+15-6.7Msolar/Lsolar, a value that is consistent with a globular cluster within the 1σ errors we derive. From the summed spectra of our member stars, we find EC4 to be metal-poor, with [Fe/H] = -1.6 +/- 0.15. We discuss several formation and evolution scenarios which could account for our kinematic and metallicity constraints on EC4, and conclude that EC4 is most comparable with an extended globular cluster. We also compare the kinematics and metallicity of EC4 with Streams `Cp' and`Cr', and find that EC4 bears a striking resemblance to Stream`Cp' in terms of velocity, and that the two structures are identical in terms of both their spectroscopic and photometric metallicities. From this, we conclude that EC4 is likely related to Stream`Cp'. The data presented herein were obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W.M. Keck Foundation. E-mail: mlmc2@ast.cam.ac.uk
Douillard, François P; Rasinkangas, Pia; von Ossowski, Ingemar; Reunanen, Justus; Palva, Airi; de Vos, Willem M
2014-05-30
In Gram-positive bacteria, sortase-dependent pili mediate the adhesion of bacteria to host epithelial cells and play a pivotal role in colonization, host signaling, and biofilm formation. Lactobacillus rhamnosus strain GG, a well known probiotic bacterium, also displays on its cell surface mucus-binding pilus structures, along with other LPXTG surface proteins, which are processed by sortases upon specific recognition of a highly conserved LPXTG motif. Bioinformatic analysis of all predicted LPXTG proteins encoded by the L. rhamnosus GG genome revealed a remarkable conservation of glycine residues juxtaposed to the canonical LPXTG motif. Here, we investigated and defined the role of this so-called triple glycine (TG) motif in determining sortase specificity during the pilus assembly and anchoring. Mutagenesis of the TG motif resulted in a lack or an alteration of the L. rhamnosus GG pilus structures, indicating that the TG motif is critical in pilus assembly and that they govern the pilin-specific and housekeeping sortase specificity. This allowed us to propose a regulatory model of the L. rhamnosus GG pilus biogenesis. Remarkably, the TG motif was identified in multiple pilus gene clusters of other Gram-positive bacteria, suggesting that similar signaling mechanisms occur in other, mainly pathogenic, species. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.
GPM GROUND VALIDATION ENVIRONMENT CANADA (EC) MANUAL PRECIPITATION MEASUREMENTS GCPEX V1
National Aeronautics and Space Administration — The GPM Ground Validation Environment Canada (EC) Manual Precipitation Measurements GCPEx dataset was collected during the GPM Cold-season Precipitation Experiment...
Claes, Ingmar; Tytgat, Hanne L. P.; Verhoeven, Tine L. A.; Marien, Eyra; von Ossowski, Ingemar; Reunanen, Justus; Palva, Airi; de Vos, Willem M.; De Keersmaecker, Sigrid C. J.; Vanderleyden, Jos
2012-01-01
Lactobacillus rhamnosus GG, a probiotic with good survival capacity in the human gut, has well-documented adhesion properties and health effects. Recently, spaCBA-encoded pili that bind to human intestinal mucus were identified on its cell surface. Here, we report on the phenotypic analysis of a spaCBA pilus knockout mutant in comparison with the wild type and other adhesin mutants. The SpaCBA pilus of L. rhamnosus GG showed to be key for efficient adherence to the Caco-2 intestinal epithelial cell (IEC) line and biofilm formation. Moreover, the spaCBA mutant induces an elevated level of interleukin-8 (IL-8) mRNA in Caco-2 cells compared to the wild type, possibly involving an interaction of lipoteichoic acid with Toll-like receptor 2. In contrast, an L. rhamnosus GG mutant without exopolysaccharides but with an increased exposure of pili leads to the reduced expression of IL-8. Using Transwells to partition bacteria from Caco-2 cells, IL-8 induction is blocked completely regardless of whether wild-type or mutant L. rhamnosus GG cells are used. Taken together, our data suggest that L. rhamnosus GG SpaCBA pili, while promoting strong adhesive interactions with IECs, have a functional role in balancing IL-8 mRNA expression induced by surface molecules such as lipoteichoic acid. PMID:22020518
Jansman, A.J.M.; Enting, H.; Verstegen, M.W.A.; Huisman, J.
1994-01-01
The effects of condensed tannins in hulls of faba beans (Vicia faba L.) on the activities of trypsin (EC 3.4.21.4) and chymotrypsin (EC 3.4.21.1) in digesta obtained from the small intestine of pigs were studied. Using four castrated male pigs (mean body weight 83 kg) fitted with both a simple
First Measurement of sigma(gg -> ttbar)/sigma(ppbar -> ttbar)
International Nuclear Information System (INIS)
Pashapour Alamdari, Shabnaz
2008-01-01
The work presented here is the first measurement of the fraction of top quark pair production through gluon-gluon fusion. We use an integrated luminosity of 0.96 ± 0.06 fb -1 of p(bar p) collisions at √s of 1.96 TeV collected by the CDF II detector. We select t(bar t) candidates by identifying a high-p T lepton candidate, a large missing E T as evidence for a neutrino candidate and at least four high E T jets, one of which has to be identified as originating from a b quark. The challenge is to discriminate between the two production processes with the identical final state, gg → t(bar t) and q(bar q) → t(bar t). We take advantage of the fact that compared to a quark, a gluon is more likely to radiate a low momentum gluon and therefore, one expects a larger number of charged particles with low p T in a process involving more gluons. Given the large uncertainties associated with the modeling of the low p T charged particle multiplicity, a data-driven technique was employed. Using calibration data samples, we show there exists a clear correlation between the observed average number of low p T charged particles and the average number of gluons involved in the production process predicted by Monte Carlo calculations. Given the correlation, one can identify low p T charged particle multiplicity distributions associated with specific average number of gluons. The W + 0 jet sample and dijets sample with leading jet E T in the range of 80-100 GeV are used to find no-gluon and gluon-rich low p T charged particle multiplicity distributions, respectively. Using these no-gluon and gluon-rich distributions in a likelihood fit, we find the fraction of gluon-rich events in t(bar t) candidates. This fraction has contributions from the signal and background events. Taking into account these contributions and the gg → t(bar t) and q(bar q) → t(bar t) production channel acceptances, we find σ(gg → t(bar t))/σ(p(bar p) → t(bar t)) = 0.07 ± 0.14(stat) ± 0.07(syst) in
Schlegel, Werner; Raimann, Adalbert; Halbauer, Daniel; Scharmer, Daniela; Sagmeister, Susanne; Wessner, Barbara; Helmreich, Magdalena; Haeusler, Gabriele; Egerbacher, Monika
2013-01-01
Human insulin-like growth factor 1 Ec (IGF-1Ec), also called mechano growth factor (MGF), is a splice variant of insulin-like growth factor 1 (IGF-1), which has been shown in vitro as well as in vivo to induce growth and hypertrophy in mechanically stimulated or damaged muscle. Growth, hypertrophy and responses to mechanical stimulation are important reactions of cartilaginous tissues, especially those in growth plates. Therefore, we wanted to ascertain if MGF is expressed in growth plate cartilage and if it influences proliferation of chondrocytes, as it does in musculoskeletal tissues. MGF expression was analyzed in growth plate and control tissue samples from piglets aged 3 to 6 weeks. Furthermore, growth plate chondrocyte cell culture was used to evaluate the effects of the MGF peptide on proliferation. We showed that MGF is expressed in considerable amounts in the tissues evaluated. We found the MGF peptide to be primarily located in the cytoplasm, and in some instances, it was also found in the nucleus of the cells. Addition of MGF peptides was not associated with growth plate chondrocyte proliferation.
Directory of Open Access Journals (Sweden)
Pusdima Rahma Pratiwi
2015-07-01
Full Text Available Kebutuhan akan tanaman sawi semakin meningkat, sehingga diperlukan teknologi yang dapat memaksimalkan hasil serta memperbaiki teknik budidaya, salah satunya teknik budidaya aeroponik vertikal. Penelitian ini bertujuan untuk mengetahui respon pertumbuhan tanaman sawi yang terbaik terhadap pengaruh tingkat EC pada larutan nutrisi. Penelitian ini dilaksanakan di daerah Bekasi Timur dengan ketinggian 25 m di atas permukaan laut, dimulai pada bulan April 2014 sampai Juli 2014. Rancangan yang digunakan adalah Rancangan Acak Kelompok dengan 4 perlakuan yaitu A (Tingkat EC 1 mS cm-1, B (Tingkat EC 1,5 mS cm-1, C (Tingkat EC 2 mS cm-1, dan D (Tingkat EC 2,5 mS cm-1 dengan diulang sebanyak 4 kali. Hasil penelitian menunjukkan bahwa tingkat EC berpengaruh terhadap tinggi tanaman sawi pada umur 14 dan 18 hst, luas daun pada umur 26 dan 30 hst, panjang akar pada umur 30 hst, dan bobot basah pada umur 30 hst. Tingkat EC 2,5 mS cm-1 memberikan pengaruh baik terhadap bobot basah. The increasing need of mustard require technologies that can maximize result and improve cultivation, one of them is aeroponic vertical cultivation technique. This research aimed to know the best response of mustard growth on influence of nutrient EC level. This research was carried out in Bekasi Timur with altitude of 25 m above sea level, form April 2014 to July 2014. The design used was Randomized Block Design with 4 treatments that A (EC level 1 mS cm-1, B (EC level 1,5 mS cm-1, C (EC level 2 mS cm-1, and D (EC level 2,5 mS cm-1 with 4 replications. The results showed that EC level affected on plant height at 14 and 18 dap, leaf area at 26 and 30 dap, root length at 30 dap, and wet weight at the age of 30 dap. The EC level 2,5 mS cm-1had better effect on wet weight.
Seizure threshold to lidocaine is decreased following repeated ECS (electroconvulsive shock)
DEFF Research Database (Denmark)
Kragh, J; Seidelin, J; Bolwig, T G
1993-01-01
Seizure susceptibility to lidocaine was investigated in rats which had received repeated ECS (electroconvulsive shock). In the first experiment three groups of rats received an ECS daily for 18 days, an ECS weekly for 18 weeks, and 18 sham treatments, respectively. Twelve weeks after the last ECS...... all rats received a lidocaine challenge (LC) in the form of an intraperitoneal (IP) injection of lidocaine (65 mg/kg). After the injection the animals were observed for occurrence of motor seizures. A total of 67% (10/15), 47% (7/15), and 0% (0/18) of the daily, weekly, and sham groups, respectively......, had motor seizures in response to the LC. In the second experiment five groups of rats received an ECS daily for 0, 1, 6, 18, and 36 days, respectively. Eighteen weeks after the last ECS all rats received an LC and 0% (0/15), 13% (2/15), 20% (3/15), 53% (8/15), and 58% (7/12), respectively, developed...
Medo, Juraj; Maková, Jana; Kovácsová, Silvia; Majerčíková, Kamila; Javoreková, Soňa
2015-01-01
This investigation was undertaken to determine the impact of the insecticides Dursban 480 EC (with organophosphate compound chlorpyrifos as the active ingredient) and Talstar 10 EC (with pyrethroid bifenthrin as the active ingredient) on the respiration activity and microbial diversity in a sandy loam luvisol soil. The insecticides were applied in two doses: the maximum recommended dose for field application (15 mg kg(-1) for Dursban 480 EC and 6 mg kg(-1) for Talstar 10 EC) and a 100-fold higher dose for extrapolation of their effect. Bacterial and fungal genetic diversity was analysed in soil samples using PCR DGGE and the functional diversity (catabolic potential) was studied using BIOLOG EcoPlates at 1, 3, 7, 14, 28, 56 and 112 days after insecticide application. Five bacterial groups (α, β, γ proteobacteria, firmibacteria and actinomycetes) and five groups of fungi or fungus-like microorganisms (Ascomycota, Basidiomycota, Chytridiomycota, Oomycota and Zygomycota) were analysed using specific primer sets. This approach provides high resolution of the analysis covering majority of microorganisms in the soil. Only the high-dose Dursban 480 EC significantly changed the community of microorganisms. We observed its negative effect on α- and γ-proteobacteria, as the number of OTUs (operational taxonomic units) decreased until the end of incubation. In the β-proteobacteria group, initial increase of OTUs was followed by strong decrease. Diversity in the firmibacteria, actinomycetes and Zygomycota groups was minimally disturbed by the insecticide application. Dursban 480 EC, however, both positively and negatively affected certain species. Among negatively affected species Sphingomonas, Flavobacterium or Penicillium were detected, but Achromobacter, Luteibacter or Aspergillus were supported by applied insecticide. The analysis of BIOLOG plates using AWCD values indicated a significant increase in metabolic potential of microorganisms in the soil after the high
EC6 safety design improvements
Energy Technology Data Exchange (ETDEWEB)
Yu, S.; Lee, A.G.; Soulard, M. [Candu Energy Inc., Mississauga, ON (Canada)
2014-07-01
The Enhanced CANDU 6 (EC6) builds on the proven high performance design such as the Qinshan CANDU 6 reactor, and has made improvements to safety, operational performance, and has incorporated extensive operational feedback. Completion of all three phases of the pre-licensing design review by the Canadian Regulator - the Canadian Nuclear Safety Commission has provided a higher level of assurance that the EC6 reference design has taken modern regulatory requirements and expectations into account and further confirmed that there are no fundamental barriers to licensing the EC6 design in Canada. The EC6 design is based on the defence-in-depth principles in INSAG-10 and provides further safety features that address the lessons learned from Fukushima. With these safety features, the EC6 design has strengthened accident prevention as the first priority in the defence-in-depth strategy, as outlined in INSAG-10. As well, the EC6 design has incorporated further mitigation measures to provide additional protection of the public and the environment if the preventive measures fail. The EC6 design has an appropriate combination of inherent, passive safety characteristics, engineered features and administrative safety measures to effectively prevent and mitigate severe accident progressions. A strong contributor to the robustness and redundancy of CANDU design is the two-group separation philosophy. This ensures a high degree of independence between safety systems as well as physical separation and functional independence in how fundamental safety functions are provided. This paper will describe the following safety features based on the application of defence-in-depth and design approach to prevent beyond design basis events progressing to severe accidents and to mitigate the consequences if it occurs: Improved steam generator heat sink via a more reliable emergency heat removal system; Increased time before manual field actions are required via enhanced capacity of
Directory of Open Access Journals (Sweden)
T. Kobashi
2013-10-01
Full Text Available Precise understanding of Greenland temperature variability is important in two ways. First, Greenland ice sheet melting associated with rising temperature is a major global sea level forcing, potentially affecting large populations in coming centuries. Second, Greenland temperatures are highly affected by North Atlantic Oscillation/Arctic Oscillation (NAO/AO and Atlantic multidecadal oscillation (AMO. In our earlier study, we found that Greenland temperature deviated negatively (positively from northern hemispheric (NH temperature trend during stronger (weaker solar activity owing to changes in atmospheric/oceanic changes (e.g. NAO/AO over the past 800 yr (Kobashi et al., 2013. Therefore, a precise Greenland temperature record can provide important constraints on the past atmospheric/oceanic circulation in the region and beyond. Here, we investigated Greenland temperature variability over the past 4000 yr reconstructed from argon and nitrogen isotopes from trapped air in a GISP2 ice core, using a one-dimensional energy balance model with orbital, solar, volcanic, greenhouse gas, and aerosol forcings. The modelled northern Northern Hemisphere (NH temperature exhibits a cooling trend over the past 4000 yr as observed for the reconstructed Greenland temperature through decreasing annual average insolation. With consideration of the negative influence of solar variability, the modelled and observed Greenland temperatures agree with correlation coefficients of r = 0.34–0.36 (p = 0.1–0.04 in 21 yr running means (RMs and r = 0.38–0.45 (p = 0.1–0.05 on a centennial timescale (101 yr RMs. Thus, the model can explain 14 to 20% of variance of the observed Greenland temperature in multidecadal to centennial timescales with a 90–96% confidence interval, suggesting that a weak but persistent negative solar influence on Greenland temperature continued over the past 4000 yr. Then, we estimated the distribution of multidecadal NH and northern high
International Nuclear Information System (INIS)
Wang, Y.J.; Wang, C.Y.; Zhang, H.
2015-01-01
Synthetic hexaploid wheat is an important germplasm resource for transfer of beneficial genes from alien species to common wheat (Triticum aestivum L.). Synthetic hexaploid wheat SE5756 confers a high level of resistance against a wide range of races of Puccinia striiformis West. f. sp. tritici Eriks. et Henn.(Pst). The objectives of this study were to determine the inheritance pattern, adjacent molecular markers, and chromosomal location of the stripe rust resistance gene in SE5756 and to develop new germplasm. We constructed a segregating population of 116 F2 plants and corresponding F2:3 families from a cross between SE5756 and Xinong979 with Pst races CYR32. Genetic analysis revealed that a single dominant gene, tentatively designated as YrSE5756, was responsible for seedling stage stripe rust resistance in SE5756. A genetic map, encompassing Xwmc626, Xwmc269, Xgwm11, Xbarx137, Xwmc419, Xwmc85, Xgpw5237, Xwmc134, WE173, Xwmc631, and YrSE5756, spanned 70.1 cM on chromosome 1BS. Xwmc419 and Xwmc85 were flanking markers tightly linked to YrSE5756 at genetic distances of 2.3 and 1.8 cM. Typical adult plant responses of the SE5756, varieties of the carrier Yr10 and Yr15, Chuanmai 42 (Yr24/Yr26), Yuanfeng 175 (Yr24/Yr26) and Huixianhong resistant to mixture Pst races (CYR32, CYR33 and V26) were experimented. The results showed that YrSE5756 was likely a new resistance stripe rust gene different from Yr24/Yr26, Yr10 and Yr15. From cross and backcross populations of SE5756/Xinong 979, we developed four new wheat lines with large seeds, stripe rust resistance, and improved agronomic traits: N07178-1, N07178-2, N08256-1, and N08256-2. These new germplasm lines could serve as sources of resistance to stripe rust in wheat breeding. SE5756 has the very vital significance in the development of breeding and expand our resistance germplasm resource gene pool. (author)
Permeation of Telone EC through protective gloves.
Zainal, Hanaa; Que Hee, Shane S
2005-09-30
Telone is a potent fumigant that is based on the chlorinated unsaturated hydrocarbon, 1,3-dichloropropene (1,3-DCP). It is often applied without dilution and so poses severe inhalation and air pollution threats. Urinary metabolites of 1,3-DCP have been detected after Telone skin exposure, so that preventing dermal exposure is also important. The objective of the study was to assess if nitrile and multi-layer ("laminated") gloves provide adequate protection against Telone EC formulation. To accomplish this, disposable (Safeskin) and chemically resistant (Sol-Vex) nitrile and laminated (Barrier mark and Silver Shield) glove materials were challenged by Telone EC with hexane liquid collection in an ASTM-type I-PTC-600 permeation cell. Analyses of cis- and trans-1,3-DCP in the collection fluid at specified times were performed on a moderately polar capillary column by gas chromatography-electron capture detection. Telone EC caused microholes in both nitrile materials, though the chemically protective material was degraded slower than the disposable nitrile. The laminated gloves offered limited protection. Silver Shield protected best because 1.5-2.3 mg 1,3-DCP permeated by 8 h relative to 2.5-7.6 mg for Barrier, implying about 2.5 times more protection for 8 h. Even for Silver Shield, the extent of protection was inadequate as illustrated by a risk assessment of the skin exposure situation. The normalized breakthrough times for both types of laminated gloves varied between 27 and 60 min. It is recommended that Viton gloves still be worn for protection.
Randles, C. A.; Hristov, A. N.; Harper, M.; Meinen, R.; Day, R.; Lopes, J.; Ott, T.; Venkatesh, A.
2017-12-01
In this analysis we used a spatially-explicit, bottom-up approach, based on animal inventories, feed intake, and feed intake-based emission factors to estimate county-level enteric (cattle) and manure (cattle, swine, and poultry) livestock methane emissions for the contiguous United States. Combined enteric and manure emissions were highest for counties in California's Central Valley. Overall, this analysis yielded total livestock methane emissions (8,916 Gg/yr; lower and upper bounds of 6,423 and 11,840 Gg/yr, respectively) for 2012 that are comparable to the current USEPA estimates for 2012 (9,295 Gg/yr) and to estimates from the global gridded Emission Database for Global Atmospheric Research (EDGAR) inventory (8,728 Gg/yr), used previously in a number of top-down studies. However, the spatial distribution of emissions developed in this analysis differed significantly from that of EDGAR. As an example, methane emissions from livestock in Texas and California (highest contributors to the national total) in this study were 36% lesser and 100% greater, respectively, than estimates by EDGAR. Thespatial distribution of emissions in gridded inventories (e.g., EDGAR) likely strongly impacts the conclusions of top-down approaches that use them, especially in the source attribution of resulting (posterior) emissions, and hence conclusions from such studies should be interpreted with caution.
Directory of Open Access Journals (Sweden)
Werner Schlegel
Full Text Available Human insulin-like growth factor 1 Ec (IGF-1Ec, also called mechano growth factor (MGF, is a splice variant of insulin-like growth factor 1 (IGF-1, which has been shown in vitro as well as in vivo to induce growth and hypertrophy in mechanically stimulated or damaged muscle. Growth, hypertrophy and responses to mechanical stimulation are important reactions of cartilaginous tissues, especially those in growth plates. Therefore, we wanted to ascertain if MGF is expressed in growth plate cartilage and if it influences proliferation of chondrocytes, as it does in musculoskeletal tissues. MGF expression was analyzed in growth plate and control tissue samples from piglets aged 3 to 6 weeks. Furthermore, growth plate chondrocyte cell culture was used to evaluate the effects of the MGF peptide on proliferation. We showed that MGF is expressed in considerable amounts in the tissues evaluated. We found the MGF peptide to be primarily located in the cytoplasm, and in some instances, it was also found in the nucleus of the cells. Addition of MGF peptides was not associated with growth plate chondrocyte proliferation.
Fernández, A P; Jaramillo, J; Jaramillo, M
2000-01-01
We compared the efficacy, predictability, and safety of photorefractive keratectomy (PRK) and laser in situ keratomileusis (LASIK) for the surgical correction of low and moderate myopia. A retrospective study was performed to evaluate uncorrected and spectacle-corrected visual acuity, and manifest refraction 1 year after PRK or LASIK. All procedures were done using an automatic microkeratome (Chiron Ophthalmic) and the Nidek EC-5000 excimer laser. PRK was performed in 75 eyes of 45 patients and LASIK in 133 eyes of 77 patients. Mean age for PRK patients was 32.8 years (range, 18 to 52 yr) and LASIK patients was 29.6 years (range, 18 to 49 yr). Mean preoperative spherical equivalent refraction for PRK patients was -3.28 D (range, -1.00 to -6.00 D) and LASIK, -3.86 D (range, -1.00 to -6.00 D). One year after surgery, mean spherical equivalent refraction for Group 1 (baseline, -1.00 to -3.00 D) PRK eyes was -0.18 +/- 0.61 D (range, -1.50 to +0.75 D) and for LASIK eyes, -0.08 +/- 0.61 D (range, -1.50 to +1.62 D), with no statistically significant difference. For Group 2 eyes (baseline, -3.25 to -6.00 D), mean spherical equivalent refraction for PRK eyes was -0.44 +/- 0.87 D (range, -2.00 to +2.12 D) and for LASIK eyes, -0.09 +/- 0.83 D (range, -1.50 to +1.75 D), with no statistically significant difference. The antilogarithm of the mean UCVA (antilogUCVA) in Group 1 for PRK was 0.79 +/- 0.21 (20/25) and for LASIK was 0.87 +/- 0.19 (20/23), with no statistically significant difference. The antilogUCVA in Group 2 for PRK eyes was 0.70 +/- 0.24 (20/28) and for LASIK eyes was 0.83 +/- 0.18 (20/24), with a statistically significant difference (0.7 vs. 0.83, P 20/40 in Group 1 for PRK was 91.5% (38 eyes) and for LASIK was 95% (50 eyes) (no statistically significant difference), and in Group 2 for PRK eyes, it was 82% (27 eyes) and 97.5% (78 eyes) for LASIK (statistically significant difference, P PRK and LASIK with the Nidek EC-5000 excimer laser are effective and safe for
Energy Technology Data Exchange (ETDEWEB)
Pennington, M.; Lacrosse, L. [Asian Institute of Technology (Thailand); Schenkel, Y. [Centre de Recherches Agronomiques (Belgium)
1996-12-31
The EC-ASEAN COGEN Programme is a co-operation programme between the European Commission (EC) and the Association of South East Asian Nations (ASEAN) co-ordinated by the Asian Institute of Technology (AIT), Bangkok, Thailand. Its aim is to accelerate the implementation of proven technologies generating heat and/or power from wood and agroindustrial residues through partnerships between European and ASEAN companies. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Pennington, M; Lacrosse, L [Asian Institute of Technology (Thailand); Schenkel, Y [Centre de Recherches Agronomiques (Belgium)
1997-12-31
The EC-ASEAN COGEN Programme is a co-operation programme between the European Commission (EC) and the Association of South East Asian Nations (ASEAN) co-ordinated by the Asian Institute of Technology (AIT), Bangkok, Thailand. Its aim is to accelerate the implementation of proven technologies generating heat and/or power from wood and agroindustrial residues through partnerships between European and ASEAN companies. (orig.)
Directory of Open Access Journals (Sweden)
Y. Chen
2016-02-01
Full Text Available Elemental Carbon (EC has a significant impact on human health and climate change. In order to evaluate the size segregation of EC emission in the EUCAARI inventory and investigate its influence on the simulation of EC long-range transportation in Europe, we used the fully coupled online Weather Research and Forecasting/Chemistry model (WRF-Chem at a resolution of 2 km focusing on a region in Germany, in conjunction with a high-resolution EC emission inventory. The ground meteorology conditions, vertical structure and wind pattern were well reproduced by the model. The simulations of particle number and/or mass size distributions were evaluated with observations at the central European background site Melpitz. The fine mode particle concentration was reasonably well simulated, but the coarse mode was substantially overestimated by the model mainly due to the plume with high EC concentration in coarse mode emitted by a nearby point source. The comparisons between simulated EC and Multi-angle Absorption Photometers (MAAP measurements at Melpitz, Leipzig-TROPOS and Bösel indicated that the coarse mode EC (ECc emitted from the nearby point sources might be overestimated by a factor of 2–10. The fraction of ECc was overestimated in the emission inventory by about 10–30 % for Russia and 5–10 % for Eastern Europe (e.g., Poland and Belarus. This incorrect size-dependent EC emission results in a shorter atmospheric life time of EC particles and inhibits the long-range transport of EC. A case study showed that this effect caused an underestimation of 20–40 % in the EC mass concentration in Germany under eastern wind pattern.
Reporting harvested wood products in national greenhouse gas inventories: Implications for Ireland
International Nuclear Information System (INIS)
Green, Carly; Avitabile, Valerio; Farrell, Edward P.; Byrne, Kenneth A.
2006-01-01
During recent years harvested wood products (HWP) have received growing attention because they may be included in national greenhouse gas (GHG) inventories and possibly Kyoto Protocol (KP) accounting procedures in future commitment periods, with practical and economic consequences for both reporting and timber markets. The Intergovernmental Panel on Climate Change (IPCC) has identified three approaches to estimating and reporting carbon (C) stock in HWP; the stock-change approach, the production approach, and the atmospheric-flow approach. Should countries choose to report C stocks in HWP, one approach needs to be universally agreed for consistency. Using a model, the C stock both in use and in solid waste disposal sites (SWDS) at a national scale in Ireland was estimated and compared for the period 1961-2003 with uncertainty in the estimates generated using a Monte Carlo analysis. In 2003, the stock-change approach yielded the highest C sink, relative to the IPCC default approach of 375 Gg C yr -1 ±40% with the production approach and atmospheric-flow approach estimating the stock change at 271 Gg C yr -1 ±48% and 149 Gg C yr -1 ±31%, respectively. On the basis of the model results, the implications of selecting one approach over another and the contribution HWP may have in the future to help Ireland reach its reduction target under the KP are discussed
Currie, L. A.; Kessler, J. D.
2005-10-01
The primary objective of the research reported here has been the development of a hybrid reference material (RM) to serve as a test of accuracy for elemental carbon (EC) isotopic (14C) speciation measurements. Such measurements are vital for the quantitative apportionment of fossil and biomass sources of "soot" (EC), the tracer of fire that has profound effects on health, atmospheric visibility, and climate. Previous studies of 14C-EC measurement quality, carried out with NIST SRM 1649a (Urban Dust), showed a range of results, but since the "truth" was not known for this natural matrix RM, one had to rely on isotopic-chemical consistency evidence (14C in PAH, EC) of measurement validity (Currie et al., 2002). Components of the new Hybrid RM (DiesApple), however, have known 14C and EC composition, and they are nearly orthogonal (isotopically and chemically). NIST SRM 2975 (Forklift Diesel Soot) has little or no 14C, and its major compositional component is EC; SRM 1515 (Apple Leaves) has the 14C content of biomass-C, and it has little or no EC. Thus, the Hybrid RM can serve as an absolute isotopic test for the absence of EC-mimicking pyrolysis-C (char) from SRM 1515 in the EC isolate of the Hybrid RM, as well as a test for conservation of its dominant soot fraction throughout the isolation procedure. The secondary objective was to employ the Hybrid RM for the comparative evaluation of the thermal optical kinetic (TOK) and thermal optical transmission (TOT) methods for the isolation of EC for micro-molar carbon accelerator mass spectrometry (AMS). As part of this process, the relatively new TOK method was subjected to a critical evaluation and significant development. Key findings of our study are: (1) both methods exhibited biomass-C "leakage"; for TOT, the EC fraction isolated for AMS contained about 8% of the original biomass-C; for TOK, the refractory carbon (RC) isolated contained about 3% of the original biomass-C.; (2) the initial isothermal oxidation stage of
Directory of Open Access Journals (Sweden)
L. A. Currie
2005-01-01
Full Text Available The primary objective of the research reported here has been the development of a hybrid reference material (RM to serve as a test of accuracy for elemental carbon (EC isotopic (14C speciation measurements. Such measurements are vital for the quantitative apportionment of fossil and biomass sources of 'soot' (EC, the tracer of fire that has profound effects on health, atmospheric visibility, and climate. Previous studies of 14C-EC measurement quality, carried out with NIST SRM 1649a (Urban Dust, showed a range of results, but since the 'truth' was not known for this natural matrix RM, one had to rely on isotopic-chemical consistency evidence (14C in PAH, EC of measurement validity (Currie et al., 2002. Components of the new Hybrid RM (DiesApple, however, have known 14C and EC composition, and they are nearly orthogonal (isotopically and chemically. NIST SRM 2975 (Forklift Diesel Soot has little or no 14C, and its major compositional component is EC; SRM 1515 (Apple Leaves has the 14C content of biomass-C, and it has little or no EC. Thus, the Hybrid RM can serve as an absolute isotopic test for the absence of EC-mimicking pyrolysis-C (char from SRM 1515 in the EC isolate of the Hybrid RM, as well as a test for conservation of its dominant soot fraction throughout the isolation procedure. The secondary objective was to employ the Hybrid RM for the comparative evaluation of the thermal optical kinetic (TOK and thermal optical transmission (TOT methods for the isolation of EC for micro-molar carbon accelerator mass spectrometry (AMS. As part of this process, the relatively new TOK method was subjected to a critical evaluation and significant development. Key findings of our study are: (1 both methods exhibited biomass-C 'leakage'; for TOT, the EC fraction isolated for AMS contained about 8% of the original biomass-C; for TOK, the refractory carbon (RC isolated contained about 3% of the original biomass-C.; (2 the initial isothermal oxidation stage
EC Transmission Line Risk Identification and Analysis
Energy Technology Data Exchange (ETDEWEB)
Bigelow, Tim S [ORNL
2012-04-01
The purpose of this document is to assist in evaluating and planning for the cost, schedule, and technical project risks associated with the delivery and operation of the EC (Electron cyclotron) transmission line system. In general, the major risks that are anticipated to be encountered during the project delivery phase associated with the implementation of the Procurement Arrangement for the EC transmission line system are associated with: (1) Undefined or changing requirements (e.g., functional or regulatory requirements) (2) Underperformance of prototype, first unit, or production components during testing (3) Unavailability of qualified vendors for critical components Technical risks associated with the design and operation of the system are also identified.
Relatiivinen solmisaatio käyrätorven alkeisopinnoissa
Laine, Aino
2009-01-01
Tämän työn aiheena on relatiivisen solmisaation hyödyntäminen käyrätorven alkeisopinnoissa. Työn tarkoituksena on selvittää, miten relatiivista solmisaatiota voidaan käyttää aloittelevien 8-9-vuotiaiden soitto-oppilaiden opetuksessa ensimmäisen vuoden aikana. Työssä pohditaan, miten Colourwinds-menetelmän periaatteita voidaan soveltaa käyrätorven alkeisopetuksessa. Colourwinds-soitinkouluja verrataan Hulda Horns första spelbok -alkeissoittovihkoon. Solmisaatiolle pohjautuvaa suomenkielist...
Energy Technology Data Exchange (ETDEWEB)
Kodama, M.
1992-12-01
This paper considers authorization powers held by the major organizations in the EC, with the Maastricht Treaty kept in mind. One of the objectives of establishing the EC is to harmonize and develop the economic activities in the community on the whole, and promote making closer the relations among the member nations. The EC's supernationality has two aspects: finances (using financial sources from externally common tariffs as the EC's independent financial resources) and legislations (member nations delegating their own powers to the international organization). Organizations involving in the EC legislations are the European Assembly, the board of ministers, and the EC Committee. The Assembly has deciding powers at high levels on the EC budget decision, as well as vetoing power on the budget. The board of ministers is provided with deciding powers to assure achievement of the objectives defined in the official requirements. The Committee has a supernational character that each committee member can act independently free from being subjected to orders from his or her native country. Practically, however, the authorization relationship among the organizations has confrontations over the interests of the organizations and member nations. There have been such movements in this situation as the Luxemburg compromises, actions at the agricultural ministers meeting, and preparation of the unified European protocol. 2 figs., 4 tabs.
Public Availability to ECS Collected Datasets
Henderson, J. F.; Warnken, R.; McLean, S. J.; Lim, E.; Varner, J. D.
2013-12-01
Coastal nations have spent considerable resources exploring the limits of their extended continental shelf (ECS) beyond 200 nm. Although these studies are funded to fulfill requirements of the UN Convention on the Law of the Sea, the investments are producing new data sets in frontier areas of Earth's oceans that will be used to understand, explore, and manage the seafloor and sub-seafloor for decades to come. Although many of these datasets are considered proprietary until a nation's potential ECS has become 'final and binding' an increasing amount of data are being released and utilized by the public. Data sets include multibeam, seismic reflection/refraction, bottom sampling, and geophysical data. The U.S. ECS Project, a multi-agency collaboration whose mission is to establish the full extent of the continental shelf of the United States consistent with international law, relies heavily on data and accurate, standard metadata. The United States has made it a priority to make available to the public all data collected with ECS-funding as quickly as possible. The National Oceanic and Atmospheric Administration's (NOAA) National Geophysical Data Center (NGDC) supports this objective by partnering with academia and other federal government mapping agencies to archive, inventory, and deliver marine mapping data in a coordinated, consistent manner. This includes ensuring quality, standard metadata and developing and maintaining data delivery capabilities built on modern digital data archives. Other countries, such as Ireland, have submitted their ECS data for public availability and many others have made pledges to participate in the future. The data services provided by NGDC support the U.S. ECS effort as well as many developing nation's ECS effort through the U.N. Environmental Program. Modern discovery, visualization, and delivery of scientific data and derived products that span national and international sources of data ensure the greatest re-use of data and
Directory of Open Access Journals (Sweden)
Ma Changhui
2009-01-01
Full Text Available Tumor necrosis factor receptor 1 (TNFR1 is a membrane receptor able to bind TNF-α or TNF-β. TNFR1 can suppress apoptosis by activating the NF-κB or JNK/SAPK signal transduction pathway, or it can induce apoptosis through a series of caspase cascade reactions; the particular effect may depend on the cell line. In the present study, we first showed that TNFR1 is expressed at both the gene and protein levels in the esophageal carcinoma cell line EC109. Then, by applying a specific siRNA, we silenced the expression of TNFR1; this resulted in a significant time-dependent promotion of cell proliferation and downregulation of the apoptotic rate. These results suggest that TNFR1 is strongly expressed in the EC109 cell line and that it may play an apoptosis-mediating role, which may be suppressed by highly activated NF-κB.
Soccer increases bone mass in prepubescent boys during growth: a 3-yr longitudinal study.
Zouch, Mohamed; Zribi, Anis; Alexandre, Christian; Chaari, Hamada; Frere, Delphine; Tabka, Zouhair; Vico, Laurence
2015-01-01
The aim of this study was to examine the effect of 3-yr soccer practice on bone acquisition in prepubescent boys. We investigated 65 boys (aged 10-13 yr, Tanner stage I) at baseline, among which only 40 boys (Tanner stages II and III) have continued the 3-yr follow-up: 23 soccer players (F) completed 2-5 h of training plus 1 competition game per week and 17 controls (C). Bone mineral density (BMD, g/cm(2)) and bone mineral content (BMC, g) were measured by dual-energy X-ray absorptiometry at different sites. At baseline, BMD was higher in soccer players than in controls in the whole body and legs. In contrast, there was nonsignificant difference BMD in head, femoral neck, arms, and BMC in all measured sites between groups. At 3-yr follow-up, soccer players were found to have higher BMD and BMC at all sites than controls, except for head BMD and BMC and arms BMC in which the difference was nonsignificant between groups. During the 3-yr follow-up, the soccer players were found to gain significantly more in lumbar spine (31.2% ± 2.9% vs 23.9% ± 2.1%; p soccer players have less %BMD and %BMC changes in the head than controls. A nonsignificant difference was found in legs, dominant arm, head %BMD and %BMC changes, and whole-body %BMC changes between groups. In summary, we suggest that soccer has an osteogenic effect BMD and BMC in loaded sites in pubertal soccer players. The increased bone mass induced by soccer training in the stressed sites was associated to a decreased skull bone mass after 3 yr of follow-up. Copyright © 2015 The International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.
Dual EC : a standardized back door
Bernstein, D.J.; Lange, T.; Niederhagen, R.F.
2015-01-01
Dual EC is an algorithm to compute pseudorandom numbers starting from some random input. Dual EC was standardized by NIST, ANSI, and ISO among other algorithms to generate pseudorandom numbers. For a long time this algorithm was considered suspicious -- the entity designing the algorithm could have
Energy Technology Data Exchange (ETDEWEB)
Midorikawa, Takashi; Ishii, Masao; Sasano, Daisuke; Kosugi, Naohiro (Geochemical Research Dept., Meteorological Research Institute Tsukuba (Japan)), e-mail: midorika@mri-jma.go.jp; Saito, Shu (Geochemical Research Dept., Meteorological Research Institute, Tsukuba (Japan); Institute of Observational Research for Global Change (IORGC), Japan Agency for Marine-Earth Science and Technology (JAMSTEC), Yokosuka (Japan)); Motoi, Tatsuo (Oceanographic Research Dept., Meteorological Research Institute, Tsukuba (Japan)); Kamiya, Hitomi; Nakadate, Akira; Nemoto, Kazuhiro (Global Environment and Marine Dept., Japan Meteorological Agency, Tokyo (Japan)); Inoue, Hisayuki Y. (Graduate School of Environmental Earth Science, Hokkaido Univ., Sapporo (Japan))
2010-11-15
We estimated long-term trends of ocean acidification in surface waters in latitudinal zones from 3 deg N to 33 deg N along the repeat hydrographic line at 137 deg E in the western North Pacific Ocean. Estimates were based on the observational records of oceanic CO{sub 2} partial pressure and related surface properties over the last two decades. The computed pH time series both for 25 yr in winter (late January to early February) and for 21 yr in summer (June-July) exhibited significant decreasing trends in the extensive subtropical to equatorial zones, with interannual variations that were larger in summer. The calculated rates of pH decrease ranged from 0.0015 to 0.0021 yr-1 (average, 0.0018 +- 0.0002 yr-1) in winter and from 0.0008 to 0.0019 yr-1 (average, 0.0013 +- 0.0005 yr-1 ) in summer. The thermodynamic effects of rising sea surface temperature (SST) accounted for up to 44% (average, 15%) of the trend of pH decrease in the subtropical region in winter, whereas a trend of decreasing SST slowed the pH decrease in the northern subtropical region (around 25 deg N) in summer. We used the results from recent trends to evaluate future possible thermodynamic changes in the upper ocean carbonate system
GPM GROUND VALIDATION ENVIRONMENT CANADA (EC) MICRO RAIN RADAR (MRR) GCPEX V1
National Aeronautics and Space Administration — Environment Canada (EC) collected data from the Micro Rain Radar (MRR) during the GPM Cold-season Precipitation Experiment (GCPEx) in Ontario, Canada during the...
Horvath, A; Dziechciarz, P; Szajewska, H
2011-06-01
A lack of reliable treatments for abdominal pain-related functional gastrointestinal disorders prompts interest in new therapies. To evaluate systematically the effect of Lactobacillus rhamnosus GG (LGG) for treating abdominal pain-related functional gastrointestinal disorders in children. MEDLINE, EMBASE, CINAHL, the Cochrane Library, trial registries and proceedings of major meetings were searched for randomised controlled trials (RCTs) evaluating LGG supplementation in children with abdominal pain-related functional gastrointestinal disorders based on the Rome II or Rome III criteria. Risk of bias was assessed for generation of the allocation sequence, allocation concealment, blinding and follow-up. Compared with placebo, LGG supplementation was associated with a significantly higher rate of treatment responders (defined as no pain or a decrease in pain intensity) in the overall population with abdominal pain-related functional gastrointestinal disorders (three RCTs, n = 290; risk ratio, RR 1.31, 95% CI 1.08-1.59, number needed to treat, NNT 7, 95% CI 4-22) and in the irritable bowel syndrome (IBS) subgroup (three RCTs, n = 167; RR 1.70, 95% CI 1.27-2.27, NNT 4, 95% CI 3-8). However, no difference was found in the rate of treatment responders between children with functional abdominal pain or functional dyspepsia who received placebo or LGG. The intensity of pain was significantly reduced in the overall study population and in the IBS subgroup. The frequency of pain was significantly reduced in the IBS subgroup only. The use of Lactobacillus rhamnosus GG moderately increases treatment success in children with abdominal pain-related functional gastrointestinal disorders, particularly among children with IBS. © 2011 Blackwell Publishing Ltd.
International Nuclear Information System (INIS)
Chen Jie; Lu Xueguan; Tang Jun; Fan Wo
2005-01-01
Objective: To evaluate the correlation between 99 Tc m -ethylene dicysteinc-metronidazaole ( 99 Tc M -EC-MNZ) SPECT imaging and the expression of hypoxia inducible factor-1α (HIF-1α) in tumor tissue. Methods: Twelve S180 sarcoma-bearing Kunming mice tumor models were established. Hypoxic imaging was obtained by SPECT with 99 Tc m -EC-MNZ and the corresponding tumor/muscle ratios (T/M) were measured. Then the animals were sacrificed and the tumor specimen was resected, the expression of HIF-1α and vascular endothelial growth factor (VEGF) was measured by immunohistochemistry. Results: Three hours after injection of 99 Tc m -EC-MNZ, the T/M ranged from 1.93 to 4.46 (median 3.13). The expression of HIF-1α ranged from 31.2% to 60.8% (median 50.4%) and was linearly correlated with the T/M (t=2.732, r=0.654, P=0.021). The expression of VEGF ranged from 33.8% to 57.5% (median 53.1%) and also linearly correlated with the expression of HIF-1α (t=3.011, r=0.690, P=0.0131). Conclusions: There is linear correlation between 99 Tc m -EC-MNZ hypoxic SPECT imaging and the expression of HIF-1α. Combining them can reliably reflect the hypoxic status of the tumor. (authors)
Energy Technology Data Exchange (ETDEWEB)
Aaltonen, T.; Abazov, V.M.; Abbott, B.; Abolins, M.; Acharya, B.S.; Adams, M.; Adams, T.; Adelman, J.; Aguilo, E.; Alexeev, G.D.; Alkhazov, G.; /Helsinki Inst. of Phys. /Dubna, JINR /Oklahoma U. /Michigan State U. /Tata Inst. /Illinois U., Chicago /Florida State U. /Chicago U., EFI /Simon Fraser U. /York U., Canada /St. Petersburg, INP /Illinois U., Urbana /Sao Paulo, IFT /Munich U. /University Coll. London /Oxford U. /St. Petersburg, INP /Duke U. /Kyungpook Natl. U. /Chonnam Natl. U. /Florida U. /Osaka City U.
2010-05-01
We combine results from searches by the CDF and D0 collaborations for a standard model Higgs boson (H) in the process gg {yields} H {yields} W{sup +}W{sup -} in p{bar p} collisions at the Fermilab Tevatron Collider at {radical}s = 1.o6 TeV. With 4.8 fb{sup -1} of itnegrated luminosity analyzed at CDF and 5.4 fb{sup -1} at D0, the 95% Confidence Level upper limit on {sigma}(gg {yields} H) x {Beta}(H {yields} W{sup +}W{sup -}) is 1.75 pb at m{sub H} = 120 GeV, 0.38 pb at m{sub H} = 165 GeV, and 0.83 pb at m{sub H} = 200 GeV. Assuming the presence of a fourth sequential generation of fermions with large masses, they exclude at the 95% Confidence Level a standard-model-like Higgs boson with a mass between 131 and 204 Gev.
Claes, I.J.; Schoofs, G.; Regulski, K.; Vos, de W.M.
2012-01-01
Lactobacillus rhamnosus GG (LGG) produces two major secreted proteins, designated here Msp1 (LGG_00324 or p75) and Msp2 (LGG_00031 or p40), which have been reported to promote the survival and growth of intestinal epithelial cells. Intriguingly, although each of these proteins shares homology with
Demonstration of sawtooth period control with EC waves in KSTAR plasma
Directory of Open Access Journals (Sweden)
Jeong J. H.
2015-01-01
Full Text Available The sawtooth period control in tokamak is important issue in recent years because the sawtooth crash can trigger TM/NTM instabilities and drive plasmas unstable. The control of sawtooth period by the modification of local current profile near the q=1 surface using ECCD has been demonstrated in a number of tokamaks [1, 2] including KSTAR. As a result, developing techniques to control the sawtooth period as a way of controlling the onset of NTM has been an important area of research in recent years [3]. In 2012 KSTAR plasma campaign, the sawtooth period control is carried out by the different deposition position of EC waves across the q=1 surface. The sawtooth period is shortened by on-axis co-ECCD (destabilization, and the stabilization of the sawtooth is also observed by off-axis co-ECCD at outside q=1 surface. In 2013 KSTAR plasma campaign, the sawtooth locking experiment with periodic forcing of 170 GHz EC wave is carried out to control the sawtooth period. The optimal target position which lengthens the sawtooth period is investigated by performing a scan of EC beam deposition position nearby q=1 surface at the toroidal magnetic field of 2.9 T and plasma current of 0.7 MA. The sawtooth locking by the modulated EC beam is successfully demonstrated as in [3-5] with the scan of modulation-frequency and duty-ratio at the low beta (βN~0.5 plasma. In this paper, the sawteeth behavior by the location of EC beam and the preliminary result of the sawtooth locking experiments in KSTAR will be presented.
Vliet, Jurg
2011-01-01
If you plan to use Amazon Web Services to run applications in the cloud, the end-to-end approach in this book will save you needless trial and error. You'll find practical guidelines for designing and building applications with Amazon Elastic Compute Cloud (EC2) and a host of supporting AWS tools, with a focus on critical issues such as load balancing, monitoring, and automation. How do you move an existing application to AWS, or design your application so that it scales effectively? How much storage will you require? Programming Amazon EC2 not only helps you get started, it will also keep y
CLARA-A1: a cloud, albedo, and radiation dataset from 28 yr of global AVHRR data
Directory of Open Access Journals (Sweden)
K.-G. Karlsson
2013-05-01
Full Text Available A new satellite-derived climate dataset – denoted CLARA-A1 ("The CM SAF cLoud, Albedo and RAdiation dataset from AVHRR data" – is described. The dataset covers the 28 yr period from 1982 until 2009 and consists of cloud, surface albedo, and radiation budget products derived from the AVHRR (Advanced Very High Resolution Radiometer sensor carried by polar-orbiting operational meteorological satellites. Its content, anticipated accuracies, limitations, and potential applications are described. The dataset is produced by the EUMETSAT Climate Monitoring Satellite Application Facility (CM SAF project. The dataset has its strengths in the long duration, its foundation upon a homogenized AVHRR radiance data record, and in some unique features, e.g. the availability of 28 yr of summer surface albedo and cloudiness parameters over the polar regions. Quality characteristics are also well investigated and particularly useful results can be found over the tropics, mid to high latitudes and over nearly all oceanic areas. Being the first CM SAF dataset of its kind, an intensive evaluation of the quality of the datasets was performed and major findings with regard to merits and shortcomings of the datasets are reported. However, the CM SAF's long-term commitment to perform two additional reprocessing events within the time frame 2013–2018 will allow proper handling of limitations as well as upgrading the dataset with new features (e.g. uncertainty estimates and extension of the temporal coverage.
Chen, Y.; Cheng, Y.F.; Nordmann, S.; Birmili, W.; Denier Van Der Gon, H.A.C.; Ma, N.; Wolke, R.; Wehner, B.; Sun, J.; Spindler, G.; Mu, Q.; Pöschl, U.; Su, H.; Wiedensohler, A.
2016-01-01
Elemental Carbon (EC) has a significant impact on human health and climate change. In order to evaluate the size segregation of EC emission in the EUCAARI inventory and investigate its influence on the simulation of EC long-range transportation in Europe, we used the fully coupled online Weather
Max Andersen, Marie Louise; Nielsen, Lotte B; Svensson, Jannet; Pörksen, Sven; Hougaard, Philip; Beam, Craig; Greenbaum, Carla; Becker, Dorothy; Petersen, Jacob S; Hansen, Lars; Mortensen, Henrik B
2014-08-01
To clarify whether the rate of decline in stimulated C-peptide (SCP) from 2 to 15 months after diagnosis has changed over an interval of 27 yr. The rate of decline in SCP levels at 1, 2, 3, 6, 9, 12, and 15 months after diagnosis was compared in four paediatric cohorts from Scandinavian and European countries including 446 children with new onset type 1 diabetes (T1D, 1982-2004). Findings were evaluated against 78 children (2004-2009) from the TrialNet studies. The mean rate of decline [%/month (±SEM)] in SCP for a 10-yr-old child was 7.7%/month (±1.5) in the 1982-1985 Cohort, 6.3%/month (±1.7) in the 1995-1998 Cohort, 7.8%/month (±0.7) in the 1999-2000 Cohort, and 10.7%/month (±0.9) in the latest 2004-2005 Cohort (p = 0.05). Including the TrialNet Cohort with a rate of decline in SCP of 10.0%/month (±0.9) the differences between the cohorts are still significant (p = 0.039). The rate of decline in SCP was negatively associated with age (p < 0.0001), insulin antibodies (IA) (p = 0.003), and glutamic acid decarboxylase-65 (GAD65A) (p = 0.03) initially with no statistically significant effect of body mass index (BMI) Z-score at 3 months. Also, at 3 months the time around partial remission, the effect of age on SCP was significantly greater in children ≤5 yr compared with older children (p ≤ 0.0001). During the past 27 yr, initial C-peptide as well as the rate of C-peptide decline seem to have increased. The rate of decline was affected significantly by age, GAD65A, and IA, but not BMI Z-score or initial C-peptide. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Yr10 gene polymorphism in bread wheat varieties | Temel | African ...
African Journals Online (AJOL)
Yellow rust resistance locus Yr10 located on chromosome 1B in Moro and originated from the Turkish line PI178383 was investigated in terms of polymorphism in seven winter type bread wheat cvs. (Triticum aestivum ssp. Aestivum) Altay2000, zgi2001, Sönmez2001 (yellow rust resistant), Aytýn98, ES14, Harmankaya99 ...
The EC discourse on vocational training
DEFF Research Database (Denmark)
Cort, Pia
2009-01-01
This article traces the EC vocational training policy historically and describes the discursive alignments which brought the policy from a ‘common vocational training policy' as laid down in Article 128, in the Treaty of Rome to the Lisbon Lifelong Learning strategy. The argument is that vocational...... EC vocational training policy (Ball, What is policy? Texts, trajectories and toolboxes. Discourse, 13(2), 1993)....
Finite impulse testing (FIT) system for Emergency Cooling System (ECS) in Dhruva
International Nuclear Information System (INIS)
Punekar, Parag; Ramkumar, N.; Kulkarni, U.S.; Darbhea, M.D.; Bharadhwaj, G; Jangra, L.R.; Geetha, Patil; Das, Shantanu; Sonnis, S.T.; Trevedi, P.; Patil, M.B.; Biswas, B.B.
2006-01-01
Finite Impulse Testing (FIT) system for Emergency Cooling System (ECS) is used to check healthiness of ECS logic circuits in an online mode. The ECS is an important safety system that ensures the cooling of reactor core during shutdown state of Main Coolant Pumps (MCPs), and hence FIT-ECS that monitors the health of ECS logic circuits in an online (real time) mode is an important part of it. Based on a Safety Related Unusual Occurrence in ECS system due to the malfunction of its earlier single channel FIT system, the new FIT-ECS system has been designed with new features and is commissioned. The FIT-ECS system feeds the simulated input signals (fine impulses of nominal width 575 μS) to the ECS logic circuits and read the outputs. These output (predicted) signals from ECS logic circuit are processed in the FIT-ECS system and in event of any discrepancy, the FIT-ECS system displays fault signature on local panel, detailed information of the fault on Operator Console (OC), and generates an alarm 'ECS logic Fail' in the control room. FIT-ECS also monitors the inputs and outputs of ECS logic circuit. All the information required is stored as a database that can be subsequently displayed in various formats. ECS system is designated as Category I-A system and is a hardwired system and FIT-ECS monitors the healthiness of the logics of the ECS System is a computerized system. As per IEC 1226, FIT-ECS is categorized as Category I-B system. This paper provides technical information on FIT-ECS system design, its important features, the testing carried on the FIT-ECS system, interconnections of FIT-ECS and ECS and the commissioning experience of FIT-ECS system. (author)
Vasilchenko, Alexey S; Yuryev, Mikhail; Ryazantsev, Dmitry Yu; Zavriev, Sergey K; Feofanov, Alexey V; Grishin, Eugene V; Rogozhin, Eugene A
2016-11-01
An interaction of recombinant hairpin-like cationic peptide EcAMP1 with conidia of plant pathogenic fungus Fusarium solani at the cellular level was studied by a combination of microscopic methods. EcAMP1 is from barnyard grass (Echinochloa crusgalli L.), and obtained by heterologous expression in Escherichia coli system. As a result, a direct relationship between hyphal growth inhibition and increasing active peptide concentration, time of incubation and fungal physiological condition has been determined. Dynamics of accumulation and redistribution of the peptide studied on fungal cellular cover and inside the conidia cells has been shown. The dynamics are dependent on time of coupling, as well as, a dissimilarity of EcAMP1 binding with cover of fungal conidia and its stepwise accumulation and diffuse localization in the cytoplasm. Correlation between structural disruption of fungal conidia and the presence of morphological changes has also been found. The correlation was found under the influence of peptide high concentrations at concentrations above 32 μM. The results indicate the presence of a binding of EcAMP1 with the surface of fungal conidia, thus, demonstrating a main specificity for its antifungal action at the cellular level. These results, however, cannot exclude the existence of attendant EcAMP1 action based on its intracellular localization on some specific targets. SCANNING 38:591-598, 2016. © 2016 Wiley Periodicals, Inc. © Wiley Periodicals, Inc.
Usefulness of L,L-ethylenedicysteine - 99mTc complex (EC-99mTc) for the kidney investigations
International Nuclear Information System (INIS)
Surma, M.J.; Wiewiora, J.; Kapuscinksi, J.; Liniecki, J.
1992-01-01
To assess the usefulness of own EC- 99m Tc complex for the kidney function examination, the renoscintigraphy with EC- 99m Tc and clearance determinations were performed. During renoscintigraphy the kidney images were of superb quality, with overlaying organs (liver, spleen) not visualized. Renograms showed typical shapes, their TMAX and T1/2 values being insignificantly different from the obtained with other radiopharmaceuticals, used in renoscintigraphy (MAG 3 , hippuran). Very strict correlations were found between values of EC- 99m Tc and OIH- 131 I clearances (r=0.91) and excretion rate constants (r=0.92) of both radiopharmaceuticals. The correlation enabled formulation of an equation by which ERPF could be established from EC- 99m Tc clearance: ERPF OIH =1.245 x Cl EC +51.52. On the basis of this equation a lower boundary of the normal EC- 99m Tc clearance was established; it amounts to 300 ml/min/1.73 m 2 . (author). 17 refs, 5 figs, 1 tab
Lymphocyte adhesion to endothelial cell (EC) is stimulated by phorbol esters
International Nuclear Information System (INIS)
Haskard, D.; Cavender, D.; Ziff, M.
1986-01-01
The effect of phorbol esters on T cell adhesion to EC has been studied. The phorbol esters 12-0-tetradecanoyl-phorbol-13-acetate and 4-beta-phorbol-12-13-dibutyrate, but not the biologically inert 4-0-methyl-phorbol-12-13-didecanoate strongly increased the binding of 51 Cr-labeled T cells to human umbilical vein EC monolayers in microtiter wells. Increase in binding was observed at 0.3 ng/ml with maximal enhancement at 50 ng/ml. Both unstimulated and phorbol ester activated T cells displayed a substantially greater binding affinity for EC than for fibroblasts or plastic. Binding enhancement occurred within one minute, with maximal increase after 15 min. Preincubation studies showed that binding enhancement was entirely attributable to an effect on T cells, with no action on EC. Additive binding enhancement was seen when phorbol esters and reagents that increase adhesion by actions on EC (LPS, IL-1 and IFN-γ) were used together. Increase in adhesion of activated T lymphocytes to EC may explain the greater emigration of activated T cells than small resting T cells into inflammatory foci in vivo. The rapid onset of the phorbol effect suggests that this may be an important mechanism for immediate localization of circulating T cells in the cellular immune response, activated, perhaps, at the endothelial blood-tissue interface
Energy Technology Data Exchange (ETDEWEB)
Anon.
2010-12-15
Meanwhile, the EC motor technology is the state of the art in fans. In the consciousness of a possible energy conservation, the EC motor technology is demanded to a large extent with the new installations of the customers. But how high are the possible savings actually? A comparative measurement at a condenser of Guentner AG (Fuerstenfeldbruck, Federal Republic of Germany) supports information.
Oksaharju, Anna; Kooistra, Teake; Kleemann, Robert; van Duyvenvoorde, Wim; Miettinen, Minja; Lappalainen, Jani; Lindstedt, Ken A; Kovanen, Petri T; Korpela, Riitta; Kekkonen, Riina A
2013-07-14
A high-fat diet disturbs the composition and function of the gut microbiota and generates local gut-associated and also systemic responses. Intestinal mast cells, for their part, secrete mediators which play a role in the orchestration of physiological and immunological functions of the intestine. Probiotic bacteria, again, help to maintain the homeostasis of the gut microbiota by protecting the gut epithelium and regulating the local immune system. In the present study, we explored the effects of two probiotic bacteria, Lactobacillus rhamnosus GG (GG) and Propionibacterium freudenreichii spp. shermanii JS (PJS), on high fat-fed ApoE*3Leiden mice by estimating the mast cell numbers and the immunoreactivity of TNF-α and IL-10 in the intestine, as well as plasma levels of several markers of inflammation and parameters of lipid metabolism. We found that mice that received GG and PJS exhibited significantly lower numbers of intestinal mast cells compared with control mice. PJS lowered intestinal immunoreactivity of TNF-α, while GG increased intestinal IL-10. PJS was also observed to lower the plasma levels of markers of inflammation including vascular cell adhesion molecule 1, and also the amount of gonadal adipose tissue. GG lowered alanine aminotransferase, a marker of hepatocellular activation. Collectively, these data demonstrate that probiotic GG and PJS tend to down-regulate both intestinal and systemic pro-inflammatory changes induced by a high-fat diet in this humanised mouse model.
EcPV2 DNA in equine genital squamous cell carcinomas and normal genital mucosa.
Bogaert, Lies; Willemsen, Anouk; Vanderstraeten, Eva; Bracho, Maria A; De Baere, Cindy; Bravo, Ignacio G; Martens, Ann
2012-07-06
Squamous cell carcinoma (SCC) represents the most common genital malignant tumor in horses. Similar to humans, papillomaviruses (PVs) have been proposed as etiological agents and recently Equine papillomavirus type 2 (EcPV2) has been identified in a subset of genital SCCs. The goals of this study were (1) to determine the prevalence of EcPV2 DNA in tissue samples from equine genital SCCs, penile intraepithelial neoplasia (PIN) and penile papillomas, using EcPV2-specific PCR, (2) to examine the prevalence of latent EcPV2 infection in healthy genital mucosa and (3) to determine genetic variability within EcPV2 and to disentangle phylogenetic relationships of EcPV2 among PVs. EcPV2 DNA was detected in all but one penile SCC (15/16), in all PIN lesions (8/8) and penile papillomas (4/4). Additionally, EcPV2 DNA was demonstrated in one of two metastasized lymph nodes, one contact metastasis in the mouth, two vaginal and one anal lesion. In healthy horses, EcPV2 DNA was detected in 10% (4/39) of penile swabs but in none of vulvovaginal swabs (0/20). This study confirms the presence of EcPV2 DNA in equine genital SCCs and shows its involvement in anal lesions, a lymph node and contact metastases. Latent EcPV2 presence was also shown in normal male genital mucosa. We found that different EcPV2 variants cocirculate among horses and that EcPV2 is related to the Delta+Zeta PVs and is only a very distant relative of high-risk human PVs causing genital cancer. Thus, similar viral tropism and similar malignant outcome of the infection do not imply close evolutionary relationship. Copyright © 2012 Elsevier B.V. All rights reserved.
Ganguli, Kriston; Collado, Maria Carmen; Rautava, Jaana; Lu, Lei; Satokari, Reetta; von Ossowski, Ingemar; Reunanen, Justus; de Vos, Willem M.; Palva, Airi; Isolauri, Erika; Salminen, Seppo; Walker, W. Allan; Rautava, Samuli
2015-01-01
Background Bacterial contact in utero modulates fetal and neonatal immune responses. Maternal probiotic supplementation reduces the risk of immune-mediated disease in the infant. We investigated the immunomodulatory properties of live Lactobacillus rhamnosus GG and its SpaC pilus adhesin in human fetal intestinal models. Methods TNF-α mRNA expression was measured by qPCR in a human fetal intestinal organ culture model exposed to live L. rhamnosus GG and proinflammatory stimuli. Binding of recombinant SpaC pilus protein to intestinal epithelial cells was assessed in human fetal intestinal organ culture and the human fetal intestinal epithelial cell line H4 by immunohistochemistry and immunofluorescence, respectively. TLR-related gene expression in fetal ileal organ culture after exposure to recombinant SpaC was assessed by qPCR. Results Live L. rhamnosus GG significantly attenuates pathogen-induced TNF-α mRNA expression in the human fetal gut. Recombinant SpaC protein was found to adhere to the fetal gut and to modulate varying levels of TLR-related gene expression. Conclusion The human fetal gut is responsive to luminal microbes. L. rhamnosus GG significantly attenuates fetal intestinal inflammatory responses to pathogenic bacteria. The L. rhamnosus GG pilus adhesin SpaC binds to immature human intestinal epithelial cells and directly modulates intestinal epithelial cell innate immune gene expression. PMID:25580735
Energy Technology Data Exchange (ETDEWEB)
Wang, Xingchang; Wang, Chuankuan; Bond-Lamberty, Benjamin
2017-12-15
Carbon dioxide (CO2) fluxes between terrestrial ecosystems and the atmosphere are primarily measured with eddy covariance (EC), biometric, and chamber methods. However, it is unclear why the estimates of CO2-fluxes, when measured using these different methods, converge at some sites but diverge at others. We synthesized a novel global dataset of forest CO2-fluxes to evaluate the consistency between EC and biometric or chamber methods for quantifying CO2 budget in forests. The EC approach, comparing with the other two methods, tended to produce 25% higher estimate of net ecosystem production (NEP, 0.52Mg C ha-1 yr-1), mainly resulting from lower EC-estimated Re; 10% lower ecosystem respiration (Re, 1.39Mg C ha-1 yr-1); and 3% lower gross primary production (0.48 Mg C ha-1 yr-1) The discrepancies between EC and the other methods were higher at sites with complex topography and dense canopies versus those with flat topography and open canopies. Forest age also influenced the discrepancy through the change of leaf area index. The open-path EC system induced >50% of the discrepancy in NEP, presumably due to its surface heating effect. These results provided strong evidence that EC produces biased estimates of NEP and Re in forest ecosystems. A global extrapolation suggested that the discrepancies in CO2 fluxes between methods were consistent with a global underestimation of Re, and overestimation of NEP, by the EC method. Accounting for these discrepancies would substantially improve the our estimates of the terrestrial carbon budget .
Ossowski, von I.; Vos, de W.M.; Palva, A.
2011-01-01
In spite of the wealth of clinical evidence supporting the health benefits of Lactobacillus rhamnosus GG in humans, there is still a lack of understanding of the molecular mechanisms behind its probiosis. Current knowledge suggests that the health-promoting effects of this probiotic strain might be
Directory of Open Access Journals (Sweden)
S.V. Belmer
2011-01-01
Full Text Available Normal intestinal microflora is necessary for human health. Sour milk products influence the composition and functional state of intestinal micro flora. Multiple studies showed high probiotic activity of Lactobacillus rhamnosus GG (ATCC 53103, LGG and its safety in children and adults. LGG has beneficial effect on functional disorders of intestinal motor function, and in treatment of allergic and inflammatory diseases. These effects are realized through TLR2 receptors activating NFkB-mediated signal way and regulating cytokines synthesis. Besides, LGG blocks interaction of mast cells and IgE and favors to the expression of H4 histamine receptors. LGG (ATCC 53103 are included in liquid yoghurts («Tyoma» for children from 8 months old, kefir, tan, cottage cheese and other food produced by Bio Balance.Key words: children, nutrition, Lactobacillus rhamnosus GG, probiotics, sour milk products, food allergy.(Voprosy sovremennoi pediatrii — Current Pediatrics. 2011; 10 (3: 80–85
Energy Technology Data Exchange (ETDEWEB)
Ahnert, C; Aragones, J M
1981-07-01
This Is a users manual of the neutron transport code TWOTRAN-TRACA, which is a version of the original TWOTRAN-GG from the Los Alamos Laboratory, with some modifications made at JEN. A detailed input data description is given as well as the new modifications developed at JEN. (Author) 8 refs.
Mishra, Arjun K; Megta, Abhin Kumar; Palva, Airi; von Ossowski, Ingemar; Krishnan, Vengadesan
2017-06-01
SpaE is the predicted basal pilin subunit in the sortase-dependent SpaFED pilus from the gut-adapted and commensal Lactobacillus rhamnosus GG. Thus far, structural characterization of the cell-wall-anchoring basal pilins has remained difficult and has been limited to only a few examples from pathogenic genera and species. To gain a further structural understanding of the molecular mechanisms that are involved in the anchoring and assembly of sortase-dependent pili in less harmful bacteria, L. rhamnosus GG SpaE for crystallization was produced by recombinant expression in Escherichia coli. Although several attempts to crystallize the SpaE protein were unsuccessful, trigonal crystals that diffracted to a resolution of 3.1 Å were eventually produced using PEG 3350 as a precipitant and high protein concentrations. Further optimization with a combination of additives led to the generation of SpaE crystals in an orthorhombic form that diffracted to a higher resolution of 1.5 Å. To expedite structure determination by SAD phasing, selenium-substituted (orthorhombic) SpaE crystals were grown and X-ray diffraction data were collected to 1.8 Å resolution.
Development of EC technology in JAERI
International Nuclear Information System (INIS)
Sakamoto, Keishi; Takahashi, Koji; Kasugai, Atsushi; Hayashi, Kenichi; Ikeda, Yoshitaka; Kajiwara, Ken; Fujii, Tsuneyuki; Imai, Tsuyoshi; Kariya, Tsuyoshi; Mitsunaka, Yoshika
2003-01-01
Recent progress of electron cyclotron (EC) heating and current drive technologies in JAERI is reported. In 170 GHz gyrotron development, 0.9 MW/9.2 sec (efficiency: 43%), 0.5 MW/30 sec (46%), etc, have been demonstrated. As for 110 GHz gyrotron, 1 MW/5 sec and 1.2 MW/4.1 sec were obtained. Using four 110 GHz gyrotrons, a 3 MW power injection into JT- 60U plasma was carried out. In parallel, a launcher design and its development that includes neutron irradiation of the launcher components and a remote steering launcher are underway for ITER application. (authors)
ESCAPE: an integrated climate model for the EC
International Nuclear Information System (INIS)
Rotmans, J.
1992-01-01
A framework has been developed for the evaluation of policy options for climate change, called ESCAPE (Evaluation of Strategies to address Climate change by Adapting to and Preventing Emissions). ESCAPE consists of a suite of linked models which enables scenarios of greenhouse gas emissions to be constructed and their impact on global and regional climate and sea level and sectors of the European economy to be assessed. Conclusions resulting from simulations with the ESCAPE 1.1 model include: the major problem of a climate change for the EC is a sea level rise; Greece, Italy, Portugal and Spain will be faced with higher costs in the agricultural sector; worldwide implementation of an EC carbon tax leads to about 12% lower worldwide CO 2 emissions; to stabilize CO 2 emissions an Ecotax of 18 dollars per barrel would be required; and in all cases the rate of global temperature increase will be above the rate of 0.1 degree C per decade for the coming 40 years. 2 figs
Holm, Guerry O.; Perez, Brian C.; McWhorter, David E.; Krauss, Ken W.; Johnson, Darren J.; Raynie, Richard C.; Killebrew, Charles J.
2016-01-01
Sulfate from seawater inhibits methane production in tidal wetlands, and by extension, salinity has been used as a general predictor of methane emissions. With the need to reduce methane flux uncertainties from tidal wetlands, eddy covariance (EC) techniques provide an integrated methane budget. The goals of this study were to: 1) establish methane emissions from natural, freshwater and brackish wetlands in Louisiana based on EC; and 2) determine if EC estimates conform to a methane-salinity relationship derived from temperate tidal wetlands with chamber sampling. Annual estimates of methane emissions from this study were 62.3 g CH4/m2/yr and 13.8 g CH4/m2/yr for the freshwater and brackish (8–10 psu) sites, respectively. If it is assumed that long-term, annual soil carbon sequestration rates of natural marshes are ~200 g C/m2/yr (7.3 tCO2e/ha/yr), healthy brackish marshes could be expected to act as a net radiative sink, equivalent to less than one-half the soil carbon accumulation rate after subtracting methane emissions (4.1 tCO2e/ha/yr). Carbon sequestration rates would need case-by-case assessment, but the EC methane emissions estimates in this study conformed well to an existing salinity-methane model that should serve as a basis for establishing emission factors for wetland carbon offset projects.
Mismatch between observed and modeled trends in dissolved upper-ocean oxygen over the last 50 yr
Directory of Open Access Journals (Sweden)
L. Stramma
2012-10-01
Full Text Available Observations and model runs indicate trends in dissolved oxygen (DO associated with current and ongoing global warming. However, a large-scale observation-to-model comparison has been missing and is presented here. This study presents a first global compilation of DO measurements covering the last 50 yr. It shows declining upper-ocean DO levels in many regions, especially the tropical oceans, whereas areas with increasing trends are found in the subtropics and in some subpolar regions. For the Atlantic Ocean south of 20° N, the DO history could even be extended back to about 70 yr, showing decreasing DO in the subtropical South Atlantic. The global mean DO trend between 50° S and 50° N at 300 dbar for the period 1960 to 2010 is –0.066 μmol kg−1 yr−1. Results of a numerical biogeochemical Earth system model reveal that the magnitude of the observed change is consistent with CO2-induced climate change. However, the pattern correlation between simulated and observed patterns of past DO change is negative, indicating that the model does not correctly reproduce the processes responsible for observed regional oxygen changes in the past 50 yr. A negative pattern correlation is also obtained for model configurations with particularly low and particularly high diapycnal mixing, for a configuration that assumes a CO2-induced enhancement of the C : N ratios of exported organic matter and irrespective of whether climatological or realistic winds from reanalysis products are used to force the model. Depending on the model configuration the 300 dbar DO trend between 50° S and 50° N is −0.027 to –0.047 μmol kg−1 yr−1 for climatological wind forcing, with a much larger range of –0.083 to +0.027 μmol kg−1 yr−1 for different initializations of sensitivity runs with reanalysis wind forcing. Although numerical models reproduce the overall sign and, to
The three-loop splitting functions P{sup (2)}{sub qg} and P{sup (2,N{sub F})}{sub gg}
Energy Technology Data Exchange (ETDEWEB)
Ablinger, J.; Schneider, C. [Johannes Kepler Univ., Linz (Austria). Research Inst. for Symbolic Computation (RISC); Behring, A. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); RWTH Aachen Univ. (Germany). Inst. fuer Theoretische Teilchenphysik und Kosmologie; Bluemlein, J.; Freitas, A. de [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Von Manteuffel, A. [Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy
2017-04-15
We calculate the unpolarized twist-2 three-loop splitting functions P{sup (2)}{sub qg}(x) and P{sup (2,N{sub F})}{sub gg}(x) and the associated anomalous dimensions using massive three-loop operator matrix elements. While we calculate P{sup (2,N{sub F})}{sub gg}(x) directly, P{sup (2)}{sub qg}(x) is computed from 1200 even moments, without any structural prejudice, using a hierarchy of recurrences obtained for the corresponding operator matrix element. The largest recurrence to be solved is of order 12 and degree 191. We confirm results in the foregoing literature.
Energy Technology Data Exchange (ETDEWEB)
Dupin, F. [DVGW Deutscher Verein des Gas- und Wasserfaches e.V., Bonn (Germany)
1998-08-01
For now nearly ten years the EC-directive 90/396/EEC is well established in the gas field. In the meantime other EC-directives are playing a role which cannot be left out of consideration. Particularly the EC-Construction Product Directive (89/106/EEC) and the Pressure Equipment Directive (97/23/EG) constitute a focal point as many key-issues (e.g. scope) are still open, causing thus hotly debated discussions. The present contribution reflects the current consultations at the national and European level, pointing out then the gas-specific features. (orig.) [Deutsch] Seit nahezu zehn Jahren hat sich die EG-Richtlinie 90/396/EWG fuer Gasverbrauchseinrichtungen im europaeischen Gasfach fest etabliert. Inzwischen sind andere EG-Richtlinien ins Spiel gekommen, deren Einfluss nicht ausser Acht gelassen werden kann. Besonders die EG-Bauproduktenrichtlinie (89/106/EWG) und die EG-Druckgeraeterichtlinie (97/23/EG) stehen z.Z. im Mittelpunkt, da viele Schluesselfragen (z.B. Geltungsbereich) noch offen sind und heftige Debatten mit sich bringen. Der vorliegende Beitrag gibt den Stand der auf nationaler und europaeischer Ebene gefuehrten Beratungen wieder und stellt dabei die gasspezifischen Gegebenheiten heraus. (orig.)
Rossman, Matthew J; Kaplon, Rachelle E; Hill, Sierra D; McNamara, Molly N; Santos-Parker, Jessica R; Pierce, Gary L; Seals, Douglas R; Donato, Anthony J
2017-11-01
Cellular senescence is emerging as a key mechanism of age-related vascular endothelial dysfunction, but evidence in healthy humans is lacking. Moreover, the influence of lifestyle factors such as habitual exercise on endothelial cell (EC) senescence is unknown. We tested the hypothesis that EC senescence increases with sedentary, but not physically active, aging and is associated with vascular endothelial dysfunction. Protein expression (quantitative immunofluorescence) of p53, a transcription factor related to increased cellular senescence, and the cyclin-dependent kinase inhibitors p21 and p16 were 116%, 119%, and 128% greater (all P age-related differences were not present (all P > 0.05) in venous ECs from older exercising adults (57 ± 1 yr, n = 13). Furthermore, venous EC protein levels of p53 ( r = -0.49, P = 0.003), p21 ( r = -0.38, P = 0.03), and p16 ( r = -0.58, P = 0.002) were inversely associated with vascular endothelial function (brachial artery flow-mediated dilation). Similarly, protein expression of p53 and p21 was 26% and 23% higher (both P healthy older sedentary (63 ± 1 yr, n = 18) versus young sedentary (25 ± 1 yr, n = 9) adults; age-related changes in arterial EC p53 and p21 expression were not observed ( P > 0.05) in older habitually exercising adults (59 ± 1 yr, n = 14). These data indicate that EC senescence is associated with sedentary aging and is linked to endothelial dysfunction. Moreover, these data suggest that prevention of EC senescence may be one mechanism by which aerobic exercise protects against endothelial dysfunction with age. NEW & NOTEWORTHY Our study provides novel evidence in humans of increased endothelial cell senescence with sedentary aging, which is associated with impaired vascular endothelial function. Furthermore, our data suggest an absence of age-related increases in endothelial cell senescence in older exercising adults, which is linked with preserved vascular endothelial function
Directory of Open Access Journals (Sweden)
V. F. Uchaikin
2015-01-01
Full Text Available In 60 patients with moderate forms of the OCI «osmotic» (76.7% and «invasive» (23.3% such as diarrhea, aged 3—12 years, to evaluate the clinical effectiveness, impact on water and electrolyte metabolism, acid-base balance and intestinal microbiocenosis hypoosmolyarny solution with Lactobacillus rhamnosus GG «Regidron Bio» (30 patients and hyperosmolarny solution (30 patients. It was found that in the group of patients receiving «Regidron Bio», in contrast to the hyperosmolarny solution, is rapidly disappearing symptoms of intoxication and exsicosis, abdominal pain, meteorism and liquid watery diarrhea. The average duration of the acute period is reduced from 4,06 ± 0,32 to 3,07 ± 0,27 day (P < 0,05. Already by the end of the 1st day of the beginning of rehydration, almost all patients (90% are normalized malformations of blood electrolytes and glucose, hematocrit, and on the 2nd day, which took place in 80% of patients with metabolic acidosis. The addition of the «Bio rehydron» Lactobacillus rhamnosus GG facilitates, unlike hyperosmolarny solution indicator normalizing lg Lactobacilli (in 73.3% and Enterococci (93.3%, but has no significant positive impact on the amount of Bifidobacteria and Escherichia coli.
Special Issue: Selected papers from ECS'97
DEFF Research Database (Denmark)
1999-01-01
This Special Issue of Analog Integrated Circuits and Signal Processing presents extended versions of selected papers from the First Electronic Circuits and Systems Conference (ECS'97) which was held on September 4-5, 1997, in Bratislava, Slovakia.......This Special Issue of Analog Integrated Circuits and Signal Processing presents extended versions of selected papers from the First Electronic Circuits and Systems Conference (ECS'97) which was held on September 4-5, 1997, in Bratislava, Slovakia....
Wu, Cheng; Huang, X. H. Hilda; Ng, Wai Man; Griffith, Stephen M.; Zhen Yu, Jian
2016-09-01
Organic carbon (OC) and elemental carbon (EC) are operationally defined by analytical methods. As a result, OC and EC measurements are protocol dependent, leading to uncertainties in their quantification. In this study, more than 1300 Hong Kong samples were analyzed using both National Institute for Occupational Safety and Health (NIOSH) thermal optical transmittance (TOT) and Interagency Monitoring of Protected Visual Environment (IMPROVE) thermal optical reflectance (TOR) protocols to explore the cause of EC disagreement between the two protocols. EC discrepancy mainly (83 %) arises from a difference in peak inert mode temperature, which determines the allocation of OC4NSH, while the rest (17 %) is attributed to a difference in the optical method (transmittance vs. reflectance) applied for the charring correction. Evidence shows that the magnitude of the EC discrepancy is positively correlated with the intensity of the biomass burning signal, whereby biomass burning increases the fraction of OC4NSH and widens the disagreement in the inter-protocol EC determination. It is also found that the EC discrepancy is positively correlated with the abundance of metal oxide in the samples. Two approaches (M1 and M2) that translate NIOSH TOT OC and EC data into IMPROVE TOR OC and EC data are proposed. M1 uses direct relationship between ECNSH_TOT and ECIMP_TOR for reconstruction: M1 : ECIMP_TOR = a × ECNSH_TOT + b; while M2 deconstructs ECIMP_TOR into several terms based on analysis principles and applies regression only on the unknown terms: M2 : ECIMP_TOR = AECNSH + OC4NSH - (a × PCNSH_TOR + b), where AECNSH, apparent EC by the NIOSH protocol, is the carbon that evolves in the He-O2 analysis stage, OC4NSH is the carbon that evolves at the fourth temperature step of the pure helium analysis stage of NIOSH, and PCNSH_TOR is the pyrolyzed carbon as determined by the NIOSH protocol. The implementation of M1 to all urban site data (without considering seasonal specificity
Overview of the ITER EC H and CD system and its capabilities
Energy Technology Data Exchange (ETDEWEB)
Omori, T., E-mail: toshimichi.omori@iter.org [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France); Henderson, M.A. [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France); Albajar, F. [Fusion for Energy, C/Josep Pla 2, Torres Diagonal Litoral-B3, E-08019 Barcelona (Spain); Alberti, S. [CRPP-Association EURATOM-Confederation Suisse, EPFL Ecublens, CH-1015 Lausanne (Switzerland); Baruah, U. [Institute for Plasma Research, Near Indira Bridge, Bhat, Gandhinagar 382428 (India); Bigelow, T.S. [US ITER Project Office, ORNL, 055 Commerce Park, PO Box 2008, Oak Ridge, TN 37831 (United States); Beckett, B. [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France); Bertizzolo, R. [CRPP-Association EURATOM-Confederation Suisse, EPFL Ecublens, CH-1015 Lausanne (Switzerland); Bonicelli, T. [Fusion for Energy, C/Josep Pla 2, Torres Diagonal Litoral-B3, E-08019 Barcelona (Spain); Bruschi, A. [Istituto di Fisica del Plasma, Association EURATOM-ENEA-CNR, Milano (Italy); Caughman, J.B. [US ITER Project Office, ORNL, 055 Commerce Park, PO Box 2008, Oak Ridge, TN 37831 (United States); Chavan, R. [CRPP-Association EURATOM-Confederation Suisse, EPFL Ecublens, CH-1015 Lausanne (Switzerland); Cirant, S. [Istituto di Fisica del Plasma, Association EURATOM-ENEA-CNR, Milano (Italy); Collazos, A. [CRPP-Association EURATOM-Confederation Suisse, EPFL Ecublens, CH-1015 Lausanne (Switzerland); Cox, D.; Darbos, C. [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France); Baar, M.R. de [Association EURATOM-FOM, 3430 BE Nieuwegein (Netherlands); Denisov, G. [Institute of Applied Physics, 46 Ulyanov Street, Nizhny Novgorod 603950 (Russian Federation); Farina, D. [Istituto di Fisica del Plasma, Association EURATOM-ENEA-CNR, Milano (Italy); Gandini, F. [ITER Organization, CS 90 046, 13067 St Paul Lez Durance Cedex (France)
2011-10-15
The Electron Cyclotron (EC) system for the ITER tokamak is designed to inject {>=}20 MW RF power into the plasma for Heating and Current Drive (H and CD) applications. The EC system consists of up to 26 gyrotrons (between 1 and 2 MW each), the associated power supplies, 24 transmission lines and 5 launchers. The EC system has a diverse range of applications including central heating and current drive, current profile tailoring and control of plasma magneto-hydrodynamic (MHD) instabilities such as the sawtooth and neoclassical tearing modes (NTMs). This diverse range of applications requires the launchers to be capable of depositing the EC power across nearly the entire plasma cross section. This is achieved by two types of antennas: an equatorial port launcher (capable of injecting up to 20 MW from the plasma axis to mid-radius) and four upper port launchers providing access from inside of mid radius to near the plasma edge. The equatorial launcher design is optimized for central heating, current drive and profile tailoring, while the upper launcher should provide a very focused and peaked current density profile to control the plasma instabilities. The overall EC system has been modified during the past 3 years taking into account the issues identified in the ITER design review from 2007 and 2008 as well as integrating new technologies. This paper will review the principal objectives of the EC system, modifications made during the past 2 years and how the design is compliant with the principal objectives.
Overview of the ITER EC H and CD system and its capabilities
International Nuclear Information System (INIS)
Omori, T.; Henderson, M.A.; Albajar, F.; Alberti, S.; Baruah, U.; Bigelow, T.S.; Beckett, B.; Bertizzolo, R.; Bonicelli, T.; Bruschi, A.; Caughman, J.B.; Chavan, R.; Cirant, S.; Collazos, A.; Cox, D.; Darbos, C.; Baar, M.R. de; Denisov, G.; Farina, D.; Gandini, F.
2011-01-01
The Electron Cyclotron (EC) system for the ITER tokamak is designed to inject ≥20 MW RF power into the plasma for Heating and Current Drive (H and CD) applications. The EC system consists of up to 26 gyrotrons (between 1 and 2 MW each), the associated power supplies, 24 transmission lines and 5 launchers. The EC system has a diverse range of applications including central heating and current drive, current profile tailoring and control of plasma magneto-hydrodynamic (MHD) instabilities such as the sawtooth and neoclassical tearing modes (NTMs). This diverse range of applications requires the launchers to be capable of depositing the EC power across nearly the entire plasma cross section. This is achieved by two types of antennas: an equatorial port launcher (capable of injecting up to 20 MW from the plasma axis to mid-radius) and four upper port launchers providing access from inside of mid radius to near the plasma edge. The equatorial launcher design is optimized for central heating, current drive and profile tailoring, while the upper launcher should provide a very focused and peaked current density profile to control the plasma instabilities. The overall EC system has been modified during the past 3 years taking into account the issues identified in the ITER design review from 2007 and 2008 as well as integrating new technologies. This paper will review the principal objectives of the EC system, modifications made during the past 2 years and how the design is compliant with the principal objectives.
Stratigraphic evidence of desertification in the west-central Great Plains within the past 1000 yr
Madole, R.F.
1994-01-01
Stratigraphic and geomorphic relations, archaeological data, and eight radiocarbon ages at five widely scattered localities in northeastern Colorado indicate that eolian sand was mobilized over broad areas within the past 1000 yr. The mobilization began after 1 ka, was episodic, and ended at some as yet undetermined time prior to the latter part of the 19th century. Given that climate-model simulations suggest only slight variation in average surface temperature and annual precipitation in this region during the past 1000 yr, this part of the Great Plains evidently is near the threshold of widespread eolian sand transport under the present climate. -Author
The plant polyphenols, quercetin and naringenin, are considered healthy dietary compounds; however, little is known of their effects on the probiotic Lactobacillus rhamnosus GG (LGG). In this study, it was discovered that both quercetin and naringenin produced temporary inhibition of LGG growth, par...
Probiotics have shown beneficial effects on human health. To increase the efficacy of probiotic applications, we used Lactobacillus rhamnosus GG (LGG) as a probiotic model to investigate approaches to enhance the bioavailability of probiotics. LGG was encapsulated in hydrogel beads containing pectin...
Ossowski, von I.; Reunanen, J.; Satokari, R.M.; Vesterlund, S.; Kankainen, M.; Huhtinen, H.; Tynkkynen, S.; Salminen, S.; Vos, de W.M.; Palva, A.
2010-01-01
Lactobacillus rhamnosus GG is a well-established Gram-positive probiotic strain, whose health-benefiting properties are in part dependent upon a prolonged residency in the gastrointestinal tract and likely dictated by an adherence to the intestinal mucosa. Previously, we identified two pilus gene
International Nuclear Information System (INIS)
Ahnert, C.; Aragones, J. M.
1981-01-01
This Is a users manual of the neutron transport code TWOTRAN-TRACA, which is a version of the original TWOTRAN-GG from the Los Alamos Laboratory, with some modifications made at JEN. A detailed input data description is given as well as the new modifications developed at JEN. (Author) 8 refs
Clinical comparison of technetium-99m-EC, technetium-99-m-MAG3 and Iodine-131-OIH in renal disorders
International Nuclear Information System (INIS)
Kabasakal, L.; Turoglu, T.; Oensel, C.
1995-01-01
Technetium-99m-ethylenedicysteine has recently been developed for renal function studies. The pharmacokinetics of 99m Tc-EC were studied by constant infusion technique and compared with 99m Tc-MAG3 and 131 I-OIH in 11 patients with various renal disorders. After giving a 7.4 MBq 131 I-OIH and 90-110 MBq 99m Tc-EC or 99m Tc-MAG3 bolus, a constant infusion (MBq/ml) 99m Tc--agent and 0.07 MBq/m 131 I-OIH was started. Sixteen blood and five urine samples were obtained over three hr. The renal clearance of 99m Tc-EC was higher than than of 99m Tc-MAG3. The 99m Tc-EC/OIH and 99m Tc-MAG3/OIH ratios were 0.75 ± 0.05 and 0.55 ± 0.10 (p=0.00087), respectively. The distribution volume of 99m Tc-EC was also higher than that of 99m Tc-MAG3 (15722 ± 4644 and 9509 ± 2788 ml/1.73m 2 , respectively; p=0.072). The 99m Tc-EC/OIH and 99m Tc-MAG/OIH distribution volume ratios were 1.03 ± 0.14 and 0.55 ± 0.10, respectively (p = 0.0003). The 60-min excretion values of 99m Tc-EC and 99m Tc-MAG3 were compared to that of OIH. The 99m Tc-EC/OIH and 99m Tc-MAG3/OIH excretion ratios were 0.96 ± 0.06 and 1.07 ± 0.10, respectively (p=0.162). The protein binding of 99m -EC and OIH were found to be 34% ±4 and 66% ±5, respectively (p 99m Tc-EC was negligible (3% ±1.2) in comparison to OIH (27% ±3; p 99m Tc-EC. This agent has good potential for renal function evaluation. 32 refs., 5 tabs
EC6 design features and pre-project licensing review
Energy Technology Data Exchange (ETDEWEB)
Yu, S.; Lee, A.G.; Dinh, N.B.; Soulard, M. [CANDU Energy Inc., Mississauga, Ontario, (Canada)
2013-07-01
The Enhanced CANDU 6 (EC6) is the new Generation III CANDU reactor design that meets the most up to date Canadian regulatory requirements and customer expectations. Candu Energy Inc. is finalizing development of the EC6 which incorporates the CANDU 6's well-proven features, and adds enhancements that strengthened reactor safety margin and improved operability. The EC6 builds on the proven high performance design and the defence-in-depth features of CANDU 6 units, and has incorporated extensive operational feedback including lessons learned from Fukushima. This paper will provide status of the engineering program including progress on the pre-licensing review of the EC6 design by the Canadian Regulator, CNSC, and will also highlight the design and safety enhancements incorporated in the EC6 product. Safety enhancements to meet safety goals and to improve robustness of systems to respond to design basis accidents and beyond design basis accidents include: new severe accident recovery and heat removal system; improved emergency heat removal system; faster shutoff rods with improved safety margins; mechanical guaranteed shutdown rods; daily load cycling capability; robust containment with containment filter venting system; and improved backed-up electrical supply and cooling services. (author)
Relationship Between BMD and Prevalent Vertebral Fractures in Indian Women Older Than 50 Yr.
Gupta, Yashdeep; Marwaha, Raman K; Kukreja, Subhash; Bhadra, Kuntal; Narang, Archana; Mani, Kalaivani; Mithal, Ambrish; Tandon, Nikhil
2016-01-01
The purpose of the study was to study the relationship of morphometric vertebral fractures with bone mineral density (BMD) in Indian women older than 50 yr. Four hundred fifteen healthy Indian women older than 50 yr (mean age: 62.8 yr) underwent lateral X-rays of the lumbar and thoracic spine. Genant's semiquantitative method was used to diagnose and classify morphometric vertebral fractures. BMD was measured by DXA at lumbar spine and total hip. Recruited subjects underwent anthropometric, biochemical, and hormonal evaluation. Vertebral fractures were present in 17.1% (95% confidence interval: 13.5, 20.8) subjects. Prevalence of osteoporosis based on BMD was 35.7%. By adding those with prevalent fractures, the number of women requiring therapy for osteoporosis would increase to 46.5%. The BMD measured at femur neck, total hip, and lumbar spine (L1eL4) was not found to be lower in women with vertebral fractures as compared with those without fractures. BMD was not found to be lower in women with vertebral fractures as compared with those without fractures. Significant number of additional subjects with BMD in the normal or osteopenic range become eligible for osteoporosis treatment when presence of vertebral fracture is used as an independent indication for such treatment. Copyright © 2016 The International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.
Do Decision 2003/54/EC and Decision no. 1229/2003/EC result in a European market for electricity?
International Nuclear Information System (INIS)
Wenting, F.
2004-01-01
In the summer of 2003 the European Parliament and the European Council issued a new Directive with respect to the internal market for electricity (Directive 2003/54/EC of the European Parliament and of the Council of 26 June 2003 concerning common rules for the internal market in electricity) and Guidelines for trans-European networks in the energy sector (Decision no. 1229/2003/EC). The question is whether these decisions will lead to a European and free market for electricity. It is concluded that this is not yet the case [nl
Directory of Open Access Journals (Sweden)
I. V. Andreyeva
2011-01-01
Full Text Available Prophylactic and therapeutic administration of prebiotics in treatment of different disorders is used very often nowadays. However, this kind of a treatment confirmed its efficacy in only several diseases. The review presents the data on efficacy of two probiotic microorganisms (L. rhamnosus GG and B. lactis Вb-12 in pediatric practice. Author summarizes and analyzes existing evidence-based data on efficacy of probiotics in treatment of acute diarrhea, prophylaxis of antibiotic-associated diarrhea and nosocomial infections. L. rhamnosus GG and B. lactis Вb-12 have their own place in prophylaxis of infections of airways and gastrointestinal tract. Administration of probiotics for treatment and prophylaxis of allergic and other diseases is reviewed. Safety of probiotics is described as well.
Directory of Open Access Journals (Sweden)
Katri Korpela
Full Text Available Antibiotic use is considered among the most severe causes of disturbance to children's developing intestinal microbiota, and frequently causes adverse gastrointestinal effects ranging from mild and transient diarrhoea to life-threatening infections. Probiotics are commonly advocated to help in preventing antibiotic-associated gastrointestinal symptoms. However, it is currently unknown whether probiotics alleviate the antibiotic-associated changes in children's microbiota. Furthermore, it is not known how long-term probiotic consumption influences the developing microbiota of children. We analysed the influence of long-term Lactobacillus rhamnosus GG intake on preschool children's antibiotic use, and antibiotic-associated gastrointestinal complaints in a double blind, randomized placebo-controlled trial with 231 children aged 2-7. In addition, we analysed the effect of L. rhanmosus GG on the intestinal microbiota in a subset of 88 children. The results show that long-term L. rhamnosus GG supplementation has an influence on the composition of the intestinal microbiota in children, causing an increase in the abundance of Prevotella, Lactococcus, and Ruminococcus, and a decrease in Escherichia. The treatment appeared to prevent some of the changes in the microbiota associated with penicillin use, but not those associated with macrolide use. The treatment, however, did reduce the frequency of gastrointestinal complaints after a macrolide course. Finally, the treatment appeared to prevent certain bacterial infections for up to 3 years after the trial, as indicated by reduced antibiotic use.ClinicalTrials.gov NCT01014676.
Zhou, Ying; Xing, Xiaofan; Lang, Jianlei; Chen, Dongsheng; Cheng, Shuiyuan; Wei, Lin; Wei, Xiao; Liu, Chao
2017-02-01
Biomass burning injects many different gases and aerosols into the atmosphere that could have a harmful effect on air quality, climate, and human health. In this study, a comprehensive biomass burning emission inventory including domestic and in-field straw burning, firewood burning, livestock excrement burning, and forest and grassland fires is presented, which was developed for mainland China in 2012 based on county-level activity data, satellite data, and updated source-specific emission factors (EFs). The emission inventory within a 1 × 1 km2 grid was generated using geographical information system (GIS) technology according to source-based spatial surrogates. A range of key information related to emission estimation (e.g. province-specific proportion of domestic and in-field straw burning, detailed firewood burning quantities, uneven temporal distribution coefficient) was obtained from field investigation, systematic combing of the latest research, and regression analysis of statistical data. The established emission inventory includes the major precursors of complex pollution, greenhouse gases, and heavy metal released from biomass burning. The results show that the emissions of SO2, NOx, PM10, PM2.5, NMVOC, NH3, CO, EC, OC, CO2, CH4, and Hg in 2012 are 336.8 Gg, 990.7 Gg, 3728.3 Gg, 3526.7 Gg, 3474.2 Gg, 401.2 Gg, 34 380.4 Gg, 369.7 Gg, 1189.5 Gg, 675 299.0 Gg, 2092.4 Gg, and 4.12 Mg, respectively. Domestic straw burning, in-field straw burning, and firewood burning are identified as the dominant biomass burning sources. The largest contributing source is different for various pollutants. Domestic straw burning is the largest source of biomass burning emissions for all the pollutants considered, except for NH3, EC (firewood), and NOx (in-field straw). Corn, rice, and wheat represent the major crop straws. The combined emission of these three straw types accounts for 80 % of the total straw-burned emissions for each specific pollutant mentioned in this study
A novel c.240_241insGG mutation in NDP gene in a family with Norrie disease.
Andarva, Monavvar; Jamshidi, Javad; Ghaedi, Hamid; Daftarian, Narsis; Emamalizadeh, Babak; Alehabib, Elham; Taghavi, Shaghyegh; Pouriran, Ramin; Darvish, Hossein
2018-03-01
Norrie disease (ND) is a rare, X-linked recessive disorder with the main characteristic of early childhood blindness. The aim of the present study was to identify the genetic cause of the disease and the phenotypic characteristics of the patients in an Iranian family with four affected males with ND. Norrie disease pseudoglioma (NDP) gene was sequenced and clinical examination was performed on patients. A GG dinucleotide insertion in exon 3 (c.240_241insGG) of NDP was detected in all patients. The mutation caused a frameshift and an early stop codon (p.Phe81Glyfs*23). A novel mutation was found in the NDP gene in the affected males of the family. As the mutation was absent in the normal male members of the family, it should be the genetic cause of the disease. © 2017 Optometry Australia.
Ruan, J.; Kherbouche, F.; Genty, D.; Blamart, D.; Cheng, H.; Dewilde, F.; Hachi, S.; Edwards, L. R.; Régnier, E.; Michelot, J.-L.
2015-07-01
Middle Holocene cultures have been widely studied round the E-Mediterranean basin in the last 30 years and past cultural activities have been commonly linked with regional climate changes. However, in many cases such linkage is equivocal, in part due to existing climatic evidence that has been derived from areas outside the distribution of ancient settlements, leading to uncertainty from complex spatial heterogeneity in both climate and demography. A few high-resolution well-dated paleoclimate records were recently established using speleothems in the Central and E-Mediterranean basin, however, the scarcity of such records in the western part of the Mediterranean prevents us from correlating past climate evolutions across the basin and deciphering climate-culture relation at fine time scales. Here we report the first decadal-resolved Mid-Holocene climate proxy records from the W-Mediterranean basin based on the stable carbon and oxygen isotopes analyses of two U/Th dated stalagmites from the Gueldaman GLD1 Cave in N-Algeria. Comparison of our records with those from Italy and Israel reveals synchronous (multi) centennial dry phases centered at ca. 5600, ca. 5200 and ca. 4200 yr BP across the Mediterranean basin. New calibrated radiocarbon dating constrains reasonably well the age of rich anthropogenic deposits (e.g., faunal remains, pottery, charcoal) excavated inside the cave, which allows the comparison between in situ evidence of human occupation and of climate change. This approach shows that the timing of a prolonged drought at ca. 4400-3800 yr BP blankets the onset of cave abandonment shortly after ca. 4403 cal yr BP, supporting the hypothesis that a climate anomaly may have played a role in this cultural disruption.
Ruan, J.; Kherbouche, F.; Genty, D.; Blamart, D.; Cheng, H.; Dewilde, F.; Hachi, S.; Edwards, R. L.; Régnier, E.; Michelot, J.-L.
2016-01-01
Middle Holocene cultures have been widely studied around the Eastern-Mediterranean basin in the last 30 years and past cultural activities have been commonly linked with regional climate changes. However, in many cases such linkage is equivocal, in part due to existing climatic evidence that has been derived from areas outside the distribution of ancient settlements, leading to uncertainty from complex spatial heterogeneity in both climate and demography. A few high-resolution well-dated paleoclimate records were recently established using speleothems in the Central and Eastern-Mediterranean basin, however, the scarcity of such records in the western part of the Mediterranean prevents us from correlating past climate evolutions across the basin and deciphering climate-culture relation at fine timescales. Here we report the first decadal-resolved Mid-Holocene climate proxy records from the Western-Mediterranean basin based on the stable carbon and oxygen isotopes analyses of two U/Th dated stalagmites from the Gueldaman GLD1 Cave in Northern Algeria. Comparison of our records with those from Italy and Israel reveals synchronous (multi) centennial dry phases centered at ca. 5600, ca. 5200 and ca. 4200 yr BP across the Mediterranean basin. New calibrated radiocarbon dating constrains reasonably well the age of rich anthropogenic deposits (e.g., faunal remains, pottery, charcoal) excavated inside the cave, which allows the comparison between in situ evidence of human occupation and of climate change. This approach shows that the timing of a prolonged drought at ca. 4400-3800 yr BP blankets the onset of cave abandonment shortly after ca. 4403 cal yr BP, supporting the hypothesis that a climate anomaly may have played a role in this cultural disruption.
International Nuclear Information System (INIS)
Ahnert, C.; Aragones, J.M.
1981-01-01
A user's manual of the neutron transport code Twotran-Traca is presented; it is a version of the original Twotran-GG from the Los Alamos Laboratory, with some modifications made at J.E.N., Spain. A detailed input data description is given as well as the new modifications developped at J.E.N. (author) [es
Tarasava, Katsiaryna; Chesnov, Serge; Freisinger, Eva
2016-05-01
Metallothioneins (MTs) are low molecular weight proteins, characterized by a high cysteine content and the ability to coordinate large amounts of d(10) metal ions, for example, Zn(II), Cd(II), and Cu(I), in form of metal-thiolate clusters. Depending on intracellular conditions such as redox potential or metal ion concentrations, MTs can occur in various states ranging from the fully metal-loaded holo- to the metal-free apo-form. The Cys thiolate groups in the apo-form can be either reduced or be involved in disulfide bridges. Although oxidation-mediated Zn(II) release might be a possible mechanism for the regulation of Zn(II) availability by MTs, no concise information regarding the associated pathways and the structure of oxidized apo-MT forms is available. Using the well-studied Zn2 γ-Ec -1 domain of the wheat Zn6 Ec -1 MT we attempt here to answer several question regarding the structure and biophysical properties of oxidized MT forms, such as: (1) does disulfide bond formation increase the stability against proteolysis, (2) is the overall peptide backbone fold similar for the holo- and the oxidized apo-MT form, and (3) are disulfide bridges specifically or randomly formed? Our investigations show that oxidation leads to three distinct disulfide bridges independently of the applied oxidation conditions and of the initial species used for oxidation, that is, the apo- or the holo-form. In addition, the oxidized apo-form is as stable against proteolysis as Zn2 γ-Ec -1, rendering the currently assumed degradation of oxidized MTs unlikely and suggesting a role of the oxidation process for the extension of protein lifetime in absence of sufficient amounts of metal ions. © 2016 Wiley Periodicals, Inc. Biopolymers (Pept Sci) 106: 295-308, 2016. © 2016 Wiley Periodicals, Inc.
New outburst of the symbiotic nova AG Pegasi after 165 yr
Skopal, A.; Shugarov, S. Yu.; Sekeráš, M.; Wolf, M.; Tarasova, T. N.; Teyssier, F.; Fujii, M.; Guarro, J.; Garde, O.; Graham, K.; Lester, T.; Bouttard, V.; Lemoult, T.; Sollecchia, U.; Montier, J.; Boyd, D.
2017-08-01
Context. AG Peg is known as the slowest symbiotic nova, which experienced its nova-like outburst around 1850. After 165 yr, during June of 2015, it erupted again showing characteristics of the Z And-type outburst. Aims: The primary objective is to determine basic characteristics, the nature and type of the 2015 outburst of AG Peg. Methods: We achieved this aim by modelling the spectral energy distribution using low-resolution spectroscopy (330-750 nm; R = 500-1000), medium-resolution spectroscopy (420-720 nm; R 11 000), and UBVRCIC photometry covering the 2015 outburst with a high cadence. Optical observations were complemented with the archival HST and FUSE spectra from the preceding quiescence. Results: During the outburst, the luminosity of the hot component was in the range of 2-11 × 1037 (d/ 0.8 kpc)2 erg s-1, being in correlation with the light curve (LC) profile. To generate the maximum luminosity by the hydrogen burning, the white dwarf (WD) had to accrete at 3 × 10-7 M⊙ yr-1, which exceeds the stable-burning limit and thus led to blowing optically thick wind from the WD. We determined its mass-loss rate to a few × 10-6 M⊙ yr-1. At the high temperature of the ionising source, 1.5-2.3 × 105 K, the wind converted a fraction of the WD's photospheric radiation into the nebular emission that dominated the optical. A one order of magnitude increase of the emission measure, from a few × 1059 (d/ 0.8 kpc)2 cm-3 during quiescence, to a few × 1060 (d/ 0.8 kpc)2 cm-3 during the outburst, caused a 2 mag brightening in the LC, which is classified as the Z And-type of the outburst. Conclusions: The very high nebular emission and the presence of a disk-like H I region encompassing the WD, as indicated by a significant broadening and high flux of the Raman-scattered O vi 6825 Å line during the outburst, is consistent with the ionisation structure of hot components in symbiotic stars during active phases. Full Table 1 and Table 6 are only available at the CDS are
Ketone EC50 values in the Microtox test.
Chen, H F; Hee, S S
1995-03-01
The Microtox EC50 values for the following ketones are reported in the following homologous series: straight chain methyl ketones (acetone, 2-butanone, 2-pentanone, 2-hepatonone, 2-octanone, 2-decanone, and 2-tridecanone); methyl ketones substituted at one alpha carbon (3-methyl-2-butanone; 3,3-dimethyl-2-butanone); methyl substituted at two alpha carbons (2,4-dimethyl-3-pentanone; 2,2,4,4-tetramethyl-3-pentanone); phenyl groups replacing methyl in acetone (acetophenone; benzophenone); methyl groups substituted at the alpha carbons of cyclohexanone; and 2,3- 2,4-, and 2,5-hexanediones, most for the first time. While there were linear relationships between log EC50 and MW for the straight chain methyl ketones, and for methyl substitution at the alpha carbon for methyl ketones, there were no other linear relationships. As molecular weight increased, the EC50 values of soluble ketones decreased; as distance between two carbonyl groups decreased so too did EC50 values. Thus, for the ketones the geometry around the carbonyl group is an important determinant of toxicity as well as MW, water solubility, and octanol/water coefficient.
Nuclear power plant performance in the EC in 1978
International Nuclear Information System (INIS)
Anon.
1979-01-01
According to the report presented by the Statistical Office of the Ec, nuclear electricity generation in the nine EC countries has been increased in 1978 by 11% to a net value of 115 TWh as compared to the year before. Installed capacity went up by 18.6% to a net value of 24. 000 MWe at the end of the year. The mean availability period has been close to the hitherto best value of 6000 h/a. The share of nuclear energy in total electricity generation in the EC rose by 0.5% to 10.5%. (orig.) [de
A 5-yr change in Norwegian 9-yr-olds' objectively assessed physical activity level
DEFF Research Database (Denmark)
Kolle, Elin; Steene-Johannessen, Jostein; Klasson-Heggebø, Lena
2009-01-01
= 0.02 and girls and boys. Interactions were found between change in physical activity and SES. Although the mean physical activity level and moderate-to-vigorous physical activity (MVPA) among children from low-SES groups showed no change...... over time, an increase was seen among children from middle-SES groups. Moreover, in high-SES groups, an increase was observed for mean physical activity level (girls only) between study periods, whereas no change was seen for MVPA participation. CONCLUSIONS: Nine-year-old children living in Oslo......PURPOSE: To describe changes in objectively assessed physical activity by socioeconomic status (SES) between 1999-2000 and 2005 in 9-yr-old children living in Oslo, Norway. METHODS: Two cross-sectional studies were conducted in 1999-2000 and 2005. The participation rate was 70.9% in 1999...
Günaydın, Gökçe; Zhang, Ran; Hammarström, Lennart; Marcotte, Harold
2014-01-16
Rotavirus-induced diarrhea causes more than 500,000 deaths annually in the world, and although vaccines are being made available, new effective treatment strategies should still be considered. Purified antibodies derived from hyperimmune bovine colostrum (HBC), from cows immunized with rotavirus, were previously used for treatment of rotavirus diarrhea in children. A combination of HBC antibodies and a probiotic strain of Lactobacillus (L. rhamnosus GG) was also found to be more effective than HBC alone in reducing diarrhea in a mouse model of rotavirus infection. In order to further improve this form of treatment, L. rhamnosus GG was engineered to display surface expressed IgG-binding domains of protein G (GB1, GB2, and GB3) which capture HBC-derived IgG antibodies (HBC-IgG) and thus target rotavirus. The expression of IgG-binding domains on the surface of the bacteria as well as their binding to HBC-IgG and to rotavirus (simian strain RRV) was demonstrated by Western blot, flow cytometry, and electron microscopy. The prophylactic effect of engineered L. rhamnosus GG and anti-rotaviral activity of HBC antibodies was evaluated in a mouse pup model of RRV infection. The combination therapy with engineered L. rhamnosus GG (PG3) and HBC was significantly more effective in reducing the prevalence, severity, and duration of diarrhea in comparison to HBC alone or a combination of wild-type L. rhamnosus GG and HBC. The new therapy reduces the effective dose of HBC between 10 to 100-fold and may thus decrease treatment costs. This antibody capturing platform, tested here for the first time in vivo, could potentially be used to target additional gastrointestinal pathogens. Copyright © 2013 Elsevier Ltd. All rights reserved.
Nissilä, Eija; Douillard, François P; Ritari, Jarmo; Paulin, Lars; Järvinen, Hanna M; Rasinkangas, Pia; Haapasalo, Karita; Meri, Seppo; Jarva, Hanna; de Vos, Willem M
2017-01-01
Lactobacillus rhamnosus strains are ubiquitous in fermented foods, and in the human body where they are commensals naturally present in the normal microbiota composition of gut, vagina and skin. However, in some cases, Lactobacillus spp. have been implicated in bacteremia. The aim of the study was to examine the genomic and immunological properties of 16 clinical blood isolates of L. rhamnosus and to compare them to the well-studied L. rhamnosus probiotic strain GG. Blood cultures from bacteremic patients were collected at the Helsinki University Hospital laboratory in 2005-2011 and L. rhamnosus strains were isolated and characterized by genomic sequencing. The capacity of the L. rhamnosus strains to activate serum complement was studied using immunological assays for complement factor C3a and the terminal pathway complement complex (TCC). Binding of complement regulators factor H and C4bp was also determined using radioligand assays. Furthermore, the isolated strains were evaluated for their ability to aggregate platelets and to form biofilms in vitro. Genomic comparison between the clinical L. rhamnosus strains showed them to be clearly different from L. rhamnosus GG and to cluster in two distinct lineages. All L. rhamnosus strains activated complement in serum and none of them bound complement regulators. Four out of 16 clinical blood isolates induced platelet aggregation and/or formed more biofilms than L. rhamnosus GG, which did not display platelet aggregation activity nor showed strong biofilm formation. These findings suggest that clinical L. rhamnosus isolates show considerable heterogeneity but are clearly different from L. rhamnosus GG at the genomic level. All L. rhamnosus strains are still normally recognized by the human complement system.
MoisturEC: a new R program for moisture content estimation from electrical conductivity data
Terry, Neil; Day-Lewis, Frederick D.; Werkema, Dale D.; Lane, John W.
2018-01-01
Noninvasive geophysical estimation of soil moisture has potential to improve understanding of flow in the unsaturated zone for problems involving agricultural management, aquifer recharge, and optimization of landfill design and operations. In principle, several geophysical techniques (e.g., electrical resistivity, electromagnetic induction, and nuclear magnetic resonance) offer insight into soil moisture, but data‐analysis tools are needed to “translate” geophysical results into estimates of soil moisture, consistent with (1) the uncertainty of this translation and (2) direct measurements of moisture. Although geostatistical frameworks exist for this purpose, straightforward and user‐friendly tools are required to fully capitalize on the potential of geophysical information for soil‐moisture estimation. Here, we present MoisturEC, a simple R program with a graphical user interface to convert measurements or images of electrical conductivity (EC) to soil moisture. Input includes EC values, point moisture estimates, and definition of either Archie parameters (based on experimental or literature values) or empirical data of moisture vs. EC. The program produces two‐ and three‐dimensional images of moisture based on available EC and direct measurements of moisture, interpolating between measurement locations using a Tikhonov regularization approach.
14C concentrations in the old woods at 6000yrBP and the variations of cosmic rays
International Nuclear Information System (INIS)
Sato, Taiichi; Sakurai, Hirohisa; Tokanai, Huyuki
2008-01-01
A large quantity of old woods was recently excavated with the Chuetsu-oki Earthquake in the bottom of the sea of near the Izumozaki-oki Nigata Prefecture. First of all, we have measured the radiocarbon ages for the three samples to identify the calendar ages of the woods. The radiocarbon ages were 5357±45 yrBP, 4573±52 yrBP, and 4812±52 yrBP, respectively. Using the OXCAL program, the calendar ages were calculated in the range from 6300 yrBP to 5100 yrBP. The IntCal04 data shows that the 14 C concentrations with the era are very variable with 20 per mille variations. We show a plan to investigate 14 C concentrations of the old tree rings around 6000 yrBP. (author)
Normal human serum (HS) prevents oxidant-induced lysis of cultured endothelial cells (ECs)
International Nuclear Information System (INIS)
Callahan, K.S.; Harlan, J.M.
1986-01-01
Most studies demonstrating oxidant lysis of cultured ECs are performed in serum-free media or media containing low concentrations of bovine serum. The authors found that HS protects human and bovine ECs from lysis caused by reagent H 2 O 2 or glucose/glucose oxidase (GO)-generated H 2 O 2 . EC injury was assessed by 51 Cr release, cell detachment, or trypan blue dye exclusion. Protective HS activity was dose-dependent with concentrations greater than or equal to 25% preventing lethal injury. Cytotoxicity at 24 hrs, induced by 20 mU/ml GO, was 90.1 +/- 5.2% without HS vs 1.7 +/- 4.6% with 25% HS present (20 exp). Similar protection was observed with heparinized plasma. Of note, comparable concentrations of bovine serum were devoid of protective activity. Addition of fatty acid-free albumin to the media was also without protective effect. Preliminary characterization showed HS activity was stable to 60 0 C for 30 min, non-dialyzable at 25,000 MW cutoff, and retained in delipidated serum. The HS protection was not merely due to scavenging of exogenous H 2 O 2 as A23187-induced EC lysis was also prevented by HS. Protective activity was not reproduced by purified cerruloplasmin or transferrin. In conclusion, unidentified factor(s) present in HS protect cultured ECs from oxidant-induced lysis. Since endothelium is normally exposed to 100% plasma, the authors suggest that in vitro studies of oxidant-mediated injury be performed in the presence of HS. Factor(s) in HS may play an important role in modulating oxidant-induced vascular injury in vivo
Chinchole, Mahadev; Pathak, Rajesh Kumar; Singh, Uma M; Kumar, Anil
2017-08-01
Finger millet grains contain exceptionally high levels of calcium which is much higher compared to other cereals and millets. Since calcium is an important macronutrient in human diet, it is necessary to explore the molecular basis of calcium accumulation in the seeds of finger millet. CIPK is a calcium sensor gene, having role in activating Ca 2+ exchanger protein by interaction with CBL proteins. To know the role of EcCIPK24 gene in seed Ca 2+ accumulation, sequence is retrieved from the transcriptome data of two finger millet genotypes GP1 (low Ca 2+ ) and GP45 (high Ca 2+ ), and the expression was determined through qRT-PCR. The higher expression was found in root, shoot, leaf and developing spike tissue of GP45 compared to GP1; structural analysis showed difference of nine SNPs and one extra beta sheet domain as well as differences in vacuolar localization was predicted; besides, the variation in amino acid composition among both the genotypes was also investigated. Molecular modeling and docking studies revealed that both EcCBL4 and EcCBL10 showed strong binding affinity with EcCIPK24 (GP1) compared to EcCIPK24 (GP45). It indicates a genotypic structural variation, which not only affects the affinity but also calcium transport efficiency after interaction of CIPK-CBL with calcium exchanger ( Ec CAX1b) to pull calcium in the vacuole. Based on the expression and in silico study, it can be suggested that by activating EcCAX1b protein, EcCIPK24 plays an important role in high seed Ca 2+ accumulation.
EC6 for Darlington - a managed-enhancements replication project
International Nuclear Information System (INIS)
Soulard, M.R.
2011-01-01
CANDU 6 design has a well-deserved reputation for lifetime performance and on-time, on-schedule construction. Candu Energy is finalizing development of an upgraded reactor product, the Enhanced CANDU 6 (EC6), which incorporates the CANDU 6's well-proven features, and adds enhancements that make the reactor even more safe and easier to operate. The EC6 is the only mid-sized reactor (700 MWe class) with a proven pedigree that meets modern reactor expectations and regulatory standards. It is sized for smaller grids and also has outstanding fuel-cycle capability. Some of the key features incorporated into the EC6 include increasing the plant's power output, shortening the overall project schedule, addressing obsolescence issues, optimizing maintenance outages and incorporating lessons learnt through feedback obtained from the operating plants. The EC6 utilizes modern computers and a distributed control system housed in an advanced control room which, along with automated testing and on-line diagnostics, make the plant easier and safer to operate, with minimal operator intervention. An array of health monitoring equipment are also installed to foretell impending equipment problems, which can be acted upon, avoiding complications that could result in forced shutdowns. Improvements to the fire protection system and enhanced security features will further protect the assets. Containment and seismic capability are upgraded to meet modern standards. The first deployment of the EC6 is anticipated in Canada; other markets are also being pursued. The EC6 reactor is designed for a target lifetime capacity factor of 92% including 94% year-to-year and a 1% Forced Loss Rate. Since the number and duration of maintenance outages impact plant capacity factors, periodic short duration maintenance outages of less than a month once every 36 months is a key target of the EC6 reactor. This objective is achieved by automating a number of tasks such as shutdown systems testing. The majority
Vartolomei, Mihai Dorin; Matei, Deliu Victor; Renne, Giuseppe; Tringali, Valeria Maria; Crisan, Nicolae; Musi, Gennaro; Mistretta, Francesco Alessandro; Russo, Andrea; Cozzi, Gabriele; Cordima, Giovani; Luzzago, Stefano; Cioffi, Antonio; Di Trapani, Ettore; Catellani, Michele; Delor, Maurizio; Bottero, Danilo; Imbimbo, Ciro; Mirone, Vincenzo; Ferro, Matteo; de Cobelli, Ottavio
2017-10-27
Nowadays, there is a debate about which surgical treatment should be best for clinical T1 renal tumors. If the oncological outcomes are considered, there are many open and laparoscopic series published. As far as robotic series are concerned, only a few of them report 5-yr oncological outcomes. The aim of this study was to analyze robot-assisted partial nephrectomy (RAPN) midterm oncological outcomes achieved in a tertiary robotic reference center. Between April 2009 and September 2013, 123 consecutive patients with clinical T1-stage renal masses underwent RAPN in our tertiary cancer center. Inclusion criteria were as follows: pathologically confirmed renal cell carcinomas (RCCs) and follow-up for >12 mo. Eighteen patients were excluded due to follow-up of <12 mo and 15 due to benign final pathology. Median follow-up was 59 mo (interquartile range 44-73 mo). Patients were followed according to guideline recommendations and institutional protocol. Outcomes were measured by time to disease progression, overall survival, or time to cancer-specific death. Kaplan-Meier method was used to estimate survival; log-rank tests were applied for pair-wise comparison of survival. From the 90 patients included, 66 (73.3%) had T1a, 12 (13.3%) T1b, three (3.3%) T2a, and nine (10%) T3a tumors. Predominant histological type was clear cell carcinoma: 67 (74.5%). Fuhrmann grade 1 and 2 was found in 73.3% of all malignant tumors. Two patients (2.2%) had positive surgical margins, and complication rate was 17.8%. Relapse rate was 7.7%, including two cases (2.2%) of local recurrences and five (5.5%) distant metastasis. Five-year disease-free survival was 90.9%, 5-yr cancer-specific survival was 97.5%, and 5-yr overall survival was 95.1%. Midterm oncological outcomes after RAPN for localized RCCs (predominantly T1a tumors of low anatomic complexity) were shown to be good, adding significant evidence to support the oncological efficacy and safety of RAPN for the treatment of this type of
2010-04-02
... DEPARTMENT OF THE INTERIOR Minerals Management Service Geological and Geophysical Exploration (G&G..., geological and geochemical sampling, and remote sensing. These activities could support siting needs for... Continental Shelf (see http://www.mms.gov/ld/PDFs/GreenBook-LeasingDocument.pdf ) and MMS's Geological and...
Energy conservation in the EC glass industry
Energy Technology Data Exchange (ETDEWEB)
Waal, H. de [TNO Institute of Applied Physics, Delft (Netherlands)
1994-12-31
The data presented in this survey are based mainly on a recent study, performed by the Energy Technology Support Unit ETSU. Harwell Laboratory, United Kingdom, in the context of the EC-Thermie programme. Also, use has been made of a paper `Glass Manufacture, energy and CO{sub 2}-emissions`, presented by G.J. Copley of the British Glass Manufacturers Confederation, Sheffield, United Kingdom, presented at the Thermie Seminar in Wiesbaden, 1992. A third source of information has been the data collected by the CPIV, the European Glass Manufacturers Federation on the present and future economic situation of the EC Glass Industry. (orig.)
Canada files WTO complaint against EC.
2000-01-01
In December 1998, Canada filed a complaint alleging that the European Communities (EC) had adopted regulations that amounted to a scheme to extend patent terms, limited to pharmaceutical and agricultural chemical products.
NASA FACTS: E. coli AntiMicrobial Satellite (EcAMSat)
Spremo, Stevan; Cappuccio, Gelsomina; Tomko, David
2013-01-01
The E. coli AntiMicrobial Satellite(EcAMSat) mission will investigate space microgravity affects on the antibiotic resistance of E. coli, a bacterial pathogen responsible for urinary tract infection in humans and animals. EcAMSat is being developed through a partnership between NASAs Ames Research Center and the Stanford University School of Medicine. Dr. A.C. Matin is the Stanford University Principal Investigator. EcAMSat will investigate spaceflight effects on bacterial antibiotic resistance and its genetic basis. Bacterial antibiotic resistance may pose a danger to astronauts in microgravity, where the immune response is weakened. Scientists believe that the results of this experiment could help design effective countermeasures to protect astronauts health during long duration human space missions.
MoisturEC: A New R Program for Moisture Content Estimation from Electrical Conductivity Data.
Terry, Neil; Day-Lewis, Frederick D; Werkema, Dale; Lane, John W
2018-03-06
Noninvasive geophysical estimation of soil moisture has potential to improve understanding of flow in the unsaturated zone for problems involving agricultural management, aquifer recharge, and optimization of landfill design and operations. In principle, several geophysical techniques (e.g., electrical resistivity, electromagnetic induction, and nuclear magnetic resonance) offer insight into soil moisture, but data-analysis tools are needed to "translate" geophysical results into estimates of soil moisture, consistent with (1) the uncertainty of this translation and (2) direct measurements of moisture. Although geostatistical frameworks exist for this purpose, straightforward and user-friendly tools are required to fully capitalize on the potential of geophysical information for soil-moisture estimation. Here, we present MoisturEC, a simple R program with a graphical user interface to convert measurements or images of electrical conductivity (EC) to soil moisture. Input includes EC values, point moisture estimates, and definition of either Archie parameters (based on experimental or literature values) or empirical data of moisture vs. EC. The program produces two- and three-dimensional images of moisture based on available EC and direct measurements of moisture, interpolating between measurement locations using a Tikhonov regularization approach. Published 2018. This article is a U.S. Government work and is in the public domain in the USA.
Accelerator-Driven Systems - the iThEC strategy
International Nuclear Information System (INIS)
Revol, Jean-Pierre
2015-01-01
The International Thorium Energy Committee (iThEC) created in Geneva in 2012 is concerned about the energetic future of our society, which is totally organized on the basis of a fossil fuel economy. This has to change because of obvious geopolitical reasons, because of the impact this economy has on the environment, and because of the rather short time on the human time scale, it will take for fossil fuels to run out. One of the main goals of iThEC is to work on reversing the current negative perception of nuclear energy in Europe, which is the main hurdle to a more serious R and D effort in this field. iThEC provides better information to the public on thorium possibilities, supports thorium ADS technology developments, any R and D regarding thorium, and actively engages the scientific, political and business leadership on the subject
The biodistribution and radiation dosimetry of 99Tcmm-EC-DG in normal volunteers
International Nuclear Information System (INIS)
Tang Jun; Yang Yi; Liu Zengli; Shi Yizhen
2010-01-01
The objective of this study is to evaluate the biodistribution of technetium-99m labeled ethylenedicysteine-deoxyglucose ( 99 Tc m -EC-DG) and to calculate its internal radiation absorbed dose in normal volunteers. 740 MBq 99 Tc m -EC-DG was injected into the antecubital vein. 2 ml blood were sampled from the contralateral antecubital vein at different time after the injection, and its radioactivity was measured. The bi-exponential curve of time-radioactivity of blood and the dynamic parameters were obtained by using ORIGIN 5.0. Urine was collected in 24 hours after the injection and the percentage of Radioactivity excreted by urine to the total injected radioactivity was calculated. The anterior and posterior whole body imaging were acquired at different time after the injection of 740 MBq 99 Tc m -EC-DG. The region of interest of these referring organs and tissues was drawn, their radioactivity at different time was calculated. The bi-exponential curve of time-radioactivity of every organ was obtained by using ORIGIN 5.0, and then cumulated radioactivity and retaining time of 99 Tcm-EC-DG were calculated and input into the software MIRDOSE 3.0 to obtain the radiation absorbed dose of every organ and tissue. The heart rate, blood pressure and breathing frequency is normal after the injection. The male volunteer's T1/2α is 39 seconds, T1/2β is 59 minutes and that of female volunteer is 21 seconds and 61 minutes. 99 Tc m -EC-DG imaging is safe, and its characteristic of biodistribution in normal volunteer makes it easy to accumulate in tumor. Brain is not imaged, the uptake of muscle is low. The absorbed dose of every organ is far lower than that of the public annual average limitation. (authors)
Directory of Open Access Journals (Sweden)
Ing-Marie Jonsson
2010-12-01
Full Text Available Ecs is an ATP-binding cassette (ABC transporter present in aerobic and facultative anaerobic gram-positive Firmicutes. Inactivation of Bacillus subtilis Ecs causes pleiotropic changes in the bacterial phenotype including inhibition of intramembrane proteolysis. The molecule(s transported by Ecs is (are still unknown.In this study we mutated the ecsAB operon in two Staphylococcus aureus strains, Newman and LS-1. Phenotypic and functional characterization of these Ecs deficient mutants revealed a defect in growth, increased autolysis and lysostaphin sensitivity, altered composition of cell wall proteins including the precursor form of staphylokinase and an altered bacterial surface texture. DNA microarray analysis indicated that the Ecs deficiency changed expression of the virulence factor regulator protein Rot accompanied by differential expression of membrane transport proteins, particularly ABC transporters and phosphate-specific transport systems, protein A, adhesins and capsular polysaccharide biosynthesis proteins. Virulence of the ecs mutants was studied in a mouse model of hematogenous S. aureus infection. Mice inoculated with the ecs mutant strains developed markedly milder infections than those inoculated with the wild-type strains and had consequently lower mortality, less weight loss, milder arthritis and decreased persistence of staphylococci in the kidneys. The ecs mutants had higher susceptibility to ribosomal antibiotics and plant alkaloids chelerythrine and sanguinarine.Our results show that Ecs is essential for staphylococcal virulence and antimicrobial resistance probably since the transport function of Ecs is essential for the normal structure and function of the cell wall. Thus targeting Ecs may be a new approach in combating staphylococcal infection.
Jonsson, Ing-Marie; Juuti, Jarmo T; François, Patrice; AlMajidi, Rana; Pietiäinen, Milla; Girard, Myriam; Lindholm, Catharina; Saller, Manfred J; Driessen, Arnold J M; Kuusela, Pentti; Bokarewa, Maria; Schrenzel, Jacques; Kontinen, Vesa P
2010-12-02
Ecs is an ATP-binding cassette (ABC) transporter present in aerobic and facultative anaerobic gram-positive Firmicutes. Inactivation of Bacillus subtilis Ecs causes pleiotropic changes in the bacterial phenotype including inhibition of intramembrane proteolysis. The molecule(s) transported by Ecs is (are) still unknown. In this study we mutated the ecsAB operon in two Staphylococcus aureus strains, Newman and LS-1. Phenotypic and functional characterization of these Ecs deficient mutants revealed a defect in growth, increased autolysis and lysostaphin sensitivity, altered composition of cell wall proteins including the precursor form of staphylokinase and an altered bacterial surface texture. DNA microarray analysis indicated that the Ecs deficiency changed expression of the virulence factor regulator protein Rot accompanied by differential expression of membrane transport proteins, particularly ABC transporters and phosphate-specific transport systems, protein A, adhesins and capsular polysaccharide biosynthesis proteins. Virulence of the ecs mutants was studied in a mouse model of hematogenous S. aureus infection. Mice inoculated with the ecs mutant strains developed markedly milder infections than those inoculated with the wild-type strains and had consequently lower mortality, less weight loss, milder arthritis and decreased persistence of staphylococci in the kidneys. The ecs mutants had higher susceptibility to ribosomal antibiotics and plant alkaloids chelerythrine and sanguinarine. Our results show that Ecs is essential for staphylococcal virulence and antimicrobial resistance probably since the transport function of Ecs is essential for the normal structure and function of the cell wall. Thus targeting Ecs may be a new approach in combating staphylococcal infection.
Geology, Surficial - MO 2012 Springfield 100Yr Flood Sinkholes (SHP)
NSGIC State | GIS Inventory — The layer "100 Yr Flood Sinkholes" is an shapefile feature showing the location of many of the sinkholes found in the Springfield Missouri area. Each of the polygons...
Shu, Qian; Koo, Bonyoung; Yarwood, Greg; Henderson, Barron H.
2017-12-01
Differences between two air quality modeling systems reveal important uncertainties in model representations of secondary organic aerosol (SOA) fate. Two commonly applied models (CMAQ: Community Multiscale Air Quality; CAMx: Comprehensive Air Quality Model with extensions) predict very different OA concentrations over the eastern U.S., even when using the same source data for emissions and meteorology and the same SOA modeling approach. Both models include an option to output a detailed accounting of how each model process (e.g., chemistry, deposition, etc.) alters the mass of each modeled species, referred to as process analysis. We therefore perform a detailed diagnostic evaluation to quantify simulated tendencies (Gg/hr) of each modeled process affecting both the total model burden (Gg) of semi-volatile organic compounds (SVOC) in the gas (g) and aerosol (a) phases and the vertical structures to identify causes of concentration differences between the two models. Large differences in deposition (CMAQ: 69.2 Gg/d; CAMx: 46.5 Gg/d) contribute to significant OA bias in CMAQ relative to daily averaged ambient concentration measurements. CMAQ's larger deposition results from faster daily average deposition velocities (VD) for both SVOC (g) (VD,cmaq = 2.15 × VD,camx) and aerosols (VD,cmaq = 4.43 × Vd,camx). Higher aerosol deposition velocity would be expected to cause similar biases for inert compounds like elemental carbon (EC), but this was not seen. Daytime low-biases in EC were also simulated in CMAQ as expected but were offset by nighttime high-biases. Nighttime high-biases were a result of overly shallow mixing in CMAQ leading to a higher fraction of EC total atmospheric mass in the first layer (CAMx: 5.1-6.4%; CMAQ: 5.6-6.9%). Because of the opposing daytime and nighttime biases, the apparent daily average bias for EC is reduced. For OA, there are two effects of reduced vertical mixing: SOA and SVOC are concentrated near the surface, but SOA yields are reduced
International Nuclear Information System (INIS)
Charrault, J.C.
1991-01-01
Nuclear power accounts for some 35% of electricity production in the European Community (EC). Using a mathematical analysis, based on different scenarios, i.e. low/high electricity demand and nuclear moratorium/revival, various demand forecasts are made. A pragmatic approach, considering conventional power generation pollution problems, forecasts a revival of nuclear power
Mathematical modeling improves EC50 estimations from classical dose-response curves.
Nyman, Elin; Lindgren, Isa; Lövfors, William; Lundengård, Karin; Cervin, Ida; Sjöström, Theresia Arbring; Altimiras, Jordi; Cedersund, Gunnar
2015-03-01
The β-adrenergic response is impaired in failing hearts. When studying β-adrenergic function in vitro, the half-maximal effective concentration (EC50 ) is an important measure of ligand response. We previously measured the in vitro contraction force response of chicken heart tissue to increasing concentrations of adrenaline, and observed a decreasing response at high concentrations. The classical interpretation of such data is to assume a maximal response before the decrease, and to fit a sigmoid curve to the remaining data to determine EC50 . Instead, we have applied a mathematical modeling approach to interpret the full dose-response curve in a new way. The developed model predicts a non-steady-state caused by a short resting time between increased concentrations of agonist, which affect the dose-response characterization. Therefore, an improved estimate of EC50 may be calculated using steady-state simulations of the model. The model-based estimation of EC50 is further refined using additional time-resolved data to decrease the uncertainty of the prediction. The resulting model-based EC50 (180-525 nm) is higher than the classically interpreted EC50 (46-191 nm). Mathematical modeling thus makes it possible to re-interpret previously obtained datasets, and to make accurate estimates of EC50 even when steady-state measurements are not experimentally feasible. The mathematical models described here have been submitted to the JWS Online Cellular Systems Modelling Database, and may be accessed at http://jjj.bio.vu.nl/database/nyman. © 2015 FEBS.
ST ECS error handling and detector safety
Esperante Pereira, D
2010-01-01
This note describes the automatic operation sequences that the ECS implements in order to operate the ST detector in a safe and reliable way. First, the start-up sequences to set the detector in a well known state are described. In addition the possible ST detector states based on the status of the different detector elements will be defined. The states are of crucial interest for the safe operation of the detector when the LHC beam is ready. Besides, the ECS automatic actions taken in case of abnormal status of any of the detector elements are reported. Next, the operational alarm ranges and the error recovery mechanisms are mentioned.
Formation of secondary organic aerosol from isoprene oxidation over Europe
Directory of Open Access Journals (Sweden)
M. Karl
2009-09-01
Full Text Available The role of isoprene as a precursor to secondary organic aerosol (SOA over Europe is studied with the two-way nested global chemistry transport model TM5. The inclusion of the formation of SOA from isoprene oxidation in our model almost doubles the atmospheric burden of SOA over Europe compared to SOA formation from terpenes and aromatics. The reference simulation, which considers SOA formation from isoprene, terpenes and aromatics, predicts a yearly European production rate of 1.0 Tg SOA yr−1 and an annual averaged atmospheric burden of about 50 Gg SOA over Europe. A fraction of 35% of the SOA produced in the boundary layer over Europe is transported to higher altitudes or to other world regions. Summertime measurements of organic matter (OM during the extensive EMEP OC/EC campaign 2002/2003 are better reproduced when SOA formation from isoprene is taken into account, reflecting also the strong seasonality of isoprene and other biogenic volatile organic compounds (BVOC emissions from vegetation. However, during winter, our model strongly underestimates OM, likely caused by missing wood burning in the emission inventories. Uncertainties in the parameterisation of isoprene SOA formation have been investigated. Maximum SOA production is found for irreversible sticking (non-equilibrium partitioning of condensable vapours on particles, with tropospheric SOA production over Europe increased by a factor of 4 in summer compared to the reference case. Completely neglecting SOA formation from isoprene results in the lowest estimate (0.51 Tg SOA yr−1. The amount and the nature of the absorbing matter are shown to be another key uncertainty when predicting SOA levels. Consequently, smog chamber experiments on SOA formation should be performed with different types of seed aerosols and without seed aerosols in order to derive an improved treatment of the absorption of SOA in the models. Consideration of a number of recent insights
Vargas García, Cynthia E.; Petrova, Mariya; Claes, Ingmar J. J.; De Boeck, Ilke; Verhoeven, Tine L. A.; Dilissen, Ellen; von Ossowski, Ingemar; Palva, Airi; Bullens, Dominique M.; Vanderleyden, Jos
2015-01-01
Recently, spaCBA-encoded pili on the cell surface of Lactobacillus rhamnosus GG were identified to be key molecules for binding to human intestinal mucus and Caco-2 intestinal epithelial cells. Here, we investigated the role of the SpaCBA pilus of L. rhamnosus GG in the interaction with macrophages in vitro by comparing the wild type with surface mutants. Our results show that SpaCBA pili play a significant role in the capacity for adhesion to macrophages and also promote bacterial uptake by these phagocytic cells. Interestingly, our data suggest that SpaCBA pili also mediate anti-inflammatory effects by induction of interleukin-10 (IL-10) mRNA and reduction of interleukin-6 (IL-6) mRNA in a murine RAW 264.7 macrophage cell line. These pili appear to mediate these effects indirectly by promoting close contact with the macrophages, facilitating the exertion of anti-inflammatory effects by other surface molecules via yet unknown mechanisms. Blockage of complement receptor 3 (CR3), previously identified to be a receptor for streptococcal pili, significantly decreased the uptake of pilus-expressing strains in RAW 264.7 cells, while the expression of IL-10 and IL-6 mRNA by these macrophages was not affected by this blocking. On the other hand, blockage of Toll-like receptor 2 (TLR2) significantly reduced the expression of IL-6 mRNA irrespective of the presence of pili. PMID:25576613
The EC6 - an enhanced mid-sized reactor with fuel cycle applications
International Nuclear Information System (INIS)
Soulard, M.; Yu, S.; Hopwood, J.; Hastings, I.J.
2011-01-01
Atomic Energy of Canada Limited (AECL) has two CANDU reactor products matched to markets: the Enhanced CANDU 6 (EC6), a modern 700 MWe-class design, and the Advanced CANDU Reactor (ACR-1000), a 1200 MWe-class Gen III+ design. Both reactor types are designed to meet both market-, and customer-driven needs; the ACR-1000 design is 90% complete and market-ready. The EC6 incorporates the CANDU 6's well-proven features, and adds enhancements that make the reactor even safer and easier to operate. The EC6 is the only mid-sized reactor with a proven pedigree that meets modern reactor expectations and regulatory standards. It is sized for smaller grids and also has outstanding fuel-cycle capability. The EC6 has domestic and offshore market pull and is the current focus of AECL's development program; market interest in the ACR-1000 is anticipated in the longer term. Some of the key features incorporated into the EC6 include upgrading containment and seismic capability to meet modern standards, shortening the overall project schedule, addressing obsolescence issues, optimizing maintenance outages and incorporating lessons learnt through feedback obtained from the operating plants. The EC6 utilizes modern computers and a distributed control system housed in an advanced control room which, along with automated testing and on-line diagnostics, make the plant easier and safer to operate, with minimal operator intervention. The first deployment of the EC6 is anticipated in Canada; off-shore markets are also being pursued. The EC6 burns natural uranium as standard. But, high neutron economy, on-power refuelling, a simple fuel bundle, and the fundamental CANDU fuel channel design provide the EC6 with the flexibility to accommodate a range of advanced fuels. (author)
Boontiam, Waewaree; Shin, Yongjin; Choi, Hong Lim; Kumari, Priyanka
2016-01-01
The goal of this study was to estimate the emissions of greenhouse gases (GHG), namely methane (CH4), nitrous oxide (N2O), and carbon dioxide (CO2) from poultry and pig production in South Korea over the last 10 years (2005 through 2014). The calculations of GHG emissions were based on Intergovernmental Panel on Climate Change (IPCC) guidelines. Over the study period, the CH4 emission from manure management decreased in layer chickens, nursery to finishing pigs and gestating to lactating sows, but there was a gradual increase in CH4 emission from broiler chickens and male breeding pigs. Both sows and nursery to finishing pigs were associated with greater emissions from enteric fermentation than the boars, especially in 2009. Layer chickens produced lower direct and indirect N2O emissions from 2009 to 2014, whereas the average direct and indirect N2O emissions from manure management for broiler chickens were 12.48 and 4.93 Gg CO2-eq/yr, respectively. Annual direct and indirect N2O emissions for broiler chickens tended to decrease in 2014. Average CO2 emission from direct on-farm energy uses for broiler and layer chickens were 46.62 and 136.56 Gg CO2-eq/yr, respectively. For pig sectors, the N2O emission from direct and indirect sources gradually increased, but they decreased for breeding pigs. Carbon dioxide emission from direct on-farm energy uses reached a maximum of 53.93 Gg CO2-eq/yr in 2009, but this total gradually declined in 2010 and 2011. For boars, the greatest CO2 emission occurred in 2012 and was 9.44 Gg CO2-eq/yr. Indirect N2O emission was the largest component of GHG emissions in broilers. In layer chickens, the largest contributing factor to GHG emissions was CO2 from direct on-farm energy uses. For pig production, the largest component of GHG emissions was CH4 from manure management, followed by CO2 emission from direct on-farm energy use and CH4 enteric fermentation emission, which accounted for 8.47, 2.85, and 2.82 Gg-CO2/yr, respectively. The
Directory of Open Access Journals (Sweden)
Waewaree Boontiam
2016-12-01
Full Text Available The goal of this study was to estimate the emissions of greenhouse gases (GHG, namely methane (CH4, nitrous oxide (N2O, and carbon dioxide (CO2 from poultry and pig production in South Korea over the last 10 years (2005 through 2014. The calculations of GHG emissions were based on Intergovernmental Panel on Climate Change (IPCC guidelines. Over the study period, the CH4 emission from manure management decreased in layer chickens, nursery to finishing pigs and gestating to lactating sows, but there was a gradual increase in CH4 emission from broiler chickens and male breeding pigs. Both sows and nursery to finishing pigs were associated with greater emissions from enteric fermentation than the boars, especially in 2009. Layer chickens produced lower direct and indirect N2O emissions from 2009 to 2014, whereas the average direct and indirect N2O emissions from manure management for broiler chickens were 12.48 and 4.93 Gg CO2-eq/yr, respectively. Annual direct and indirect N2O emissions for broiler chickens tended to decrease in 2014. Average CO2 emission from direct on-farm energy uses for broiler and layer chickens were 46.62 and 136.56 Gg CO2-eq/yr, respectively. For pig sectors, the N2O emission from direct and indirect sources gradually increased, but they decreased for breeding pigs. Carbon dioxide emission from direct on-farm energy uses reached a maximum of 53.93 Gg CO2-eq/yr in 2009, but this total gradually declined in 2010 and 2011. For boars, the greatest CO2 emission occurred in 2012 and was 9.44 Gg CO2-eq/yr. Indirect N2O emission was the largest component of GHG emissions in broilers. In layer chickens, the largest contributing factor to GHG emissions was CO2 from direct on-farm energy uses. For pig production, the largest component of GHG emissions was CH4 from manure management, followed by CO2 emission from direct on-farm energy use and CH4 enteric fermentation emission, which accounted for 8.47, 2.85, and 2.82 Gg-CO2/yr
Sedimentary Evidence for a Rapid Sea Level Rise at 7,600 cal yr BP from North-Central Cuba
Peros, M. C.; Agosta G'meiner, A. M.; Collins, S.
2016-12-01
A lack of high-resolution relative sea level (RSL) proxy data has meant that the pattern of early Holocene RSL change in the Caribbean is poorly understood. A RSL curve published by Toscano and Macintyre (2003) using inter-tidal mangrove peats and submerged corals suggests RSL underwent a relatively fast and `smooth' curvilinear increase during the Holocene. However, others, such as Blanchon and Shaw (1995), suggest that RSL increased rapidly at around 7600 cal yr BP, in response to the final stages of the melting of the Laurentide Ice Sheet (melt water pulse 1C or catastrophic rise event 3). We investigated this question using multi-proxy data from a flooded sinkhole (Cenote Jennifer) on the north coast of central Cuba. Cenote Jennifer is located 7 m above mean sea level and 2 km from the Bahamas Channel and appears to have a high degree of connectivity with the ocean through a network of underground caverns. The water depth is 13 m and the bottommost 5 m is anoxic. A sediment core collected from Cenote Jennifer was studied using loss-on-ignition, pollen analysis, high-resolution XRF core-scanning, and grain size analysis. An age-depth model was generated for the core by AMS dating. The results show that the bottommost stratigraphic unit ( 9000 to 7600 cal yr BP) is a fine-grained carbonate-rich mud (i.e., marl). This unit abruptly transitions into finely laminated organic-rich sediment from 7600 cal yr BP to the present. The pollen analysis shows that the sinkhole supported a cattail (Typha) community until 7600 cal yr BP, indicating low water levels ( 1 m). At 7600 cal yr BP, the cattail community disappeared and the vegetation of the surrounding bedrock became dominated by a thorny coastal scrubland. In addition, a 3 cm thick fining-upward siliciclastic unit is present immediately above the marl-organic contact, suggesting: 1) a marine sediment source given the limestone-dominated nature of the region, and 2) the presence of a short-duration, high
The shift of energy regulatory powers under the framework of Directive 2009/72/EC
International Nuclear Information System (INIS)
Grimm, N. S.
2011-01-01
The paper examines the powers of Member States' national regulatory authorities under the framework of Directive 2009/72/EC of the European Parliament and of the Council of 13 July 2009 concerning common rules for the internal market in electricity and repealing Directive 2003/54/EC (OJEU L 176/37) and analyses the implications of framework of Directive 2009/72/EC on the national laws of the Member States, in particular on the Austrian and German constitutional, administrative and energy laws. The Introductory Part gives a historical overview of the development of national energy regulators under European energy legislation. This Part shows that the national regulatory authorities attract increased attention and that their regulatory powers are on a constant rise. In order to understand the huge impact of the framework of Directive 2009/72/EC on the regulatory regimes of the Member States, this Part briefly examines the former and current powers of the national energy regulators under Austrian and German law. Part Two analyses whether the powers conferred upon national energy regulators under the framework of Directive 2009/72/EC have been enhanced in comparison to those established under the framework of Directive 2003/54/EC. The main focus lies thereby on the propositions made by the European Commission in its Proposal for a Directive of the European Parliament and of the Council amending Directive 2003/54/EC concerning common rules for the internal market in electricity (COM (2007) 528 final, 2.1) and laid down in Directive 2009/72/EC. Part Two comes to the conclusion that the powers of the national energy regulators under the framework of Directive 2009/72/EC have indeed been enhanced in comparison to former regime of Directive 2003/54/EC. Part Three demonstrates that the enhancement of national energy regulators' powers does not benefit the Member States. On the contrary, they lose considerable powers of control over their own national energy regulators. While
ICECAP: an integrated, general-purpose, automation-assisted IC50/EC50 assay platform.
Li, Ming; Chou, Judy; King, Kristopher W; Jing, Jing; Wei, Dong; Yang, Liyu
2015-02-01
IC50 and EC50 values are commonly used to evaluate drug potency. Mass spectrometry (MS)-centric bioanalytical and biomarker labs are now conducting IC50/EC50 assays, which, if done manually, are tedious and error-prone. Existing bioanalytical sample preparation automation systems cannot meet IC50/EC50 assay throughput demand. A general-purpose, automation-assisted IC50/EC50 assay platform was developed to automate the calculations of spiking solutions and the matrix solutions preparation scheme, the actual spiking and matrix solutions preparations, as well as the flexible sample extraction procedures after incubation. In addition, the platform also automates the data extraction, nonlinear regression curve fitting, computation of IC50/EC50 values, graphing, and reporting. The automation-assisted IC50/EC50 assay platform can process the whole class of assays of varying assay conditions. In each run, the system can handle up to 32 compounds and up to 10 concentration levels per compound, and it greatly improves IC50/EC50 assay experimental productivity and data processing efficiency. © 2014 Society for Laboratory Automation and Screening.
On the practical exploitability of dual EC in TLS implementations
Checkoway, S.; Fredrikson, M.; Niederhagen, R.F.; Everspaugh, A.; Green, M.; Lange, T.; Ristenpart, T.; Bernstein, D.J.; Maskiewicz, J,; Shacham, H.
2014-01-01
This paper analyzes the actual cost of attacking TLS implementations that use NIST’s Dual EC pseudorandom number generator, assuming that the attacker generated the constants used in Dual EC. It has been known for several years that an attacker generating these constants and seeing a long enough
EC6 safety enhancement - including impact of Fukushima lessons learned
Energy Technology Data Exchange (ETDEWEB)
Yu, S.; Zemdegs, R.; Boyle, S.; Soulard, M., E-mail: stephen.yu@candu.com [Candu Energy Inc., Mississauga, Ontario (Canada)
2012-09-15
The Enhanced CANDU 6 (EC6) is the new Generation III CANDU reactor design that meets the most up to date regulatory requirements and customer expectations. EC6 builds on the proven high performance design inch as the Qinshan CANDU 6 units and has made improvements to safety and operational performance, and has incorporated extensive operational feedback including Fukushima. The Fukushima Dai-ichi March 11, 2011 event has demonstrated the importance of defence-in-depth considerations for beyond-design basis events, including severe accidents. The EC6 design is based on the defence-in-depth principles and provides further design features that address the lessons learned from Fukushima. (author)
Tasmaloum, Vanuatu Fossil Coral SST Reconstruction for 4200 YrBP
National Oceanic and Atmospheric Administration, Department of Commerce — Vanuatu Fossil Coral SST Reconstruction, 4200 YrBP. Paleobathymetry estimated at 10-15 m. SST reconstruction is based on the analysis of Sr/Ca and U/Ca ratios in...
Kajjari, Praveen B; Manjeshwar, Lata S; Aminabhavi, Tejraj M
2012-12-01
This paper reports the preparation and characterization of novel pH- and thermo-responsive blend hydrogel microspheres of sodium alginate (NaAlg) and poly(N-isopropylacrylamide)(PNIPAAm)-grafted-guar gum (GG) i.e., PNIPAAm-g-GG by emulsion cross-linking method using glutaraldehyde (GA) as a cross-linker. Isoniazid (INZ) was chosen as the model antituberculosis drug to achieve encapsulation up to 62%. INZ has a plasma half-life of 1.5 h, whose release was extended up to 12 h. Fourier transform infrared spectroscopy was used to confirm the grafting reaction and chemical stability of INZ during the encapsulation. Differential scanning calorimetry was used to investigate the drug's physical state, while powder X-ray diffraction confirmed the molecular level dispersion of INZ in the matrix. Scanning electron microscopy confirmed varying surface morphologies of the drug-loaded microspheres. Temperature- and pH-responsive nature of the blend hydrogel microspheres were investigated by equilibrium swelling, and in vitro release experiments were performed in pH 1.2 and pH 7.4 buffer media at 37°C as well as at 25°C. Kinetics of INZ release was analyzed by Ritger-Peppas empirical equation to compute the diffusional exponent parameter (n), whose value ranged between 0.27 and 0.58, indicating the release of INZ follows a diffusion swelling controlled release mechanism.
MAPPING CO GAS IN THE GG TAURI A TRIPLE SYSTEM WITH 50 au SPATIAL RESOLUTION
International Nuclear Information System (INIS)
Tang, Ya-Wen; Dutrey, Anne; Guilloteau, Stéphane; Di Folco, Emmanuel; Huré, Jean-Marc; Pierens, Arnaud; Chapillon, Edwige; Pietu, Vincent; Gueth, Fréderic; Bary, Jeff; Beck, Tracy; Beust, Hervé; Boehler, Yann; Simon, Michal
2016-01-01
We aim to unveil the observational imprint of physical mechanisms that govern planetary formation in the young, multiple system GG Tau A. We present ALMA observations of 12 CO and 13 CO 3–2 and 0.9 mm continuum emission with 0.″35 resolution. The 12 CO 3–2 emission, found within the cavity of the circumternary dust ring (at radius <180 au) where no 13 CO emission is detected, confirms the presence of CO gas near the circumstellar disk of GG Tau Aa. The outer disk and the recently detected hot spot lying at the outer edge of the dust ring are mapped both in 12 CO and 13 CO. The gas emission in the outer disk can be radially decomposed as a series of slightly overlapping Gaussian rings, suggesting the presence of unresolved gaps or dips. The dip closest to the disk center lies at a radius very close to the hot spot location at ∼250–260 au. The CO excitation conditions indicate that the outer disk remains in the shadow of the ring. The hot spot probably results from local heating processes. The two latter points reinforce the hypothesis that the hot spot is created by an embedded proto-planet shepherding the outer disk
Lebeer, S.; Claes, I.J.; Tytgat, H.L.P.; Verhoeven, T.L.A.; Marien, E.; Ossowski, von I.; Reunanen, J.; Palva, A.; Vos, de W.M.; Keersmaecker, de S.C.; Vanderleyden, J.
2012-01-01
Lactobacillus rhamnosus GG, a probiotic with good survival capacity in the human gut, has well-documented adhesion properties and health effects. Recently, spaCBA-encoded pili that bind to human intestinal mucus were identified on its cell surface. Here, we report on the phenotypic analysis of a
Behzadi, Elham; Mahmoodzadeh Hosseini, Hamideh; Imani Fooladi, Abbas Ali
2017-09-01
Bacterial extracellular vesicles (EVs) have come forth into notice as possible important agent to mediate host-pathogen interactions. In this scientific research, the authors have tried to find out the effect of EVs derived from Lactobacillus rhamnosus GG (LDEVs) on the apoptosis induction in HepG2 cell line. The EVs were purified from the conditioned medium of Lactobacillus rhamnosus GG using ultrafiltration and confirmed by transmission electron microscopy (TEM). The HepG2 cells were treated with different concentrations of purified LDEVs and the cytotoxicity and their effects on the expression of bcl-2 and bax genes were assessed by the MTT assay and semi-quantitative RT-PCR, respectively. The MTT assay showed that only 100 μg/ml of LDEVs had a significant cytotoxic effect on cancer cells (p < 0.05). The apoptotic index (bax/bcl2 expression ratio) was significantly increased after treating with 50 and 100 μg/ml LDEVs (p < 0.05). Increased bax/bcl-2 ratio was led to cancer cell death. Copyright © 2017 Elsevier Ltd. All rights reserved.
Fischer, Nina M; Favrot, Claude; Birkmann, Katharina; Jackson, Michele; Schwarzwald, Colin C; Müller, Martin; Tobler, Kurt; Geisseler, Marco; Lange, Christian E
2014-06-01
The DNA of equine papillomavirus type 2 (EcPV2) is consistently found in equine papillomas and squamous cell carcinomas, indicating a causal association of EcPV2 in the pathogenesis of these tumours; however, little is known about the prevalence of this virus. The aim of this study was to determine the geno- and seroprevalence of EcPV2 in clinically healthy horses in Switzerland. Fifty horses presented to the equine department of the university clinic, displaying no skin or mucous membrane lesions or severe signs of other diseases, were sampled. Cytobrush samples from the penis or vulva and serum samples were collected. To determine the genoprevalence of EcPV2, DNA was extracted from cytobrush samples and tested for viral DNA with a PCR assay amplifying a 338 bp fragment of the E7/E1 region of the viral genome. Seroprevalence was tested using an enzyme-linked immunosorbent assay aimed to detect antibodies against the major capsid protein (L1) of EcPV2. In five of 50 horses (10%), EcPV2-specific DNA was amplified but no antibodies could be detected, whereas in 14 of 50 horses (28%), antibodies against EcPV2 but no DNA were demonstrated. Both antibodies and viral DNA were detected in four of 50 horses (8%). Neither antibodies nor viral DNA were found in 27 of 50 horses (54%). The seroprevalence suggests that EcPV2 is prevalent in the Swiss equine population, while the genoprevalence indicates that currently ongoing infections are less common. The discrepancy between geno- and seroprevalence probably indicates different stages of infection in the tested cohort. © 2014 ESVD and ACVD.
Utgikar, V P; Chen, B Y; Chaudhary, N; Tabak, H H; Haines, J R; Govind, R
2001-12-01
Acid mine drainage from abandoned mines and acid mine pit lakes is an important environmental concern and usually contains appreciable concentrations of heavy metals. Because sulfate-reducing bacteria (SRB) are involved in the treatment of acid mine drainage, knowledge of acute metal toxicity levels for SRB is essential for the proper functioning of the treatment system for acid mine drainage. Quantification of heavy metal toxicity to mixed cultures of SRB is complicated by the confounding effects of metal hydroxide and sulfide precipitation, biosorption, and complexation with the constituents of the reaction matrix. The objective of this paper was to demonstrate that measurements of dissolved metal concentrations could be used to determine the toxicity parameters for mixed cultures of sulfate-reducing bacteria. The effective concentration, 100% (EC100), the lowest initial dissolved metal concentrations at which no sulfate reduction is observed, and the effective concentration, 50% (EC50), the initial dissolved metal concentrations resulting in a 50% decrease in sulfate reduction, for copper and zinc were determined in the present study by means of nondestructive, rapid physical and chemical analytical techniques. The reaction medium used in the experiments was designed specifically (in terms of pH and chemical composition) to provide the nutrients necessary for the sulfidogenic activity of the SRB and to preclude chemical precipitation of the metals under investigation. The toxicity-mitigating effects of biosorption of dissolved metals were also quantified. Anaerobic Hungate tubes were set up (at least in triplicate) and monitored for sulfate-reduction activity. The onset of SRB activity was detected by the blackening of the reaction mixture because of formation of insoluble ferrous sulfide. The EC100 values were found to be 12 mg/L for copper and 20 mg/L for zinc. The dissolved metal concentration measurements were effective as the indicators of the effect of the
Directory of Open Access Journals (Sweden)
Özgür GÜNAL
2017-12-01
Full Text Available Objective: We aimed to review the influence of host genetic factors on the clinical course, treatment response as well as fibrosis progression in patients with viral hepatitis C genotype 1. Materials and Methods: Ninety-five patients with chronic hepatitis C virus (HCV infection and 97 controls were enrolled. The patients received pegylated interferon (Peg-IFN+ribavirin therapy for 48 weeks and were followed up for the next 48 weeks. Aspartat aminotransferase/platelet ratio (APRI was used to detect liver fibrosis DNA specimens were extracted from the peripheral blood mononuclear cells and the tumor necrosis factor-alpha (TNF-α 308 rs3091256 was genotyped by the polymerase chain reaction-restriction fragment length polymorphism method. Results: All patients included in the study were infected with HCV genotype 1. of the 95 HCV-positive patients, spontaneous viral clearence was observed in 25.5%, rapid viral response in 44.2%, early viral response in 91.8%, and sustained viral response was found in 73.3% of patients. The allele and genotype were not significant between patients and controls. There was no significant difference in virologic response as well. However, TNF-α-308 single nucleotide polymorphisms (SNP rs3091256 GG genotype was strongly associated with fibrosis and alanine aminotransferase (ALT levels (p=0.006 and p=0.017, respectively. Conclusion: TNF-α-308 polymorphisms may reveal different results among countries. Patients having SNP rs3091256 GG are prone to have higher ALT levels and fibrosis score but have better treatment outcome.
EC environmental legislation and the European oil industry
International Nuclear Information System (INIS)
Luding, W.G.
1993-01-01
EUROPIA has 32 ordinary member companies which own and operate more than 95% of EC refining capacity, plus three associate member companies from EFTA countries. A large part of EUROPIA's efforts is devoted to environmental issues. Among its initial actions, EUROPIA developed Guiding Principles for environmental management which have been adopted by all member companies. This article can only highlight some of the key areas of EC environmental policy of interest to the oil industry. Most of the comments will refer to air pollution issues but, of course, water and ground pollution and waste are equally important subjects. (orig./HS)
Kinetic study on ligand exchange reaction between EC and 99mTc-GH
International Nuclear Information System (INIS)
Wu Chunying; Luo Shineng; Fang Ping; Huang Heyun; Xie Minhao; Meng Hong
1995-01-01
The ligand exchange reaction between EC and 99m Tc-GH and its influence factors such as concentrations of EC and pH were described. The concentration of EC has no influence on the exchange reaction rate constant, while pH is the most important influence factor. The rate constants of ligand exchange reaction at different pH values were determined. The results showed that in order to make the labelling yield of 99m Tc-EC higher than 90%, pH of the reaction must be higher than 8
Fei, Xuehai; Jin, Yanqiang; Zhang, Yiping; Sha, Liqing; Liu, Yuntong; Song, Qinghai; Zhou, Wenjun; Liang, Naishen; Yu, Guirui; Zhang, Leiming; Zhou, Ruiwu; Li, Jing; Zhang, Shubin; Li, Peiguang
2017-02-01
Savanna ecosystems play a crucial role in the global carbon cycle. However, there is a gap in our understanding of carbon fluxes in the savanna ecosystems of Southeast Asia. In this study, the eddy covariance technique (EC) and the biometric-based method (BM) were used to determine carbon exchange in a savanna ecosystem in Southwest China. The BM-based net ecosystem production (NEP) was 0.96 tC ha-1 yr-1. The EC-based estimates of the average annual gross primary productivity (GPP), ecosystem respiration (Reco), and net ecosystem carbon exchange (NEE) were 6.84, 5.54, and -1.30 tC ha-1 yr-1, respectively, from May 2013 to December 2015, indicating that this savanna ecosystem acted as an appreciable carbon sink. The ecosystem was more efficient during the wet season than the dry season, so that it represented a small carbon sink of 0.16 tC ha-1 yr-1 in the dry season and a considerable carbon sink of 1.14 tC ha-1 yr-1 in the wet season. However, it is noteworthy that the carbon sink capacity may decline in the future under rising temperatures and decreasing rainfall. Consequently, further studies should assess how environmental factors and climate change will influence carbon-water fluxes.
Directory of Open Access Journals (Sweden)
Ryoichiro Nishibayashi
Full Text Available Interleukin-12 (IL-12 is an important cytokine for the immunomodulatory effects of lactic acid bacteria (LAB. Using murine immune cells, we previously reported that the RNA of Enterococcus faecalis EC-12, a LAB strain exerting probiotic-like beneficial effects, is the major IL-12-inducing immunogenic component. However, it was recently revealed that bacterial RNA can be a ligand for Toll-like receptor (TLR 13, which is only expressed in mice. Because TLR13 is not expressed in humans, the immuno-stimulatory and -modulatory effects of LAB RNA in human cells should be augmented excluding TLR13 contribution. In experiment 1 of this study, the role of LAB RNA in IL-12 induction in human immune cells was studied using three LAB strains, E.faecalis EC-12, Lactobacillus gasseri JCM5344, and Bifidobacterium breve JCM1192. RNase A treatment of heat-killed LAB significantly decreased the IL-12 production of human peripheral blood mononuclear cells on stimulation, while RNase III treatment revealed virtually no effects. Further, IL-12 production against heat-killed E. faecalis EC-12 was abolished by depleting monocytes. These results demonstrated that single stranded RNA (ssRNA of LAB is a strong inducer of IL-12 production from human monocytes. In experiment 2, major receptor for ssRNA of E. faecalis EC-12 was identified using THP-1 cells, a human monocytic cell line. The type of RNA molecules of E. faecalis EC-12 responsible for IL-12 induction was also identified. IL-12 production induced by the total RNA of E. faecalis EC-12 was significantly reduced by the treatment of siRNA for TLR8 but not for TLR7. Furthermore, both 23S and 16S rRNA, but not mRNA, of E. faecalis EC-12 markedly induced IL-12 production from THP-1 cells. These results suggested that the recognition of ssRNA of E. faecalis EC-12 was mediated by TLR8 and that rRNA was the RNA molecule that exhibited IL-12-inducing ability in human cells.
Tracking of leisure time physical activity during 28 yr in adults: the Tromsø study.
Morseth, Bente; Jørgensen, Lone; Emaus, Nina; Jacobsen, Bjarne K; Wilsgaard, Tom
2011-07-01
Physical activity plays an important role in the prevention of many serious diseases. To develop targeted strategies that encourage physical activity, knowledge of stability of physical activity levels over time is essential. The aim of this study was to examine tracking of leisure time physical activity in adults in Northern Norway during three decades. We followed 5432 women and men who attended the Tromsø Study in 1979-1980, as well as repeated examinations after 7 and 28 yr. Baseline age was 20-54 yr (mean age=35.8 yr). Physical activity was assessed by self-administered questionnaires. Tracking of physical activity, defined as maintenance of relative rank of physical activity level, was estimated by Spearman correlation coefficient and by weighted κ statistics. Tracking in terms of predictability of later values from earlier measurements was analyzed by generalized estimating equations. A higher-than-expected proportion of subjects maintained their physical activity level from examination 1 to 2 (58%) and 3 (53%). κ statistics showed agreement of 0.41 and 0.29, respectively. Belonging to a specific physical activity level at baseline increased the odds of belonging to the same category at later examinations (sedentary odds ratio (OR)=3.9 (95% confidence interval (CI)=3.5-4.4), moderately active OR=2.2 (95% CI=2.0-2.4), active OR=2.9 (95% CI=2.6-3.3), and highly active OR=14.0 (95% CI=8.7-22.5)). Being physically active in young adulthood increased the odds of being physically active later in life (moderately active OR=3.4 (95% CI=3.0-3.9), active OR=5.4 (95% CI=4.6-6.4), and highly active OR=13.0 (95% CI=7.4-22.8)). This study showed tracking of leisure time physical activity during 28 yr in a cohort of adults.
Boreddy, Suresh K. R.; Mozammel Haque, M.; Kawamura, Kimitaka
2018-01-01
The present study reports on long-term trends of carbonaceous aerosols in total suspended particulate (TSP) samples collected at Chichijima in the western North Pacific during 2001-2012. Seasonal variations of elemental carbon (EC), organic carbon (OC), and water-soluble organic carbon (WSOC) concentrations showed maxima in winter to spring and minima in summer. These seasonal differences in the concentrations of carbonaceous aerosols were associated with the outflows of polluted air masses from East Asia, which are clearly distinguishable from pristine air masses from the central Pacific. The higher concentrations of carbonaceous aerosols during winter to spring are associated with long-range atmospheric transport of East Asian continental polluted air masses, whereas lower concentrations may be due to pristine air masses from the central Pacific in summer. The annual trends of OC / EC (+0.46 % yr-1), WSOC (+0.18 % yr-1) and WSOC / OC (+0.08 % yr-1) showed significant (p Asia.
Lactobacillus rhamnosus strain GG is a potential probiotic for calves
2004-01-01
Abstract Diarrhea is a common occurrence in neonatal calves. Several veterinary probiotics claiming to prevent or treat calf diarrhea are available, but have not been well studied. This study assessed the capability of Lactobacillus rhamnosus strain GG (LGG) to maintain viability in the gastrointestinal tract of calves. We also determined whether LGG can be administered in an oral rehydration solution (ORS) without compromising the efficacy of the ORS or the viability of LGG, and whether LGG produces D-lactate or not. To investigate the intestinal survival of LGG, 15 calves were randomized into 3 groups and LGG was administered orally with their morning milk feeding on 3 consecutive days at a low (LD), medium (MD), or high (HD) dosage. Fecal samples were collected on days 0 (control), 1, 2, 3, 5, and 7 and incubated for 72 h on deMan, Rogosa, Sharpe agar. Twenty-four hours after the 1st feeding, LGG was recovered from 1 out of 5 calves in the LD group, 4 out of 5 calves in the MD group, and 5 out of 5 calves in the HD group. To determine if LGG caused the glucose levels in the ORS to drop below effective levels, 1.5 L of the ORS was incubated with LGG for 2 h at 37°C and the glucose concentration was measured every 20 min using a glucose meter. This ORS was then further incubated for 10 h and aliquots analyzed by high performance liquid chromatography to determine if D-lactate was produced by LGG. Glucose concentrations did not change over the 2 h of incubation, and no D-lactate was produced after 48 h. The LGG maintained viability in ORS. Therefore, this study demonstrated that LGG survives intestinal transit in the young calf, produces no D-lactate, and can be administered in an ORS. PMID:15581218
A 3500 14C yr High-Resolution Record of Water-Level Changes in Lake Titicaca, Bolivia/Peru
Abbott, Mark B.; Binford, Michael W.; Brenner, Mark; Kelts, Kerry R.
1997-03-01
Sediment cores collected from the southern basin of Lake Titicaca (Bolivia/Peru) on a transect from 4.6 m above overflow level to 15.1 m below overflow level are used to identify a new century-scale chronology of Holocene lake-level variations. The results indicate that lithologic and geochemical analyses on a transect of cores can be used to identify and date century-scale lake-level changes. Detailed sedimentary analyses of subfacies and radiocarbon dating were conducted on four representative cores. A chronology based on 60 accelerator mass spectrometer radiocarbon measurements constrains the timing of water-level fluctuations. Two methods were used to estimate the 14C reservoir age. Both indicate that it has remained nearly constant at ˜250 14C yr during the late Holocene. Core studies based on lithology and geochemistry establish the timing and magnitude of five periods of low lake level, implying negative moisture balance for the northern Andean altiplano over the last 3500 cal yr. Between 3500 and 3350 cal yr B.P., a transition from massive, inorganic-clay facies to laminated organic-matter-rich silts in each of the four cores signals a water-level rise after a prolonged mid-Holocene dry phase. Evidence of other significant low lake levels occurs 2900-2800, 2400-2200, 2000-1700, and 900-500 cal yr B.P. Several of the low lake levels coincided with cultural changes in the region, including the collapse of the Tiwanaku civilization.
International Nuclear Information System (INIS)
Panini, S.R.; Gupta, A.K.; Sexton, R.C.; Parish, E.J.; Rudney, H.
1987-01-01
Treatment of IEC-6 cells with PG caused a strong inhibition of cholesterol biosynthesis at the level of desmosterol reductase. In addition, two new products were observed in PG-treated cells. The first compound was designated as cholesta-5,7,24-trien-3β-ol based on its HPLC chromatographic properties. The second compound was identified as S-EC based on (1) a comparison of its chromatographic properties with those of authentic EC and (2) by its conversion to 25-hydroxycholesterol (HC) upon reduction with LiAlH 4 . In spite of cellular accumulation of S-EC in the presence of PG, the activity of HMG-CoA reductase (HMGR) which is known to be sensitive to oxysterols, was elevated rather than suppressed. On the other hand, when PG-treated cells were refed fresh medium without PG, HMGR activity was suppressed. Exogenous S-EC was a potent suppressor of HMGR in untreated IEC-6 cells. Suppression of HMGR by S-EC but not by HC could be prevented by progesterone. Exogenous [ 3 H]S-EC was not metabolized by IEC-6 cells. These results support the hypothesis that S-EC plays a normal regulatory role in sterol biosynthesis and indicate that enhanced S-EC synthesis observed in the presence of PG may be due to interference with this regulatory action
Deposition of HgTe by electrochemical atomic layer epitaxy (EC-ALE)
CSIR Research Space (South Africa)
Venkatasamy, V
2006-04-01
Full Text Available This paper describes the first instance of HgTe growth by electrochemical atomic layer epitaxy (EC-ALE). EC-ALE is the electrochemical analog of atomic layer epitaxy (ALE) and atomic layer deposition (ALD), all of which are based on the growth...
Analysis of ATLAS FLB-EC6 Experiment using SPACE Code
International Nuclear Information System (INIS)
Lee, Donghyuk; Kim, Yohan; Kim, Seyun
2013-01-01
The new code is named SPACE(Safety and Performance Analysis Code for Nuclear Power Plant). As a part of code validation effort, simulation of ATLAS FLB(Feedwater Line Break) experiment using SPACE code has been performed. The FLB-EC6 experiment is economizer break of a main feedwater line. The calculated results using the SPACE code are compared with those from the experiment. The ATLAS FLB-EC6 experiment, which is economizer feedwater line break, was simulated using the SPACE code. The calculated results were compared with those from the experiment. The comparisons of break flow rate and steam generator water level show good agreement with the experiment. The SPACE code is capable of predicting physical phenomena occurring during ATLAS FLB-EC6 experiment
Directory of Open Access Journals (Sweden)
Wing Sze eHo
2016-01-01
Full Text Available Extraintestinal pathogenic Escherichia coli (ExPEC that causes extraintestinal infections often harbor plasmids encoding fitness traits such as resistance and virulence determinants that are of clinical importance. We determined the complete nucleotide sequence of plasmid pEC302/04 from a multidrug-resistant E. coli EC302/04 which was isolated from the tracheal aspirate of a patient in Malaysia. In addition, we also performed comparative sequence analyses of 18 related IncFIIA plasmids to determine the phylogenetic relationship and diversity of these plasmids. The 140,232 bp pEC302/04 is a multireplicon plasmid that bears three replication systems (FII, FIA and FIB with subtype of F2:A1:B1. The plasmid is self-transmissible with a complete transfer region. pEC302/04 also carries antibiotic resistance genes such as blaTEM-1 and a class I integron containing sul1, cml and aadA resistance genes, conferring multidrug resistance (MDR to its host, E. coli EC302/04. Besides, two iron acquisition systems (SitABCD and IutA-IucABCD which are the conserved virulence determinants of ExPEC-colicin V or B and M (ColV/ColBM-producing plasmids were identified in pEC302/04. Multiple toxin-antitoxin (TA-based addiction systems (i.e., PemI/PemK, VagC/VagD, CcdA/CcdB, and Hok/Sok and a plasmid partitioning system, ParAB and PsiAB, which are important for plasmid maintenance were also found.Comparative plasmid analysis revealed only one conserved gene, the repA1 as the core genome, showing that there is an extensive diversity among the IncFIIA plasmids. The phylogenetic relationship of 18 IncF plasmids based on the core regions revealed that ColV/ColBM-plasmids and non-ColV/ColBM plasmids were separated into two distinct groups. These plasmids, which carry highly diverse genetic contents, are also mosaic in nature. The atypical combination of genetic materials, i.e., the MDR- and ColV/ColBM-plasmid-virulence encoding regions in a single ExPEC plasmid is rare but of
Ho, Wing Sze; Yap, Kien-Pong; Yeo, Chew Chieng; Rajasekaram, Ganeswrie; Thong, Kwai Lin
2015-01-01
Extraintestinal pathogenic Escherichia coli (ExPEC) that causes extraintestinal infections often harbor plasmids encoding fitness traits such as resistance and virulence determinants that are of clinical importance. We determined the complete nucleotide sequence of plasmid pEC302/04 from a multidrug-resistant E. coli EC302/04 which was isolated from the tracheal aspirate of a patient in Malaysia. In addition, we also performed comparative sequence analyses of 18 related IncFIIA plasmids to determine the phylogenetic relationship and diversity of these plasmids. The 140,232 bp pEC302/04 is a multireplicon plasmid that bears three replication systems (FII, FIA, and FIB) with subtype of F2:A1:B1. The plasmid is self-transmissible with a complete transfer region. pEC302/04 also carries antibiotic resistance genes such as bla TEM-1 and a class I integron containing sul1, cml and aadA resistance genes, conferring multidrug resistance (MDR) to its host, E. coli EC302/04. Besides, two iron acquisition systems (SitABCD and IutA-IucABCD) which are the conserved virulence determinants of ExPEC-colicin V or B and M (ColV/ColBM)-producing plasmids were identified in pEC302/04. Multiple toxin-antitoxin (TA)-based addiction systems (i.e., PemI/PemK, VagC/VagD, CcdA/CcdB, and Hok/Sok) and a plasmid partitioning system, ParAB, and PsiAB, which are important for plasmid maintenance were also found. Comparative plasmid analysis revealed only one conserved gene, the repA1 as the core genome, showing that there is an extensive diversity among the IncFIIA plasmids. The phylogenetic relationship of 18 IncF plasmids based on the core regions revealed that ColV/ColBM-plasmids and non-ColV/ColBM plasmids were separated into two distinct groups. These plasmids, which carry highly diverse genetic contents, are also mosaic in nature. The atypical combination of genetic materials, i.e., the MDR- and ColV/ColBM-plasmid-virulence encoding regions in a single ExPEC plasmid is rare but of clinical
DOD Electronic Commerce (EC)/Electronic Data Interchange (EDI) in contracting report
1993-12-01
Use of Electronic Commerce (EC)/Electronic Data Interchange (EDI) to support Department of Defense (DoD) procurement processes has been under consideration for some time. A 1988 Deputy Secretary of Defense memo calls for maximum use of EDI, based on 10 years of DoD EDI investigation and experiments. In 1990, Defense Management Review Decision 941 stated, 'The strategic goal of DoD's current efforts is to provide the department with the capability to initiate, conduct, and maintain its external business related transactions and internal logistics, contracting, and financial activities without requiring the use of hard copy media.' The EC in Contracting PAT membership reflected a broad cross section of Military Services and Defense Agencies working on a full-time basis for 60 days. The diversity of the EC in Contracting PAT ensured that the needs and concerns of all DoD components were addressed during the creation of the report. The resultant plan, therefore, represents a comprehensive approach for implementing EC throughout the DoD.
Directory of Open Access Journals (Sweden)
A. J. Ding
2013-06-01
Full Text Available This work presents an overview of 1 yr measurements of ozone (O3 and fine particular matter (PM2.5 and related trace gases at a recently developed regional background site, the Station for Observing Regional Processes of the Earth System (SORPES, in the western part of the Yangtze River Delta (YRD in eastern China. Ozone and PM2.5 showed strong seasonal cycles but with contrast patterns: O3 reached a maximum in warm seasons but PM2.5 in cold seasons. Correlation analysis suggests a VOC-sensitive regime for O3 chemistry and a formation of secondary aerosols under conditions of high O3 in summer. Compared with the National Ambient Air Quality Standards in China, our measurements report 15 days of O3 exceedance and 148 days of PM2.5 exceedance during the 1 yr period, suggesting a severe air pollution situation in this region. Case studies for typical O3 and PM2.5 episodes demonstrated that these episodes were generally associated with an air mass transport pathway over the mid-YRD, i.e., along the Nanjing–Shanghai axis with its city clusters, and showed that synoptic weather played an important role in air pollution, especially for O3. Agricultural burning activities caused high PM2.5 and O3 pollution during harvest seasons, especially in June. A calculation of potential source contributions based on Lagrangian dispersion simulations suggests that emissions from the YRD contributed to over 70% of the O3 precursor CO, with a majority from the mid-YRD. North-YRD and the North China Plain are the main contributors to PM2.5 pollution in this region. This work shows an important environmental impact from industrialization and urbanization in the YRD region, and suggests an urgent need for improving air quality in these areas through collaborative control measures among different administrative regions.
ECS: Efficient Communication Scheduling for Underwater Sensor Networks
Directory of Open Access Journals (Sweden)
Lu Hong
2011-03-01
Full Text Available TDMA protocols have attracted a lot of attention for underwater acoustic sensor networks (UWSNs, because of the unique characteristics of acoustic signal propagation such as great energy consumption in transmission, long propagation delay and long communication range. Previous TDMA protocols all allocated transmission time to nodes based on discrete time slots. This paper proposes an efficient continuous time scheduling TDMA protocol (ECS for UWSNs, including the continuous time based and sender oriented conflict analysis model, the transmission moment allocation algorithm and the distributed topology maintenance algorithm. Simulation results confirm that ECS improves network throughput by 20% on average, compared to existing MAC protocols.
International Nuclear Information System (INIS)
Xu Shuwei; Zhang Tianmei; Xie Yuanxiang; Ma Ruichang; Ge Yuanxiu; Guo Yingxiang; Wang Chunfang; Li Zhankui; Guo Bing; Xing Jianping; Guo Tianrui; Zhu Shaofei; Xu Wang; Du Jinzhou
1996-01-01
The nuclide 130 Ce was produced by a ( 16 O, 4n) reaction on an enriched 118 Sn target. Reaction products were transported to a shielded location by using a helium-jet tape transport system. A 22.9 min activity in chemically separated cerium sample was identified as 130 Ce. The (EC+β + ) decay scheme of 130 Ce was proposed for the first time. This scheme includes 108 γ-lines, 107 γ-lines among them being new. More than 13 1 + low-lying states of 130 La are populated in the decay of 130 Ce. Two new isomers with half-life of 77±10 ns and 17±5 ns were observed by means of delayed γ-γ coincidence measurements. (orig.). With 5 figs., 3 tabs
Dommels, Yvonne E M; Kemperman, Robèr A; Zebregs, Yvonne E M P; Draaisma, René B; Jol, Arne; Wolvers, Danielle A W; Vaughan, Elaine E; Albers, Ruud
2009-10-01
Probiotics are live microorganisms which, when administered in adequate amounts, confer a health benefit on the host. Therefore, probiotic strains should be able to survive passage through the human gastrointestinal tract. Human gastrointestinal tract survival of probiotics in a low-fat spread matrix has, however, never been tested. The objective of this randomized, double-blind, placebo-controlled human intervention study was to test the human gastrointestinal tract survival of Lactobacillus reuteri DSM 17938 and Lactobacillus rhamnosus GG after daily consumption of a low-fat probiotic spread by using traditional culturing, as well as molecular methods. Forty-two healthy human volunteers were randomly assigned to one of three treatment groups provided with 20 g of placebo spread (n = 13), 20 g of spread with a target dose of 1 x 10(9) CFU of L. reuteri DSM 17938 (n = 13), or 20 g of spread with a target dose of 5 x 10(9) CFU of L. rhamnosus GG (n = 16) daily for 3 weeks. Fecal samples were obtained before and after the intervention period. A significant increase, compared to the baseline, in the recovery of viable probiotic lactobacilli in fecal samples was demonstrated after 3 weeks of daily consumption of the spread containing either L. reuteri DSM 17938 or L. rhamnosus GG by selective enumeration. In the placebo group, no increase was detected. The results of selective enumeration were supported by quantitative PCR, detecting a significant increase in DNA resulting from the probiotics after intervention. Overall, our results indicate for the first time that low-fat spread is a suitable carrier for these probiotic strains.
Directory of Open Access Journals (Sweden)
M.A.S. Medeiros
1997-10-01
Full Text Available Two intramolecularly quenched fluorogenic peptides containing o-aminobenzoyl (Abz and ethylenediamine 2,4-dinitrophenyl (EDDnp groups at amino- and carboxyl-terminal amino acid residues, Abz-DArg-Arg-Leu-EDDnp (Abz-DRRL-EDDnp and Abz-DArg-Arg-Phe-EDDnp (Abz-DRRF-EDDnp, were selectively hydrolyzed by neutral endopeptidase (NEP, enkephalinase, neprilysin, EC 3.4.24.11 at the Arg-Leu and Arg-Phe bonds, respectively. The kinetic parameters for the NEP-catalyzed hydrolysis of Abz-DRRL-EDDnp and Abz-DRRF-EDDnp were Km = 2.8 µM, kcat = 5.3 min-1, kcat/Km = 2 min-1 µM-1 and Km = 5.0 µM, kcat = 7.0 min-1, kcat/Km = 1.4 min-1 µM-1, respectively. The high specificity of these substrates was demonstrated by their resistance to hydrolysis by metalloproteases [thermolysin (EC 3.4.24.2, angiotensin-converting enzyme (ACE; EC 3.4.24.15], serineproteases [trypsin (EC 3.4.21.4, a-chymotrypsin (EC 3.4.21.1] and proteases present in tissue homogenates from kidney, lung, brain and testis. The blocked amino- and carboxyl-terminal amino acids protected these substrates against the action of aminopeptidases, carboxypeptidases and ACE. Furthermore, DR amino acids ensured total protection of Abz-DRRL-EDDnp and Abz-DRRF-EDDnp against the action of thermolysin and trypsin. Leu-EDDnp and Phe-EDDnp were resistant to hydrolysis by a-chymotrypsin. The high specifity of these substrates suggests their use for specific NEP assays in crude enzyme preparations
Mars, J.C.; Houseknecht, D.W.
2007-01-01
A new quantitative coastal land gained-and-lost method uses image analysis of topographic maps and Landsat thematic mapper short-wave infrared data to document accelerated coastal land loss and thermokarst lake expansion and drainage. The data span 1955-2005 along the Beaufort Sea coast north of Teshekpuk Lake in the National Petroleum Reserve in Alaska. Some areas have undergone as much as 0.9 km of coastal erosion in the past 50 yr. Land loss attributed to coastal erosion more than doubled, from 0.48 km2 yr-1 during 1955-1985 to 1.08 km2 yr-1 during 1985-2005. Coastal erosion has breached thermokarst lakes, causing initial draining of the lakes followed by marine floodng. Although inland thermokarst lakes show some uniform expansion, lakes breached by coastal erosion display lake expansion several orders of magnitude greater than inland lakes. ?? 2007 The Geological Society of America.
AMS measurement of C-14 concentration in a single-year ring of a 2500-yr-old tree
International Nuclear Information System (INIS)
Sakurai, H.; Gandou, T.; Kato, W.; Sawaki, Y.; Matsumoto, T.; Aoki, T.; Matsuzaki, H.; Gunji, S.; Tokanai, F.
2004-01-01
The 14 C concentration in rings of an old tree that date back approximately 2500 yr has been measured at single-year intervals with a highly accurate liquid scintillation counter (LSC) (0.2%) to investigate the 11-yr periodicity of solar activity. To investigate the applicability of AMS to accurate 14 C measurement, 16 graphite samples produced from the cellulose of a single-year tree ring of a 2500-yr-old cedar were measured with the micro analysis laboratory tandem (MALT) accelerator, at The University of Tokyo, and the results were compared with the 14 C age determined using LSC. The average 14 C age of the single-year tree ring calculated from 16 measurements was 2496 ± 23 yr BP, corresponding to the statistical accuracy of 0.26%. This was consistent with the age of 2514 ± 23 yr BP determined using LSC within the acceptable error range, which indicates that accelerator mass spectrometry (AMS) is applicable for accurate 14 C measurement using multi-graphite for the same single-year tree ring
DEFF Research Database (Denmark)
Andersen, Marie Louise Max; Nielsen, Lotte B; Svensson, Jannet
2014-01-01
paediatric cohorts from Scandinavian and European countries including 446 children with new onset type 1 diabetes (T1D, 1982-2004). Findings were evaluated against 78 children (2004-2009) from the TrialNet studies. RESULTS: The mean rate of decline [%/month (±SEM)] in SCP for a 10-yr-old child was 7.7%/month...... (±1.5) in the 1982-1985 Cohort, 6.3%/month (±1.7) in the 1995-1998 Cohort, 7.8%/month (±0.7) in the 1999-2000 Cohort, and 10.7%/month (±0.9) in the latest 2004-2005 Cohort (p = 0.05). Including the TrialNet Cohort with a rate of decline in SCP of 10.0%/month (±0.9) the differences between the cohorts...
Translation and validation of the Dutch version of the Effective Consumer Scale (EC-17)
ten Klooster, Peter M.; Taal, Erik; Tjin-Kam-Jet-Siemons, Liseth; Oostveen, J.C.M.; Oostveen, Johanna C.M.; Harmsen, Etelka J.; Tugwell, Peter S.; Rader, Tamara; Lyddiatt, Anne; van de Laar, Mart A F J
2013-01-01
PURPOSE: The Effective Consumer Scale (EC-17) measures the skills of musculoskeletal patients in managing their own healthcare. The objectives of this study were to translate the EC-17 into Dutch and to further evaluate its psychometric properties. METHODS: The EC-17 was translated and cognitively
Yang, Y; Huang, S; Wang, J; Jan, G; Jeantet, R; Chen, X D
2017-04-01
Food-related carbohydrates and proteins are often used as thermoprotectants for probiotic lactobacilli during industrial production and processing. However, the effect of inorganic salts is rarely reported. Magnesium is the second-most abundant cation in bacteria, and commonly found in various foods. Mg 2+ homeostasis is important in Salmonella and has been reported to play a critical role in their thermotolerance. However, the role of Mg 2+ in thermotolerance of other bacteria, in particular probiotic bacteria, still remains a hypothesis. In this study, the effect of Mg 2+ on thermotolerance of probiotic lactobacilli was investigated in three well-documented probiotic strains, Lactobacillus rhamnosus GG, Lactobacillus casei Zhang and Lactobacillus plantarum P-8, in comparison with Zn 2+ and Na + . Concentrations of Mg 2+ between 10 and 50 mmol l -1 were found to increase the bacterial survival upon heat challenge. Remarkably, Mg 2+ addition at 20 mmol l -1 led to a 100-fold higher survival of L. rhamnosus GG upon heat challenge. This preliminary study also showed that Mg 2+ shortened the heat-induced extended lag time of bacteria, which indicated the improvement in bacterial recovery from thermal injury. In order to improve the productivity and stability of live probiotics, extensive investigations have been carried out to improve thermotolerance of probiotics. However, most of these studies focused on the effects of carbohydrates, proteins or amino acids. The roles of inorganic salts in various food materials, which have rarely been reported, should be considered when incorporating probiotics into these foods. In this study, Mg 2+ was found to play a significant role in the thermotolerance of probiotic lactobacilli. A novel strategy may be available in the near future by employing magnesium salts as protective agents of probiotics during manufacturing process. © 2017 The Society for Applied Microbiology.
Vahlsing, T.; Moser, H.; Grafen, M.; Nalpantidis, K.; Brandstetter, M.; Heise, H. M.; Lendl, B.; Leonhardt, S.; Ihrig, D.; Ostendorf, A.
2015-07-01
Mid-infrared spectroscopy has been successfully applied for reagent-free clinical chemistry applications. Our aim is to design a portable bed-side system for ICU patient monitoring, based on mid-infrared absorption spectra of continuously sampled body-fluids. Robust and miniature bed-side systems can be achieved with tunable external cavity quantum cascade lasers (EC-QCL). Previously, single EC-QCL modules covering a wavenumber interval up to 250 cm-1 have been utilized. However, for broader applicability in biomedical research an extended interval around the mid-infrared fingerprint region should be accessible, which is possible with at least three or four EC-QCL modules. For such purpose, a tunable ultra-broadband system (1920 - 780 cm-1, Block Engineering) has been studied with regard to its transient emission characteristics in ns time resolution during different laser pulse widths using a VERTEX 80v FTIR spectrometer with step-scan option. Furthermore, laser emission line profiles of all four incorporated EC-QCL modules have been analysed at high spectral resolution (0.08 cm-1) and beam profiles with few deviations from the TEM 00 spatial mode have been manifested. Emission line reproducibility has been tested for various wavenumbers in step tune mode. The overall accuracy of manufacturer default wavenumber setting has been found between ± 3 cm-1 compared to the FTIR spectrometer scale. With regard to an application in clinical chemistry, theoretically achievable concentration accuracies for different blood substrates based on blood plasma and dialysate spectra previously recorded by FTIRspectrometers have been estimated taking into account the now accessible extended wavenumber interval.
Fossil and non-fossil sources of organic carbon (OC and elemental carbon (EC in Göteborg, Sweden
Directory of Open Access Journals (Sweden)
S. Szidat
2009-03-01
Full Text Available Particulate matter was collected at an urban site in Göteborg (Sweden in February/March 2005 and in June/July 2006. Additional samples were collected at a rural site for the winter period. Total carbon (TC concentrations were 2.1–3.6 μg m−3, 1.8–1.9 μg m−3, and 2.2–3.0 μg m−3 for urban/winter, rural/winter, and urban/summer conditions, respectively. Elemental carbon (EC, organic carbon (OC, water-insoluble OC (WINSOC, and water-soluble OC (WSOC were analyzed for 14C in order to distinguish fossil from non-fossil emissions. As wood burning is the single major source of non-fossil EC, its contribution can be quantified directly. For non-fossil OC, the wood-burning fraction was determined independently by levoglucosan and 14C analysis and combined using Latin-hypercube sampling (LHS. For the winter period, the relative contribution of EC from wood burning to the total EC was >3 times higher at the rural site compared to the urban site, whereas the absolute concentrations of EC from wood burning were elevated only moderately at the rural compared to the urban site. Thus, the urban site is substantially more influenced by fossil EC emissions. For summer, biogenic emissions dominated OC concentrations most likely due to secondary organic aerosol (SOA formation. During both seasons, a more pronounced fossil signal was observed for Göteborg than has previously been reported for Zurich, Switzerland. Analysis of air mass origin using back trajectories suggests that the fossil impact was larger when local sources dominated, whereas long-range transport caused an enhanced non-fossil signal. In comparison to other European locations, concentrations of levoglucosan and other monosaccharide anhydrides were low for the urban and the rural site in the area of Göteborg during winter.
Hundreds of Bombyx mori miRNAs had been identified in recent years, but their function in vivo remains poorly understood. The silkworm EcR gene (BmEcR) has three transcriptional isoforms, A, B1 and B2. Isoform sequences are different in the 3’UTR region of the gene, which is the case only in insects...
Hepatic Disposition of Gemfibrozil and Its Major Metabolite Gemfibrozil 1-O-β-Glucuronide.
Kimoto, Emi; Li, Rui; Scialis, Renato J; Lai, Yurong; Varma, Manthena V S
2015-11-02
Gemfibrozil (GEM), which decreases serum triglycerides and low density lipoprotein, perpetrates drug-drug interactions (DDIs) with several drugs. These DDIs are primarily attributed to the inhibition of drug transporters and metabolic enzymes, particularly cytochrome P450 (CYP) 2C8 by the major circulating metabolite gemfibrozil 1-O-β-glucuronide (GG). Here, we characterized the transporter-mediated hepatic disposition of GEM and GG using sandwich-cultured human hepatocytes (SCHH) and transporter-transfect systems. Significant active uptake was noted in SCHH for the metabolite. GG, but not GEM, showed substrate affinity to organic anion transporting polypeptide (OATP) 1B1, 1B3, and 2B1. In SCHH, glucuronidation was characterized affinity constants (Km) of 7.9 and 61.4 μM, and biliary excretion of GG was observed. Furthermore, GG showed active basolateral efflux from preloaded SCHH and ATP-dependent uptake into membrane vesicles overexpressing multidrug resistance-associated protein (MRP) 2, MRP3, and MRP4. A mathematical model was developed to estimate hepatic uptake and efflux kinetics of GEM and GG based on SCHH studies. Collectively, the hepatic transporters play a key role in the disposition and thus determine the local concentrations of GEM and more so for GG, which is the predominant inhibitory species against CYP2C8 and OATP1B1.
The representation of tropical upper tropospheric water in EC Earth V2
Energy Technology Data Exchange (ETDEWEB)
Johnston, M.S. [Chalmers University of Technology, Department of Earth and Space Sciences, Goeteburg (Sweden); Swedish Meteorological and Hydrological Institute (SMHI), Norrkoeping (Sweden); Eriksson, P.; Murtagh, D.P. [Chalmers University of Technology, Department of Earth and Space Sciences, Goeteburg (Sweden); Eliasson, S. [Luleaa University of Technology, Department of Computer Science, Electrical and Space Engineering, Kiruna (Sweden); Jones, C.G. [Swedish Meteorological and Hydrological Institute (SMHI), Norrkoeping (Sweden); Forbes, R.M. [ECMWF, Reading, Berkshire (United Kingdom)
2012-12-15
Tropical upper tropospheric humidity, clouds, and ice water content, as well as outgoing longwave radiation (OLR), are evaluated in the climate model EC Earth with the aid of satellite retrievals. The Atmospheric Infrared Sounder and Microwave Limb Sounder together provide good coverage of relative humidity. EC Earth's relative humidity is in fair agreement with these observations. CloudSat and CALIPSO data are combined to provide cloud fractions estimates throughout the altitude region considered (500-100 hPa). EC Earth is found to overestimate the degree of cloud cover above 200 hPa and underestimate it below. Precipitating and non-precipitating EC Earth ice definitions are combined to form a complete ice water content. EC Earth's ice water content is below the uncertainty range of CloudSat above 250 hPa, but can be twice as high as CloudSat's estimate in the melting layer. CERES data show that the model underestimates the impact of clouds on OLR, on average with about 9 W m{sup -2}. Regionally, EC Earth's outgoing longwave radiation can be {proportional_to}20 W m{sup -2} higher than the observation. A comparison to ERA-Interim provides further perspectives on the model's performance. Limitations of the satellite observations are emphasised and their uncertainties are, throughout, considered in the analysis. Evaluating multiple model variables in parallel is a more ambitious approach than is customary. (orig.)
Lr67/Yr46 confers adult plant resistance to stem rust and powdery mildew in wheat.
Herrera-Foessel, Sybil A; Singh, Ravi P; Lillemo, Morten; Huerta-Espino, Julio; Bhavani, Sridhar; Singh, Sukhwinder; Lan, Caixia; Calvo-Salazar, Violeta; Lagudah, Evans S
2014-04-01
We demonstrate that Lr67/Yr46 has pleiotropic effect on stem rust and powdery mildew resistance and is associated with leaf tip necrosis. Genes are designated as Sr55, Pm46 and Ltn3 , respectively. Wheat (Triticum aestivum) accession RL6077, known to carry the pleiotropic slow rusting leaf and yellow rust resistance genes Lr67/Yr46 in Thatcher background, displayed significantly lower stem rust (P. graminis tritici; Pgt) and powdery mildew (Blumeria graminis tritici; Bgt) severities in Kenya and in Norway, respectively, compared to its recurrent parent Thatcher. We investigated the resistance of RL6077 to stem rust and powdery mildew using Avocet × RL6077 F6 recombinant inbred lines (RILs) derived from two photoperiod-insensitive F3 families segregating for Lr67/Yr46. Greenhouse seedling tests were conducted with Mexican Pgt race RTR. Field evaluations were conducted under artificially initiated stem rust epidemics with Pgt races RTR and TTKST (Ug99 + Sr24) at Ciudad Obregon (Mexico) and Njoro (Kenya) during 2010-2011; and under natural powdery mildew epiphytotic in Norway at Ås and Hamar during 2011 and 2012. In Mexico, a mean reduction of 41 % on stem rust severity was obtained for RILs carrying Lr67/Yr46, compared to RILs that lacked the gene, whereas in Kenya the difference was smaller (16 %) but significant. In Norway, leaf tip necrosis was associated with Lr67/Yr46 and RILs carrying Lr67/Yr46 showed a 20 % reduction in mean powdery mildew severity at both sites across the 2 years of evaluation. Our study demonstrates that Lr67/Yr46 confers partial resistance to stem rust and powdery mildew and is associated with leaf tip necrosis. The corresponding pleiotropic, or tightly linked, genes, designated as Sr55, Pm46, and Ltn3, can be utilized to provide broad-spectrum durable disease resistance in wheat.
Uncertainty in CH4 and N2O emission estimates from a managed fen meadow using EC measurements
International Nuclear Information System (INIS)
Kroon, P.S.; Hensen, A.; Van 't Veen, W.H.; Vermeulen, A.T.; Jonker, H.
2009-02-01
The overall uncertainty in annual flux estimates derived from chamber measurements may be as high as 50% due to the temporal and spatial variability in the fluxes. As even a large number of chamber plots still cover typically less than 1% of the total field area, the field-scale integrated emission necessarily remains a matter of speculation. High frequency micrometeorological methods are a good option for obtaining integrated estimates on a hectare scale with a continuous coverage in time. Instrumentation is now becoming available that meets the requirements for CH4 and N2O eddy covariance (EC) measurements. A system consisting of a quantum cascade laser (QCL) spectrometer and a sonic anemometer has recently been proven to be suitable for performing EC measurements. This study analyses the EC flux measurements of CH4 and N2O and its corrections, like calibration, Webb-correction, and corrections for high and low frequency losses, and assesses the magnitude of the uncertainties associated with the precision of the measurement instruments, measurement set-up and the methodology. The uncertainty of one single EC flux measurement, a daily, monthly and 3-monthly average EC flux is estimated. In addition, the cumulative emission of C-CH4 and N-N2O and their uncertainties are determined over several fertilizing events at a dairy farm site in the Netherlands. These fertilizing events are selected from the continuously EC flux measurements from August 2006 to September 2008. The EC flux uncertainties are compared by the overall uncertainty in annual flux estimates derived from chamber measurements. It will be shown that EC flux measurements can decrease the overall uncertainty in annual flux estimates
Uncertainty in CH4 and N2O emission estimates from a managed fen meadow using EC measurements
Energy Technology Data Exchange (ETDEWEB)
Kroon, P.S.; Hensen, A.; Van ' t Veen, W.H.; Vermeulen, A.T. [ECN Biomass, Coal and Environment, Petten (Netherlands); Jonker, H. [Delft University of Technology, Delft (Netherlands)
2009-02-15
The overall uncertainty in annual flux estimates derived from chamber measurements may be as high as 50% due to the temporal and spatial variability in the fluxes. As even a large number of chamber plots still cover typically less than 1% of the total field area, the field-scale integrated emission necessarily remains a matter of speculation. High frequency micrometeorological methods are a good option for obtaining integrated estimates on a hectare scale with a continuous coverage in time. Instrumentation is now becoming available that meets the requirements for CH4 and N2O eddy covariance (EC) measurements. A system consisting of a quantum cascade laser (QCL) spectrometer and a sonic anemometer has recently been proven to be suitable for performing EC measurements. This study analyses the EC flux measurements of CH4 and N2O and its corrections, like calibration, Webb-correction, and corrections for high and low frequency losses, and assesses the magnitude of the uncertainties associated with the precision of the measurement instruments, measurement set-up and the methodology. The uncertainty of one single EC flux measurement, a daily, monthly and 3-monthly average EC flux is estimated. In addition, the cumulative emission of C-CH4 and N-N2O and their uncertainties are determined over several fertilizing events at a dairy farm site in the Netherlands. These fertilizing events are selected from the continuously EC flux measurements from August 2006 to September 2008. The EC flux uncertainties are compared by the overall uncertainty in annual flux estimates derived from chamber measurements. It will be shown that EC flux measurements can decrease the overall uncertainty in annual flux estimates.
EC4IT - A Guide to European Commission Projects for CERN/IT department
Jones, R
2012-01-01
European Commission (EC) projects represent an important source of external funding for a number of activities in which IT department is involved. The EC has a set of procedures and formalities for the preparation, negotiation, execution and completion of projects that are different to those normally used at CERN. This document gives an overview of the administrative, financial, reporting and managerial steps involved in participating in an EC project.
House dust mite allergen reduction and allergy at 4 yr : Follow up of the PIAMA-study
Corver, K; Kerkhof, M; Brussee, JE; Brunekreef, B; van Strien, RT; Vos, AP; Smit, HA; Gerritsen, J; Neijens, HJ; de Jongste, JC
Exposure to high allergen levels in early life is a risk factor for the development of allergy. We previously reported limited effects of mite allergen impermeable mattress covers in the prevention and incidence of asthma and mite allergy (PIAMA) cohort at the age of 1 and 2 yr. We now present the
Present status of developing petroleum-substituting energy (EC)
1993-03-01
The EC has had approximately 50% of its total energy demand supplied by imports from the exterior of the Community. Hence, it is getting important to develop oil-substituting renewable energy as well as to curtail the emission of carbon dioxide. In consideration of these situations, the results of investigation on the energy policy of the European Community are described. The policy comprises three courses: European Energy Charter, formation of an open European Community energy market, and environmental conservation. Particularly, concerning the reduction of carbon dioxide emission, the EC Council has decided to introduce carbon dioxide taxation so as to suppress the carbon dioxide emission in the year 2000 to the 1990 level. The arrangement for its introduction, however, encountered with difficulties because of the opposition of various countries other than the European Community and the industrial world of the European Community. Legislation of the investment promotion law for energy saving and the construction of infrastructure footing and an information network are ineffective due to the sluggish fuel price and economic recession. A plurality of EC member countries are advancing a comprehensive activity within the framework of the joint programs of research, development, and demonstration set for the renewable energy policy ensuring energy supply and environmental harmonization.
OAS1: a multiple sclerosis susceptibility gene that influences disease severity.
LENUS (Irish Health Repository)
O'Brien, M
2012-02-01
BACKGROUND: Type 1 interferons upregulate oligoadenylate synthetase 1 (OAS1). A single nucleotide polymorphism (SNP) in exon 7 of OAS1 results in differential RNAseL enzyme activity, the A allele coding for a truncated form with low activity and the G conferring high activity. We hypothesized that OAS1 genotypes would influence both susceptibility to multiple sclerosis (MS) and disease activity with the AA genotype being overrepresented and the GG genotype underrepresented in relapsing-remitting MS (RRMS) with increased disease activity. METHODS: We examined OAS1 genotype distribution in 401 patients with MS, 394 healthy controls, and 178 patients with RRMS receiving interferon-beta (IFNbeta) assessed as 1) having no or minimal disease activity on IFNbeta, 2) having disease activity despite IFNbeta, and 3) 65 patients with RRMS with highly active disease. RESULTS: The OAS1 genotype distribution differed between patients with MS and controls (p = 0.000003), with lower frequency of GG homozygotes in patients with MS (6%) compared with controls (17%). In relation to disease severity, 34 (32%) patients with no or minimal disease activity on IFNbeta had the AA and 8 (8%) the GG genotype; of patients with disease activity despite IFNbeta, 27 (51%) were AA, while only 1 (2%) was GG (p = 0.03). Median time to first relapse on IFNbeta was 24 months in patients with RRMS with AA genotype and 33 months with AG or GG genotype (p = 0.04). The GG genotype was absent in 65 patients with highly active RRMS (p = 0.03). CONCLUSIONS: A functional OAS1 SNP, AA genotype, confers susceptibility to MS and the GG genotype may protect against increased disease activity.
哈氏弧菌EcGY020401优化培养%Optimization Culture of Vibrio harveyi EcGY020401
Institute of Scientific and Technical Information of China (English)
陶家发; 赖迎迢; 潘厚军; 石存斌; 吴淑勤
2010-01-01
目的:为规模化制备弧菌疫苗提供相关数据.方法:利用摇瓶和小型发酵罐培养,通过平板计数测定培养菌液的活菌数.结果:哈氏弧菌(Vibrio harveyi)EcGY020401株最适盐度为20~25g/L,合适的pH为7.5~7.7,葡萄糖浓度最适浓度为2~5g/L,用TSB优化培养基:胰蛋白胨5g/L、蛋白胨15g/L、大豆蛋白胨3g/L、酵母膏1g/L、葡萄糖4g/L、磷酸氢二钾5g/L、氯化钠15g/L、pH 7.5,培养EcGY020401菌株,可达2.95×1010 cfu/mL;小型发酵罐培养,10h可达到生长最大值,菌液浓度为3.46×1010cfu/mL 结论:用优化TSB培养基,采用发酵罐培养弧菌,可降低成本,提搞培养效率.
Cooperative Fuzzy Games Approach to Setting Target Levels of ECs in Quality Function Deployment
Directory of Open Access Journals (Sweden)
Zhihui Yang
2014-01-01
Full Text Available Quality function deployment (QFD can provide a means of translating customer requirements (CRs into engineering characteristics (ECs for each stage of product development and production. The main objective of QFD-based product planning is to determine the target levels of ECs for a new product or service. QFD is a breakthrough tool which can effectively reduce the gap between CRs and a new product/service. Even though there are conflicts among some ECs, the objective of developing new product is to maximize the overall customer satisfaction. Therefore, there may be room for cooperation among ECs. A cooperative game framework combined with fuzzy set theory is developed to determine the target levels of the ECs in QFD. The key to develop the model is the formulation of the bargaining function. In the proposed methodology, the players are viewed as the membership functions of ECs to formulate the bargaining function. The solution for the proposed model is Pareto-optimal. An illustrated example is cited to demonstrate the application and performance of the proposed approach.
Cooperative fuzzy games approach to setting target levels of ECs in quality function deployment.
Yang, Zhihui; Chen, Yizeng; Yin, Yunqiang
2014-01-01
Quality function deployment (QFD) can provide a means of translating customer requirements (CRs) into engineering characteristics (ECs) for each stage of product development and production. The main objective of QFD-based product planning is to determine the target levels of ECs for a new product or service. QFD is a breakthrough tool which can effectively reduce the gap between CRs and a new product/service. Even though there are conflicts among some ECs, the objective of developing new product is to maximize the overall customer satisfaction. Therefore, there may be room for cooperation among ECs. A cooperative game framework combined with fuzzy set theory is developed to determine the target levels of the ECs in QFD. The key to develop the model is the formulation of the bargaining function. In the proposed methodology, the players are viewed as the membership functions of ECs to formulate the bargaining function. The solution for the proposed model is Pareto-optimal. An illustrated example is cited to demonstrate the application and performance of the proposed approach.
EC-LEDS Mexico: Advancing Clean Energy Goals
Energy Technology Data Exchange (ETDEWEB)
2016-07-01
EC-LEDS works with the government of Mexico to help meet its goals of reducing greenhouse gas emissions from the energy sector. The program targets specific, highly technical areas where Mexico has indicated the program can add value and make an impact.
EC-LEDS Supports the Low-Carbon Transition
Energy Technology Data Exchange (ETDEWEB)
2016-09-01
EC-LEDS is a flagship U.S. government-led effort that assists countries to create and implement low emission development strategies, or LEDS -- development frameworks that promote sustainable social and economic development while reducing greenhouse gas emissions over the medium to long term.
Sahli, Hichem; Bruschini, Claudio; Van Kempen, Luc; Schleijpen, Ric; den Breejen, Eric
2008-04-01
conclusion, creating coherence between: (1) the EC policy based on political decisions, (2) RTD, testing and industrialization of equipment, and (3) timely deployment, requires a new way of coordinated thinking: "end-to-end planning" has to be supported by a well organized and coordinated organizational structure involving different DGs and even extending beyond the EU. This was not the case for Mine Action, but appears today to be the case for Environmental Risk Management.
Belle monte-carlo production on the Amazon EC2 cloud
International Nuclear Information System (INIS)
Sevior, Martin; Fifield, Tom; Katayama, Nobuhiko
2010-01-01
The Belle II experiment which aims to increase the Luminosity of the KEKB collider by a factor of 50 will search for physics beyond the Standard Model through precision measurements and the investigation of rare processes in Flavour physics. The expected data rate is comparable to a current era LHC experiment with commensurate computing needs. Incorporating commercial cloud computing, such as that provided by the Amazon Elastic Compute Cloud (EC2) into the Belle II computing model may provide a lower Total Cost of Ownership for the Belle II computing solution. To investigate this possibility, we have created a system to conduct the complete Belle Monte Carlo simulation chain on EC2 to benchmark the cost and performance of the service. This paper will describe how this was achieved in addition to the drawbacks and costs of large-scale Monte Carlo production on EC2.
Belle monte-carlo production on the Amazon EC2 cloud
Energy Technology Data Exchange (ETDEWEB)
Sevior, Martin; Fifield, Tom [University of Melbourne, School of Physics, Victoria 3010 Australia (Australia); Katayama, Nobuhiko, E-mail: msevior@gmail.co, E-mail: fifieldt@unimelb.edu.a, E-mail: nobu.katayama@kek.j [High Energy Accelerator Research Organisation (KEK), Tsukuba (Japan)
2010-04-01
The Belle II experiment which aims to increase the Luminosity of the KEKB collider by a factor of 50 will search for physics beyond the Standard Model through precision measurements and the investigation of rare processes in Flavour physics. The expected data rate is comparable to a current era LHC experiment with commensurate computing needs. Incorporating commercial cloud computing, such as that provided by the Amazon Elastic Compute Cloud (EC2) into the Belle II computing model may provide a lower Total Cost of Ownership for the Belle II computing solution. To investigate this possibility, we have created a system to conduct the complete Belle Monte Carlo simulation chain on EC2 to benchmark the cost and performance of the service. This paper will describe how this was achieved in addition to the drawbacks and costs of large-scale Monte Carlo production on EC2.
Genes and proteins of Escherichia coli (GenProtEc).
Riley, M; Space, D B
1996-01-01
GenProtEc is a database of Escherichia coli genes and their gene products, classified by type of function and physiological role and with citations to the literature for each. Also present are data on sequence similarities among E.coli proteins with PAM values, percent identity of amino acids, length of alignment and percent aligned. The database is available as a PKZip file by ftp from mbl.edu/pub/ecoli.exe. The program runs under MS-DOS on IMB-compatible machines. GenProtEc can also be accessed through the World Wide Web at URL http://mbl.edu/html/ecoli.html.
International Nuclear Information System (INIS)
Munro, Peter; Jordan, Kevin; Lewis, Craig; Heerema, Tim
2001-01-01
Purpose: To develop a method of measuring technique charts for enhanced contrast (EC) film, to demonstrate how X-ray scatter changes the response of EC film, and to generate technique charts for general use. Methods and Materials: We have developed a 'digital cassette' - consisting of a metal plate/phosphor screen, a light guide, a photodiode sensor, and an electrometer - that can be used to measure the light generated in the phosphor screen of the film cassette. In turn, these measurements can be used to generate technique charts for EC film. The digital cassette has been used to measure technique charts for 4-MV and 6-MV X-ray beams for a variety of different phantom thicknesses, field sizes, and phantom-to-cassette air gaps. Results and Discussion: We have observed that the signals generated in an ionization chamber located 9.4 cm behind a 30-cm-thick water-equivalent phantom increase by a factor of 1.9 when the field size is increased from 4x4 cm 2 to 40x40 cm 2 when irradiated by a 6-MV X-ray beam. However, the change in EC film response is a factor of 3.5 under the same conditions. Irradiations to optimally expose the EC film predicted by the digital cassette differ by up to 82% compared to those predicted by ion chamber measurements. Nevertheless, the technique charts measured using the digital cassette predict the response of the EC film to ±0.2 optical density. The overresponse of the EC film is most likely due to low-energy scattered photons, which interact with the high atomic number (Z=64) phosphor screen of the enhanced contrast localization cassette. Therefore, simple solutions, such as placing a high atomic number material above the enhanced contrast localization cassette, can reduce this contribution by scattered photons to the signal generated in the cassettes. Conclusions: We have developed a digital cassette that can make more accurate measurements of the technique charts for EC films. Our measurements show that under some conditions, X
The Liang Bua faunal remains: a 95k.yr. sequence from Flores, East Indonesia.
van den Bergh, G D; Meijer, H J M; Due Awe, Rokhus; Morwood, M J; Szabó, K; van den Hoek Ostende, L W; Sutikna, T; Saptomo, E W; Piper, P J; Dobney, K M
2009-11-01
Excavations at Liang Bua, a limestone cave on the island of Flores, East Indonesia, have yielded a well-dated archaeological and faunal sequence spanning the last 95k.yr., major climatic fluctuations, and two human species -H. floresiensis from 95 to 17k.yr.(1), and modern humans from 11k.yr. to the present. The faunal assemblage comprises well-preserved mammal, bird, reptile and mollusc remains, including examples of island gigantism in small mammals and the dwarfing of large taxa. Together with evidence from Early-Middle Pleistocene sites in the Soa Basin, it confirms the long-term isolation, impoverishment, and phylogenetic continuity of the Flores faunal community. The accumulation of Stegodon and Komodo dragon remains at the site in the Pleistocene is attributed to Homo floresiensis, while predatory birds, including an extinct species of owl, were largely responsible for the accumulation of the small vertebrates. The disappearance from the sequence of the two large-bodied, endemic mammals, Stegodon florensis insularis and Homo floresiensis, was associated with a volcanic eruption at 17 ka and precedes the earliest evidence for modern humans, who initiated use of mollusc and shell working, and began to introduce a range of exotic animals to the island. Faunal introductions during the Holocene included the Sulawesi warty pig (Sus celebensis) at about 7ka, followed by the Eurasian pig (Sus scrofa), Long-tailed macaque, Javanese porcupine, and Masked palm civet at about 4ka, and cattle, deer, and horse - possibly by the Portuguese within historic times. The Holocene sequence at the site also documents local faunal extinctions - a result of accelerating human population growth, habitat loss, and over-exploitation.
Li, Shiyang; Yu, Fang; Zhu, Huichen; Yang, Yuting; Yang, Liqun; Lian, Jianfeng
2016-04-21
Propofol and fentanyl are the most widely administered anesthesia maintaining drugs during colonoscopy. In this study, we determined the median effective concentration (EC50) of propofol required for colonoscopy in elderly patients, and the purpose of this study was to describe the pharmacodynamic interaction between fentanyl and propofol when used in combination for colonoscopy in elderly patients. Ninety elderly patients scheduled for colonoscopy were allocated into three groups in a randomized, double-blinded manner as below, F0.5 group (0.5 μg.kg(-1) fentanyl), F1.0 group (1.0 μg.kg(-1) fentanyl) and saline control group. Anaesthesia was achieved by target-controlled infusion of propofol (Marsh model, with an initial plasma concentration of 2.0 μg.ml(-1)) and fentanyl. Colonoscopy was started 3 min after the injection of fentanyl. The EC50 of propofol for colonoscopy with different doses of fentanyl was measured by using an up-and-down sequential method with an adjacent concentration gradient at 0.5 μg.ml(-1) to inhibit purposeful movements. Anaesthesia associated adverse events and recovery characters were also recorded. The EC50 of propofol for colonoscopy in elderly patients were 2.75 μg.ml(-1) (95% CI, 2.50-3.02 μg.ml(-1)) in F0.5 group, 2.05 μg.ml(-1) (95% CI, 1.98-2.13 μg.ml(-1)) in F1.0 group and 3.08 μg.ml(-1) (95% CI, 2.78-3.42 μg.ml(-1)) in control group respectively (P fentanyl up to 1.0 μg.kg(-1) reduces the propofol EC50 required for elderly patients undergoing colonoscopy, and there was no significant difference in anaesthesia associated adverse events but prolonged awake and discharge time. Chinese Clinical Trial Registry ChiCTR15006368. Date of registration: May 3, 2015.
Variation in the ACE, PPARGC1A and PPARA genes in Lithuanian football players.
Gineviciene, Valentina; Jakaitiene, Audrone; Tubelis, Linas; Kucinskas, Vaidutis
2014-01-01
The aim of this study was to determine the impact of ACE (I/D), PPARGC1A (G/A) and PPARA (G/C) polymorphisms on footballers performance among 199 Lithuanian professional footballers and 167 sedentary, healthy men (controls). Genotyping was performed using polymerase chain reaction and restriction fragment length polymorphism methods on DNA from leucocytes. Results revealed that the angiotensin-1-coverting enzyme gene (ACE) genotype distribution was significantly different between total football players group (II 23.6%, ID 46.7% and DD 29.6%) and the controls (II 24.6%, ID 29.9% and DD 45.5%; P=0.002). Although investigating PPARGC1A (G/A) and PPARA (G/C) polymorphisms no significant results were obtained in the total football players group, however, significant differences were determined between forwards and controls [PPARGC1A: GG 54.6%, GA 29.5%, AA 15.9% vs. GG 49.7%, GA 44.3% and AA 6.0% (P = 0.044); PPARA: GG 52.3%, GC 40.9%, CC 6.8% vs. GG 72.4%, GC 24.6% and CC 3.0% (P = 0.034)]. In the whole cohort, the odds ratio of the genotype [ACE ID + PPARA GG] being a footballer was 1.69 (95% CI 1.04-2.74), and of [ACE ID + PPARGC1A GG] 1.93 (95% CI 1.10-3.37) and of [ACE II + PPARA GC] 2.83 (95% CI 1.02-7.91) compared to controls. It was revealed that ACE ID genotype together with PPARA GG and PPARGC1A GG as well as ACE II genotype with PPARA GC is probably the 'preferable genotype' for footballers. Summing up, the present study suggests that the ACE, PPARGC1A and PPARA polymorphisms genotypes are associated, separately and in combination, with Lithuanian footballers' performance.
International Nuclear Information System (INIS)
Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.
1999-01-01
Pollen and sediment analysis of two Holocene cores from Awana, Great Barrier Island, shows that at 7000 calibrated yr B.P. the local swamp was an estuarine salt marsh dominated by Restionaceae. By c. 6000 yr B.P. the water table was lower, and a fresh water swamp (Gleichenia-Leptospermum) had replaced the salt marsh. Regional conifer-hardwood forest c. 7000 yr B.P. was initially co-dominated by Libocedrus and Dacrydium cupressinum. Libocedrus declined from c. 6000 yr B.P. During the period c. 6000-c. 2500 yr B.P., relatively stable environmental conditions ensued with little change in local or regional vegetation. Around 2500 yr B.P., the swamp surface became drier and was invaded by Dacrycarpus and Laurelia swamp forest. This forest was subsequently repeatedly disturbed (not by fire), indicating climatic change to drier and windier conditions. Ascarina lucida was periodically a major component of swamp forest. Disturbance is also recorded in the clastic (mineral) sediments, where beds of sand within finer-grained sediment and peat are interpreted as wind blown material derived from partly devegetated dunes to seaward. The presence of the Kaharoa Tephra allows the timing of major Polynesian deforestation at Awana to be reliably dated to c. 600 calibrated yr B.P. In contrast, we see no evidence in the clastic sediment record of disturbance at Awana since Kaharoa time. We attribute this to the maintenance of stable dunes by a herb/scrub cover despite nearby fires, or to the presence of scrub or forest buffering the swamp from ablating dunes. (author). 45 refs., 4 figs., 1 tab
Consumption of food in EC countries
International Nuclear Information System (INIS)
Ven-Breken, T.J. van de; Brenot, J.; Bonnefous, S.; Noordijk, H.; Leenhouts, H.P.
1990-08-01
Annual consumption of 10 classes of food and drink is reported for the total population of each EC-country. National food consumption data are generalized by distinguishing groups of countries with similar diet. Group 1: UK and Ireland (low consumption of fruit, high consumption of potatoes and fresh dairy products). Group 2: Italy and Greece (high consumption of cereals, vegetables and fruit, low consumption of fresh dairy products). Group 3: France, Belgium, Luxembourg, Netherlands, FRG and Spain (intermediate consumption of most foodstuffs). Portugal and Denmark could not be classified in any group. Changes in food consumption related to differences in age, sex, social class, regional habits and level of urbanisation are reported.In some cases, variation of annual food consumption over the different seasons on the relative contribution of food from local origin to the total diet, could be estimated. Differences of region, age and level of urbanisation appear to have the largest influence on consumed amounts. As for age, the values for the different age-groups range from 50 to 80 percent of the adult diet. Regional consumption may diverge from 70-130 percent of the average national consumption, with values of 200 percent for potatoes and fruit. Consumption in urban areas compared with the entire country diverges from 70-100 percent. In rural areas the values diverge from 100-140 percent. Self-support of vegetables and milk seems to be important for most countries. Of the other products, self-support of wheat and cheese is only of importance in the south of the EC. When combining the effects of the different factors, a range of consumed amounts for specific population groups of 50 to 200 percent of the average national consumption was determined. (author). 38 refs.; 13 figs.; 75 tabs
Energy Technology Data Exchange (ETDEWEB)
Baur, J.F.; Blask, H. [Koeln Univ. (Germany). Inst. fuer das Recht der Europaeischen Gemeinschaften und Inst. fuer Energierecht
2002-09-01
In the light of necessary amendments of the Internal Electricity Market Directive and the Internal Gas Market Directive, a debate has evolved within the European Community about lawmaking powers for the energy sector. Whereas the Member States refer to the EC Treaty and deny any lawmaking powers of the EC for the energy sector, the EC defends its position that the EC should have and can derive lawmaking competence for energy policy decisions from the EC Treaty. The author reviews the situation from the legal point of view based on existing provisions and gives an outlook on a possible outcome of the ''constitutional convention'' of the EC which is to meet for discussing a revision of the EC Treaty. (orig./CB) [German] In Bezug auf die geplanten Aenderungen der Binnenmarktrichtlinien fuer Elektrizitaet und Gas werden moegliche Kompetenzen der EG im Bereich der Energiepolitik und ihre Grenzen eroertert. In einer Schlussbetrachtung werden die Ergebnisse zusammengefasst und ein kurzer Ausblick auf die Arbeit des 'Verfassungskonvents' der EU und die anstehende Vertragsrevision geworfen, in deren Rahmen die Implikation einer eigenstaendigen Spezialkompetenz im Bereich Energie erneut thematisiert werden koennte. (orig./CB)
Directory of Open Access Journals (Sweden)
Rikard Dammen
Full Text Available We recently demonstrated that hypoxia, a key feature of IBD, increases enterochromaffin (EC cell 5-HT secretion, which is also physiologically regulated by the ADORA2B mechanoreceptor. Since hypoxia is associated with increased extracellular adenosine, we wanted to examine whether this nucleotide amplifies HIF-1α-mediated 5-HT secretion.The effects of hypoxia were studied on IBD mucosa, isolated IBD-EC cells, isolated normal EC cells and the EC cell tumor derived cell line KRJ-1. Hypoxia (0.5% O2 was compared to NECA (adenosine agonist, MRS1754 (ADORA2B receptor antagonist and SCH442146 (ADORA2A antagonist on HIF signaling and 5-HT secretion. Antisense approaches were used to mechanistically evaluate EC cells in vitro. PCR and western blot were used to analyze transcript and protein levels of HIF-1α signaling and neuroendocrine cell function. An animal model of colitis was evaluated to confirm hypoxia:adenosine signaling in vivo.HIF-1α is upregulated in IBD mucosa and IBD-EC cells, the majority (~90% of which express an activated phenotype in situ. Hypoxia stimulated 5-HT release maximally at 30 mins, an effect amplified by NECA and selectively inhibited by MRS1754, through phosphorylation of TPH-1 and activation of VMAT-1. Transient transfection with Renilla luciferase under hypoxia transcriptional response element (HRE control identified that ADORA2B activated HIF-1α signaling under hypoxic conditions. Additional signaling pathways associated with hypoxia:adenosine included MAP kinase and CREB. Antisense approaches mechanistically confirmed that ADORA2B signaling was linked to these pathways and 5-HT release under hypoxic conditions. Hypoxia:adenosine activation which could be reversed by 5'-ASA treatment was confirmed in a TNBS-model.Hypoxia induced 5-HT synthesis and secretion is amplified by ADORA2B signaling via MAPK/CREB and TPH-1 activation. Targeting ADORA2s may decrease EC cell 5-HT production and secretion in IBD.
Renewables in Transport: Directive 2009/28/EC - Devils in its Details
International Nuclear Information System (INIS)
Wilkin, S.
2009-01-01
As part of the 3*20 targets reached in December 2008, the EC decided that the EU should, by 2020, source 20% of its Final Energy Consumption (FEC) renewably. Working towards this aim should in general contribute to the primary objective of reducing emissions, but there are two major issues with the implementation of the target in the Transport sector which run the risk of being irrelevant or even counterproductive. Firstly, the constraining stipulation that all Member States should source 10% of their Transport sector FEC renewably will be a struggle for some Member States to achieve, forcing them to invest large amounts of money which would be better spent elsewhere. Secondly, the relevant legislation gives unrepresentative weight to the benefits of Electric Vehicles (EVs), meaning that Member States which invest in EVs may give the illusion of having reached their national renewable targets without actually having done so. This paper is based on EC Directive 2009/28/EC (henceforth referred to as 'the Directive') and the National Renewable Energy Action Plans of Denmark, France, Germany, Italy, Spain, and the UK which were submitted in response. Each EU Member State has an individual target for the proportion of its FEC which is to come from renewable sources in 2020. The targets are based on the countries? existing renewable shares (as shown in Table 1 below) and their supposed capacity for improvement. Together, they give an average EU-wide target of 20% across the 27 Member States. (author)
First Measurement of σ(gg → t$\\bar{t}$)/σ(p$\\bar{p}$ → t$\\bar{t}$)
Energy Technology Data Exchange (ETDEWEB)
Alamdari, Shabnaz Pashapour [Univ. of Toronto, ON (Canada)
2008-01-01
The work presented here is the first measurement of the fraction of top quark pair production through gluon-gluon fusion. We use an integrated luminosity of 0.96 ± 0.06 fb-1 of p{bar p} collisions at √s of 1.96 TeV collected by the CDF II detector. We select t$\\bar{t}$ candidates by identifying a high-pT lepton candidate, a large missing ET as evidence for a neutrino candidate and at least four high ET jets, one of which has to be identified as originating from a b quark. The challenge is to discriminate between the two production processes with the identical final state, gg → t$\\bar{t}$ and q$\\bar{p}$ → t$\\bar{t}$. We take advantage of the fact that compared to a quark, a gluon is more likely to radiate a low momentum gluon and therefore, one expects a larger number of charged particles with low pT in a process involving more gluons. Given the large uncertainties associated with the modeling of the low pT charged particle multiplicity, a data-driven technique was employed. Using calibration data samples, we show there exists a clear correlation between the observed average number of low pT charged particles and the average number of gluons involved in the production process predicted by Monte Carlo calculations. Given the correlation, one can identify low pT charged particle multiplicity distributions associated with specific average number of gluons. The W + 0 jet sample and dijets sample with leading jet ET in the range of 80-100 GeV are used to find no-gluon and gluon-rich low p{sub T} charged particle multiplicity distributions, respectively. Using these no-gluon and gluon-rich distributions in a likelihood fit, we find the fraction of gluon-rich events in t{bar t} candidates. This fraction has contributions from the signal and background events. Taking into account these contributions and the gg → t$\\bar{t}$ and q$\\bar{q}$ → t
Kim, Joo-Wan; Choi, Jae-Suk; Ha, Yu-Mi; Choi, In Soon; Kim, Ki-Young; Cho, Hyung-rae; Rha, Chae-hun; Ku, Sae-Kwang
2013-11-01
The object of this study was to obtain acute oral toxicity information of Polycalcium, a mixed composition of Polycan and Calcium lactate-gluconate 1:9 (g/g), in Sprague-Dawely (SD) rats. In order to investigate the toxicity and identify target organs, Polycalcium were once orally administered to female and male SD rats at dose levels of 2000, 1000, 500 and 0 (control) mg/kg body weights. The mortality, changes on body weight and clinical signs were monitored during 14 days after treatment with gross observation, changes on the organ weights and histopathology of principle organs and treatment sites based on the recommendation of KFDA Guidelines [2009-116, 2009]. As the results of single oral treatment of Polycalcium, no treatment related mortalities were observed within 14 days after end of treatment up to 2000 mg/kg, the limited dosage of rodents in the both genders. In addition, no Polycalcium treatment related changes on the body and organ weights, clinical signs, necropsy and histopathological findings were detected. The results obtained in this study suggest that the Polycalcium is non-toxic in rats. The LD50 and approximate LD in rats after single oral dose of Polycalcium were considered over 2000 mg/kg in both female and male, respectively.
Directory of Open Access Journals (Sweden)
Pilli R
2014-02-01
Full Text Available Historical analysis and modeling of the forest carbon dynamics using the Carbon Budget Model: an example for the Trento Province (NE, Italy. The Carbon Budget Model (CBM-CFS3 developed by the Canadian Forest Service was applied to data collected by the last Italian National Forest Inventory (INFC for the Trento Province (NE, Italy. CBM was modified and adapted to the different management types (i.e., even-aged high forests, uneven-aged high forests and coppices and silvicultural systems (including clear cuts, single tree selection systems and thinning applied in this province. The aim of this study was to provide an example of down-scaling of this model from a national to a regional scale, providing (i an historical analysis, from 1995 to 2011, and (ii a projection, from 2012 to 2020, of the forest biomass and the carbon stock evolution. The analysis was based on the harvest rate reported by the Italian National Institute of Statistics (from 1995 to 2011, corrected according to the last INFC data and distinguished between timber and fuel woods and between conifers and broadleaves. Since 2012, we applied a constant harvest rate, equal to about 1300 Mm3 yr-1, estimated from the average harvest rate for the period 2006-2011. Model results were consistent with similar data reported in the literature. The average biomass C stock was 90 Mg C ha-1 and the biomass C stock change was 0.97 Mg C ha-1 yr-1 and 0.87 Mg C ha-1 yr-1, for the period 1995 -2011 and 2012-2020, respectively. The C stock cumulated by the timber products since 1995 was 96 Gg C yr-1, i.e., about 28% of the average annual C stock change of the forests, equal to 345 Gg C yr-1. CBM also provided estimates on the evolution of the age class distribution of the even-aged forests and on the C stock of the DOM forest pools (litter, dead wood and soil. This study demonstrates the utility of CBM to provide estimates at a regional or local scale, using not only the data provided by the forest
Safety controls according to the non-proliferation treaty in EC countries
International Nuclear Information System (INIS)
Pander, J. von.
1978-01-01
Above all, content and extent of the duty conferred upon the IAEA according to article III, paragraph 1 of the NP treaty which implies the conducting of safety controls and the consequences resulting here from are examined. Including the peaceful use of nuclear energy developing under international law the agreement on safety control signed on 5th April 1973 between IAEA and EURATOM as well as its seven non-nuclear-weapon member states is discussed, along with its technical and its implicit legal problems. In detail the manifold technical and judicial problems of IAEA safety controls are shown, their realization requiring a well-working cooperation between IAEA and the European Communities. As only the non-nuclear-weapon member states of the EC are subject to the IAEA safety control system within the frame of this agreement the following questions are discussed: 1. effects on the member status after the signing of the EURATOM contract and 2. granting the principle of equal treatment for all member states as against the nuclear-weapon member states of the EC, France and the United Kingdom. (orig./HP) [de
Pena, L. D.; Francés, G.; Diz, P.; Nombela, M. A.; Alejo, I.
2003-04-01
Carbon and oxygen stable isotopes and ICP-OES elemental ratio concentrations (Mg/Ca, Sr/Ca, Ba/Ca) from core EUGC-3B (42 45.10'N; 9 02.23'W, at 38 m.b.s.l. and 410 cm length) were measured over monospecific benthic foraminiferal samples (Nonion fabum) ranging over the last 4500 yr BP. From the oldest analysed sample (289 cm) to the core top, stable isotopes signal shows that the whole record can be separated into 4 intervals lasting each of them about 1000 yr. The lowermost interval (4300-3000 yr BP) is characterized by relatively stable delta 18O values (mean 1.77 per mil). Delta 13C is relatively low except for a maximum around 3300 cal BP (-1.50 per mil). An abrupt decrease down to the minimum value in delta 13C (-4.41 per mil) is accomplished in approximately 200 yr. Mg/Ca and Ba/Ca match perfectly this event, both of them showing the respective maxima values. Sr/Ca has a very similar behaviour to that of delta 13C but with smoother fluctuations. We attribute high values of delta 13C, Sr/Ca and Ba/Ca to periods of enhanced coastal productivity, probably due to reinforced upwelling events in the region. According to Mg/Ca signal this reinforcement took place during a relatively warmer period. The most remarkable feature during the two next periods (3000-1900 yr BP and 1900-1000 yr BP) consists of a stepwise increase of delta 13C values punctuated by a sharp decrease at the end of each interval. All the remaining proxies exhibit a nearly constant trend over these intervals. Each period can be interpreted as a weak enhance of marine productivity that the system does not hold up and finally aborts. The most recent interval represents the establishment of current conditions in the coastal system. The most conspicuous event from this interval consists of an abrupt decrease of the delta 18O that lasted for 300 yr. This event could be correlated with the well recognized warm climatic event known as the Medieval Warm Period. However the Mg/Ca ratio does not show high
Aakko, J; Sánchez, B; Gueimonde, M; Salminen, S
2014-07-01
The purpose of this study was to investigate the heat-shock response at molecular level in Lactobacillus rhamnosus GG, Bifidobacterium animalis subsp. lactis BB-12 and their heat-tolerant derivatives and to characterize the changes that make the derivatives more robust in terms of heat stress. The study strains were exposed for 2 h to a heat-shock treatment, Bif. animalis subsp. lactis BB-12 and its derivative at 50°C and the Lact. rhamnosus GG and its derivative at 60°C. Protein synthesis before and after heat shock was examined using proteomics and RT-qPCR. The analysis revealed that the regulation of seven proteins in both strain pairs was modified as a response to heat or between the original and the derivative strain. The comparison of wild-type strains and the heat-tolerant derivatives suggests that the acquisition of heat tolerance in the Bif. animalis subsp. lactis BB-12 derivative is due to a slightly increased constitutive level of chaperones, while in Lact. rhamnosus GG derivative, the main reason seems to be a higher ability to induce the production of chaperones. This study revealed possible markers of heat tolerance in B. lactis and Lact. rhamnosus strains. This study increases our knowledge on how Lactobacillus and Bifidobacterium strains may acquire heat tolerance. These findings may be useful for improving the heat tolerance of existing probiotic strains as well as screening new heat-tolerant strains. © 2014 The Society for Applied Microbiology.
Two investigations concerning the release of tritium. I. Tritium leakage from 3H(Sc) EC-detectors
International Nuclear Information System (INIS)
Bergman, C.; Wesslen, E.
1977-01-01
Recently the manufacturers of EC-detectors for gas chromatographs introduced a new type of 3 H EC-detector where the tritium is bound to scandium instead of to titanium and has an activity up to 1 Ci. It is expected that the scandium-based detector will take a great part of the Swedish EC-detector market. The Swedish National Institute of Radiation Protection is anxious to make sure that the introduction of the new detector, which will be used at higher temperature, will not give rise to any increased risk of tritium intake to the personnel handling the chromatographs. The leakage of tritium from commercially available 3 H(Sc) EC-detectors containing 1 Ci of tritium was measured as a function of the detector temperature. Tritium appears both in the form of tritium gas dissolved in the scandium and in the form of tritide. The gas evaporates rather easily with increasing temperature while the dissociation of the tritide is a slower process. The evaporation of tritium due to the dissociation of the tritide was found to be negligible, less than 0.2 μCi/h at temperatures less than 100 0 C, but rises rapidly with temperature. The study also showed that even when the detector is stored at room temperature, a re-distribution of the tritium occures, from the tritide to the dissolved tritium gas, which then easily evaporates even at moderately elevated temperatures
Simmonds, Peter G.; Rigby, Matthew; McCulloch, Archie; Vollmer, Martin K.; Henne, Stephan; Mühle, Jens; O'Doherty, Simon; Manning, Alistair J.; Krummel, Paul B.; Fraser, Paul J.; Young, Dickon; Weiss, Ray F.; Salameh, Peter K.; Harth, Christina M.; Reimann, Stefan; Trudinger, Cathy M.; Steele, L. Paul; Wang, Ray H. J.; Ivy, Diane J.; Prinn, Ronald G.; Mitrevski, Blagoj; Etheridge, David M.
2018-03-01
High frequency measurements of trifluoromethane (HFC-23, CHF3), a potent hydrofluorocarbon greenhouse gas, largely emitted to the atmosphere as a by-product of the production of the hydrochlorofluorocarbon HCFC-22 (CHClF2), at five core stations of the Advanced Global Atmospheric Gases Experiment (AGAGE) network, combined with measurements on firn air, old Northern Hemisphere air samples and Cape Grim Air Archive (CGAA) air samples, are used to explore the current and historic changes in the atmospheric abundance of HFC-23. These measurements are used in combination with the AGAGE 2-D atmospheric 12-box model and a Bayesian inversion methodology to determine model atmospheric mole fractions and the history of global HFC-23 emissions. The global modelled annual mole fraction of HFC-23 in the background atmosphere was 28.9 ± 0.6 pmol mol-1 at the end of 2016, representing a 28 % increase from 22.6 ± 0.4 pmol mol-1 in 2009. Over the same time frame, the modelled mole fraction of HCFC-22 increased by 19 % from 199 ± 2 to 237 ± 2 pmol mol-1. However, unlike HFC-23, the annual average HCFC-22 growth rate slowed from 2009 to 2016 at an annual average rate of -0.5 pmol mol-1 yr-2. This slowing atmospheric growth is consistent with HCFC-22 moving from dispersive (high fractional emissions) to feedstock (low fractional emissions) uses, with HFC-23 emissions remaining as a consequence of incomplete mitigation from all HCFC-22 production.Our results demonstrate that, following a minimum in HFC-23 global emissions in 2009 of 9.6 ± 0.6, emissions increased to a maximum in 2014 of 14.5 ± 0.6 Gg yr-1 and then declined to 12.7 ± 0.6 Gg yr-1 (157 Mt CO2 eq. yr-1) in 2016. The 2009 emissions minimum is consistent with estimates based on national reports and is likely a response to the implementation of the Clean Development Mechanism (CDM) to mitigate HFC-23 emissions by incineration in developing (non-Annex 1) countries under the Kyoto Protocol. Our derived cumulative
Methane emissions from a human-dominated lowland coastal river network (Shanghai, China)
Wang, D.; Yu, Z.
2017-12-01
Evasion of methane (CH4) in streams and rivers play a critical role in global carbon (C) cycle, offsetting the C uptake by terrestrial ecosystems. However, little is known about CH4 emissions from lowland coastal rivers profoundly modified by anthropogenic perturbations. Here, we report results from a long-term, large-scale study of CH4 partial pressures (pCH4) and evasion rates in the Shanghai river network. The spatiotemporal variability of pCH4 was examined along a land-use gradient and the annual CH4 evasion were estimated to assess its role in regional C budget. During the study period, the median pCH4 from 87 surveyed rivers was 241 μatm. CH4 was oversaturated throughout the river network, CH4 hotpots were concentrated in the small urban rivers and highly discharge-dependent. The annual median fCH4 for each site ranged from 3.1 mg C•m-2•d-1 to 296.6 mg C•m-2•d-1. The annual CH4 evasion were 105 Gg CO2-eq•yr-1 and 96 Gg CO2-eq•yr-1 for the entire river network and the mainland rivers, respectively. Given the rapid urbanization in global coastal areas, more research is needed to quantify the role of lowland coastal rivers as a major landscape C source in global C budget.
Directory of Open Access Journals (Sweden)
Damigos Dimitris
2008-08-01
Full Text Available Abstract Background The Emotional Contagion Scale (ECS is a self-report scale used to measure individual differences in susceptibility to converge towards the emotions expressed by others. The main aim of the present paper was to examine the psychometric properties of the Greek translation of the scale. Methods The Greek ECS was completed by 691 undergraduate students (312 males and 379 females. To investigate the factor structure of the ECS, principal components analysis (PCA was used. Results The results showed that a four-factor model was tenable. Regarding homogeneity, the Greek ECS version showed acceptable results for the full scale (α = 0.74 but not for all subscales. Gender differences were also identified concerning the susceptibility to emotional contagion between men and women. Women score significantly higher than men for all the different emotions described by the ECS (love, happiness, sadness except the anger emotion, where there was no significant difference. Conclusion The Greek version of the ECS showed good psychometric properties. It can be used to assess susceptibility to emotional contagion in correlation with psychopathological processes, mood and anxiety disorders primarily. The usefulness of the ECS in the fields of group psychotherapy and health psychology is also under consideration. Further investigation is needed in all these areas.
2010-07-01
... Waste Incinerators for Which Construction is Commenced After June 20, 1996 Pt. 60, Subpt. Ec, Table 1A... Facilities as Defined in § 60.50c(a)(1) and (2) Pollutant Units (7 percent oxygen, dry basis) Emissions... matter Milligrams per dry standard cubic meter (grains per dry standard cubic foot) 69 (0.03) 34 (0.015...
The upgrade of the DIII-D EC system using 120 GHz ITER gyrotrons
International Nuclear Information System (INIS)
Callis, R.W.; Lohr, J.; Gorelov, I.A.; Ponce, D.; Kajiwara, K.; Tooker, J.F.
2005-01-01
The planned growth in the EC system on DIII-D over the next few years requires the installation of two depressed collector gyrotrons, a high voltage power supply, two low loss transmission lines, and the required support equipment. This new DIII-D EC equipment could be made identical to the ITER EC system requirements. By building the DIII-D hardware to the ITER specifications, it will allow ITER to gain beneficial prototyping experience on a working tokamak, prior to committing to building the hardware for delivery to ITER
Revisiting the EC/CMB model for extragalactic large scale jets
Lucchini, M.; Tavecchio, F.; Ghisellini, G.
2017-04-01
One of the most outstanding results of the Chandra X-ray Observatory was the discovery that AGN jets are bright X-ray emitters on very large scales, up to hundreds of kpc. Of these, the powerful and beamed jets of flat-spectrum radio quasars are particularly interesting, as the X-ray emission cannot be explained by an extrapolation of the lower frequency synchrotron spectrum. Instead, the most common model invokes inverse Compton scattering of photons of the cosmic microwave background (EC/CMB) as the mechanism responsible for the high-energy emission. The EC/CMB model has recently come under criticism, particularly because it should predict a significant steady flux in the MeV-GeV band which has not been detected by the Fermi/LAT telescope for two of the best studied jets (PKS 0637-752 and 3C273). In this work, we revisit some aspects of the EC/CMB model and show that electron cooling plays an important part in shaping the spectrum. This can solve the overproduction of γ-rays by suppressing the high-energy end of the emitting particle population. Furthermore, we show that cooling in the EC/CMB model predicts a new class of extended jets that are bright in X-rays but silent in the radio and optical bands. These jets are more likely to lie at intermediate redshifts and would have been missed in all previous X-ray surveys due to selection effects.
Bischoff, James L.; Cummins, Kathleen
2001-01-01
Chemical analyses of the clay-sized fractions of 564 continuous sediment samples (200-yr resolution) from composite core OL90/92 allow quantification of an abundance of glacial rock flour. Rock flour produced during glacier advances is represented by clay-sized plagioclase, K-feldspar, and biotite in homogeneous internal composition. The abundance of rock flour is deemed proportional to the intensity of glacies advances. Age control for the composite section is provided by combining previously published radiocarbon dates on organics, U/Th dates on ostracode shells, and U/Th dates on saline minerals from nearby Searles Lake correlated to OL92 by pollen. The rock flour record displays three levels of variability: (1) a dominant one of about 20,000 yr related to summer insolation and precipitation; (2) an intermediate one of 3000-5000 yr, perhaps related to North Atlantic Heinrich events; and (3) a minor one of 1000-2000 yr, perhaps related to North Atlantic thermohaline-driven air-temperature variation.
Early diagenesis of recently deposited organic matter: A 9-yr time-series study of a flood deposit
Tesi, T.; Langone, L.; Goñi, M. A.; Wheatcroft, R. A.; Miserocchi, S.; Bertotti, L.
2012-04-01
In Fall 2000, the Po River (Italy) experienced a 100-yr return period flood that resulted in a 1-25 cm-thick deposit in the adjacent prodelta (10-25 m water depth). In the following years, numerous post-depositional perturbations occurred including bioturbation, reworking by waves with heights exceeding 5 m, as well as periods of extremely high and low sediment supply. Cores collected in the central prodelta after the Fall 2000 flood and over the following 9 yr, allowed characterization of the event-strata in their initial state and documentation of their subsequent evolution. Sedimentological characteristics were investigated using X-radiographs and sediment texture analyses, whereas the composition of sedimentary organic matter (OM) was studied via bulk and biomarker analyses, including organic carbon (OC), total nitrogen (TN), carbon stable isotope composition (δ13C), lignin phenols, cutin-products, p-hydroxy benzenes, benzoic acids, dicarboxylic acids, and fatty acids. The 9-yr time-series analysis indicated that roughly the lower half of the original event bed was preserved in the sediment record. Conversely, the upper half of the deposit experienced significant alterations including bioturbation, addition of new material, as well as coarsening. Comparison of the recently deposited material with 9-yr old preserved strata represented a unique natural laboratory to investigate the diagenesis of sedimentary OM in a non-steady system. Bulk data indicated that OC and TN were degraded at similar rates (loss ∼17%) whereas biomarkers exhibited a broad spectrum of reactivities (loss from ∼6% to ∼60%) indicating selective preservation during early diagenesis. Given the relevance of episodic sedimentation in several margins, this study has demonstrated the utility of event-response and time-series sampling of the seabed for understanding the early diagenesis in non-steady conditions.
Austria's environmental law in comparison with the environmental law of the EC
International Nuclear Information System (INIS)
Jantscher, S.H.
1991-11-01
The thesis describes and compares the environmental legislation in Austria and the EC. A short introduction into structure and organization of EC-institutions and EC-legislation in followed by an examination of the constitutional foundations of environmental policy in Austria and the EC respectively. After the adoption for the Single European Act, the EEC-Treaty provides for objectives, orientation criteria and instruments regarding environmental protection. These provisions constitute a valid basis for environmental action. The adoption of a constitutional law does equally declare environmental protection as an objective of the state in Austria, however, its significance is regarded as rather controversial. Some provinces ('Laender') have shown a higher degree of sensitivity in their constitutions . The distribution of powers between the EC and its member stated in the field of environmental protection is of particular interests. It is shown, that the principle of subsidiarity and the safeguard-clauses leave discretion to the member states. Much will be determined by the European Court of Justice (ECJ) . Main emphasis has been placed on the description and comparison of Austria's and the EEC-environmental legislation. Environmental legislation of Austria as well as the EC is outlined sector by sector (i.e. water, air, chemicals, waste, soil, fauna and flora) and subsequently the object of a detailed comparison. Criteria, such as - preventiveness -stringency - focus, depth and comprehensiveness - clearness and legal force of the regulations have been applied. For most of the mentioned sectors it is correct to state, that Austria's legislation is more preventive, advanced, comprehensive and stringent (especially regulations related to water, waste, chemicals, also air) . However, there are particular areas (e.g. air quality objectives, noise limits for construction plants) where Austria' s legislation may well get a fresh impetus
On the Origin of Multidecadal to Centennial Greenland Temperature Anomalies Over the Past 800 yr
Kobashi, T.; Shindell, D. T.; Kodera, K.; Box, J. E.; Nakaegawa, T.; Kawamura, K.
2013-01-01
The surface temperature of the Greenland ice sheet is among the most important climate variables for assessing how climate change may impact human societies due to its association with sea level rise. However, the causes of multidecadal-to-centennial temperature changes in Greenland temperatures are not well understood, largely owing to short observational records. To examine these, we calculated the Greenland temperature anomalies (GTA[G-NH]) over the past 800 yr by subtracting the standardized northern hemispheric (NH) temperature from the standardized Greenland temperature. This decomposes the Greenland temperature variation into background climate (NH); polar amplification; and regional variability (GTA[G-NH]). The central Greenland polar amplification factor as expressed by the variance ratio Greenland/NH is 2.6 over the past 161 yr, and 3.3-4.2 over the past 800 yr. The GTA[G-NH] explains 31-35%of the variation of Greenland temperature in the multidecadal-to-centennial time scale over the past 800 yr. We found that the GTA[G-NH] has been influenced by solar-induced changes in atmospheric circulation patterns such as those produced by the North Atlantic Oscillation/Arctic Oscillation (NAO/AO). Climate modeling and proxy temperature records indicate that the anomaly is also likely linked to solar-paced changes in the Atlantic meridional overturning circulation (AMOC) and associated changes in northward oceanic heat transport.
On the origin of multidecadal to centennial Greenland temperature anomalies over the past 800 yr
Directory of Open Access Journals (Sweden)
T. Kobashi
2013-03-01
Full Text Available The surface temperature of the Greenland ice sheet is among the most important climate variables for assessing how climate change may impact human societies due to its association with sea level rise. However, the causes of multidecadal-to-centennial temperature changes in Greenland temperatures are not well understood, largely owing to short observational records. To examine these, we calculated the Greenland temperature anomalies (GTA[G-NH] over the past 800 yr by subtracting the standardized northern hemispheric (NH temperature from the standardized Greenland temperature. This decomposes the Greenland temperature variation into background climate (NH; polar amplification; and regional variability (GTA[G-NH]. The central Greenland polar amplification factor as expressed by the variance ratio Greenland/NH is 2.6 over the past 161 yr, and 3.3–4.2 over the past 800 yr. The GTA[G-NH] explains 31–35% of the variation of Greenland temperature in the multidecadal-to-centennial time scale over the past 800 yr. We found that the GTA[G-NH] has been influenced by solar-induced changes in atmospheric circulation patterns such as those produced by the North Atlantic Oscillation/Arctic Oscillation (NAO/AO. Climate modeling and proxy temperature records indicate that the anomaly is also likely linked to solar-paced changes in the Atlantic meridional overturning circulation (AMOC and associated changes in northward oceanic heat transport.
Directory of Open Access Journals (Sweden)
Amol Prakash Mankar
2017-09-01
Full Text Available Background: Prevalence of hypertension is not only on the rise in urban population, but its precedence is of concern. Aims & Objective: To identify risk factors associated with hypertension among urban young Indian males. (<40yr. Material & Methods: Young males (<40yr working in Hinjewadi industrial area of Pune, Maharashtra were studied (n=254 for anthropometry, blood pressure and diet, lifestyle, and stress at work. Results: Prevalence of overweight was 72.5% and 48.4 % were obese while 38.2% were centrally obese (WC90. Prevalence of hypertension (HTN was high (25.6% and showed significant association only with BMI. Non vegetarian diet was a risk factor (OR-1.94;p<0.05 for overweight while lifestyle factors increased risk for obesity (OR-2.1;p<0.05 as also central obesity (OR-1.91;p<0.05. Among subjects with high BMI, these factors became non-significant and stress alone showed independent influence on HTN (OR-4.43; p<0.05 indicating that their influence was mediated through adiposity. Conclusion: Promoting good dietary practices, healthy lifestyle and better work environment for reducing obesity and consequent risk of NCDs among young urban males is essential in India.
Directory of Open Access Journals (Sweden)
Amol Prakash Mankar
2017-09-01
Full Text Available Background: Prevalence of hypertension is not only on the rise in urban population, but its precedence is of concern. Aims & Objective: To identify risk factors associated with hypertension among urban young Indian males. (<40yr. Material & Methods: Young males (<40yr working in Hinjewadi industrial area of Pune, Maharashtra were studied (n=254 for anthropometry, blood pressure and diet, lifestyle, and stress at work. Results: Prevalence of overweight was 72.5% and 48.4 % were obese while 38.2% were centrally obese (WC90. Prevalence of hypertension (HTN was high (25.6% and showed significant association only with BMI. Non vegetarian diet was a risk factor (OR-1.94;p<0.05 for overweight while lifestyle factors increased risk for obesity (OR-2.1;p<0.05 as also central obesity (OR-1.91;p<0.05. Among subjects with high BMI, these factors became non-significant and stress alone showed independent influence on HTN (OR-4.43; p<0.05 indicating that their influence was mediated through adiposity. Conclusion: Promoting good dietary practices, healthy lifestyle and better work environment for reducing obesity and consequent risk of NCDs among young urban males is essential in India.
Energy Technology Data Exchange (ETDEWEB)
Gohlke, B. [IMI Norgren Herion Fluidtronic GmbH und Co. KG, Fellbach (Germany)
2003-09-01
The European Parliament and European Council have enacted special codes in order to implement uniform conditions in all countries of the European Community. The manufacturers of technical and commercial products are obliged to adhere to these codes. Harmonized standards, which are to be used as a tool for the implementation of the codes, are embedded at another level of the overall 'European reference literature'. Two EC codes, in particular, are definitive for fluids engineering: On the one hand, the EC Machinery Code, 98/37/EC and, on the other hand, the EC Pressurized Equipment Code, 97/23/EC. These EC codes cover, inter alia, machinery and chemical process-engineering plants, and conventional power generating plants. Norgren-Herion, a manufacturer of fluid engineering components, perceived a necessity for positioning its control valves in the scope of applicability of the EC codes. This article describes experience with the EC codes from the control valve manufacturer's point of view and examines the various qualification procedures for control valves. (orig.)
Xu, Ying; Gao, Xuejie; Giorgi, Filippo; Zhou, Botao; Shi, Ying; Wu, Jie; Zhang, Yongxiang
2018-04-01
Future changes in the 50-yr return level for temperature and precipitation extremes over mainland China are investigated based on a CMIP5 multi-model ensemble for RCP2.6, RCP4.5 and RCP8.5 scenarios. The following indices are analyzed: TXx and TNn (the annual maximum and minimum of daily maximum and minimum surface temperature), RX5day (the annual maximum consecutive 5-day precipitation) and CDD (maximum annual number of consecutive dry days). After first validating the model performance, future changes in the 50-yr return values and return periods for these indices are investigated along with the inter-model spread. Multi-model median changes show an increase in the 50-yr return values of TXx and a decrease for TNn, more specifically, by the end of the 21st century under RCP8.5, the present day 50-yr return period of warm events is reduced to 1.2 yr, while extreme cold events over the country are projected to essentially disappear. A general increase in RX5day 50-yr return values is found in the future. By the end of the 21st century under RCP8.5, events of the present RX5day 50-yr return period are projected to reduce to China. Changes in CDD-50 show a dipole pattern over China, with a decrease in the values and longer return periods in the north, and vice versa in the south. Our study also highlights the need for further improvements in the representation of extreme events in climate models to assess the future risks and engineering design related to large-scale infrastructure in China.
International Nuclear Information System (INIS)
Wicks, G.G.; Lodding, A.R.; Macedo, P.B.; Clark, D.E.
1991-01-01
The first field test, involving burial of simulated high-level waste (HLW) forms and package components, to be conducted in the United States, was begun in July of 1986. This program, called the Materials Interface Interactions Test or MIIT, comprises the largest cooperative field-testing venture in the international waste management community. Included in the study are over 900 waste form samples comprising 15 different systems supplied by 7 countries. Also included are about 300 potential canister or overpack metal samples along with more than 500 geologic and backfill specimens. There are almost 2000 relevant interactions that characterize this effort which is being conducted in the bedded salt site at the Waste Isolation Pilot Plant (WIPP), near Carlsbad, New Mexico. The MIIT program represents a joint effort managed by Sandia National Laboratories in Albuquerque, N.M., and Savannah River Laboratory in Aiken, S.C. and sponsored by the US Department of Energy. Also involved in MIIT are participants from various laboratories and universities in France, Germany, Belgium, Canada, Japan, Sweden, the United Kingdom, and the United States. In July of 1991, the experimental portion of the 5-yr. MIIT program was completed. Although only about 5% of all MIIT samples have been assessed thus far, there are already interesting findings that have emerged. The present paper will discuss results obtained for SRS 165/TDS waste glass after burial of 6 mo., 1 yr. and 2 yrs., along with initial analyses of 5 yr. samples
Boyd, Mark R.; Winters, Jennifer G.; Henry, Todd J.; Jao, Wei-Chun; Finch, Charlie T.; Subasavage, John P.; Hambly, Nigel C.
2011-01-01
We present 2817 new southern proper motion systems with 0.40 sec/yr > mu > or = 0.18 sec/yr and declination between 47 deg and 00 deg. This is a continuation of the SuperCOSMOS-RECONS (SCR) proper motion searches of the southern sky. We use the same photometric relations as previous searches to provide distance estimates based on the assumption that the objects are single main-sequence stars. We find 79 new red dwarf systems predicted to be within 25 pc, including a few new components of previously known systems. Two systems--SCR 1731-2452 at 9.5 pc and SCR 1746-3214 at 9.9 pc--are anticipated to be within 10 pc. We also find 23 new white dwarf (WD) candidates with distance estimates of 15-66 pc, as well as 360 new red subdwarf candidates. With this search, we complete the SCR sweep of the southern sky for stars with mu > or = 0.18 sec/yr and R(sub 59F) < or = 16.5, resulting in a total of 5042 objects in 4724 previously unreported proper motion systems. Here we provide selected comprehensive lists from our SCR proper motion search to date, including 152 red dwarf systems estimated to be within 25 pc (9 within 10 pc), 46 WDs (10 within 25 pc), and 598 subdwarf candidates. The results of this search suggest that there are more nearby systems to be found at fainter magnitudes and lower proper motion limits than those probed so far.
Genes and proteins of Escherichia coli K-12 (GenProtEC).
Riley, M
1997-01-01
GenProtEC is a database of Escherichia coli genes and their gene products, classified by type of function and physiological role and with citations to the literature for each. Also present are data on sequence similarities amongE.coliproteins with PAM values, percent identity of amino acids, length of alignment and percent aligned. GenProtEC can also be accessed through the World Wide Web at URL http://mbl.edu/html/ecoli.html .
Antiviral activity of some Tunisian medicinal plants against Herpes simplex virus type 1.
Sassi, A Ben; Harzallah-Skhiri, F; Bourgougnon, N; Aouni, M
2008-01-10
Fifteen species of Tunisian traditional medicinal plants, belonging to 10 families, were selected for this study. They were Inula viscosa (L.) Ait and Reichardia tingitana (L.) Roth ssp. discolor (Pom.) Batt. (Asteraceae), Mesembryanthemum cristallinum L. and M. nodiflorum L. (Aizoaceae), Arthrocnemum indicum (Willd.) Moq., Atriplex inflata Muell., A. parvifolia Lowe var. ifiniensis (Caball) Maire, and Salicornia fruticosa L. (Chenopodiaceae), Cistus monspeliensis L. (Cistaceae), Juniperus phoenicea L. (Cupressaceae), Erica multiflora L. (Ericaceae), Frankenia pulverulenta L. (Frankeniaceae), Hypericum crispum L. (Hypericaceae), Plantago coronopus L. ssp. eu-coronopus Pilger var. vulgaris G.G. (Plantaginaceae) and Zygophyllum album L. (Zygophyllaceae). Fifty extracts prepared from those plants were screened in order to assay their antiviral activity against Herpes simplex virus type 1 (HSV-1), using neutral red incorporation. Extracts from eight plants among these 15 showed some degree of antiviral activity, while the methanolic extract of E. multiflora was highly active with EC(50) of 132.6 microg mL(-1). These results corroborate that medicinal plants from Tunisia can be a rich source of potential antiviral compounds.
International Nuclear Information System (INIS)
Pfister, S.L.; Schmitz, J.M.; Willerson, J.T.; Campbell, W.B.
1986-01-01
This study was designed to characterize the metabolism of arachidonic acid (AA) in normal and atherosclerotic aortas. Segments of aortas were obtained from 1 yr old NZW rabbits, and WHHL rabbits, a genetic model of athero-sclerosis resembling familial hypercholesterolemia. Aortas were incubated at 37 0 C for 15 min with 14 C-AA (5 x 10 -5 M) during stimulation by A23187. The media was extracted using octadecylsilica columns and resolved into metabolites by reverse-phase HPLC. Prostaglandins (PGs) were identified by comigration of 14 C-metabolites with standards. The monoxygenated metabolites of AA (HETEs) were resolved by normal-phase HPLC, and their structures confirmed by GC-MS. In extracts from NZW and WHHL aortas, approximately 14% and 6% of the total radioactivity was converted to PGs and HETEs, respectively. The major PG produced by NZW and WHHL aortas was 6-keto PGF/sub 1α/ with lesser amounts of PGE 2 . Similarly, NZW and WHHL aortas produced primarily 12- and 15-HETE with lesser amounts of 11-, 9-, 8-, and 5-HETE. There were no qualitative differences between NZW and WHHL aortas in PG and HETE production. Therefore, despite extensive atherosclerosis in aortas of WHHL rabbits, the vessels maintain the ability to synthesize PGs and HETEs
Hydrophysical Evaluation of Wells TW-B, TW-7, UE-6d, U-2gg PSE 3A, U-10L 1, and UE-6e in Yucca Flat
Energy Technology Data Exchange (ETDEWEB)
Pohlmann, Karl [Desert Research Inst. (DRI), Las Vegas, NV (United States); Healey, John [Desert Research Inst. (DRI), Las Vegas, NV (United States); Lyles, Bred [Desert Research Inst. (DRI), Reno, NV (United States); Cooper, Clay [Desert Research Inst. (DRI), Reno, NV (United States); Hershey, Ronald L. [Desert Research Inst. (DRI), Reno, NV (United States)
2017-05-01
This study evaluated six wells in Yucca Flat in support of the Underground Test Area (UGTA) Activity conducted by the U.S. Department of Energy (DOE) at the Nevada National Security Site (NNSS). Accessibility and groundwater sampling conditions were assessed and if conditions permitted, samples were collected for tritium analysis. Four of the wells, TW-B, UE-6d, UE-6e, and TW-7 were sampled in support of UGTA responses to recommendations made by the Yucca Flat/Climax Mine External Peer Review Committee (Navarro, 2016). In addition to its role in support of these responses, TW-7 was included because it is listed in the NNSS Integrated Groundwater Sampling Plan (DOE, 2014) as a required sampling location, although it had not been sampled since 1994. U-2gg PSE 3A and U-10L 1 were evaluated to determine whether deteriorating well conditions can be addressed so that these wells can be used as additional sampling points in Yucca Flat.
International Nuclear Information System (INIS)
Grupche, Ljupcho; Lozanovski, Risto; Markovska, Natasha
2001-01-01
During 2000 and 2001 inventories of CO 2 removals and emissions caused by changes in forest and other woody biomass stocks, as well as the inventories of CO 2 and non-CO 2 trace gas emissions caused by forest conversions (accidental burning) were carried out. According to the forest area in ha, and depending on the differences between the annual biomass increment and annual biomass consumption, about 30-50% of total annual carbon uptake increment is released through the biomass consumption from stocks. 50-70% of the net annual carbon uptake converted to CO 2 identify the annual removals of this gas, which is on average 1805 Gg/yr, ranging between 1485 and 2243 Gg/yr. From 1990 to 1998 on average 4700 ha forest area (min. 110 ha in 1991, max. 14420 ha in 1993) was burned. Proportionally to the burned area, there was a release on average of 18.62 kt C annually (min. 0.42 kt C, max. 57.11 kt), related to 136.07 kt CO 2 on average (min. 1.5 kt CO 2 , max. 209.22 kt CO 2 ). (Original)
EC Competition law and environmental protection
Energy Technology Data Exchange (ETDEWEB)
Rantala, M.
1996-12-31
Due to the increasing attention paid on environmental protection, by the European Community, the Member States and the consumers, undertakings are forced to adjust their policies to meet the new demands posed by public authorities and the market. This has an inevitable impact on competition. No matter how acceptable the goals were, the means are to be assessed also from the competition law point of view. The objective of this study is to analyze the situations where conflicts may take place, the main sources of research being the principles of law relating to the Treaty ,the judgements of the European Court of Justice, the Commission Decisions and other official documents of the Community as well as legal literature. This study classifies the Community and Member State instruments which are used for environmental protection into four categories. These are legislative, market-based, horizontal and financial supporting instruments. Undertakings` environmental practices, which are capable of affecting competition, are examined under Articles 85 and 86 EC, some attention being paid also to Article 90 EC. The touching points of competition policy and environmental protection in such cases are scrutinized under three headings. These are the two, in this case, most relevant public instruments, ie. legislative and market-based measures, and the voluntary actions of undertakings. (42 refs.)
Explosion-proof actuators according to EU directive 94/9/EC (ATEX)
Energy Technology Data Exchange (ETDEWEB)
Herbstritt, M. [AUMA Riester GmbH und Co. KG. Muellheim (Germany)
2004-07-01
Since July, 1, 2003 only explosion-proof devices which conform to the new EU Directive 94/9/EC, better known as the ATEX Directive, are introduced to the market. Especially the explosion protection of non-electrical equipment is a completely new task for many manufacturers. AUMA has qualified its electric actuators for the automation of industrial valves in accordance with the new regulations. In addition the design has been improved. (orig.)
Ganguli, K.; Collado, M.C.; Rautava, J.; Lu, L.; Satokari, R.M.; Ossowski, von I.; Reunanen, J.; Vos, de W.M.; Palva, A.; Isolauri, E.; Salminen, S.; Walker, W.A.; Rautava, S.
2015-01-01
BACKGROUND: Bacterial contact in utero modulates fetal and neonatal immune responses. Maternal probiotic supplementation reduces the risk of immune-mediated disease in the infant. We investigated the immunomodulatory properties of live Lactobacillus rhamnosus GG and its SpaC pilus adhesin in human
Enhanced CANDU 6 (EC6): a proven mid-sized reactor with fuel cycle capability
International Nuclear Information System (INIS)
Hopwood, J.; Soulard, M.; Hastings, I.J.
2011-01-01
Atomic Energy of Canada (AECL) is finalizing development of the Enhanced CANDU 6 (EC6), which incorporates the CANDU 6's well-proven features, and adds enhancements that make the reactor even more safe and easier to operate. The EC6 is the only mid-sized reactor (700 MWe class) with a proven pedigree that meets modern reactor expectations and regulatory standards. It is sized for smaller grids and also has outstanding fuel-cycle capability. Changes are incremental and consistent with the CANDU 6 project approach. The EC6 utilizes modern computers and a distributed control system housed in an advanced control room which, along with automated testing and on-line diagnostics, make the plant easier and safer to operate, with minimal operator intervention. Containment and seismic capability are upgraded to meet modern standards. The first deployment of the EC6 is anticipated in Canada; international markets are also being pursued. AECL is performing a comprehensive review of the EC6 design in the wake of the Fukushima accident, will review lessons learned, and incorporate any necessary improvements into new build design. (author)
Enhanced CANDU 6 (EC6): a proven mid-sized reactor with fuel cycle capability
International Nuclear Information System (INIS)
Hopwood, J.; Soulard, M.; Hastings, I.J.
2011-01-01
Atomic Energy of Canada (AECL) is finalizing development of the Enhanced CANDU 6 (EC6), which incorporates the CANDU 6's well-proven features, and enhancements that make the reactor even more safe and easier to operate. The EC6 is the only mid-sized reactor (700 MWe class) with a proven pedigree that meets modern reactor expectations and regulatory standards. It is sized for smaller grids and also has outstanding fuel-cycle capability. Changes are incremental and consistent with the CANDU 6 project approach. The EC6 utilizes modern computers and a distributed control system housed in an advanced control room which, along with automated testing and on-line diagnostics, make the plant easier and safer to operate, with minimal operator intervention. Containment and seismic capability are upgraded to meet modern standards. The first deployment of the EC6 is anticipated in Canada; international markets are also being pursued. AECL is performing a comprehensive review of the EC6 design in the wake of the Fukushima accident, will review lessons learned, and incorporate any necessary improvements into new build design. (author)
Air Toxics Emissions from Open Burning of Crop Residues in Southeast Asia
KIM Oanh, N. T.; Permadi, D. A.; Hopke, P. K.; Smith, K. R.; Nguyet, D. A.
2016-12-01
Agricultural crops production in Southeast Asia (SEA) increases annually to meet domestic consumption of growing population and also for export. Crop residue open burning (CROB) is commonly practiced by farmers to quickly dispose of huge amounts of the agricultural waste, such as rice straw, generated after each crop cycle. This CROB activity emits various toxic air pollutants as well as short-lived climate pollutants such as black carbon particles. Our study focused on quantifying the 2015 annual emissions of semi-volatile organic compounds including polycyclic aromatic hydrocarbons (PAHs), dioxins/furans (PCDD/PCDF), organochlorine pesticides (OCP), along with other conventional trace gases, particulate matter, and greenhouse gases from CROB in 10 major agricultural crop producing SEA countries. Crop production statistics and current field OB practices were gathered from our primary surveys and relevant secondary data sources. Emission factors for rice straw and maize residue burning were taken mainly from our measurements in Thailand while for other crops relevant published data were used. The best emission estimates of air toxics from CROB in SEA were 112 g-TEQ/yr of PCDD/PCDF, 33 t/yr of OCP, and 25 Gg/yr of total PAH of which the well-known carcinogenic benzo[a]pyrene was 0.3 Gg/yr. The CROB of rice production had the highest shares of emissions (33-95%) among considered 8 crop types. Indonesia was the top contributor to the total SEA emissions (30-45%) followed by Vietnam (16-26%), Thailand (6-22%) and Myanmar (5-18%). The spatial distributions of emissions, 0.1º x 0.1º, for each specie were prepared using MODIS land cover data. Temporally, higher emissions were observed in the harvesting months of the main rice crops. This emissions database can be used in regional air quality modeling studies to assess the impacts of CROB activity and to promote non-open burning alternatives.
Polymorphisms of Interlukin-1β rs16944 confer susceptibility to myelodysplastic syndromes.
Yin, Congcong; He, Na; Li, Peng; Zhang, Chen; Yu, Jie; Hua, Mingqiang; Ji, Chunyan; Ma, Daoxin
2016-11-15
Genetic factors have been shown to be associated with Myelodysplastic syndromes (MDS) susceptibility. In recent years, the role of inflammation in the promotion of tumor growth is supported by a broad range of experimental and clinical evidence. But the relationship between polymorphisms in NOD-like receptor protein 3 (NLRP3) inflammasome and MDS is rarely reported. Thus, we conducted a case-control study, and genotyped five single nucleotide polymorphisms (SNPs) (NLRP3, IL-1β, IL-18, CARD8, and NF-κB) in MDS patients and healthy controls. The association of different genotypes with patient characteristics was analyzed. Comparing MDS patients with controls, GG genotype of IL-1β (rs16944) was observed to be associated with a significantly increased risk of MDS 78/166 (48.8%) vs 26/96 (27.0%), OR=2.1, CI (1.0-4.4). No significant association was identified regarding the rest of investigated polymorphisms and MDS susceptibility. Complex karyotypes were more frequent in patients with GG genotype of IL-1β (rs16944). Patients with IL-1β polymorphisms (rs16944) GG and GA had lower hemoglobin than those without. Patients with IL-1β polymorphisms (rs16944) GG had higher IPSS scores than those without IL-1β polymorphisms. In conclusion, our present data shows that the IL-1β polymorphisms (rs16944) GG were frequently occurred in MDS. IL-1β (rs16944) GG genotype might serve as a novel biomarker and potential targets for MDS. Copyright © 2016 Elsevier Inc. All rights reserved.
A Study on Partnering Mechanism in B to B EC Server for Global Supply Chain Management
Kaihara, Toshiya
B to B Electronic Commerce (EC) technology is now in progress and regarded as an information infrastructure for global business. As the number and diversity of EC participants grows at the agile environment, the complexity of purchasing from a vast and dynamic array of goods and services needs to be hidden from the end user. Putting the complexity into the EC system instead means providing flexible auction server for enabling commerce within different business units. Market mechanism could solve the product distribution problem in the auction server by allocating the scheduled resources according to market prices. In this paper, we propose a partnering mechanism for B to B EC with market-oriented programming that mediates amongst unspecified various companies in the trade, and demonstrate the applicability of the economic analysis to this framework after constructing a primitive EC server. The proposed mechanism facilitates sophisticated B to B EC, which conducts a Pareto optimal solution for all the participating business units in the coming agile era.
Expression of Finger Millet EcDehydrin7 in Transgenic Tobacco Confers Tolerance to Drought Stress.
Singh, Rajiv Kumar; Singh, Vivek Kumar; Raghavendrarao, Sanagala; Phanindra, Mullapudi Lakshmi Venkata; Venkat Raman, K; Solanke, Amolkumar U; Kumar, Polumetla Ananda; Sharma, Tilak Raj
2015-09-01
One of the critical alarming constraints for agriculture is water scarcity. In the current scenario, global warming due to climate change and unpredictable rainfall, drought is going to be a master player and possess a big threat to stagnating gene pool of staple food crops. So it is necessary to understand the mechanisms that enable the plants to cope with drought stress. In this study, effort was made to prospect the role of EcDehydrin7 protein from normalized cDNA library of drought tolerance finger millet in transgenic tobacco. Biochemical and molecular analyses of T0 transgenic plants were done for stress tolerance. Leaf disc assay, seed germination test, dehydration assay, and chlorophyll estimation showed EcDehydrin7 protein directly link to drought tolerance. Northern and qRT PCR analyses shows relatively high expression of EcDehydrin7 protein compare to wild type. T0 transgenic lines EcDehydrin7(11) and EcDehydrin7(15) shows superior expression among all lines under study. In summary, all results suggest that EcDehydrin7 protein has a remarkable role in drought tolerance and may be used for sustainable crop breeding program in other food crops.
Determinants of fire activity during the last 3500 yr at a wildland-urban interface, Alberta, Canada
Davis, Emma L.; Courtney Mustaphi, Colin J.; Gall, Amber; Pisaric, Michael F. J.; Vermaire, Jesse C.; Moser, Katrina A.
2016-11-01
Long-term records of wildfires and their controlling factors are important sources of information for informing land management practices. Here, dendrochronology and lake sediment analyses are used to develop a 3500-yr fire and vegetation history for a montane forest in Jasper National Park, Alberta, Canada. The tree-ring record (AD 1771-2012) indicates that this region historically experienced a mixed-severity fire regime, and that effective fire suppression excluded widespread fire events from the study area during the 20th century. A sediment core collected from Little Trefoil Lake, located near the Jasper townsite, is analyzed for subfossil pollen and macroscopic charcoal (>150 μm). When comparing the tree-ring record to the 3500-yr record of sediment-derived fire events, only high-severity fires are represented in the charcoal record. Comparisons between the charcoal record and historical climate and pollen data indicate that climate and vegetation composition have been important controls on the fire regime for most of the last 3500 yr. Although fire frequency is presently within the historical range of variability, the fire return interval of the last 150 yr is longer than expected given modern climate and vegetation conditions, indicating that humans have become the main control on fire activity around Little Trefoil Lake.
Ecological audits under EC regulations: background and impact in practice
International Nuclear Information System (INIS)
Walther, T.
1995-01-01
There are publications discussing the practical aspects of the implementation of the EC Directive on ecological audits, but little has been published yet on the theoretical background of the directive. The contribution in hand is intended to elucidate the theoretical basis of this instrument in the context of the system of law, explains the term of ''sustainable development'' as a key term, and reveals problems encountered in the evaluation of environmental performance. This information will contribute to a better understanding of the meaning and purposes of the EC Directive, and will thus point out ways and means for direct implementation. (orig.) [de
Studies on absorption of EC waves in assisted startup experiment on FTU
Granucci, G.; Ricci, D.; Farina, D.; Figini, L.; Iraji, D.; Tudisco, O.; Ramponi, G.; Bin, W.
2012-09-01
Assistance of EC wave for plasma breakdown and current ramp up is the proposed scenario for the ITER case, characterized by low toroidal electric field. The experimental results on many tokamaks clearly indicate the capabilities of the proposed scheme to have a robust breakdown in ITER. The key aspect of this technique is the EC power required, strongly related to the absorption of the wave in the initial stage of plasma formation. This aspect is generally neglected due to the diagnostics difficulties in the plasma formation phase. As a consequence a multi-pass absorption scheme is usually considered reasonable, leading to a strong absorption after many reflections on the walls. The present study exploits the high temporal and spatial resolution of the fast scanning interferometer of FTU together with the measure of residual power obtained by a sniffer probe. The absorbed EC power is calculated considering also the polarization rotation and the subsequent mode conversion after incidence on the internal wall and compared with that derived from experimental data. The resulting EC power distribution can explain differences observed between perpendicular and oblique injection results, indicating future investigations to define ITER power requirements.
Studies on absorption of EC waves in assisted startup experiment on FTU
Directory of Open Access Journals (Sweden)
Ramponi G.
2012-09-01
Full Text Available Assistance of EC wave for plasma breakdown and current ramp up is the proposed scenario for the ITER case, characterized by low toroidal electric field. The experimental results on many tokamaks clearly indicate the capabilities of the proposed scheme to have a robust breakdown in ITER. The key aspect of this technique is the EC power required, strongly related to the absorption of the wave in the initial stage of plasma formation. This aspect is generally neglected due to the diagnostics difficulties in the plasma formation phase. As a consequence a multi-pass absorption scheme is usually considered reasonable, leading to a strong absorption after many reflections on the walls. The present study exploits the high temporal and spatial resolution of the fast scanning interferometer of FTU together with the measure of residual power obtained by a sniffer probe. The absorbed EC power is calculated considering also the polarization rotation and the subsequent mode conversion after incidence on the internal wall and compared with that derived from experimental data. The resulting EC power distribution can explain differences observed between perpendicular and oblique injection results, indicating future investigations to define ITER power requirements.
Upgrading from the Dicon Wiring Management system to IntEC at the Gentilly 2 station
International Nuclear Information System (INIS)
Theoret, P.A.
1995-01-01
The General Electric DICON Wiring Management system supplied to HQ during the construction of G2 is currently being replaced by the stand-alone version of the IntEC software developed by AECL. The reasons for replacing DICON and choosing lntEC are discussed. The different aspects of the two year DICON data conversion project are presented with the problems encountered and the means that were taken to resolve the problems. lntEC has shown our DICON data to be considerably more deficient than we had thought. This has increased the cost and the duration of the conversion process. However, correcting the errors during the conversion process provides us with much more accurate data. This should be viewed as an investment in configuration management. Many potential causes of future errors and potentially critical path delays have been removed. We have chosen to document the detailed procedures for the use of lntEC in our plant using a Windows Help File compiler. This also has been found to be extremely useful as a training tool as well as providing on-line help. The DICON data conversion into lntEC will not be completed until 1996. lntEC is not perfect. However, from what we have up to now, we are satisfied with the conviviality and efficiency of lntEC and with AECL's diligence in constantly aspiring in making it a better product. (author)
Directory of Open Access Journals (Sweden)
Ingemar von Ossowski
Full Text Available Primarily arising from their well understood beneficial health effects, many lactobacilli strains are considered good candidates for use as probiotics in humans and animals. Lactobacillar probiosis can itself be best typified by the Lactobacillus rhamnosus GG strain, which, with its well-documented clinical benefits, has emerged as one of the most widely used probiotics in the food and health-supplement industries. Even so, many facets of its molecular mechanisms and limitations as a beneficial commensal bacterium still remain to be thoroughly explored and dissected. Because L. rhamnosus GG is one of only a few such strains exhibiting surface piliation (called SpaCBA, we sought to examine whether this particular type of cell-surface appendage has a discernible immunomodulating capacity and is able to trigger targeted responses in human immune-related cells. Thus, presented herein for this study, we recombinantly engineered Lactococcus lactis to produce native (and pilin-deleted SpaCBA pili that were assembled in a structurally authentic form and anchored to the cell surface, and which had retained mucus-binding functionality. By using these recombinant lactococcal constructs, we were able to demonstrate that the SpaCBA pilus can be a contributory factor in the activation of Toll-like receptor 2-dependent signaling in HEK cells as well as in the modulation of pro- and anti-inflammatory cytokine (TNF-α, IL-6, IL-10, and IL-12 production in human monocyte-derived dendritic cells. From these data, we suggest that the recombinant-expressed and surface-anchored SpaCBA pilus, given its projected functioning in the gut environment, might be viewed as a new microbe-associated molecular pattern (MAMP-like modulator of innate immunity. Accordingly, our study has brought some new insight to the molecular immunogenicity of the SpaCBA pilus, thus opening the way to a better understanding of its possible role in the multifaceted nature of L. rhamnosus GG
Bruzzese, Eugenia; Raia, Valeria; Ruberto, Eliana; Scotto, Riccardo; Giannattasio, Antonietta; Bruzzese, Dario; Cavicchi, Maria Cristina; Francalanci, Michela; Colombo, Carla; Faelli, Nadia; Daccò, Valeria; Magazzù, Giuseppe; Costa, Stefano; Lucidi, Vincenzina; Majo, Fabio; Guarino, Alfredo
2017-11-08
Intestinal dysbiosis has been described in Cystic Fibrosis (CF) and probiotics have been proposed to restore microbial composition. Aim of the study was to investigate the effects of Lactobacillus rhamnosus GG (LGG) on clinical outcomes in children with cystic fibrosis (CF). A multicentre, randomised double-blind, clinical trial was conducted in children with CF. After 6months of baseline assessment, enrolled children (2 to 16years of age) received Lactobacillus GG (6×10 9 CFU/day) or placebo for 12months. Primary outcomes were proportion of subjects with at least one pulmonary exacerbation and hospitalisation over 12months. Secondary endpoints were total number of exacerbations and hospitalisations, pulmonary function, and nutritional status. Ninety-five patients were enrolled (51/95 female; median age of 103±50months). In a multivariate GEE logistic analysis, the odds of experiencing at least one exacerbation was not significantly different between the two groups, also after adjusting for the presence of different microbial organisms and for the number of pulmonary exacerbations within 6months before randomisation (OR 0.83; 95% CI 0.38 to 1.82, p=0.643). Similarly, LGG supplementation did not significantly affect the odds of hospitalisations (OR 1.67; 95% CI 0.75 to 3.72, p=0.211). No significant difference was found for body mass index and FEV1. LGG supplementation had no effect on respiratory and nutritional outcomes in this large study population of children with CF under stringent randomised clinical trial conditions. Whether earlier interventions, larger doses, or different strains of probiotics may be effective is unknown. Copyright © 2017 European Cystic Fibrosis Society. Published by Elsevier B.V. All rights reserved.
Sturges, Diana; Maurer, Trent W.; Allen, Deborah; Gatch, Delena Bell; Shankar, Padmini
2016-01-01
This project used a nonexperimental design with a convenience sample and studied the relationship between academic motivation, grade expectation, and academic performance in 1,210 students enrolled in undergraduate human anatomy and physiology (HAP) classes over a 2-yr period. A 42-item survey that included 28 items of the adapted academic…
Towards a better understanding of Lactobacillus rhamnosus GG - host interactions
2014-01-01
Lactobacillus rhamnosus GG (LGG) is one of the most widely used probiotic strains. Various health effects are well documented including the prevention and treatment of gastro-intestinal infections and diarrhea, and stimulation of immune responses that promote vaccination or even prevent certain allergic symptoms. However, not all intervention studies could show a clinical benefit and even for the same conditions, the results are not univocal. Clearly, the host phenotype governed by age, genetics and environmental factors such as the endogenous microbiota, plays a role in whether individuals are responders or non-responders. However, we believe that a detailed knowledge of the bacterial physiology and the LGG molecules that play a key role in its host-interaction capacity is crucial for a better understanding of its potential health benefits. Molecules that were yet identified as important factors governing host interactions include its adhesive pili or fimbriae, its lipoteichoic acid molecules, its major secreted proteins and its galactose-rich exopolysaccharides, as well as specific DNA motifs. Nevertheless, future studies are needed to correlate specific health effects to these molecular effectors in LGG, and also in other probiotic strains. PMID:25186587
Vegetation relevés and soil measurements in the Netherlands: the Ecological Conditions Database (EC)
Wamelink, G.W.W.; Adrichem, van M.H.C.; Dobben, van H.F.; Frissel, J.Y.; Held, den M.E.; Joosten, V.; Malinowska, A.H.; Slim, P.A.; Wegman, R.M.A.
2012-01-01
Since its establishment around 1990, the Ecological Conditions Database (EC; GIVD ID EU-00-006) has been accumulating vegetation relevés from the Netherlands, each accompanied by at least one abiotic soil measurement (e.g. pH or nutrient availability). On 1-1-2010, the database contained 8,229
Erber, Ramona; Gluz, Oleg; Brünner, Nils; Kreipe, Hans Heinrich; Pelz, Enrico; Kates, Ronald; Bartels, Annette; Huober, Jens; Mohrmann, Svjetlana; Moustafa, Zehra; Liedtke, Cornelia; Möbus, Volker; Augustin, Doris; Thomssen, Christoph; Jänicke, Fritz; Kiechle, Marion; Kuhn, Walther; Nitz, Ulrike; Harbeck, Nadia; Hartmann, Arndt
2015-04-01
Taxane-anthracycline-based adjuvant chemotherapy is standard of care in patients with node-positive breast cancer (BC) but is also associated with severe side effects and significant costs. It is yet unclear, which biomarkers would predict benefit from taxanes and/or general chemoresistance. In this study, we investigate a large cohort of patients with intermediate-risk BC treated within the WSG EC-DOC Trial for the predictive impact of topoisomerase-II-alpha, HER2/neu, and TIMP-1. Tumor tissue was available in a representative cohort of 772 cases of the WSG EC-DOC Trial collective which compared 4xEC-4xDoc versus 6xCEF/CMF. In addition to hormone receptor status and Ki-67, HER2/neu+ and topoisomerase-II-alpha status using fluorescence in situ hybridisation (FISH) and immunohistochemistry, TIMP-1 using immunohistochemistry, and aneuploidy of chromosome 17 using FISH were evaluated and correlated with outcome and taxane benefit. There was significant superiority of EC-Doc over CEF regarding 5-year DFS (90 vs. 80 %, respectively, p = 0.006) particularly in patient subgroups defined by HR+, HER2/neu+, high proliferation (i.e., Ki-67 ≥ 20 %), patient age >50 years old and normal chromosome 17 status, high TIMP-1 and low topoisomerase-II-alpha protein expression. Significant prognostic factors in multivariate analysis were EC-Doc therapy (HR = 0.61; 95 %CI 0.38-0.986), age Doc vs. CEF) and high topoisomerase-II-alpha protein expression (HR = 0.427; 95 %CI 0.203-0.900) in multivariate interaction analysis. Despite of univariate predictive effect of HER2/neu status among other factors only topoisomerase-II-alpha protein expression was associated with significant benefit from EC-Doc compared to CEF by multivariate interaction analysis.
[Raman spectra study on radiation damage in EC9706 cells by 60Cogamma-rays].
Qi, Jian; Guo, Zheng-Yuan; Zhang, Guang-Shui; Wu, Dian-Yong; Tang, Wei-Yue
2009-07-01
Raman spectrum was used to study the structure and content of protein, nucleic acid and fat, while EC9706 cells irradiated by 60Co gamma-ray were cultivated for 24 h. The results showed that for spectrum intensity and frequency deviation, there were big differences between each exposure group and control group. For the 1 244 cm(-1) peak of amide III, beta folder changed to disordered conformations in the middle dose (4, 5Gy) groups. The 1 341 cm(-1) peak of v (the indole ring of Trp) was red-shifted in every dose group. There was a 2-3 cm(-1) red shift at the 782 cm(-1) peak in the big dose groups (7, 8Gy). It was showed that the non-hydrogenation of v(s)(PO2-) was strengthened due to big dose gamma-rays radiation. There was a 4 cm(-1) blue shift at the 1 446 cm(-1) peak of delta (CH2, CH3). It maybe resulted from 60Co gamma-rays' damage to the film of EC9706 cells. The preferable dose of 60Co gamma-rays may be found by analyzing the variety of the above-mentioned peaks in some dose groups.
Directory of Open Access Journals (Sweden)
Li Yang
Full Text Available Endometrial cancer (EC is a complex disease involving multiple gene-gene and gene-environment interactions. TGF-β signaling plays pivotal roles in EC development. This study aimed to investigate whether the genetic polymorphisms of TGF-β signaling related genes TGFB1, TGFBR1, SNAI1 and TWIST1 contribute to EC susceptibility. Using the TaqMan Genotyping Assay, 19 tagging-SNPs of these four genes were genotyped in 516 EC cases and 707 controls among Chinese Han women. Logistic regression (LR showed that the genetic variants of TGFB1 rs1800469, TGFBR1 rs6478974 and rs10733710, TWIST1 rs4721745 were associated with decreased EC risk, and these four loci showed a dose-dependent effect (Ptrend < 0.0001. Classification and regression tree (CART demonstrated that women carrying both the genotypes of TGFBR1 rs6478974 TT and rs10512263 TC/CC had the highest risk of EC (aOR = 7.86, 95% CI = 3.42-18.07, P<0.0001. Multifactor dimensionality reduction (MDR revealed that TGFB1 rs1800469 plus TGFBR1 rs6478974 was the best interactional model to detect EC risk. LR, CART and MDR all revealed that TGFBR1 rs6478974 was the most important protective locus for EC. In haplotype association study, TGFBR1 haplotype CACGA carrier showed the lowest EC risk among women with longer menarche-first full term pregnancy intervals (˃11 years and BMI˂24 (aOR = 0.39, 95% CI = 0.17-0.90, P = 0.0275. These results suggest that polymorphisms in TGFB1, TGFBR1, SNAI1 and TWIST1 may modulate EC susceptibility, both separately and corporately.
Protein p40, a Lactobacillus rhamnosus GG (LGG)-derived soluble protein, ameliorates intestinal injury and colitis, reduces apoptosis and preserves barrier function by activation of EGF receptor (EGFR) in intestinal epithelial cells. The aim of this study was to determine the mechanisms by which p40...
Reliability of the Francis Scale of Attitude Toward Christianity among 8-yr-olds.
Robbins, Mandy; Francis, Leslie J; Williams, Naomi
2003-02-01
The Francis Scale of Attitude Toward Christianity was completed by 78 8-yr.-olds (40 boys and 38 girls) whose data support reliability measured as the internal consistency of the scale for this young sample.
Application of the EC eco-audit regulation in the energy industry
International Nuclear Information System (INIS)
Schulz, J.
1994-01-01
The eco-audit regulation isolates the precision of goals to improve operational environmental protection for observation, particularly with a view to the industrial energy economy. It is not wise without an investigation into the possible repercussions with other EU and national regulatory laws. Keywords here are: design of a heat application regulation according to the BImSchG, discussion over the introduction of an EC CO 2 Energy tax as well as the EC guidelines on reducing CO 2 emissions (SAVE). (orig./HP) [de
Nitz, U; Gluz, O; Huober, J; Kreipe, H H; Kates, R E; Hartmann, A; Erber, R; Moustafa, Z; Scholz, M; Lisboa, B; Mohrmann, S; Möbus, V; Augustin, D; Hoffmann, G; Weiss, E; Böhmer, S; Kreienberg, R; Du Bois, A; Sattler, D; Thomssen, C; Kiechle, M; Jänicke, F; Wallwiener, D; Harbeck, N; Kuhn, W
2014-08-01
Taxane-based adjuvant chemotherapy is standard in node-positive (N+) early breast cancer (BC). The magnitude of benefit in intermediate-risk N+ early BC is still unclear. WSG-AGO epiribicine and cyclophosphamide (EC)-Doc is a large trial evaluating modern taxane-based chemotherapy in patients with 1-3 positive lymph nodes (LNs) only. A total of 2011 BC patients (18-65 years, pN1) were entered into a randomized phase III trial comparing 4 × E90C600 q3w followed by 4 × docetaxel 100 q3w (n = 1008) with the current standard: 6 × F500E100C500 q3w (n = 828) or C600M40F600 d1, 8× q4w (n = 175). Primary end point was event-free survival (EFS); secondary end points were overall survival (OS), toxicity, translational research, and quality of life. Central tumor bank samples were evaluable in a representative collective (n = 772; 40%). Ki-67 was assessed centrally in hormone receptor-positive disease as a surrogate marker for the distinction of luminal A/B-like tumors. Baseline characteristics were well balanced between study arms in both main study and central tumor bank subset. At 59-month median follow-up, superior efficacy of EC-Doc [versus FEC (a combination of 5-fluorouracil, epirubicin, and cyclophosphamide)] was seen in EFS and OS: 5-year EFS: 89.8% versus 87.3% (P = 0.038); 5-year OS: 94.5% versus 92.8% (P = 0.034); both tests one-tailed. EC-Doc caused more toxicity. In hormone receptor-positive (HR)+ disease, only high-Ki-67 tumors (≥ 20%) derived significant benefit from taxane-based therapy: hazard ratio = 0.39 (95% CI 0.18-0.82) for EC-Doc versus FEC (test for interaction; P = 0.01). EC-Doc significantly improved EFS and OS versus FEC in intermediate-risk BC (1-3 LNs) within all subgroups as defined by local pathology. In HR+ disease, patients with luminal A-like tumors may be potentially over-treated by taxane-based chemotherapy. ClinicalTrials.gov, NCT02115204. © The Author 2014. Published by Oxford University Press on behalf of the European Society for
Relativity Parameters Determined from Lunar Laser Ranging
Williams, J. G.; Newhall, X. X.; Dickey, J. O.
1996-01-01
Analysis of 24 years of lunar laser ranging data is used to test the principle of equivalence, geodetic precession, the PPN parameters beta and gamma, and G/G. Recent data can be fitted with a rms scatter of 3 cm. (a) Using the Nordtvedt effect to test the principle of equivalence, it is found that the Moon and Earth accelerate alike in the Sun's field. The relative accelerations match to within 5 x 10(exp -13) . This limit, combined with an independent determination of y from planetary time delay, gives beta. Including the uncertainty due to compositional differences, the parameter beta differs from unity by no more than 0.0014; and, if the weak equivalence principle is satisfied, the difference is no more than 0.0006. (b) Geodetic precession matches its expected 19.2 marc sec/yr rate within 0.7%. This corresponds to a 1% test of gamma. (c) Apart from the Nordtvedt effect, beta and gamma can be tested from their influence on the lunar orbit. It is argued theoretically that the linear combination 0.8(beta) + 1.4(gamma) can be tested at the 1% level of accuracy. For solutions using numerically derived partial derivatives, higher sensitivity is found. Both 6 and y match the values of general relativity to within 0.005, and the linear combination beta+ gamma matches to within 0,003, but caution is advised due to the lack of theoretical understanding of these sensitivities. (d) No evidence for a changing gravitational constant is found, with absolute value of G/G less than or equal to 8 x lO(exp -12)/yr. There is significant sensitivity to G/G through solar perturbations on the lunar orbit.
Mouteva, G.; Randerson, J. T.; Fahrni, S.; Santos, G.; Bush, S. E.; Ehleringer, J. R.; Czimczik, C. I.
2015-12-01
Anthropogenic emissions of carbonaceous aerosols are a major component of fine air particulate matter (PM2.5) in polluted metropolitan areas and in the global atmosphere. Elemental (EC) and organic carbon (OC) aerosols influence Earth's energy balance by means of direct and indirect pathways and EC has been suggested as a better indicator of public health impacts from combustion-related sources than PM mass. Quantifying the contribution of fossil fuel and biomass combustion to the EC and OC emissions and their temporal and spatial variations is critical for developing efficient legislative air pollution control measures and successful climate mitigation strategies. In this study, we used radiocarbon (14C) to separate and quantify fossil and biomass contributions to a time series of EC and OC collected at 3 locations in Salt Lake City (SLC). Aerosol samples were collected on quartz fiber filters and a modified OC/EC analyzer was used with the Swiss_4S protocol to isolate and trap the EC fraction. Together with the total carbon (TC) content of the samples, the EC was analyzed for its 14C content with accelerator mass spectrometry. The 14C of OC was derived as a mass balance difference between TC and EC. EC had an annual average fraction modern of 0.13±0.06 and did not vary significantly across seasons. OC had an annual average FM of 0.49±0.13, with the winter mean (0.43±0.11) lower than the summer mean (0.64±0.13) at the 5% significance level. While the 3 stations were chosen to represent a variety of environmental conditions within SLC, no major differences in this source partitioning were observed between stations. During winter, the major sources of air pollutants in SLC are motor vehicles and wood stove combustion and determining their relative contributions has been the subject of debate. Our results indicated that fossil fuels were the dominant source of carbonaceous aerosols during winter, contributing 87% or more of the total EC mass and 40-75% of the OC
DEFF Research Database (Denmark)
Püthe, Christoph; Kuvshinov, Alexey; Khan, Amir
2015-01-01
We present a newmodel of the radial (1-D) conductivity structure of Earth's mantle. This model is derived frommore than 10 yr of magnetic measurements from the satellites ørsted, CHAMP, SAC-C and the Swarm trio as well as the global network of geomagnetic observatories. After removal of core...
Alang, G; Kaur, G; Kaur, R; Singh, A; Tiwari, R
2010-10-01
In the present study, five new derivatives (GG4 to GG8) of benzothiazoles were synthesized and evaluated against Staphylococcus aureus (MTCC 737), Pseudomonas aeruginosa (MTCC 424), Escherichia coli (MTCC 1687), and yeast-like fungi Candida tropicalis. p-Toluidine on treatment with ammonium thiocynate formed 2-benzothiazolamines (II), which on reaction with hydrazine hydrate formed a hydrazino derivative (III). Compounds GG4 to GG8 were synthesized by reacting the hydrazine derivative with different acetophenones. All the synthesized compounds were identified by IR and (1)H-NMR, and antimicrobial activity was performed on the synthesized compounds. Presence of NO(2), Br, OCH(3), and Cl groups to the substituted benzothiazole enhanced the antibacterial and antifungal activities.
2010-07-01
... Waste Incinerators for Which Construction is Commenced After June 20, 1996 Pt. 60, Subpt. Ec, Table 1B... Facilities as Defined in § 60.50c(a)(3) and (4) Pollutant Units (7 percent oxygen, dry basis) Emissions... matter Milligrams per dry standard cubic meter (grains per dry standard cubic foot) 66 (0.029) 22 (0.0095...
Effects of Sludge Compost on EC value of Saline Soil and Plant Height of Medicago
Sun, Chongyang; Zhao, Ke; Chen, Xing; Wang, Xiaohui
2017-12-01
In this study, the effects of sludge composting on the EC value of saline soil and the response to Medicago plant height were studied by planting Medicago with pots for 45 days in different proportions as sludge composting with saline soil. The results showed that the EC value of saline soil did not change obviously with the increase of fertilization ratio,which indicated that the EC value of saline soil was close to that of the original soil. The EC decreased by 31.45% at fertilization ratio of 40%. The height of Medicago reached the highest at 40% fertilization ratio, and that was close to 60% fertilization ratio, and the difference was significant with other treatments. By comprehensive analyse and compare,the optimum application rate of sludge compost was 40% under this test condition.
International Nuclear Information System (INIS)
Nezzo, M.; Di Trani, M.G.; Caporale, A.; Miano, R.; Mauriello, A.; Bove, P.; Capuani, S.; Manenti, G.
2016-01-01
Purpose: To test the potential ability of mean diffusivity (MD) and fractional anisotropy (FA) in discriminating between PCa of grade group (GG) 1&2, and GGs ≥ 3. Material and methods: Diffusion Tensor Imaging (DTI) experiments at 3T in a cohort of 38 patients with PCa (fifty lesions in total) were performed, by using different diffusion weights (b values) up to 2500 s/mm 2 . Gleason score (GS) and GG data were correlated with DTI parameters (MD and FA) estimated in PCa. The relation between DTI measures and GS was tested by the linear correlation analysis (Pearson's coefficient). One-way analysis of variance to check the statistical significance of the difference between GG 1&2 and GGs 3, 4, 5, ≥3 was used. Results were reported for each of the three b-values ranges: 0–800 s/mm 2 , 0–1500 s/mm 2 , 0–2500 s/mm 2 . Results: A negative correlation was found between MD and GS. The highest linear correlation was observed when the fit was performed with data acquired in the b-values range 0–2500 s/mm 2 . MD values were significantly different between GG 1&2 and GG = 3 and between GG 1&2 and GG ≥3. Moreover this difference is better defined when high b values (higher than b = 800 s/mm 2 ) are used. The specificity, sensitivity and accuracy in the discrimination between GG 1&2 and GG = 3 were: 90%, 66.7% and 82.4%, respectively when MD was estimated in the b-values range 0–2500 s/mm 2 while these values were 85%, 58.3% and 78.4% when MD was estimated in the b-values range 0–800 s/mm 2 . Conversely FA did not discriminate between GG 1&2 and GG ≥3, at any investigated b-values range. Conclusion: This study suggests that MD estimation in PCa, obtained from DTI acquired at high b-values, can contribute to the diagnosis and grading of prostate cancer while FA is not a useful parameter for this purpose.
Energy Technology Data Exchange (ETDEWEB)
Nezzo, M., E-mail: marco.nezzo@gmail.com [Department of Diagnostic and Interventional Radiology, Molecular Imaging and Radiotherapy, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Di Trani, M.G. [Physics Department, Sapienza University of Rome, Piazzale Aldo Moro 5, Rome (Italy); Caporale, A. [Department of Anatomical, Histological, Forensic and Locomotor System Science, Morfogenesis and Tissue Homeostasis, Sapienza University of Rome (Italy); CNR ISC, UOS Roma Sapienza, Physics Department Sapienza University of Rome (Italy); Miano, R. [Urology Unit, Department of Experimental Medicine and Surgery, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Mauriello, A. [Anatomic Pathology, Department of Biomedicine and Prevention, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Bove, P. [Urology Unit, Department of Experimental Medicine and Surgery, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy); Capuani, S. [CNR ISC, UOS Roma Sapienza, Physics Department Sapienza University of Rome (Italy); Manenti, G. [Department of Diagnostic and Interventional Radiology, Molecular Imaging and Radiotherapy, PTV Foundation, “Tor Vergata” University of Rome, Viale Oxford 81, 00133 Rome (Italy)
2016-10-15
Purpose: To test the potential ability of mean diffusivity (MD) and fractional anisotropy (FA) in discriminating between PCa of grade group (GG) 1&2, and GGs ≥ 3. Material and methods: Diffusion Tensor Imaging (DTI) experiments at 3T in a cohort of 38 patients with PCa (fifty lesions in total) were performed, by using different diffusion weights (b values) up to 2500 s/mm{sup 2}. Gleason score (GS) and GG data were correlated with DTI parameters (MD and FA) estimated in PCa. The relation between DTI measures and GS was tested by the linear correlation analysis (Pearson's coefficient). One-way analysis of variance to check the statistical significance of the difference between GG 1&2 and GGs 3, 4, 5, ≥3 was used. Results were reported for each of the three b-values ranges: 0–800 s/mm{sup 2}, 0–1500 s/mm{sup 2}, 0–2500 s/mm{sup 2}. Results: A negative correlation was found between MD and GS. The highest linear correlation was observed when the fit was performed with data acquired in the b-values range 0–2500 s/mm{sup 2}. MD values were significantly different between GG 1&2 and GG = 3 and between GG 1&2 and GG ≥3. Moreover this difference is better defined when high b values (higher than b = 800 s/mm{sup 2}) are used. The specificity, sensitivity and accuracy in the discrimination between GG 1&2 and GG = 3 were: 90%, 66.7% and 82.4%, respectively when MD was estimated in the b-values range 0–2500 s/mm{sup 2} while these values were 85%, 58.3% and 78.4% when MD was estimated in the b-values range 0–800 s/mm{sup 2}. Conversely FA did not discriminate between GG 1&2 and GG ≥3, at any investigated b-values range. Conclusion: This study suggests that MD estimation in PCa, obtained from DTI acquired at high b-values, can contribute to the diagnosis and grading of prostate cancer while FA is not a useful parameter for this purpose.
Effect of a community screening for Helicobacter pylori: a 5-Yr follow-up study
DEFF Research Database (Denmark)
Hansen, Jane M; Wildner-Christensen, Mette; Hallas, Jesper
2008-01-01
of community H. pylori screening and treatment on the prevalence of dyspepsia, and as secondary outcomes, the effect on dyspepsia-related health-care consumption and quality of life over 5 yr. METHODS: In 1998-1999, individuals aged 40-65 yr were randomized to H. pylori screening and treatment...... ulcers vs 148 ulcers) was seen in the screened group compared to the unscreened group. CONCLUSION: A population H. pylori screening and treatment program in an H. pylori low-prevalence area had only a modest, but insignificant, effect on the rate of dyspepsia, and a modest, significant effect...... on the consultation rate and sick leave days for dyspepsia, but resulted in a decreased ulcer incidence. The intervention resulted in an increased cost due to H. pylori screening and treatment....
Campbell, John; Carena, Marcela; Harnik, Roni; Liu, Zhen
2017-01-01
We consider interference between the Higgs signal and QCD background in $gg\\rightarrow h \\rightarrow \\gamma\\gamma$ and its effect on the on-shell Higgs rate. The existence of sizable strong phases leads to destructive interference of about 2% of the on-shell cross section in the Standard Model. This effect can be enhanced by beyond the standard model physics. In particular, since it scales differently from the usual rates, the presence of interference allows indirect limits to be placed on th...
3-Loop massive O(T{sub 2}{sup F}) contributions to the DIS operator matrix element A{sub gg}
Energy Technology Data Exchange (ETDEWEB)
Ablinger, J.; Schneider, C. [Johannes Kepler Univ., Linz (Austria). Inst. for Symbolic Computation (RISC); Bluemlein, J.; Freitas, A. de [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Hasselhuhn, A.; Round, M. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany); Johannes Kepler Univ., Linz (Austria). Inst. for Symbolic Computation (RISC); Manteuffel, A. von [Mainz Univ. (Germany). PRISMA Cluster of Excellence
2014-09-15
Contributions to heavy flavour transition matrix elements in the variable flavour number scheme are considered at 3-loop order. In particular a calculation of the diagrams with two equal masses that contribute to the massive operator matrix element A{sup (3)}{sub gg,Q} is performed. In the Mellin space result one finds finite nested binomial sums. In x-space these sums correspond to iterated integrals over an alphabet containing also square-root valued letters.
Alang, G; Kaur, G; Kaur, R; Singh, A; Tiwari, R
2010-01-01
In the present study, five new derivatives (GG4 to GG8) of benzothiazoles were synthesized and evaluated against Staphylococcus aureus (MTCC 737), Pseudomonas aeruginosa (MTCC 424), Escherichia coli (MTCC 1687), and yeast-like fungi Candida tropicalis. p-Toluidine on treatment with ammonium thiocynate formed 2-benzothiazolamines (II), which on reaction with hydrazine hydrate formed a hydrazino derivative (III). Compounds GG4 to GG8 were synthesized by reacting the hydrazine derivative with different acetophenones. All the synthesized compounds were identified by IR and 1H-NMR, and antimicrobial activity was performed on the synthesized compounds. Presence of NO2, Br, OCH3, and Cl groups to the substituted benzothiazole enhanced the antibacterial and antifungal activities. PMID:21264101
Zeng, Qing; He, Xiao-Long; Xiao, Han-Sheng; DU, Lei; Li, Yu-Jing; Chen, Le-Cheng; Tian, Hui-Wen; Huang, Sheng-He; Cao, Hong
2017-01-20
To investigate whether Lactobacillus rhamnosus GG conditioned medium(LGG-CM)has preventive effect against E. coli K1-induced neuropathogenicity in vitro by inhibiting nuclear factor-κB (NF-κB) signaling pathway. An in vitro blood-brain barrier (BBB) model was constructed using human brain microvascular endothelial cells (HBMECs). The effect of LGG-CM on E. coli-actived NF-κB signaling pathway was assayed using Western blotting. Invasion assay and polymorphonuclear leukocyte (PMN) transmigration assay were performed to explore whether LGG-CM could inhibit E. coli invasion and PMN transmigration across the BBB in vitro. The expressions of ZO-1 and CD44 were detected using Western blotting and immunofluorescence. The changes of trans-epithelial electric resistance (TEER) and bacterial translocation were determined to evaluate the BBB permeability. Pre-treament with LGG-CM inhibited E. coli-activated NF-κB signaling pathway in HBMECs and decreased the invasion of E. coli K1 and transmigration of PMN. Western blotting showed that LGG-CM could alleviate E. coli-induced up-regulation of CD44 and down-regulation of ZO-1 expressions in HBMECs. In addition, pre-treatment with LGG-CM alleviated E. coli K1-induced reduction of TEER and suppressed bacterial translocation across the BBB in vitro. LGG-CM can block E. coli-induced activation of NF-κB signaling pathway and thereby prevents E. coli K1-induced neuropathogenicity by decreasing E. coli K1 invasion rates and PMN transmigration.
On the robustness of EC-PC spike detection method for online neural recording.
Zhou, Yin; Wu, Tong; Rastegarnia, Amir; Guan, Cuntai; Keefer, Edward; Yang, Zhi
2014-09-30
Online spike detection is an important step to compress neural data and perform real-time neural information decoding. An unsupervised, automatic, yet robust signal processing is strongly desired, thus it can support a wide range of applications. We have developed a novel spike detection algorithm called "exponential component-polynomial component" (EC-PC) spike detection. We firstly evaluate the robustness of the EC-PC spike detector under different firing rates and SNRs. Secondly, we show that the detection Precision can be quantitatively derived without requiring additional user input parameters. We have realized the algorithm (including training) into a 0.13 μm CMOS chip, where an unsupervised, nonparametric operation has been demonstrated. Both simulated data and real data are used to evaluate the method under different firing rates (FRs), SNRs. The results show that the EC-PC spike detector is the most robust in comparison with some popular detectors. Moreover, the EC-PC detector can track changes in the background noise due to the ability to re-estimate the neural data distribution. Both real and synthesized data have been used for testing the proposed algorithm in comparison with other methods, including the absolute thresholding detector (AT), median absolute deviation detector (MAD), nonlinear energy operator detector (NEO), and continuous wavelet detector (CWD). Comparative testing results reveals that the EP-PC detection algorithm performs better than the other algorithms regardless of recording conditions. The EC-PC spike detector can be considered as an unsupervised and robust online spike detection. It is also suitable for hardware implementation. Copyright © 2014 Elsevier B.V. All rights reserved.
Damage Detection Response Characteristics of Open Circuit Resonant (SansEC) Sensors
Dudley, Kenneth L.; Szatkowski, George N.; Smith, Laura J.; Koppen, Sandra V.; Ely, Jay J.; Nguyen, Truong X.; Wang, Chuantong; Ticatch, Larry A.; Mielnik, John J.
2013-01-01
The capability to assess the current or future state of the health of an aircraft to improve safety, availability, and reliability while reducing maintenance costs has been a continuous goal for decades. Many companies, commercial entities, and academic institutions have become interested in Integrated Vehicle Health Management (IVHM) and a growing effort of research into "smart" vehicle sensing systems has emerged. Methods to detect damage to aircraft materials and structures have historically relied on visual inspection during pre-flight or post-flight operations by flight and ground crews. More quantitative non-destructive investigations with various instruments and sensors have traditionally been performed when the aircraft is out of operational service during major scheduled maintenance. Through the use of reliable sensors coupled with data monitoring, data mining, and data analysis techniques, the health state of a vehicle can be detected in-situ. NASA Langley Research Center (LaRC) is developing a composite aircraft skin damage detection method and system based on open circuit SansEC (Sans Electric Connection) sensor technology. Composite materials are increasingly used in modern aircraft for reducing weight, improving fuel efficiency, and enhancing the overall design, performance, and manufacturability of airborne vehicles. Materials such as fiberglass reinforced composites (FRC) and carbon-fiber-reinforced polymers (CFRP) are being used to great advantage in airframes, wings, engine nacelles, turbine blades, fairings, fuselage structures, empennage structures, control surfaces and aircraft skins. SansEC sensor technology is a new technical framework for designing, powering, and interrogating sensors to detect various types of damage in composite materials. The source cause of the in-service damage (lightning strike, impact damage, material fatigue, etc.) to the aircraft composite is not relevant. The sensor will detect damage independent of the cause
Archive of Geosample Data and Information from the U.S. Extended Continental Shelf (ECS) Project.
National Oceanic and Atmospheric Administration, Department of Commerce — Geological samples collected as part of the U.S. Extended Continental Shelf (ECS) Project are curated by the U.S. Geological Survey, a partner in the ECS Project. To...
Energy Technology Data Exchange (ETDEWEB)
Setoguchi, T.; Manchu, Y.; Katsumata, M. [Toshiba Corp., Tokyo (Japan)
2000-04-01
Toshiba provides a range of information technology (IT) solutions called SmartEC Solution, which includes business-to-business electronic commerce systems and services based on international standards and industrial know-how, especially our electronic data interchange (EDI) know-how as a manufacturer. These IT solutions are supplied as services covering strategy planning, system integration, and application service provider based on five types of business-to-business electronic commerce. (author)
International Nuclear Information System (INIS)
Bruschini, C.; Sahli, H.; Van Kempen, L.; Schleijpen, R.; Breejen, E. den
2010-01-01
The EC DELVE Support Action (www.delve.vub.ac.be) has analyzed the bottlenecks in the transfer of Humanitarian Demining (HD) technology from technology development to the use in the field, basing itself on the assessment of the European HD Research and Technology Development (RTD) situation from early 1990 until 2006. The developments in HD during the last 10 years underline the fact that in a number of cases demining related developments have been terminated or at least put on hold. A number of lessons learned were drawn, bottlenecks identified and broadly classified as either Confidence, Cost, or Communication related. The study also showed that the funding provided by the European Commission (EC) has led directly to the creation of an extensive portfolio of HD technology development projects. However, the range of instruments available to the EC to finance the necessary R and D was limited to pre-competitive research. The EC had no tools or programs to fund actual product development. The corresponding consequences are detailed in the study. The separation of the Mine Action and RTD funding streams in the EC did also negatively affect the take-up of new technologies. As a main conclusion, creating coherence between: (1) the EC policy based on political decisions, (2) RTD, testing and industrialization of equipment, and (3) timely deployment, requires a new way of coordinated thinking: 'end-to-end planning' has to be supported by a well organized and coordinated organizational structure involving different DGs (Directorate General) and even extending beyond the EU. This was not the case for Mine Action. (author)
Directory of Open Access Journals (Sweden)
Chandran Sundaravadivelan
2017-12-01
Full Text Available Ecdysteroid signal transduction plays a major role in insect metamorphosis, 20-hydroxyecdysone (20E binds to the nuclear receptor composed of the ecdysone receptor ligand binding domine (EcR-LBD and triggers the developmental transitions. Ariadne merione ecdysone receptor (AmEcR cDNA was amplified and partially sequenced of about 553â¯bp, which encodes a polypeptide of 184 amino acids (aa. The theoretical molecular weight (MW, isoelectric point (pI and aliphatic index of the deduced AmEcR protein were predicted using BIOEDIT (v7.2.5 to be 21.192â¯kDa, 9.31 and 101.739 respectively. Identified ecdysone receptor gene of A. merione showed maximum similarity with Precis coenia gene. In this research, we have employed ligand-receptor engineering technique to screen a specific compound which plays antagonist role and assist to formulate an insect specific pesticide. The EcR protein 3D structure of AmEcR modeled using Schrödinger maestro and virtual screening was performed using 5554 molecules from Zinc database, where ZINC20031812 showed highest glide score of â6.257 and Etoxazole chosen on literature basis and showed best glide score â6.671. We have compared the antagonist with agonist (20E by molecular dynamics (MD simulation. Root Mean Square Deviation (RMSD value of agonist and antagonist indicates the binding were stable in water with a range of distance from 2.3 to 2.6â¯Ã , 1.8 to 2.3â¯Ã and 1.9 to 2.3â¯Ã with a variation over the time scale of 1â¯ps. Since Etoxazole and ZINC20031812 are antagonists, computationally they were more stable than 20E. Keywords: Ariadne merione, 20 Hydroxyecdysone (20E, Etoxazole, Schrödinger
Top-down estimates of benzene and toluene emissions in the Pearl River Delta and Hong Kong, China
Fang, Xuekun; Shao, Min; Stohl, Andreas; Zhang, Qiang; Zheng, Junyu; Guo, Hai; Wang, Chen; Wang, Ming; Ou, Jiamin; Thompson, Rona L.; Prinn, Ronald G.
2016-03-01
Benzene (C6H6) and toluene (C7H8) are toxic to humans and the environment. They are also important precursors of ground-level ozone and secondary organic aerosols and contribute substantially to severe air pollution in urban areas in China. Discrepancies exist between different bottom-up inventories for benzene and toluene emissions in the Pearl River Delta (PRD) and Hong Kong (HK), which are emission hot spots in China. This study provides top-down estimates of benzene and toluene emissions in the PRD and HK using atmospheric measurement data from a rural site in the area, Heshan, an atmospheric transport model, and an inverse modeling method. The model simulations captured the measured mixing ratios during most pollution episodes. For the PRD and HK, the benzene emissions estimated in this study for 2010 were 44 (12-75) and 5 (2-7) Gg yr-1 for the PRD and HK, respectively, and the toluene emissions were 131 (44-218) and 6 (2-9) Gg yr-1, respectively. Temporal and spatial differences between the inversion estimate and four different bottom-up emission estimates are discussed, and it is proposed that more observations at different sites are urgently needed to better constrain benzene and toluene (and other air pollutant) emissions in the PRD and HK in the future.
The environmental policy of the EC. An analysis exemplified by air pollution abatement policy
International Nuclear Information System (INIS)
Caspari, S.
1995-01-01
Since the early seventies the European Community has reacted to increasing ecological damage with complex and comprehensive common environmental policies. In this study, the author analyzes and evaluates the theoretical conception and the instrumental application of the EC Environmental Policy using four criteria: (1) Ecological effectiveness, (2) economic efficiency, (3) conformity with a market order - viewpoint of 'Ordnungspolitik', (4) 'sustainability'. The study shows that there is a large discrepancy between the demands and the reality of the EC Environmental Policy. In addition to grave ecological deficiencies it reveals an increse in rent-seeking activities and an interventionist trend which have resulted in the erosion of the competitive incentive system of the market order in the Community. In view of various deficits the author perceives a basic 'regulation paradox' and a 'policy failure'. Based on a diagnosis of the causes of these deficiencies, he outlines some proposals for a reform of the EC Environmental Policy, indicating that a central prerequisite for a more effective and efficient environmental protection is a reorientation in the system ('Ordnungspolitik') which determines the common Environmental Policy. In addition, he maintains that in view of the clear asymmetry in the representation of interests in favour of particularist interests it is necessary to strengthen public interest in order to enable a more effective protection of the options future generations will have regarding their lives and their behaviour. (orig.) [de
DEFF Research Database (Denmark)
Vendius, Trine Thygesen
2015-01-01
The European Cyber Crime Centre, EC3, established under the umbrella of Europol, started operations on January 1 2013. It is to act as the focal point in the fight against cybercrime in the European Union. Using a “shared, cross-community approach” the EC3 is concluding partnerships with member...... states, European agencies, international partners and the private sector. This article describes the coming about of EC3 and its efforts to address cybercrime. Furthermore, the article is an attempt to assess the growing role of the European law enforcement community on the European security scene...
Institute of Scientific and Technical Information of China (English)
周刚; 唐江; 谭昆华; 谭巍
2012-01-01
This paper carries out experimental study on rotational viscosity, normal performance indices and rheological properties, etc. of EC-120 organic viscosity reducing and wet-mixing modified asphalt, the experiment shows that EC-120 as an organic additive with the melting point at approximate 100 t is well compatible with asphalt and easy to prepare without problem of isolation. The experiment also shows EC-120 in wet-mixing modified asphalt can reduce high-temperature viscosity and increase medium and low-temperature viscosity of asphalt so as to decrease mixing and compacting temperature of asphalt mixtures; can reduce needle penetration and increase softening point and anti-rutting factor so as to improve high-temperature stability of asphalt remarkably; and will enable reduction of ductility, increase of fatigue factor, increase of creepage stiffness and reduction of deformation rate of wet-mixing modified asphalt, which slightly have negative influence on anti-fatigue and low-temperature cracking properties of asphalt.%对EC-120有机降粘温拌改性沥青进行旋转粘度、常规性能指标、流变特性等试验研究,试验表明,EC- 120作为一种熔点在100℃左右的有机添加剂,与沥青相容性好,制备容易,不存在离析问题.试验还表明在温拌改性沥青中,EC-120可降低沥青的高温粘度,提高中低温粘度,从而降低沥青混合料的拌和和压实温度;可降低沥青针入度,提高软化点和抗车辙因子,从而大幅改善沥青的高温稳定性;会使温拌改性沥青的延度降低,疲劳因子增大,蠕变劲度增大,变形速率减小,对沥青的抗疲劳和低温抗开裂性能略有消极影响.
Pollen-based biome reconstruction for southern Europe and Africa 18,000 yr BP
Elenga, H; Peyron, O; Bonnefille, R; Jolly, D; Cheddadi, R; Guiot, J; Andrieu, [No Value; Bottema, S; Buchet, G; de Beaulieu, JL; Hamilton, AC; Maley, J; Marchant, R; Perez-Obiol, R; Reille, M; Riollet, G; Scott, L; Straka, H; Taylor, D; Van Campo, E; Vincens, A; Laarif, F; Jonson, H
Pollen data from 18,000 C-14 yr sp were compiled in order to reconstruct biome distributions at the last glacial maximum in southern Europe and Africa. Biome reconstructions were made using the objective biomization method applied to pollen counts using a complete list of dryland taxa wherever
Bouchet, Sandrine; Tang, Ruoping; Fava, Fanny; Legrand, Ollivier; Bauvois, Brigitte
2015-01-01
The CD13 antigen's binding site for the Asn-Gly-Arg (NGR) motif enables NGR-containing chemotherapeutic drugs to be delivered to CD13-positive tumours. Human CD13-positive acute myeloid leukemia (AML) cells proliferate abnormally and escape death. Here, we show that the CNGRC-GG-D(KLAKLAK)2 peptide induces death in AML cell lines (U937, THP-1, NB4, HL-60) and primary blood cells from AML patients. Cell death was characterized as a caspase-independent mechanism, without DNA fragmentation, but ...
Effects of Lactobacillus rhamnosus GG supplementation on cow's milk allergy in a mouse model
Directory of Open Access Journals (Sweden)
Thang Cin L
2011-12-01
Full Text Available Abstract Background Cow's milk allergy (CMA is one of the most prevalent human food-borne allergies, particularly in infants and young children from developed countries. Our study aims to evaluate the effects of Lactobacillus rhamnosus GG (LGG administration on CMA development using whole cow's milk proteins (CMP sensitized Balb/C mice by two different sensitization methods. Methods LGG supplemented mice were either sensitized orally with CMP and cholera toxin B-subunit (CTB as adjuvant, or intraperitoneally (IP with CMP but without the adjuvant. Mice were then orally challenged with CMP and allergic responses were accessed by monitoring hypersensitivity scores, measuring the levels of CMP-specific immunoglobulins (IgG1, IgG2a and IgG and total IgE from sera, and cytokines (IL-4 and IFN-γ from spleen lysates. Results Sensitization to CMP was successful only in IP sensitized mice, but not in orally sensitized mice with CMP and CTB. Interestingly, LGG supplementation appeared to have reduced cow's milk allergy (CMA in the IP group of mice, as indicated by lowered allergic responses. Conclusions Adjuvant-free IP sensitization with CMP was successful in inducing CMA in the Balb/C mice model. LGG supplementation favourably modulated immune reactions by shifting Th2-dominated trends toward Th1-dominated responses in CMP sensitized mice. Our results also suggest that oral sensitization by the co-administration of CMP and CTB, as adjuvant, might not be appropriate to induce CMA in mice.
Lewandowska, A U; Bełdowska, M; Witkowska, A; Falkowska, L; Wiśniewska, K
2018-08-15
PM1 aerosols were collected at the coastal station in Gdynia between 1st January and 31st December 2012. The main purpose of the study was to determine the variability in concentrations of mercury Hg(p), organic carbon (OC) and elemental carbon (EC) in PM1 aerosols under varying synoptic conditions in heating and non-heating periods. Additionally, sources of origin and bonds of mercury with carbon species were identified. The highest concentrations of Hg(p), OC and EC were found during the heating period. Then all analyzed PM1 components had a common, local origin related to the consumption of fossil fuels for heating purposes under conditions of lower air temperatures and poor dispersion of pollutants. Long periods without precipitation also led to the increase in concentration of all measured PM1 compounds. In heating period mercury correlated well with elemental carbon and primary and secondary organic carbon when air masses were transported from over the land. At that time, the role of transportation was of minor importance. In the non-heating period, the concentration of all analyzed compounds were lower than in the heating period, which could be associated with the reduced influence of combustion processes, higher precipitation and, in the case of mercury, also the evaporation of aerosols at higher air temperatures. However, when air masses were transported from over the sea or from the port/shipyard areas the mercury concentration increased significantly. In the first case higher air humidity, solar radiation and ozone concentration as well as the presence of marine aerosols could further facilitate the conversion of gaseous mercury into particulate mercury and its concentration increase. In the second case Hg(p) could be adsorbed on particles rich in elemental carbon and primary organic carbon emitted from ships. Copyright © 2018 Elsevier Inc. All rights reserved.
Shen, Yuan; Wang, Xiaoyu; Xu, Jianping; Lu, Lin
2017-07-04
The SerpinE2 pathway is evolutionarily conserved and plays an important role in tumorigenesis. SerpinE2 (a small ubiquitin-related modifier), like ubiquitin, conjugates SerpinE2 proteins onto lysine residues of target proteins. SerpinE2 over-expression has been found in several tumors. Here, we detected the level of SerpinE2 in 72 samples of EC tissue using immunohistochemistry to assess the role of SerpinE2 in EC prognosis. Meanwhile, we knocked down SerpinE2 by siRNA in the HTB-111 and Ishikawa EC cell lines and analyzed the viability and mobility change using an MTT assay, an annexin V/PI apoptosis assay, a wound scratch test and a transwell assay. A Kaplan-Meier analysis indicated a negative correlation between the level of SerpinE2 and the EC prognosis. Silencing SerpinE2 induced cell apoptosis and reduced the migration ability. Our data suggest SerpinE2 works as an oncogene in EC.
Meini, Simone; Laureano, Raffaele; Fani, Lucia; Tascini, Carlo; Galano, Angelo; Antonelli, Alberto; Rossolini, Gian Maria
2015-12-01
Probiotics are widely investigated in the treatment of various bowel diseases. However, they may also have a pathogenic potential, and the role of Lactobacillus spp. as opportunistic pathogens, mostly following disruption of the intestinal mucosa, is emerging. We report on a case of bacteremia caused by L. rhamnosus GG in an adult patient affected by severe active ulcerative colitis under treatment with corticosteroids and mesalazine. Lactobacillus bacteremia was associated with candidemia and occurred while the patient was receiving a probiotic formulation containing the same strain (as determined by PFGE typing), and was being concomitantly treated with i.v. vancomycin, to which the Lactobacillus strain was resistant. L. rhamnosus GG bacteremia, therefore, was apparently related with translocation of bacteria from the intestinal lumen to the blood. Pending conclusive evidence, use of probiotics should be considered with caution in case of active severe inflammatory bowel diseases with mucosal disruption.
Directory of Open Access Journals (Sweden)
Yuri de Jesus Lopes de Abreu
2013-08-01
Full Text Available Bacterial interference can occur through various mechanisms, including the production of peroxides, acids, ammonia, bacteriolytic enzymes or bacteriocins. The strain Escherichia coli EC2 produces the antimicrobial substance (AMS EC2, able to inhibit different strains of Gram-negative bacteria isolated from food, as E. coli and Salmonella sp. The activity of AMS EC2 was lost after treatment with proteolytic enzymes, indicating the presence of an active proteinaceous compound, suggesting that it is a bacteriocin. The substance, renamed bacteriocin EC2, has its better production when the producer strain is grown on Casoy medium, at 37ºC and pH 6.0, without NaCl addition, but it is also able to be produced in milk. When co-cultivated in UHT milk with the producer strain E. coli EC2, the growth of the indicator strain Salmonella Typhi is totally inhibited within the first 4 hours of incubation, suggesting a potential application of bacteriocin EC2 in the control of Salmonella sp. e.g. in foods.
Directory of Open Access Journals (Sweden)
Lehmann Birka
2008-12-01
Full Text Available Abstract Before any medicinal product is authorised for use in adults, it must undergo extensive pharmaceutical consistency and stability tests, toxicological tests and clinical trials to ensure that it is of high quality, safe and effective. The same approach may not always be applied to medicinal products used to treat children. Studies showed that over 50% of the medicinal products used in children may not have been tested for use in this age group. The absence of suitable authorised medicinal products to treat conditions in children results from the fact that pharmaceutical companies do not adapt medicinal products to the needs of the paediatric population. This leaves health care professionals with no alternative other than to use medicinal products "off-label" and to use unauthorised products with the associated risks of inefficacy and/or adverse reactions. The Regulation (EC No 1901/2006 sets up a system of requirements, rewards and incentives, together with horizontal measures, to ensure that medicinal products are researched, developed and authorised to meet the therapeutic needs of children. The Regulation is addressed to: 1. The pharmaceutical industry by setting out the legal framework for receiving rewards and incentives by conducting clinical trials in the paediatric population. 2. The Member States to set out to support research into, and the development and availability of, medicinal products for paediatric use. 3. The Community as funds for research into medicinal products for the paediatric population shall be provided for in the Community budget in order to support studies relating to medicinal products or active substances not covered by a patent or a supplementary protection certificate. The legal framework for conducting clinical trials, including children/minors, is set up in Directive 2001/20/EC, the Clinical Trials Directive (CTD, for the European Union (EU. The CTD establishes specific provisions regarding conduct of
ggCyto: Next Generation Open-Source Visualization Software for Cytometry.
Van, Phu; Jiang, Wenxin; Gottardo, Raphael; Finak, Greg
2018-06-01
Open source software for computational cytometry has gained in popularity over the past few years. Efforts such as FlowCAP, the Lyoplate and Euroflow projects have highlighted the importance of efforts to standardize both experimental and computational aspects of cytometry data analysis. The R/BioConductor platform hosts the largest collection of open source cytometry software covering all aspects of data analysis and providing infrastructure to represent and analyze cytometry data with all relevant experimental, gating, and cell population annotations enabling fully reproducible data analysis. Data visualization frameworks to support this infrastructure have lagged behind. ggCyto is a new open-source BioConductor software package for cytometry data visualization built on ggplot2 that enables ggplot-like functionality with the core BioConductor flow cytometry data structures. Amongst its features are the ability to transform data and axes on-the-fly using cytometry-specific transformations, plot faceting by experimental meta-data variables, and partial matching of channel, marker and cell populations names to the contents of the BioConductor cytometry data structures. We demonstrate the salient features of the package using publicly available cytometry data with complete reproducible examples in a supplementary material vignette. https://bioconductor.org/packages/devel/bioc/html/ggcyto.html. gfinak@fredhutch.org. Supplementary data are available at Bioinformatics online and at http://rglab.org/ggcyto/.
Energy Technology Data Exchange (ETDEWEB)
1992-06-23
The European Commission has told the German federal government to open the door for coal imports from other EC member countries. As an initial step, the Commission is suggesting that some of the power station coal which was to be sourced from German stockpiles under the November 1991 agreement between Rurhkohle AG, the state mining company and the generators, be supplied by other member states such as the UK. The implications of this move for the German coal industry are discussed. 2 tabs.
Sabordo, L; Sallustio, B C; Evans, A M; Nation, R L
2000-10-01
Glucuronidation of carboxylic acid compounds results in the formation of electrophilic acyl glucuronides. Because of their polarity, carrier-mediated hepatic transport systems play an important role in determining both intra- and extrahepatic exposure to these reactive conjugates. We have previously shown that the hepatic membrane transport of 1-O-gemfibrozil-beta-D-glucuronide (GG) is carrier-mediated and inhibited by the organic anion dibromosulfophthalein. In this study, we examined the influence of 200 microM acetaminophen, acetaminophen glucuronide, and clofibric acid on the disposition of GG (3 microM) in the recirculating isolated perfused rat liver preparation. GG was taken up by the liver, excreted into bile, and hydrolyzed within the liver to gemfibrozil, which appeared in perfusate but not in bile. Mean +/- S. D. hepatic clearance, apparent intrinsic clearance, hepatic extraction ratio, and biliary excretion half-life of GG were 10.4 +/- 1.4 ml/min, 94.1 +/- 17.9 ml/min, 0.346 +/- 0.046, and 30.9 +/- 4.9 min, respectively, and approximately 73% of GG was excreted into bile. At the termination of the experiment (t = 90 min), the ratio of GG concentrations in perfusate, liver, and bile was 1:35:3136. Acetaminophen and acetaminophen glucuronide had no effect on the hepatic disposition of GG, suggesting relatively low affinities of acetaminophen conjugates for hepatic transport systems or the involvement of multiple transport systems for glucuronide conjugates. In contrast, clofibric acid increased the hepatic clearance, extraction ratio, and apparent intrinsic clearance of GG (P clofibric acid glucuronide at the level of hepatic transport. However, the transporter protein(s) involved remains to be identified.
Camacho-Morales, Reyna Lucero; Zazueta-Novoa, Vanesa; Casillas, Juana Lizbeth González; Ballesteros, Elizabeth Aranda; Bote, Juan Antonio Ocampo; Zazueta-Sandoval, Roberto
2014-05-01
We detected NADP(+)-dependent dihydrodiol dehydrogenase (DD) activity in a cell-free extract from Mucor circinelloides YR-1, after high-speed centrifugation. We analyzed the enzymatic activity in the cytosolic fraction by zymograms, as described previously, and eight different DD activity bands were revealed. Five constitutive DD activities (DD1-5) were present when glucose was used as carbon source and three inducible activities (NDD, PDD1 and PDD2) when aromatic hydrocarbon compounds were used. NDD activity was induced all of the aromatic hydrocarbon compounds. The highest DD activity inducer was naphthalene and the lowest was pyrene. One of the enzymes showed higher activity with cis-naphthalene-diol rather than with trans-nahthalenediol as a substrate. We purified this particular enzyme to homogeneity and found that it had an isoelectric point of 4.6. The molecular weight for the native protein was 197.4kDa and 49.03±0.5kDa for the monomer that conforms it, suggesting a homotetrameric structure for the complete enzyme. Polyclonal antibodies were raised against it and obtained. NDD activity was almost totally inhibited when antibodies were used at low concentrations, and in native immunoblots only one band, which corresponds to the activity band detected in the zymograms, could be detected. In denaturing PAGE immunoblots only one band was detected. This band corresponds to the purified protein band of 49kDa detected in SDS-PAGE gels. The other two inducible enzymes PDD1 and PDD2 were present only when phenanthrene was used as sole carbon source in the culture media. Copyright © 2014 Elsevier Inc. All rights reserved.
Dold, C.; Hatfield, J.; Prueger, J. H.; Wacha, K.
2017-12-01
Midwestern US agriculture is dominated by corn and soybean production. Corn has typically higher Net Ecosystem Exchange (NEE) than soybean due to increased carboxylation efficiency and different crop management. The conjoined NEE may be measured with eddy covariance (EC) stations covering both crops, however, it is often unclear what the contribution of each crop is, as the CO2 source area remains unknown. The aim of this study was to quantify the contribution of CO2 fluxes from each crop for a conventional corn-soybean rotation system from 2007 - 2015. Therefore, the combined CO2 flux of three adjacent fields with annual corn-soybean rotation was measured with a 9.1 m EC tower (Flux 30). In the center of two of these fields, additional EC towers (Flux 10 and Flux 11) were positioned above the corn and soybean canopy to validate Flux 30 NEE. For each EC system the annual 90% NEE footprint area was calculated, footprints were partitioned among fields, and NEE separated accordingly. The average annual 90% footprint area of Flux 30, and Flux 10/11 corn and soybean was estimated to 206, 11 and 7 ha, respectively. The annual average (±SE) NEE of Flux 30 was -693 ± 47 g CO2 m-2 yr-1, of which 83% out of 90% originated from the three adjacent fields. Corn and soybean NEE measured at Flux 10 and 11 was -1124 ± 95 and 173 ± 73 g CO2 m-2 yr-1, respectively, and 89% and 90% originated from these fields. That demonstrates, that Flux 30 represents the combined NEE of a corn-soybean rotation, and Flux 10 and 11 measured NEE from a single crop. However, the share of Flux 30 NEE originating from corn and soybean grown on the Flux 10/11 fields was -192 ± 16 and -205 ± 18 g CO2 m-2 yr-1, indicating a substantial difference to single crop NEE. While it was possible to measure the NEE of a corn-soybean rotation with a tall EC tower, footprint partitioning could not retrieve NEE for each crop, probably due to differences in measurement height and footprint source area.
Effects of fire on regional evapotranspiration in the central Canadian boreal forest
Energy Technology Data Exchange (ETDEWEB)
Bond-Lamberty, Benjamin; Peckham, Scott D.; Gower, Stith T.; Ewers, Brent
2009-04-08
Changes in fire regimes are driving the carbon balance of much of the North American boreal forest, but few studies have examined fire-driven changes in evapotranspiration (ET) at a regional scale. This study used a version of the Biome-BGC process model with dynamic and competing vegetation types, and explicit spatial representation of a large (106 km2) region, to simulate the effects of wildfire on ET and its components from 1948 to 2005 by comparing the fire dynamics of the 1948-1967 period with those of 1968-2005. Simulated ET averaged, over the entire temporal and spatial modeling domain, 323 mm yr-1; simulation results indicated that changes in fire in recent decades decreased regional ET by 1.4% over the entire simulation, and by 3.9% in the last ten years (1996-2005). Conifers dominated the transpiration (EC) flux (120 mm yr-1) but decreased by 18% relative to deciduous broadleaf trees in the last part of the 20th century, when increased fire resulted in increased soil evaporation, lower canopy evaporation, lower EC and a younger and more deciduous forest. Well- and poorly-drained areas had similar rates of evaporation from the canopy and soil, but EC was twice as high in the well-drained areas. Mosses comprised a significant part of the evaporative flux to the atmosphere (22 mm yr-1). Modeled annual ET was correlated with net primary production, but not with temperature or precipitation; ET and its components were consistent with previous field and modeling studies. Wildfire is thus driving significant changes in hydrological processes, changes that may control the future carbon balance of the boreal forest.
Hydroclimate variability in the low-elevation Atacama Desert over the last 2500 yr
Gayo, E. M.; Latorre, C.; Santoro, C. M.; Maldonado, A.; de Pol-Holz, R.
2012-02-01
Paleoclimate reconstructions reveal that Earth system has experienced sub-millennial scale climate changes over the past two millennia in response to internal/external forcing. Although sub-millennial hydroclimate fluctuations have been detected in the central Andes during this interval, the timing, magnitude, extent and direction of change of these events remain poorly defined. Here, we present a reconstruction of hydroclimate variations on the Pacific slope of the central Andes based on exceptionally well-preserved plant macrofossils and associated archaeological remains from a hyperarid drainage (Quebrada Maní, ∼21° S, 1000 m a.s.l.) in the Atacama Desert. During the late Holocene, riparian ecosystems and farming social groups flourished in the hyperarid Atacama core as surface water availability increased throughout this presently sterile landscape. Twenty-six radiocarbon dates indicate that these events occurred between 1050-680, 1615-1350 and 2500-2040 cal yr BP. Regional comparisons with rodent middens and other records suggest that these events were synchronous with pluvial stages detected at higher-elevations in the central Andes over the last 2500 yr. These hydroclimate changes also coincide with periods of pronounced SST gradients in the Tropical Pacific (La Niña-like mode), conditions that are conducive to significantly increased rainfall in the central Andean highlands and flood events in the low-elevation watersheds at inter-annual timescales. Our findings indicate that the positive anomalies in the hyperarid Atacama over the past 2500 yr represent a regional response of the central Andean climate system to changes in the global hydrological cycle at centennial timescales. Furthermore, our results provide support for the role of tropical Pacific sea surface temperature gradient changes as the primary mechanism responsible for climate fluctuations in the central Andes. Finally, our results constitute independent evidence for comprehending the
Certification of a plutonium dioxide reference material for elemental analyses (EC-NRM 210)
International Nuclear Information System (INIS)
Le Duigou, Y.
1990-01-01
A new EC plutonium reference material is made available in the form of 5g samples of plutonium dioxide powder. Before weighing the material must be calcined at 1 250 0 C for two hours. The plutonium content (880.26 ± 0.44) g.kg -1 has been derived from plutonium measurements performed by three different laboratories each applying a different oxydo-reductive method. The results of the plutonium measurement, the statistical evaluation of the uncertainty of the plutonium content together with information on the impurities present in the material are given in the report
The Higgs boson inclusive decay channels $H \\to b\\bar{b}$ and $H \\to gg$ up to four-loop level
Wang, Sheng-Quan; Wu, Xing-Gang; Zheng, Xu-Chang; Shen, Jian-Ming; Zhang, Qiong-Lian
2013-01-01
The principle of maximum conformality (PMC) has been suggested to eliminate the renormalization scheme and renormalization scale uncertainties, which are unavoidable for the conventional scale setting and are usually important errors for theoretical estimations. In this paper, by applying PMC scale setting, we analyze two important inclusive Standard Model Higgs decay channels, H→bb¯ and H→gg , up to four-loop and three-loop levels, respectively. After PMC scale setting, it is found that the ...
Current status of ITER EC design
International Nuclear Information System (INIS)
Bosia, G.
2003-01-01
The ITER-FEAT Electron Cyclotron System employs one equatorial launcher and three upper port launchers to inject 20 + 20 MW of mm-wave power at 170 GHz through slots in the plasma-facing neutron and radiation shield. The equatorial launcher includes 3 sets of toroidally steer-able mirrors, each collecting 8 RF beams from 24 circular cross-section corrugated wave-guides. In the upper-port launcher, eight beams, reflected in pairs by four toroidally angled (∼30 angle) and poloidally steer-able (∼ 10 angle) mirrors focus of the RF power on the plasma m = 2 and m = 3/2 plasma flux rational surfaces, for neo-classical tearing mode(s) (NTM) control. Conceptual studies of remote steering that would possibly allow removing the beam- steering equipment from the vacuum vessel and locating them in more protected positions have been carried out. All EC wave transmission is based on low losses circular cross section corrugated and evacuated wave guides each connected to a 170 GHz, 1 MW CW Gyrotron tube oscillator featuring an overall efficiency of ∼ 50%, obtained by depressed-collector energy recovery. In the paper, requirements, issues and the current status of the design is reviewed. (authors)
Northward advection of Atlantic water in the eastern Nordic Seas over the last 3000 yr
Directory of Open Access Journals (Sweden)
C. V. Dylmer
2013-07-01
Full Text Available Three marine sediment cores distributed along the Norwegian (MD95-2011, Barents Sea (JM09-KA11-GC, and Svalbard (HH11-134-BC continental margins have been investigated in order to reconstruct changes in the poleward flow of Atlantic waters (AW and in the nature of upper surface water masses within the eastern Nordic Seas over the last 3000 yr. These reconstructions are based on a limited set of coccolith proxies: the abundance ratio between Emiliania huxleyi and Coccolithus pelagicus, an index of Atlantic vs. Polar/Arctic surface water masses; and Gephyrocapsa muellerae, a drifted coccolith species from the temperate North Atlantic, whose abundance changes are related to variations in the strength of the North Atlantic Current. The entire investigated area, from 66 to 77° N, was affected by an overall increase in AW flow from 3000 cal yr BP (before present to the present. The long-term modulation of westerlies' strength and location, which are essentially driven by the dominant mode of the North Atlantic Oscillation (NAO, is thought to explain the observed dynamics of poleward AW flow. The same mechanism also reconciles the recorded opposite zonal shifts in the location of the Arctic front between the area off western Norway and the western Barents Sea–eastern Fram Strait region. The Little Ice Age (LIA was governed by deteriorating conditions, with Arctic/Polar waters dominating in the surface off western Svalbard and western Barents Sea, possibly associated with both severe sea ice conditions and a strongly reduced AW strength. A sudden short pulse of resumed high WSC (West Spitsbergen Current flow interrupted this cold spell in eastern Fram Strait from 330 to 410 cal yr BP. Our dataset not only confirms the high amplitude warming of surface waters at the turn of the 19th century off western Svalbard, it also shows that such a warming was primarily induced by an excess flow of AW which stands as unprecedented over the last 3000 yr.
Zhong, Binlong; Huang, Donghua; Ma, Kaige; Deng, Xiangyu; Shi, Deyao; Wu, Fashuai; Shao, Zengwu
2017-09-26
It has been reported that the single nucleotide polymorphism (SNP) rs1800012 in COL1A1 gene might be linked to the susceptibility of musculoskeletal degenerative diseases, such as osteoarthritis (OA) and intervertebral disc degeneration (IVDD). However, the data from different studies is contradictory. Here we aimed to comprehensively summarize and clarify the relationship between the SNP and musculoskeletal degenerative diseases. Seven eligible studies including 1339 cases and 5406 controls were screened out from PubMed, Web Of Science and Cochrane library databases. Significant association was identified in sub group analysis of IVDD in homozygote model (GG versus TT: OR = 0.33, 95% CI 0.14-0.78, P = 0.012), heterozygote model (GT versus TT: OR = 0.29, 95% CI 0.11-0.72, P = 0.008) and dominant model (GG/GT versus TT: OR = 0.31, 95% CI 0.13-0.74, P = 0.008). Additionally, significant relationship was also found in sub group analysis of severe degree of IVDD in homozygote model (GG versus TT: OR = 0.37, 95% CI 0.15-0.91, P = 0.031), heterozygote model (GT versus TT: OR = 0.33, 95% CI 0.13-0.87, P = 0.024) and dominant model (GG/GT versus TT: OR = 0.36, 95% CI 0.14-0.88, P = 0.025). Although no significance was observed, there is a trend that the more G allele at COL1A1 rs1800012 site, the less possibility of IVDD and severe IVDD would happen. Our results indicate that COL1A1 rs1800012 polymorphism associates with the susceptibility of IVDD. However, this polymorphism may not be associated with OA risk.
Arnold, Tim; Manning, Alistair; Li, Shanlan; Kim, Jooil; Park, Sunyoung; Muhle, Jens; Weiss, Ray
2017-04-01
The fluorinated species carbon tetrafluoride (CF4; PFC-14), nitrogen trifluoride (NF3) and trifluoromethane (CHF3; HFC-23) are potent greenhouse gases with 100-year global warming potentials of 6,630, 16,100 and 12,400, respectively. Unlike the majority of CFC-replacements that are emitted from fugitive and mobile emission sources, these gases are mostly emitted from large single point sources - semiconductor manufacturing facilities (all three), aluminium smelting plants (CF4) and chlorodifluoromethane (HCFC-22) factories (HFC-23). In this work we show that atmospheric measurements can serve as a basis to calculate emissions of these gases and to highlight emission 'hotspots'. We use measurements from one Advanced Global Atmospheric Gases Experiment (AGAGE) long term monitoring sites at Gosan on Jeju Island in the Republic of Korea. This site measures CF4, NF3 and HFC-23 alongside a suite of greenhouse and stratospheric ozone depleting gases every two hours using automated in situ gas-chromatography mass-spectrometry instrumentation. We couple each measurement to an analysis of air history using the regional atmospheric transport model NAME (Numerical Atmospheric dispersion Modelling Environment) driven by 3D meteorology from the Met Office's Unified Model, and use a Bayesian inverse method (InTEM - Inversion Technique for Emission Modelling) to calculate yearly emission changes over seven years between 2008 and 2015. We show that our 'top-down' emission estimates for NF3 and CF4 are significantly larger than 'bottom-up' estimates in the EDGAR emissions inventory (edgar.jrc.ec.europa.eu). For example we calculate South Korean emissions of CF4 in 2010 to be 0.29±0.04 Gg/yr, which is significantly larger than the Edgar prior emissions of 0.07 Gg/yr. Further, inversions for several separate years indicate that emission hotspots can be found without prior spatial information. At present these gases make a small contribution to global radiative forcing, however, given
75 FR 57371 - Airworthiness Directives; Turbomeca Arriel 1 Series Turboshaft Engines
2010-09-21
... have been found when performing quality inspections during production of Arriel 1 gas generator (GG... 2,500 GG cycles. We are issuing this AD to prevent failure of the gas generator second stage turbine... Building Ground Floor, Room W12-140, Washington, DC 20590-0001. Hand Delivery: Deliver to Mail address...
International Nuclear Information System (INIS)
Ingelbrecht, C.; Pauwels, J.; Lievens, F.
1993-01-01
Copper metal of ≥ 99.995% nominal purity in the form of 0.1 and 1.0 mm thick foil and 0.5 and 1.0 mm diameter wire has been certified for its cobalt and silver mass fractions. The certified values are -1 and 0.95 ± 0.04 mg.kg -1 respectively, based on 66 results for cobalt and 88 results for silver obtained by nine laboratories using three methods. This reference material, EC-NRM 522, is intended for reactor neutron dosimetry. (authors). 14 refs., 1 annexe, 10 tabs., 2 figs
International Nuclear Information System (INIS)
Kumar, N. Sanjeev; Goel, Sudha
2010-01-01
An experimental study was conducted under continuous flow conditions to evaluate some of the factors influencing contaminant removal by electrocoagulation (EC). A bench-scale simulation of drinking water treatment was done by adding a filtration column after a rectangular EC reactor. Contaminant removal efficiency was determined for voltages ranging from 10 to 25 V and a comparative study was done with distilled water and tap water for two contaminants: nitrate and arsenic(V). Maximum removal efficiency was 84% for nitrate at 25 V and 75% for arsenic(V) at 20 V. No significant difference in contaminant removal was observed in tap water versus distilled water. Increase in initial As(V) concentration from 1 ppm to 2 ppm resulted in a 10% increase in removal efficiency. Turbidity in the EC reactor effluent was 52 NTU and had to be filtered to achieve acceptable levels of final turbidity (5 NTU) at steady-state. The flow regime in the continuous flow reactor was also evaluated in a tracer study to determine whether it is a plug flow reactor (PFR) or constantly stirred tank reactor (CSTR) and the results show that this reactor was close to an ideal CSTR, i.e., it was fairly well-mixed.
Energy Technology Data Exchange (ETDEWEB)
Kumar, N. Sanjeev [Civil Engineering Department, IIT Kharagpur, Kharagpur 721302 (India); Goel, Sudha, E-mail: sudhagoel@civil.iitkgp.ernet.in [Civil Engineering Department, IIT Kharagpur, Kharagpur 721302 (India)
2010-01-15
An experimental study was conducted under continuous flow conditions to evaluate some of the factors influencing contaminant removal by electrocoagulation (EC). A bench-scale simulation of drinking water treatment was done by adding a filtration column after a rectangular EC reactor. Contaminant removal efficiency was determined for voltages ranging from 10 to 25 V and a comparative study was done with distilled water and tap water for two contaminants: nitrate and arsenic(V). Maximum removal efficiency was 84% for nitrate at 25 V and 75% for arsenic(V) at 20 V. No significant difference in contaminant removal was observed in tap water versus distilled water. Increase in initial As(V) concentration from 1 ppm to 2 ppm resulted in a 10% increase in removal efficiency. Turbidity in the EC reactor effluent was 52 NTU and had to be filtered to achieve acceptable levels of final turbidity (5 NTU) at steady-state. The flow regime in the continuous flow reactor was also evaluated in a tracer study to determine whether it is a plug flow reactor (PFR) or constantly stirred tank reactor (CSTR) and the results show that this reactor was close to an ideal CSTR, i.e., it was fairly well-mixed.
Improved design of an ITER equatorial EC launcher
International Nuclear Information System (INIS)
Takahashi, K.; Kajiwara, K.; Kobayashi, N.; Kasugai, A.; Sakamoto, K.
2008-01-01
New design improvements for an ITER equatorial EC launcher are described. A design of the front shield modules was evaluated analytically. The results indicate that these modules can withstand the electromagnetic forces induced by plasma disruption and vertical plasma motion. The steering mirror mock-up including the spiral cooling tubes was fabricated based on the present design with application of the hot isostatic pressing technique to bond the copper alloy mirror body and the embedded stainless steel cooling tubes. The test of water flow was carried out and the expected flow rate was successfully obtained. A quasi-optical (QO) transmission layout has been proposed instead of the waveguide lines. The advantage of this option is possibly to increase the reliability in terms of fabrication and refurbishment. According to the beam propagation analysis, it is verified that transmission loss at the QO region is 1.1%-2.2%, which is comparable to the reference design. The peak heat load on the steering mirror surface could be reduced by 55%, which relaxes the mirror design
socio-ec(h)o: Ambient Intelligence and Gameplay
Wakkary, Ron
2005-01-01
The socio-ec(h)o project aims to research a generalized ambient intelligent software platform and design models for responsive environments based on the concept of ambient intelligent "ecologies" and group gameplay. The benefits of the research include a software-architecture, ambient intelligence inference engine, and interaction design models for gameplay and responsive environments. The paper will discuss the results of our prototypes for games in responsive environments. These prototypes ...
Calculation of Savannah River K Reactor Mark-22 assembly LOCA/ECS power limits
International Nuclear Information System (INIS)
Fischer, S.R.; Farman, R.F.; Birdsell, S.A.
1992-01-01
This paper summarizes the results of TRAC-PF1/MOD3 calculations of Mark-22 fuel assembly of loss-of-coolant accident/emergency cooling system (LOCA/ECS) power limits for the Savannah River Site (SRS) K Reactor. This effort was part of a larger effort undertaken by the Los Alamos National Laboratory for the US Department of Energy to perform confirmatory power limits calculations for the SRS K Reactor. A method using a detailed three-dimensional (3D) TRAC model of the Mark-22 fuel assembly was developed to compute LOCA/ECS power limits. Assembly power was limited to ensure that no point on the fuel assembly walls would exceed the local saturation temperature. The detailed TRAC model for the Mark-22 assembly consisted of three concentric 3D vessel components which simulated the two targets, two fuel tubes, and three main flow channels of the fuel assembly. The model included 100% eccentricity between the assembly annuli and a 20% power tilt. Eccentricity in the radial alignment of the assembly annuli arises because axial spacer ribs that run the length of the fuel and targets are used. Wall-shear, interfacial-shear, and wall heat-transfer correlations were developed and implemented in TRAC-PF1/MOD3 specifically for modeling flow and heat transfer in the narrow ribbed annuli encountered in the Mark-22 fuel assembly design. We established the validity of these new constitutive models using separate-effects benchmarks. TRAC system calculations of K Reactor indicated that the limiting ECS-phase accident is a double-ended guillonite break in a process water line at the pump discharge (i.e., a PDLOCA). The fuel assembly with the minimum cooling potential is identified from this system calculation. Detailed assembly calculations then were performed using appropriate boundary conditions obtained from this limiting system LOCA. Coolant flow rates and pressure boundary conditions were obtained from this system calculation and applied to the detailed assembly model
Garcia-Garcia, L; Llewellyn-Jones, V; Fernandez Fernandez, I; Fuentes, J A; Manzanares, J
1998-01-05
The purpose of this study was to investigate the effects of acute and repeated electroconvulsive shock (ECS) on corticotropin releasing factor (CRF), proopiomelanocortin (POMC) and proenkephalin (PENK) gene expression in selected regions of the brain and pituitary of the rat. Acute ECS increased CRF gene expression in the paraventricular nucleus (PVN) by 20%, an effect that was further enhanced to 38% when rats received repeated ECS treatment. Acute and repeated ECS increased POMC gene expression in the arcuate nucleus (ARC) by 49-59% but failed to alter these mRNA levels in the anterior lobe (AL) of the pituitary gland. PENK gene expression was increased by 35% in the nucleus accumbens (NA) and by 180% the ventromedial nucleus (VMN) after acute or repeated ECS treatment but no significant changes were found in the PVN or striatum (ST). Taken together, these results indicate a differential CRF and opioid gene expression regulation after acute or repeated ECS treatment that may be relevant to their therapeutic or side effects in depression.
Energy Technology Data Exchange (ETDEWEB)
Provornikova, E. [Department of Physics, Catholic University of America, Washington, DC 20064 (United States); Opher, M. [Astronomy Department, Boston University, Boston, MA 02215 (United States); Izmodenov, V. V. [Space Research Institute of RAS, Moscow, 117997 (Russian Federation); Richardson, J. D. [Kavli Center for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Toth, G., E-mail: elena.a.provornikova@nasa.gov, E-mail: mopher@bu.edu, E-mail: izmod@iki.rssi.ru, E-mail: jdr@space.mit.edu, E-mail: gtoth@umich.edu [University of Michigan, Ann Arbor, MI 48109 (United States)
2014-10-10
We investigate the role of the 11 yr solar cycle variations in the solar wind (SW) parameters on the flows in the heliosheath using a new three-dimensional time-dependent model of the interaction between the SW and the interstellar medium. For boundary conditions in the model we use realistic time and the latitudinal dependence of the SW parameters obtained from SOHO/SWAN and interplanetary scintillation data for the last two solar cycles (1990-2011). This data set generally agrees with the in situ Ulysses measurements from 1991 to 2009. For the first ∼30 AU of the heliosheath the time-dependent model predicts constant radial flow speeds at Voyager 2 (V2), which is consistent with observations and different from the steady models that show a radial speed decrease of 30%. The model shows that V2 was immersed in SW with speeds of 500-550 km s{sup –1} upstream of the termination shock before 2009 and in wind with upstream speeds of 450-500 km s{sup –1} after 2009. The model also predicts that the radial velocity along the Voyager 1 (V1) trajectory is constant across the heliosheath, contrary to observations. This difference in observations implies that additional effects may be responsible for the different flows at V1 and V2. The model predicts meridional flows (VN) higher than those observed because of the strong bluntness of the heliosphere shape in the N direction in the model. The modeled tangential velocity component (VT) at V2 is smaller than observed. Both VN and VT essentially depend on the shape of the heliopause.
Directory of Open Access Journals (Sweden)
Sandra Wagener
2014-04-01
Full Text Available The elemental carbon (EC-tracer method was applied to PM10 and PM1 data of three sampling sites in the City of Berlin from February to October 2010. The sites were characterized by differing exposure to traffic and vegetation. The aim was to determine the secondary organic carbon (SOC concentration and to describe the parameters influencing the application of the EC-tracer method. The evaluation was based on comparisons with results obtained from positive matrix factorization (PMF applied to the same samples. To obtain site- and seasonal representative primary OC/EC-ratios ([OC/EC]p, the EC-tracer method was performed separately for each station, and additionally discrete for samples with high and low contribution of biomass burning. Estimated SOC-concentrations for all stations were between 11% and 33% of total OC. SOC-concentrations obtained with PMF exceeded EC-tracer results more than 100% at the park in the period with low biomass burning emissions in PM10. The deviations were besides others attributed to the high ratio of biogenic to combustion emissions and to direct exposure to vegetation. The occurrences of biomass burning emissions in contrast lead to increased SOC-concentrations compared to PMF in PM10. The obtained results distinguish that the EC-tracer-method provides well comparable results with PMF if sites are strongly influenced by one characteristic primary combustion source, but was found to be adversely influenced by direct and relatively high biogenic emissions.
Uchide, Keiji; Sakon, Masato; Ariyoshi, Hideo; Nakamori, Syouji; Tokunaga, Masaru; Monden, Morito
2007-02-01
Cancer cell mediated vascular endothelial cell (vEC) retraction plays a pivotal role in cancer metastasis. The aim of this study is to clarify the biochemical character of vEC retraction factor derived from human breast cancer cell line, MCF-7. In order to estimate vEC retracting activity, transwell chamber assay system was employed. We first tested the effects of trypsin digestion as well as lipid extraction of culture medium (CM). Trypsin digestion of CM resulted in approximately 40% loss of vEC retracting activity and lipid extraction of CM by Brigh and Dyer methods recovered approximately 60% of vEC retracting activity, suggesting that approximately 60% of vEC retracting activity in MCF-7 derived CM is due to lipid. Although Nordihydroguaiaretic acid (NDGA), the specific lipoxygenase inhibitor, suppressed vEC retracting activity in CM, Acetyl salicylic acid (ASA), a specific cyclooxygenase inhibitor, did not affect the activity, suggesting that lipid exerting vEC retracting activity in CM belongs to lipoxygenase mediated arachidonate metabolites. Thin layer chromatography clearly demonstrated that Rf value of lipid vEC retracting factor in CM is identical to 12HETE. Authentic 12(S)HETE, but not 12(R)HETE, showed vEC retracting activity. After the ultracentrifugation of CM, most lipid vEC retracting activity was recovered from the pellet fraction, and flow cytometric analysis using specific antibody against 12(S)HETE clearly showed the association of 12(S)HETE with small particle in CM. These findings suggested the principal involvement of 12(S)HETE in cancer cell derived microparticles in cancer cell mediated vEC retraction.
Habib, Gazala; Venkataraman, Chandra; Shrivastava, Manish; Banerjee, Rangan; Stehr, J. W.; Dickerson, Russell R.
2004-09-01
The dominance of biofuel combustion emissions in the Indian region, and the inherently large uncertainty in biofuel use estimates based on cooking energy surveys, prompted the current work, which develops a new methodology for estimating biofuel consumption for cooking. This is based on food consumption statistics, and the specific energy for food cooking. Estimated biofuel consumption in India was 379 (247-584) Tg yr-1. New information on the user population of different biofuels was compiled at a state level, to derive the biofuel mix, which varied regionally and was 74:16:10%, respectively, of fuelwood, dung cake and crop waste, at a national level. Importantly, the uncertainty in biofuel use from quantitative error assessment using the new methodology is around 50%, giving a narrower bound than in previous works. From this new activity data and currently used black carbon emission factors, the black carbon (BC) emissions from biofuel combustion were estimated as 220 (65-760) Gg yr-1. The largest BC emissions were from fuelwood (75%), with lower contributions from dung cake (16%) and crop waste (9%). The uncertainty of 245% in the BC emissions estimate is now governed by the large spread in BC emission factors from biofuel combustion (122%), implying the need for reducing this uncertainty through measurements. Emission factors of SO2 from combustion of biofuels widely used in India were measured, and ranged 0.03-0.08 g kg-1 from combustion of two wood species, 0.05-0.20 g kg-1 from 10 crop waste types, and 0.88 g kg-1 from dung cake, significantly lower than currently used emission factors for wood and crop waste. Estimated SO2 emissions from biofuels of 75 (36-160) Gg yr-1 were about a factor of 3 lower than that in recent studies, with a large contribution from dung cake (73%), followed by fuelwood (21%) and crop waste (6%).
Data of evolutionary structure change: 1BP2A-3DIHA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available ain> CFSKV--PYNKE >HGGG -- GG> A 3DIHA CFRENLKTYNKK re...yIDChain>3DIHA VCGSS-TPCKK ture... >EEE HHHH> ATOM 640 CA THR A 83...>HHHH GGG GG> ATOM 722 CA CYS A 95 72.245 22.685 6.343 1.00 14.
Benson, Larry V.; May, Howard M.; Antweiler, Ronald C.; Brinton, Terry I.; Kashgarian, Michaele; Smoot, Joseph P.; Lund, Steve P.
1998-09-01
The chemistry of the carbonate-free clay-size fraction of Owens Lake sediments supports the use of total organic carbon and magnetic susceptibility as indicators of stadial-interstadial oscillations. Owens Lake records of total organic carbon, magnetic susceptibility, and chemical composition of the carbonate-free, clay-size fraction indicate that Tioga glaciation began ˜24,500 and ended by ˜13,600 14C yr B.P. Many of the components of glacial rock flour (e.g., TiO 2, MnO, BaO) found in Owens Lake sediments achieved maximum values during the Tioga glaciation when valley glaciers reached their greatest extent. Total organic carbon and SiO 2(amorphous) concentrations reached minimum values during Tioga glaciation, resulting from decreases in productivity that accompanied the introduction of rock flour into the surface waters of Owens Lake. At least 20 stadial-interstadial oscillations occurred in the Sierra Nevada between 52,600 and 14,000 14C yr B.P. Total organic carbon data from a Pyramid Lake sediment core also indicate oscillations in glacier activity between >39,500 and ˜13,600 14C yr B.P. Alpine glacier oscillations occurred on a frequency of ≤1900 yr in both basins, suggesting that millennial-scale oscillations occurred in California and Nevada during most of the past 52,600 yr.
Study of Synergetic Effect of X2 and X3 EC Wave in KSTAR
Directory of Open Access Journals (Sweden)
Bae Y.S.
2015-01-01
Full Text Available An experimental study of the X-mode absorption at the second and the third harmonic frequencies has been performed in KSTAR tokamak. The X2 EC frequency is 110 GHz and the X3 EC frequency is 170 GHz at the nominal KSTAR operating toroidal magnetic field. From the 1-D model of the synergetic effect, the X3 cold resonance should lie at low field side with the X2 cold resonance at the high field side to meet the condition which both X2 and X3 EC waves interact with the same resonant electron at the same radial position. However, 170 GHz X3 cold resonance lies at the high field side with distance of 54 mm from the X2 cold resonance position in KSTAR. This paper presents the study of the synergetic effect of X3 absorption by the X2 ECCD with a scheme of two beam target positions at the same flux surface by scanning the poloidal and toroidal beam injection angles to enhance X3 absorption even in the low temperature plasma in KSTAR. For this study, the3D relativistic ray/tracing and Fokker-Planck codes C3PO/LUKE is used for the quantitative prediction of its synergetic effect. The C3PO/LUKE codes are appropriate for X2 and X3 synergy calculations as the distribution function can be calculated with either one or both waves affecting the absorption rate of each other. This paper also introduces the future ECH system upgrade plan.
Attitude toward Christianity and paranormal belief among 13- to 16-yr.-old students.
Williams, Emyr; Francis, Leslie J; Robbins, Mandy
2006-08-01
A small but statistically significant positive correlation (r = .17) was found in a sample of 279 13- to 16-yr.-old students in Wales between scores on the Francis Scale of Attitude toward Christianity and on a new Index of Paranormal Belief. These data suggest that there is little common variance between attitude toward Christianity and belief in the paranormal.
annot8r: GO, EC and KEGG annotation of EST datasets
Directory of Open Access Journals (Sweden)
Schmid Ralf
2008-04-01
Full Text Available Abstract Background The expressed sequence tag (EST methodology is an attractive option for the generation of sequence data for species for which no completely sequenced genome is available. The annotation and comparative analysis of such datasets poses a formidable challenge for research groups that do not have the bioinformatics infrastructure of major genome sequencing centres. Therefore, there is a need for user-friendly tools to facilitate the annotation of non-model species EST datasets with well-defined ontologies that enable meaningful cross-species comparisons. To address this, we have developed annot8r, a platform for the rapid annotation of EST datasets with GO-terms, EC-numbers and KEGG-pathways. Results annot8r automatically downloads all files relevant for the annotation process and generates a reference database that stores UniProt entries, their associated Gene Ontology (GO, Enzyme Commission (EC and Kyoto Encyclopaedia of Genes and Genomes (KEGG annotation and additional relevant data. For each of GO, EC and KEGG, annot8r extracts a specific sequence subset from the UniProt dataset based on the information stored in the reference database. These three subsets are then formatted for BLAST searches. The user provides the protein or nucleotide sequences to be annotated and annot8r runs BLAST searches against these three subsets. The BLAST results are parsed and the corresponding annotations retrieved from the reference database. The annotations are saved both as flat files and also in a relational postgreSQL results database to facilitate more advanced searches within the results. annot8r is integrated with the PartiGene suite of EST analysis tools. Conclusion annot8r is a tool that assigns GO, EC and KEGG annotations for data sets resulting from EST sequencing projects both rapidly and efficiently. The benefits of an underlying relational database, flexibility and the ease of use of the program make it ideally suited for non
A new verification film system for routine quality control of radiation fields: Kodak EC-L.
Hermann, A; Bratengeier, K; Priske, A; Flentje, M
2000-06-01
The use of modern irradiation techniques requires better verification films for determining set-up deviations and patient movements during the course of radiation treatment. This is an investigation of the image quality and time requirement of a new verification film system compared to a conventional portal film system. For conventional verifications we used Agfa Curix HT 1000 films which were compared to the new Kodak EC-L film system. 344 Agfa Curix HT 1000 and 381 Kodak EC-L portal films of different tumor sites (prostate, rectum, head and neck) were visually judged on a light box by 2 experienced physicians. Subjective judgement of image quality, masking of films and time requirement were checked. In this investigation 68% of 175 Kodak EC-L ap/pa-films were judged "good", only 18% were classified "moderate" or "poor" 14%, but only 22% of 173 conventional ap/pa verification films (Agfa Curix HT 1000) were judged to be "good". The image quality, detail perception and time required for film inspection of the new Kodak EC-L film system was significantly improved when compared with standard portal films. They could be read more accurately and the detection of set-up deviation was facilitated.
van Buel, Erin M; Sigrist, Hannes; Seifritz, Erich; Fikse, Lianne; Bosker, Fokko J; Schoevers, Robert A; Klein, Hans C; Pryce, Christopher R; Eisel, Ulrich Lm
2017-01-01
Electroconvulsive therapy (ECT) is an effective treatment for depression, but can have negative side effects including amnesia. The mechanisms of action underlying both the antidepressant and side effects of ECT are not well understood. An equivalent manipulation that is conducted in experimental animals is electroconvulsive seizure (ECS). Rodent studies have provided valuable insights into potential mechanisms underlying the antidepressant and side effects of ECT. However, relatively few studies have investigated the effects of ECS in animal models with a depression-relevant manipulation such as chronic stress. In the present study, mice were first exposed to chronic social stress (CSS) or a control procedure for 15 days followed by ECS or a sham procedure for 10 days. Behavioral effects were investigated using an auditory fear conditioning (learning) and expression (memory) test and a treadmill-running fatigue test. Thereafter, immunohistochemistry was conducted on brain material using the microglial marker Iba-1 and the cholinergic fibre marker ChAT. CSS did not increase fear learning and memory in the present experimental design; in both the control and CSS mice ECS reduced fear learning and fear memory expression. CSS induced the expected fatigue-like effect in the treadmill-running test; ECS induced increased fatigue in CSS and control mice. In CSS and control mice ECS induced inflammation in hippocampus in terms of increased expression of Iba-1 in radiatum of CA1 and CA3. CSS and ECS both reduced acetylcholine function in hippocampus as indicated by decreased expression of ChAT in several hippocampal sub-regions. Therefore, CSS increased fatigue and reduced hippocampal ChAT activity and, rather than reversing these effects, a repeated ECS regimen resulted in impaired fear learning-memory, increased fatigue, increased hippocampal Iba-1 expression, and decreased hippocampal ChAT expression. As such, the current model does not provide insights into the
Directory of Open Access Journals (Sweden)
Erin M van Buel
Full Text Available Electroconvulsive therapy (ECT is an effective treatment for depression, but can have negative side effects including amnesia. The mechanisms of action underlying both the antidepressant and side effects of ECT are not well understood. An equivalent manipulation that is conducted in experimental animals is electroconvulsive seizure (ECS. Rodent studies have provided valuable insights into potential mechanisms underlying the antidepressant and side effects of ECT. However, relatively few studies have investigated the effects of ECS in animal models with a depression-relevant manipulation such as chronic stress. In the present study, mice were first exposed to chronic social stress (CSS or a control procedure for 15 days followed by ECS or a sham procedure for 10 days. Behavioral effects were investigated using an auditory fear conditioning (learning and expression (memory test and a treadmill-running fatigue test. Thereafter, immunohistochemistry was conducted on brain material using the microglial marker Iba-1 and the cholinergic fibre marker ChAT. CSS did not increase fear learning and memory in the present experimental design; in both the control and CSS mice ECS reduced fear learning and fear memory expression. CSS induced the expected fatigue-like effect in the treadmill-running test; ECS induced increased fatigue in CSS and control mice. In CSS and control mice ECS induced inflammation in hippocampus in terms of increased expression of Iba-1 in radiatum of CA1 and CA3. CSS and ECS both reduced acetylcholine function in hippocampus as indicated by decreased expression of ChAT in several hippocampal sub-regions. Therefore, CSS increased fatigue and reduced hippocampal ChAT activity and, rather than reversing these effects, a repeated ECS regimen resulted in impaired fear learning-memory, increased fatigue, increased hippocampal Iba-1 expression, and decreased hippocampal ChAT expression. As such, the current model does not provide insights
B-mode contamination by synchrotron emission from 3-yr Wilkinson Microwave Anisotropy Probe data
Carretti, E.; Bernardi, G.; Cortiglioni, S.
2006-01-01
We study the contamination of the B-mode of the cosmic microwave background polarization (CMBP) by Galactic synchrotron in the lowest emission regions of the sky. The 22.8-GHz polarization map of the 3-yr Wilkinson Microwave Anisotropy Probe (WMAP) data release is used to identify and analyse such
Studies with the EC-Earth seamless Earth system prediction model
Hazeleger, W.; Bintanja, R.
2012-01-01
EC-Earth is a new Earth System Model (ESM) based on the operational seasonal forecast system of the European Centre for Medium-Range Weather Forecasts (ECMWF). Climate and weather forecasting applications share a common ancestry and are build on the same physical principles. The emerging concept of
Lorentzon, Karin; Gustafsson, Victor
2017-01-01
Denna studie handlar om hur ett sponsrat blogginlägg av en influencer inkodas och hur läsarna i kommentarerna avkodar meddelandet och reagerar på inlägget. Studiens syfte är att öka förståelsen för hur läsare avkodar sponsrade blogginlägg. Vi antog innan genomförandet att fler skulle avkoda meddelandena på ett sätt som skulle vara mer kritiskt gentemot samarbetet, därför har det gjorts en teoriprövande studie av Stuart Halls teori om inkodning och avkodning. För uppnå vårt syfte har vi använt...
Impurity analysis in EC-99mTC radiotracer using chromatographic techniques
International Nuclear Information System (INIS)
Almeida, E.V.; Fukumori, N.T.O.; Mengatti, J.; Silva, C.P.G.; Matsuda, M.M.N.
2008-01-01
The objective of this study was to develop two chromatographic methods of impurity analysis in radiotracer 99m Tc-EC: the Thin Layer Chromatography (TLC) and the High Performance Liquid Chromatography Reversed Phase (HPLC-RP)
Energy Technology Data Exchange (ETDEWEB)
Wang, Xiaojun, E-mail: xjwang@iue.ac.cn [Key Laboratory of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China); Jia, Mingsheng, E-mail: msjia@iue.ac.cn [Key Laboratory of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China); Chen, Xiaohai, E-mail: cxiaoh_xm@126.com [Xiamen City Environmental Sanitation Management Department, Xiamen 361000 (China); Xu, Ying, E-mail: yxu@iue.ac.cn [Key Laboratory of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China); Lin, Xiangyu, E-mail: xylin@iue.ac.cn [Key Laboratory of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China); Kao, Chih Ming, E-mail: jkao@mail.nsysu.edu.tw [Institute of Environmental Engineering, National Sun Yat-Sen University, Kaohsiung 80424, Taiwan (China); Chen, Shaohua, E-mail: shchen@iue.ac.cn [Key Laboratory of Urban Environment and Health, Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361021 (China)
2014-07-15
Highlights: • Young and aged leachate works accounted for 89.1% and 10.9% of 33.35 Gg CO{sub 2} yr{sup −1}. • Fresh leachate owned extremely low ORP and high organic matter content. • Strong CH{sub 4} emissions occurred in the fresh leachate ponds, but small in the aged. • N{sub 2}O emissions became dominant in the treatment units of both systems. • 8.45–11.9% of nitrogen was removed as the form of N{sub 2}O under steady-state. - Abstract: With limited assessment, leachate treatment of a specified landfill is considered to be a significant source of greenhouse gas (GHG) emissions. In our study, the cumulative GHG emitted from the storage ponds and process configurations that manage fresh or aged landfill leachate were investigated. Our results showed that strong CH{sub 4} emissions were observed from the fresh leachate storage pond, with the fluxes values (2219–26,489 mg C m{sup −2} h{sup −1}) extremely higher than those of N{sub 2}O (0.028–0.41 mg N m{sup −2} h{sup −1}). In contrast, the emission values for both CH{sub 4} and N{sub 2}O were low for the aged leachate tank. N{sub 2}O emissions became dominant once the leachate entered the treatment plants of both systems, accounting for 8–12% of the removal of N-species gases. Per capita, the N{sub 2}O emission based on both leachate treatment systems was estimated to be 7.99 g N{sub 2}O–N capita{sup −1} yr{sup −1}. An increase of 80% in N{sub 2}O emissions was observed when the bioreactor pH decreased by approximately 1 pH unit. The vast majority of carbon was removed in the form of CO{sub 2}, with a small portion as CH{sub 4} (<0.3%) during both treatment processes. The cumulative GHG emissions for fresh leachate storage ponds, fresh leachate treatment system and aged leachate treatment system were 19.10, 10.62 and 3.63 Gg CO{sub 2} eq yr{sup −1}, respectively, for a total that could be transformed to 9.09 kg CO{sub 2} eq capita{sup −1} yr{sup −1}.
Bryant, Ruth R M; McGrann, Graham R D; Mitchell, Alice R; Schoonbeek, Henk-Jan; Boyd, Lesley A; Uauy, Cristobal; Dorling, Steve; Ridout, Christopher J
2014-01-08
Rust diseases are of major importance in wheat production worldwide. With the constant evolution of new rust strains and their adaptation to higher temperatures, consistent and durable disease resistance is a key challenge. Environmental conditions affect resistance gene performance, but the basis for this is poorly understood. Here we show that a change in day temperature affects wheat resistance to Puccinia striiformis f. sp tritici (Pst), the causal agent of yellow (or stripe) rust. Using adult plants of near-isogenic lines UC1041 +/- Yr36, there was no significant difference between Pst percentage uredia coverage in plants grown at day temperatures of 18°C or 25°C in adult UC1041 + Yr36 plants. However, when plants were transferred to the lower day temperature at the time of Pst inoculation, infection increased up to two fold. Interestingly, this response was independent of Yr36, which has previously been reported as a temperature-responsive resistance gene as Pst development in adult UC1041 -Yr36 plants was similarly affected by the plants experiencing a temperature reduction. In addition, UC1041 -Yr36 plants grown at the lower temperature then transferred to the higher temperature were effectively resistant and a temperature change in either direction was shown to affect Pst development up to 8 days prior to inoculation. Results for seedlings were similar, but more variable compared to adult plants. Enhanced resistance to Pst was observed in seedlings of UC1041 and the cultivar Shamrock when transferred to the higher temperature. Resistance was not affected in seedlings of cultivar Solstice by a temperature change in either direction. Yr36 is effective at 18°C, refining the lower range of temperature at which resistance against Pst is conferred compared to previous studies. Results reveal previously uncharacterised defence temperature sensitivity in the UC1041 background which is caused by a change in temperature and independently of Yr36. This novel
Directory of Open Access Journals (Sweden)
Ingmar J J Claes
Full Text Available Lactobacillus rhamnosus GG (LGG produces two major secreted proteins, designated here Msp1 (LGG_00324 or p75 and Msp2 (LGG_00031 or p40, which have been reported to promote the survival and growth of intestinal epithelial cells. Intriguingly, although each of these proteins shares homology with cell wall hydrolases, a physiological function that correlates with such an enzymatic activity remained to be substantiated in LGG. To investigate the bacterial function, we constructed knock-out mutants in the corresponding genes aiming to establish a genotype to phenotype relation. Microscopic examination of the msp1 mutant showed the presence of rather long and overly extended cell chains, which suggests that normal daughter cell separation is hampered. Subsequent observation of the LGG wild-type cells by immunofluorescence microscopy revealed that the Msp1 protein accumulates at the septum of exponential-phase cells. The cell wall hydrolyzing activity of the Msp1 protein was confirmed by zymogram analysis. Subsequent analysis by RP-HPLC and mass spectrometry of the digestion products of LGG peptidoglycan (PG by Msp1 indicated that the Msp1 protein has D-glutamyl-L-lysyl endopeptidase activity. Immunofluorescence microscopy and the failure to construct a knock-out mutant suggest an indispensable role for Msp2 in priming septum formation in LGG.
ECONOMIC AND LEGAL ASPECTS OF THE PLANNED DAMAGES ACTIONS FOR THE BREACHES OF EC ANTITRUST LAW
Directory of Open Access Journals (Sweden)
Elena Isac
2010-09-01
Full Text Available This paper investigates the planned damages actions for breaches of EC antitrust law in order to assess their impact on consumer welfare. It first examines the current legal situation and concurs that the European Union needs to regulate damages actions for breaches of EC antitrust law so that a higher number of consumers could be compensated for their losses. This paper then discusses the main legal provisions proposed by the Commission in the Green and in the White paper on damages actions for breaches of EC antitrust law. The analysis of these proposed legal provisions is done using arguments specific to the economic analysis of law. It is demonstrated that most of these proposed legal provisions will enhance consumer welfare but that there are also proposed legal provisions which will damage consumer welfare. The paper concludes that the planned damages actions for breaches of the EC law will be an improvement compared to the current situation. However, the Commission should amend some of the proposed legal provisions in order to help consumers further.
Q and A. Why the EC's PINC has failed Europe's nuclear industry
Energy Technology Data Exchange (ETDEWEB)
Kraev, Kamen [NucNet, Brussels (Belgium)
2016-12-15
The European Economic and Social Committee (EESC) has called for a more comprehensive strategy to be incorporated in a revised version of the European Commission's (EC) Illustrative Programme for Nuclear Energy (PINC). EESC member Brian Curtis tells NucNet why the PINC has failed to address key issues for nuclear and why he believes the EC has become side-tracked by renewables. The EESC is a consultative body which represents the interests of civil society organisations and stakeholders at the EU. Its opinions are forwarded to the EC, the European Council, and the European Parliament and are considered in the EU's decision-making process. Brian Curtis was rapporteur on the committee's opinion paper.
Jekic, Biljana; Lukovic, Ljiljana; Bunjevacki, Vera; Milic, Vera; Novakovic, Ivana; Damnjanovic, Tatjana; Milasin, Jelena; Popovic, Branka; Maksimovic, Nela; Damjanov, Nemanja; Radunovic, Goran; Kovacevic, Ljiljana; Krajinovic, Maja
2013-03-01
Gamma-glutamyl hydrolase (GGH), cyclin D1 (CCND1) and thymidylate synthase (TS) genes encode enzymes that are involved in methotrexate (MTX) action. In a group of 184 RA patients treated with MTX, we have investigated whether selected polymorphisms in these genes modulate MTX efficacy and/or have impact on adverse drug effects (ADEs). The efficacy of the MTX therapy has been estimated using the disease activity score in 28 joints (DAS28-ESR) based on EULAR criteria and relative DAS28 values (rDAS28). All adverse drug events were recorded. Patients were genotyped for selected polymorphisms of the GGH (-354 G > T and 452 C > T), CCND1 (870 A > G) and TYMS (variable number of tandem repeats, VNTR, and G to C substitution of triple repeat, 3R allele) gene. Association studies have been performed between obtained genotypes and the efficacy and toxicity of MTX. According to the EULAR response criteria, 146 RA patients (79.3 %) were classified as responders (good/moderate response) and 38 (20.7 %) as non-responders (poor response). Higher frequency of the TYMS 3 G/3 G genotype has been found among non-responders as compared to individuals with remaining genotypes (p = 0.02). ADEs were recorded in 53 patients. Among those patients eight experienced bone marrow toxicity, all of them carried GGH -354GG genotype (p = 0.003). No other significant association were observed. The 3 G/3 G genotype of the TYMS gene may indicate predisposition of poor response to MTX and GG genotype of GGH -354 T > G polymorphism may have high predictive value for myelosuppression in RA patients.
Soin, Thomas; Iga, Masatoshi; Swevers, Luc; Rougé, Pierre; Janssen, Colin R; Smagghe, Guy
2009-08-01
Molting in insects is regulated by ecdysteroids and juvenile hormones. Several synthetic non-steroidal ecdysone agonists are on the market as insecticides. These ecdysone agonists are dibenzoylhydrazine (DBH) analogue compounds that manifest their toxicity via interaction with the ecdysone receptor (EcR). Of the four commercial available ecdysone agonists, three (tebufenozide, methoxyfenozide and chromafenozide) are highly lepidopteran specific, one (halofenozide) is used to control coleopteran and lepidopteran insects in turf and ornamentals. However, compared to the very high binding affinity of these DBH analogues to lepidopteran EcRs, halofenozide has a low binding affinity for coleopteran EcRs. For the discovery of ecdysone agonists that target non-lepidopteran insect groups, efficient screening systems that are based on the activation of the EcR are needed. We report here the development and evaluation of two coleopteran-specific reporter-based screening systems to discover and evaluate ecdysone agonists. The screening systems are based on the cell lines BRL-AG-3A and BRL-AG-3C that are derived from the weevil Anthonomus grandis, which can be efficiently transduced with an EcR reporter cassette for evaluation of induction of reporter activity by ecdysone agonists. We also cloned the almost full length coding sequence of EcR expressed in the cell line BRL-AG-3C and used it to make an initial in silico 3D-model of its ligand-binding pocket docked with ponasterone A and tebufenozide.
Integration of IC/EC systems in ITER
International Nuclear Information System (INIS)
Gassmann, T.; Beaumont, B.; Baruah, U.K.; Bonicelli, T.; Chiocchio, S.; Cox, D.; Darbos, C.; Decamps, H.; Denisov, G.; Henderson, M.; Kazarian, F.; Lamalle, P.U.; Mukherjee, A.; Rasmussen, D.; Saibene, G.; Sartori, R.; Sakamoto, K.; Tanga, A.
2010-01-01
The RF heating and current drive (H and CD) systems that are to be installed in ITER during the construction phase, are the electron cyclotron (EC) and ion cyclotron (IC) systems. They are complex assemblies of high voltage power supplies (HVPS), RF generators, transmission lines and antennas. Their design and integration are constrained by many interfaces, both internal, between the subsystems, and external, with the other ITER systems. In addition, some components must be compatible with a nuclear environment and are classified as Safety Important Component. This paper describes the processes implemented in ITER to ensure proper integration.
Grant, R. F.; Mekonnen, Z. A.; Riley, W. J.; Arora, B.; Torn, M. S.
2017-12-01
Differences of surface elevation in arctic polygonal landforms cause spatial variation in soil water contents (θ), active layer depths (ALD), and thereby in CO2 and CH4 exchange. Here we test hypotheses in ecosys for topographic controls on CO2 and CH4 exchange in trough, rim, and center features of low- and flat-centered polygons (LCP and FCP) against chamber and eddy covariance (EC) measurements during 2013 at Barrow, Alaska. Larger CO2 influxes and CH4 effluxes were measured with chambers and modeled with ecosys in LCPs than in FCPs and in lower features (troughs) than in higher (rims) within LCPs and FCPs. Spatially aggregated CO2 and CH4 fluxes from ecosys were significantly correlated with EC flux measurements. Lower features were modeled as C sinks (52-56 g C m-2 yr-1) and CH4 sources (4-6 g C m-2 yr-1), and higher features as near C neutral (-2-15 g C m-2 yr-1) and CH4 neutral (0.0-0.1 g C m-2 yr-1). Much of the spatial and temporal variations in CO2 and CH4 fluxes were modeled from topographic effects on water and snow movement and thereby on θ, ALD, and soil O2 concentrations. Model results forced with meteorological data from 1981 to 2015 indicated increasing net primary productivity in higher features and CH4 emissions in some lower and higher features since 2008, attributed mostly to recent rises in precipitation. Small-scale variation in surface elevation causes large spatial variation of greenhouse gas (GHG) exchanges and therefore should be considered in estimates of GHG exchange in polygonal landscapes.
EC assisted start-up experiments reproduction in FTU and AUG for simulations of the ITER case
Energy Technology Data Exchange (ETDEWEB)
Granucci, G.; Ricci, D.; Farina, D.; Figini, L. [Associazione EURATOM-ENEA sulla Fusione, IFP-CNR, Via R. Cozzi 53, 20125 Milano (Italy); Cavinato, M. [F4E C/Josep Pla2, Torres Diagonal Litoral - Building 83 08019 Barcelona (Spain); Mattei, M. [CREATE via Claudio 21, 80125 Napoli (Italy); Stober, J. [Max-Planck-Institut für Plasmaphysik, EURATOM Association, Boltzmannstr. 2, 85748 Garching bei München (Germany); Tudisco, O. [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, Via E. Fermi 45, 00044 Frascati (Roma) (Italy)
2014-02-12
The breakdown and plasma start-up in ITER are well known issues studied in the last few years in many tokamaks with the aid of calculation based on simplified modeling. The thickness of ITER metallic wall and the voltage limits of the Central Solenoid Power Supply strongly limit the maximum toroidal electric field achievable (0.3 V/m), well below the level used in the present generation of tokamaks. In order to have a safe and robust breakdown, the use of Electron Cyclotron Power to assist plasma formation and current rump up has been foreseen. This has raised attention on plasma formation phase in presence of EC wave, especially in order to predict the required power for a robust breakdown in ITER. Few detailed theory studies have been performed up to nowadays, due to the complexity of the problems. A simplified approach, extended from that proposed in ref[1] has been developed including a impurity multispecies distribution and an EC wave propagation and absorption based on GRAY code. This integrated model (BK0D) has been benchmarked on ohmic and EC assisted experiments on FTU and AUG, finding the key aspects for a good reproduction of data. On the basis of this, the simulation has been devoted to understand the best configuration for ITER case. The dependency of impurity distribution content and neutral gas pressure limits has been considered. As results of the analysis a reasonable amount of power (1 - 2 MW) seems to be enough to extend in a significant way the breakdown and current start up capability of ITER. The work reports the FTU data reproduction and the ITER case simulations.
Zhang, Wen; Li, Shaojun; Zhao, Yunlong; Guo, Nannan; Li, Yingjie
2016-12-01
Objective To observe the expression of the neural precursor cell expressed, developmentally down-regulated 9 (NEDD9) in esophageal cancer, to investigate the impact of decreased expression of NEDD9 on invasion and migration, and to explicit the function of NEDD9 in EC109 human esophageal cancer cell line. Methods Immunohistochemical staining was used to detect the expression of NEDD9 in human esophageal cancer tissues and paracancerous normal tissues. RNA interfering (RNAi) was used to knockdown NEDD9 in EC109 cells. The interference efficiency was detected by reverse transcription PCR (RT-PCR) and Western blot analysis. Cell proliferation was determined by MTT assay and the invasion and migration abilities of EC109 cells were monitored by Transwell TM assay. The protein levels of proliferating cell nuclear antigen (PCNA), Bax and Bcl-2 were tested by Western blotting. Results The positive expression rate of NEDD9 in esophageal carcinoma tissues was significantly higher compared with that in the paracancerous tissues. After NEDD9 expression was successfully downregulated in EC109 cells by siRNA, the proliferation, invasion and migration rates in transfection group were significantly lower than those in control group; meanwhile, the expression of Bcl-2 was reduced and Bax expression was enhanced. Conclusion The protein expression level of NEDD9 is higher in esophageal carcinoma tissues than that in adjacent normal tissues. Knockdown of NEDD9 expression can restrain the proliferation, invasion and migration of EC109 cells.
Signal-background interference effects for gg{yields}H{yields}W{sup +}W{sup -} beyond leading order
Energy Technology Data Exchange (ETDEWEB)
Bonvini, Marco [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Caola, Fabrizio; Melnikov, Kirill [Johns Hopkins Univ., Baltimore (United States). Dept. of Physics and Astronomy; Forte, Stefano [Univ. di Milano, Sezione di Milano (Italy). Dipt. di Fisica; INFN, Sezione di Milano (Italy); Ridolfi, Giovanni [Univ. di Genova, Sezione di Genova (Italy). Dipt. di Fisica; INFN, Sezione di Genova (Italy)
2013-04-15
We study the effect of QCD corrections to the gg {yields} H {yields} W{sup +}W{sup -} signal-background interference at the LHC for a heavy Higgs boson. We construct a soft-collinear approximation to the NLO and NNLO corrections for the background process, which is exactly known only at LO. We estimate its accuracy by constructing and comparing the same approximation to the exact result for the signal process, which is known up to NNLO, and we conclude that we can describe the signal-background interference to better than O(10%) accuracy. We show that our result implies that, in practice, a fairly good approximation to higher-order QCD corrections to the interference may also be obtained by rescaling the known LO result by a K-factor computed using the signal process.
A new verification film system for routine quality control of radiation fields: Kodak EC-L
International Nuclear Information System (INIS)
Hermann, A.; Bratengeier, K.; Priske, A.; Flentje, M.
2000-01-01
Background: The use of modern irradiation techniques requires better verification films for determining set-up deviations and patient movements during the course of radiation treatment. This is an investigation of the image quality and time requirement of a new verification film system compared to a conventional portal film system. Material and Methods: For conventional verifications we used Agfa Curix HT 1000 films which were compared to the new Kodak EC-L film system. 344 Agfa Curix HT 1000 and 381 Kodak EC-L portal films of different tumor sites (prostate, rectum, head and neck) were visually judged on a light box by 2 experienced physicians. Subjective judgement of image quality, masking of films and time requirement were checked. Results: In this investigation 68% of 175 Kodak EC-L ap/pa-films were judged 'good', only 18% were classified 'moderate' or 'poor' 14%, but only 22% of 173 conventional ap/pa verification films (Agfa Curix HT 1000) were judged to be 'good'. Conclusions: The image quality, detail perception and time required for film inspection of the new Kodak EC-L film system was significantly improved when compared with standard portal films. They could be read more accurately and the detection of set-up deviation was facilitated. (orig.) [de
620 ASSESSMENT OF HEAVY METALS, pH AND EC IN EFFLUENT ...
African Journals Online (AJOL)
Osondu
evaluated metals were Cu, Fe, Ni, Mn, Cr, Zn, Cd, Co, and Ag. The pH, EC, TDS, DO ... heavy metals, but the high heavy metal concentrations in the soil could seriously ... Key words: Heavy metals, AAS, contamination, floriculture and effluents.
International Nuclear Information System (INIS)
Wei, Siye; Shen, Guofeng; Zhang, Yanyan; Xue, Miao; Xie, Han; Lin, Pengchuan; Chen, Yuanchen; Wang, Xilong; Tao, Shu
2014-01-01
Field measurements were conducted to measure emission factors of particulate matter (EF PM ), organic carbon (EF OC ), elemental carbon (EF EC ), 28 parent polycyclic aromatic hydrocarbons (EF 28pPAHs ), and 4 oxygenated PAHs (EF 4oPAHs ) for four types of crop straws burned in two stoves with similar structure but different ages. The average EF PM , EF OC , EF EC , EF 28pPAHs , and EF 4oPAHs were 9.1 ± 5.7 (1.8–22 as range), 2.6 ± 2.9 (0.30–12), 1.1 ± 1.2 (0.086–5.5), 0.26 ± 0.19 (0.076–0.96), 0.011 ± 0.14 (1.3 × 10 −4 – 0.063) g/kg, respectively. Much high EF 28pPAHs was observed in field compared with the laboratory derived EFs and significant difference in EF 28pPAHs was identified among different crop residues, indicating considerable underestimation when laboratory derived EFs were used in the inventory. The field measured EF PM , EF OC , and EF EC were significantly affected by stove age and the EFs of carbonaceous particles for the 15-year old stove were approximately 2.5 times of those for the 1-year old stove. Highlights: • Field measurements provided more reliable data for the inventory. • Emissions from indoor crop residue burning were measured in field. • Much high PAHs emissions were found in field measurement in comparison with laboratory derived results. • Emissions of carbonaceous particulate matter increased by 2.5 times in the old stove compared that in a new stove. -- Emissions of incomplete combustion pollutants strongly affected by the fuel type and stove usage
Directory of Open Access Journals (Sweden)
Patricia L Hibberd
Full Text Available Although Lactobacillus rhamnosus GG ATCC 53103 (LGG has been consumed by 2 to 5 million people daily since the mid 1990s, there are few clinical trials describing potential harms of LGG, particularly in the elderly.The primary objective of this open label clinical trial is to assess the safety and tolerability of 1×1010 colony forming units (CFU of LGG administered orally twice daily to elderly volunteers for 28 days. The secondary objectives were to evaluate the effects of LGG on the gastrointestinal microbiome, host immune response and plasma cytokines.Fifteen elderly volunteers, aged 66-80 years received LGG capsules containing 1×1010 CFU, twice daily for 28 days and were followed through day 56. Volunteers completed a daily diary, a telephone call on study days 3, 7 and 14 and study visits in the Clinical Research Center at baseline, day 28 and day 56 to determine whether adverse events had occurred. Assessments included prompted and open-ended questions.There were no serious adverse events. The 15 volunteers had a total of 47 events (range 1-7 per volunteer, 39 (83% of which were rated as mild and 40% of which were considered related to consuming LGG. Thirty-one (70% of the events were expected, prompted symptoms while 16 were unexpected events. The most common adverse events were gastrointestinal (bloating, gas, and nausea, 27 rated as mild and 3 rated as moderate. In the exploratory analysis, the pro-inflammatory cytokine interleukin 8 decreased during LGG consumption, returning towards baseline one month after discontinuing LGG (p = 0.038 while there was no difference in other pro- or anti-inflammatory plasma cytokines.Lactobacillus rhamnosus GG ATCC 53103 is safe and well tolerated in healthy adults aged 65 years and older.ClinicalTrials.gov NCT 01274598.
Analysis of Well ER-EC-7 Testing, Western Pahute Mesa - Oasis Valley FY 2000 Testing Program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-EC-7 during the Western Pahute Mesa - Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program was documented in Appendix A, Western Pahute Mesa - Oasis Valley, Well ER-EC-7 Data Report for Development and Hydraulic Testing.
Analysis of Well ER-EC-8 testing, Western Pahute Mesa-Oasis Valley FY 2000 testing program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-EC-8 during the Western Pahute Mesa - Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program is documented in Appendix A, Western Pahute Mesa-Oasis Valley, Well ER-EC-8 Data Report for development and Hydraulic Testing.
Analysis of Well ER-EC-4 Testing, Western Pahute Mesa-Oasis Valley FY 2000 Testing Program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-EC-4 during the Western Pahute Mesa-Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program is documented in Appendix A, Western Pahute Mesa - Oasis Valley, Well ER-EC-4 Data Report for Development and Hydraulic Testing.
Analysis of Well ER-EC-5 Testing, Western Pahute Mesa-Oasis Valley FY 2000 Testing Program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-EC-5 during the Western Pahute Mesa - Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program is documented in Appendix A, Western Pahute Mesa - Oasis Valley, Well ER-EC-5 Data Report for Development and Hydraulic Testing.
Analysis of Well ER-EC-6 Testing, Western Pahute Mesa - Oasis Valley FY 2000 Testing Program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-EC-6 during the Western Pahute Mesa-Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program is documented in Appendix A, Western Pahute Mesa-Oasis Valley, Well ER-EC-6 Data Report for Development and Hydraulic Testing.
Trevisi, P; Casini, L; Coloretti, F; Mazzoni, M; Merialdi, G; Bosi, P
2011-08-01
Lactobacillus rhamnosus GG (LGG) is a probiotic for humans and is normally not found in pigs; however, it has been shown to protect the human-derived intestinal Caco-2 cells against the damage induced by an important intestinal pathogen, enterotoxigenic Escherichia coli F4 (ETEC). An experiment was conducted to test whether the dietary addition of LGG improves the growth and health of weaned pigs when orally challenged by E. coli F4. Thirty-six pigs were weaned at 21 days and assigned to a standard weaning diet with or without 1010 CFU LGG (ATCC 53103) per day. The pigs, individually penned, were orally challenged with 1.5 ml of a 1010 CFU E. coli F4 suspension on day 7 and slaughtered on day 12 or 14. With the addition of LGG, the average daily gain and the average daily feed intake were reduced after the challenge with ETEC and for the entire trial (P F4-specific IgA activity was not affected by the diet at all the samplings. Our result shows that, the administration of LGG do not prevent or reduce the detrimental effect of the E. coli F4 infection on the growth performance and health status of weaned piglet.
Capability and limits of EC policy and instruments for protection of the environment
International Nuclear Information System (INIS)
Jarass, H.D.; Neumann, L.F.; Pastowski, A.; Ruhr, H.J. von der; Schreiber, F.
1994-01-01
The authors who contributed to this compilation of studies start from different points of view in their approaches towards describing the existing (or desirable) balance between centralised and decentralised frameworks and instruments of the EC policy for protection of the environment: A total harmonisation of environmental protection standards would be inconsistent with the principles of competition and, in terms of environmental protection, would rather foster a climate tending to be hostile to innovation. The impetus given by the EC in support of free mobility in the transport sector of the internal market on the other hand ought to be flanked by mandatory ecological standards. Adhering to the economic theory of federalism would mean to decide for a high degree of decentralisation, which in turn does not seem to be altogether appropriate in view of the large scope of impact of environmental damage and the mutual ecological dependence of EC member states. A more centralised regulatory competence has to be accompanied by correspondingly strong, democratic institutions in order to fulfill the principles of constitutional law. The priority given to the principle of subsidiarity in the compromise laid down in the Treaty of Maastricht needs to be given concrete shape [de
Changes of the value added tax in the tax-harmonization process with EC directives
Directory of Open Access Journals (Sweden)
Andrea Votavová
2005-01-01
Full Text Available The aim of this article is to bring near the topical process of the assimilation the Czech law of value added tax to the EC-directives. The attention will be paid to the development of the harmonization this law in 1993 – 2003 and I will describe and analyse the choice sections of the value added tax law (with the effective date from 1. 5. 2004. I will explain the changes by tax rates.
Estrutura de comunidades em transições ambientais : lagartos no ecótono Cerrado-Amazônia
Dantas, Pedro Tourinho
2014-01-01
Os limites ecológicos desempenham um papel crucial no fluxo de espécies, de genes e 2 nutrientes entre áreas adjacentes. Os limites não apenas separam, mas também conectam 3 estas áreas, agindo como filtros de permeabilidade variável. A estrutura das comunidades 4 varia com a proximidade do ecótono e a riqueza de espécies no ecótono pode ser maior que, 5 menor que, ou intermediária entre as áreas adjacentes. Aqui, eu investigo como o ecótono 6 isola a Amazônia e o Cerrado, atuando como um fil...
Stability of the Gel Electrolyte PAN : EC : PC : LICF3SO3 towards Lithium
DEFF Research Database (Denmark)
Perera, Kumudu; Dissanayake, M.A.K.L.; Skaarup, Steen
2006-01-01
The stability of the gel electrolyte consisting of polyacrylonitrile (PAN), ethylene carbonate (EC), propylene carbonate (PC) and lithium trifluoromethanesulfonate (LiCF3SO3 – LiTF) towards metallic lithium was investigated using the time evolution of impedance plots. Symmetric cells of the form Li...... / PAN : EC : PC: LiTF / Li were assembled and impedance data were collected at room temperature for one week. A clear indication of growth of a resistive layer could be seen. The electrolyte resistance remained constant. The growth of the passivation layer became constant after first two days...
2011-05-27
... Connection With the EC-Beef Hormones Dispute AGENCY: Office of the United States Trade Representative. ACTION... Hormones dispute. In January 2009, the Trade Representative announced a determination to modify the list of...) in the EC-Beef Hormones dispute. The MOU provides for the EU to make phased increases in market...
CYP1A1, CYP1A2, SULT1A1 AND SULT1E1 ALLELIC POLYMORPHISM IN CASE OF GENITAL ENDOMETRIOSIS
Directory of Open Access Journals (Sweden)
Konstantin Sergeevich Kublinskiy
2016-02-01
Up-to-date molecular and genetic analyses reveal that women predisposed to genital endometriosis possess Allele G and Genotypes AG and GG of the polymorphic option A-4889G of the CYP1A1 gene and Allele A and Genotypes CA and AA of the polymorphic option C-734A of the CYP1A2 gene. The polymorphism of the promoter regions of the SULT1A1 (G-638A and SULT1E1 (C-174T genes is not associated with genital endometriosis in women.
Association between MLH1 -93G>a polymorphism and risk of colorectal cancer.
Directory of Open Access Journals (Sweden)
Ting Wang
Full Text Available The -93G>A (rs1800734 polymorphism located in the promoter of mismatch repair gene, MLH1, has been identified as a low-penetrance variant for cancer risk. Many published studies have evaluated the association between the MLH1 -93G>A polymorphism and colorectal cancer (CRC risk. However, the results remain conflicting rather than conclusive.The aim of this study was to assess the association between the MLH1 -93G>A polymorphism and the risk of CRC.To derive a more precise estimation of the association, a meta-analysis of six studies (17,791 cases and 13,782 controls was performed. Odds ratios (ORs and 95% confidence intervals (CIs were used to evaluate the strength of the association. Four of these published studies were performed on subjects of known microsatellite instability (MSI status. An additional analysis including 742 cases and 10,895 controls was used to assess the association between the MLH1 -93G>A polymorphism and the risk of MSI-CRC.The overall results indicated that the variant genotypes were associated with a significantly increased risk of CRC (AG versus GG: OR = 1.06, 95% CI = 1.01-1.11; AA/AG versus GG: OR = 1.06, 95% CI = 1.01-1.11. This increased risk was also found during stratified analysis of MSI status (AA versus GG: OR = 2.52, 95% CI = 1.94-3.28; AG versus GG: OR = 1.29, 95% CI = 1.10-1.52; AA/AG versus GG: OR = 1.45, 95% CI = 1.24-1.68; AA versusOR = 2.29, 95% CI = 1.78-2.96. Egger's test did not show any evidence of publication bias.Our results suggest that the MLH1 -93G>A polymorphism may contribute to individual susceptibility to CRC and act as a risk factor for MSI-CRC.
International Nuclear Information System (INIS)
Conesa-Zamora, Pablo; Vicente, Vicente; Pérez-Guillermo, Miguel; Ruiz-Cosano, Javier; Torres-Moreno, Daniel; Español, Ignacio; Gutiérrez-Meca, María D; Trujillo-Santos, Javier; Pérez-Ceballos, Elena; González-Conejero, Rocío; Corral, Javier
2013-01-01
The interplay between genetic susceptibility and carcinogenic exposure is important in the development of haematopoietic malignancies. EPHX1, NQO1 and PON1 are three genes encoding proteins directly involved in the detoxification of potential carcinogens. We have studied the prevalence of three functional polymorphisms affecting these genes rs1051740 EPHX1, rs1800566 NQO1 and rs662 PON1 in 215 patients with lymphoma and 214 healthy controls. Genotype frequencies for EPHX and NQO1 polymorphisms did not show any correlation with disease. In contrast, the GG genotype in the PON1 polymorphism was found to be strongly associated with the disease (15.3% vs. 4.7%; OR = 3.7 CI (95%): 1.8-7.7; p < 0.001). According to the pathological diagnosis this association was related to follicular (p = 0.004) and diffuse large B-cell (p = 0.016) lymphomas. Despite the fact that further confirmation is needed, this study shows that the PON1 GG genotype in rs662 polymorphism could be a risk factor for B-cell lymphomas
Although Lactobacillus rhamnosus GG ATCC 53103 (LGG) has been consumed since the mid 1990s by between 2 and 5 million people daily, the scientific literature lacks rigorous clinical trials that describe the potential harms of LGG, particularly in the elderly. The primary objective of this open label...
Cao, Minghui; Wang, Minqiang; Li, Le; Qiu, Hengwei; Yang, Zhi
2018-01-10
To optimize the performance of silver nanowire (Ag NW) film heaters and explore the effect of graphene on a film, we introduced poly(3,4-ethylenedioxythiophene):poly(4-styrenesulfonate) (PEDOT:PSS) and graphene modified with ethyl cellulose (graphene-EC) into the film. The high-quality and well-dispersed graphene-EC was synthesized from graphene obtained by electrochemical exfoliation as a precursor. The transparent film heaters were fabricated via spin-coating. With the assistance of graphene-EC, the stability of film heaters was greatly improved, and the conductivity was optimized by adjusting the Ag NW concentration. The film heaters exhibited a fast and accurate response to voltage, accompanied by excellent environmental endurance, and there was no significant performance degradation after being operated for a long period of time. These results indicate that graphene-EC plays a crucial role in optimizing film stability and heat dispersion in the film. The Ag NW/PEDOT:PSS-doped graphene-EC film heaters show a great potential in low-cost indium-tin-oxide-free flexible transparent electrodes, heating systems, and transparent film heaters.
Directory of Open Access Journals (Sweden)
Akbota Aitkulova
2014-12-01
Full Text Available Introduction: Single nucleotide polymorphism (SNP at the collagen type I alpha 1 gene (COL1A1 rs1800012 has been widely studied and has shown an association with bone mineral density (BMD and fractures. A minor allele TT of this SNP was found to be greatly overrepresented in individuals with fractures compared to controls, thus becoming a good predictor of increased fracture risk. The aim of this investigation was to evaluate potential association between COL1A1 gene polymorphism and osteoporosis in Kazakh postmenopausal women.Methods: The study population included 103 postmenopausal women recruited from Pavlodar and Almaty clinics. BMD was measured using DEXA. Genomic DNA was extracted from peripheral venous blood of study participants with Wizard® Genomic DNA Purification Kit (Promega, USA. Detection of COL1A1 +1245G/T (Sp1 polymorphism was done by the TaqMan® SNP Genotyping Assay of real-time PCR.Results: Densitometry results revealed 36 osteoporotic, 42 osteopenic, and 25 normal postmenopausal women. Data analysis of 1245G>T polymorphism in COL1A1 gene in the group of women with osteopenia and osteoporosis revealed deviation from Hardy-Weinberg equilibrium. The mutant TT genotype was prevalent compared to the heterozygous genotype GT in both groups. Distributions were 83% GG, 3% GT, and 14% TT in the group with osteopenia and 80% GG, 6% GT, and 14% TT in the group with osteoporosis. The distribution of genotypes frequency in the group of normal postmenopausal women was 76% GG, 16% GT, and 8% TT.Conclusion: These results suggest that TT genotype of COL1A1 +1245G/T (Sp1 polymorphism is associated with risk of postmenopausal osteoporosis in Kazakh women. Further studies involving a larger number of women are needed to clarify the relationship of this polymorphism with risk of osteoporosis.
A look at the ocean in the EC-Earth climate model
Energy Technology Data Exchange (ETDEWEB)
Sterl, Andreas; Bintanja, Richard; Severijns, Camiel [Royal Netherlands Meteorological Institute (KNMI), P.O. Box 201, De Bilt (Netherlands); Brodeau, Laurent [Stockholm University, Department of Meteorology, Stockholm (Sweden); Gleeson, Emily; Semmler, Tido [Met Eireann, Dublin (Ireland); Koenigk, Torben; Wyser, Klaus [Swedish Meteorological and Hydrological Institute (SMHI), Norrkoeping (Sweden); Schmith, Torben; Yang, Shuting [Danish Meteorological Institute (DMI), Copenhagen (Denmark)
2012-12-15
EC-Earth is a newly developed global climate system model. Its core components are the Integrated Forecast System (IFS) of the European Centre for Medium Range Weather Forecasts (ECMWF) as the atmosphere component and the Nucleus for European Modelling of the Ocean (NEMO) developed by Institute Pierre Simon Laplace (IPSL) as the ocean component. Both components are used with a horizontal resolution of roughly one degree. In this paper we describe the performance of NEMO in the coupled system by comparing model output with ocean observations. We concentrate on the surface ocean and mass transports. It appears that in general the model has a cold and fresh bias, but a much too warm Southern Ocean. While sea ice concentration and extent have realistic values, the ice tends to be too thick along the Siberian coast. Transports through important straits have realistic values, but generally are at the lower end of the range of observational estimates. Exceptions are very narrow straits (Gibraltar, Bering) which are too wide due to the limited resolution. Consequently the modelled transports through them are too high. The strength of the Atlantic meridional overturning circulation is also at the lower end of observational estimates. The interannual variability of key variables and correlations between them are realistic in size and pattern. This is especially true for the variability of surface temperature in the tropical Pacific (El Nino). Overall the ocean component of EC-Earth performs well and helps making EC-Earth a reliable climate model. (orig.)
Evaluation of reliability of EC inspection of VVER SG tubes
International Nuclear Information System (INIS)
Stanic, D.
2001-01-01
Evaluation of eddy current data collected during inspection of VVER steam generators is very complex task because of numerous parameters which have affect on eddy current signals. That was the reason that recently ago INETEC has started related scientific project in order to evaluate the reliability of eddy current (EC) inspection of VVER steam generator (SG) tubing. In the scope of project the following objectives will be investigated: 1. Determination of POD (Probability of detection) of various types degradation cracks, where their basic parameters are variables (basic parameters are depth, length, width, orientation, number) on three different sets of tubes (clean ideal tubes, tubes with pilgering, tubes electroplated with copper) 2. Sizing quality (accuracy, repeatability) (same data sets as defined in 1.) 3. Effect of fill factor on POD and sizing quality. 4. Effect of tube bends on POD and sizing quality. 5. Effect of other tube geometry variations on POD and sizing quality (tube ovality, transition zone region, expanded (rolled) part of tube, dents, dings). Investigation will start with bobbin probe technique which is the most used technique for general purpose VVER tube examination. Since INETEC is the only world company which successfully developed and applied rotating probe technique for VVER SG tubes, scope of the project will be extended on rotating probe technique utilizing 'pancake' and 'point' coil. Method reliability will be investigated first on the huge set of EDM notches representing various defect morphologies and simulating different factors, and the second part will be investigated on sets of degradation defects obtained by artificial corrosion. In the scope of the project the measures for enhancing the method reliability have to be determined. This considers the proper definition of parameters of examination system, as well as establishment of the suitable analysis procedures. This article presents the temporary results of the first part of
Futagawa, Masato; Iwasaki, Taichi; Murata, Hiroaki; Ishida, Makoto; Sawada, Kazuaki
2012-01-01
Making several simultaneous measurements with different kinds of sensors at the same location in a solution is difficult because of crosstalk between the sensors. In addition, because the conditions at different locations in plant beds differ, in situ measurements in agriculture need to be done in small localized areas. We have fabricated a multimodal sensor on a small Si chip in which a pH sensor was integrated with electrical conductivity (EC) and temperature sensors. An ISFET with a Si(3)N(4) membrane was used for the pH sensor. For the EC sensor, the electrical conductivity between platinum electrodes was measured, and the temperature sensor was a p-n junction diode. These are some of the most important measurements required for controlling the conditions in plant beds. The multimodal sensor can be inserted into a plant bed for in situ monitoring. To confirm the absence of crosstalk between the sensors, we made simultaneous measurements of pH, EC, and temperature of a pH buffer solution in a plant bed. When the solution was diluted with hot or cold water, the real time measurements showed changes to the EC and temperature, but no change in pH. We also demonstrated that our sensor was capable of simultaneous in situ measurements in rock wool without being affected by crosstalk.
Research and development programme of the EC in the field of raw materials 1982 to 1985
International Nuclear Information System (INIS)
Anon.
1982-01-01
Brussels: The EC Cabinet Council was presented a research and development programme in the field of raw materials for the years 1982 to 1985 which covers programmes already running and new actions as an overlapping raw material research programme of the EC. The new programme is divided up into 7 subprogrammes: I) metals and minerals (formerly: primary raw materials, II) uranium, III) ceramics, IV) wood as a renewable raw material, V) recycling of wastes (house and industry, VI) regaining of non-iron metals, VII) substitution. For the continuing of running actions and for beginning new projects in the 4 years plan, a total of 17 million ECU are to be allocated in the budget of the EC which will be used in cost sharing contracts or for coordinative projects. (orig./UA) [de
International Nuclear Information System (INIS)
Cherepanov, E.A.; Lee Gen Soo; Mezentsev, A.N.; Volkov, V.V.
1978-01-01
Relative cross sections have been calculated for the production of gold isotopes with mass numbers of the 190-199 range in the 181 Ta+ 40 Ar, 181 Ta+ 86 Kr and 181 Ta+ 136 Xe systems at laboratory bombarding energies of 290, 550 and 840 MeV, respectively. It was assumed that gold isotopes were produced as a result of multinucleon transfers followed by neutron evaporation. The yield of primary gold isotopes was found using the Qsub(gg)-systematics, whereas the neutron evaporation process was calculated within the framework of the Jackson model. The parameters used in the calculation are the average entrance angular momentum anti l, temperature UPSILON and the nuclear parameter r 0 of exit reaction channels. For realistic values of the parameters indicated a good agreement with the experimental data obtained previously has been achieved. This provides evidence for the applicability of the Qsub(gg)-systematics to the description of multinucleon transfer reactions induced by very heavy ions
Completion report for Well ER-EC-6
Energy Technology Data Exchange (ETDEWEB)
M. J. Townsend
2000-05-01
Well ER-EC-6 was drilled for the U.S. Department of Energy, Nevada Operations Office in support of the Nevada Environmental Restoration Project at the Nevada Test Site, Nye County, Nevada. This well was drilled in the spring of 1999 as part of the DOE's hydrogeologic investigation well program in the Western Pahute Mesa - Oasis Valley region just west of the Nevada Test Site. A 66-centimeter surface hole was drilled and cased off to the depth of 485.1 meters below the surface. The hole diameter was then decreased to 31.1 centimeters for drilling to a total depth of 1,524.0 meters. A preliminary composite, static, water level was measured at the depth of approximately 434.6 meters prior to installation of the completion string. One completion string with four isolated, slotted intervals was installed in the well. Detailed lithologic descriptions with preliminary stratigraphic assignments are included in the report. These are based on composite drill cuttings collected every 3 meters and 33 sidewall samples taken at various depths below 504.4 meters, supplemented by geophysical log data. Detailed chemical and mineralogical studies of rock samples are in progress. The well penetrated Tertiary-age lava and tuff of the Timber Mountain Group, the Paintbrush Group, the Calico Hills Formation, and the Volcanics of Quartz Mountain. Intense hydrothermal alteration was observed below the depth of 640 m. The preliminary geologic interpretation indicates that this site may be located on a buried structural ridge that separates the Silent Canyon and Timber Mountain caldera complexes.
The planned EC Directive on 'Integrated Pollution Prevention and Control' (IPC)
International Nuclear Information System (INIS)
Sellner, D.; Schnutenhaus, J.
1993-01-01
This EC Directive is intended to incorporate integrated pollution control as a mandatory obligation in the legal provisions governing industrial installations licensing within the EC. The article in hand presents an assessment of the Directive and discusses some possible impacts on the German national law in the field of pollution control, which hitherto has been defined on the basis of a preferably medium-oriented approach. A serious point of deviation from the German approach is seen in the fact that the draft's provisions relating to the licensing of industrial installations defines certain pre-conditions allowing a plant in a low-polluted area to be licensed, although the pollution control systems of the plant do not them come up to the state-of-the-art in pollution abatement technology. This is seen as a fact jeopardizing the principle of precantionary measures which has been firmly established in German pollution control law. (orig./HP) [de
Indirect probes of the trilinear Higgs coupling: $gg \\to h$ and $h \\to \\gamma \\gamma$
Gorbahn, Martin
2016-10-18
In the framework of the Standard Model effective field theory, we examine the indirect constraints on the trilinear Higgs coupling $\\lambda$ that arise from Higgs production in gluon-gluon-fusion and diphoton Higgs decays. We calculate 2-loop contributions to the $gg \\to h$ and $h \\to \\gamma \\gamma$ amplitudes that are affected by modifications of the trilinear Higgs-boson vertex. This calculation involves both the computation of anomalous dimensions and finite matching corrections. Based on our new results, we analyse the sensitivity of present and future measurements of the $hgg$ and $h \\gamma \\gamma$ couplings to shifts in $\\lambda$. Under the assumption that $O_6 = - \\lambda \\left (H^\\dagger H \\right )^3$ is the only dimension-6 operator that alters the trilinear Higgs interactions, we find that at present the considered loop-level probes provide stronger constraints than $pp \\to 2h$. At future high-energy colliders indirect ${\\cal O} (5)$ determinations of the trilinear Higgs coupling may be possible, ma...
Gatej, Simona M; Marino, Victor; Bright, Richard; Fitzsimmons, Tracy R; Gully, Neville; Zilm, Peter; Gibson, Rachel J; Edwards, Suzanne; Bartold, Peter M
2018-02-01
This study investigated the role of Lactobacillus rhamnosus GG (LGG) on bone loss and local and systemic inflammation in an in vivo mouse model of experimental periodontitis (PD). Experimental PD was induced in mice by oral inoculation with Porphyromonas gingivalis and Fusobacterium nucleatum over a period of 44 days. The probiotic LGG was administered via oral inoculation or oral gavage prior to, and during disease induction. The antimicrobial activity of LGG on the inoculum was also tested. Alveolar bone levels and gingival tissue changes were assessed using in vivo microcomputed tomography and histological analysis. Serum levels of mouse homologues for IL-8 were measured using multiplex assays. Pre-treatment with probiotics either via oral gavage or via oral inoculation significantly reduced bone loss (p loss in a mouse model of induced PD irrespective of the mode of administration. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Contribution of polymorphisms in ESR1, ESR2, FSHR, CYP19A1 ...
Indian Academy of Sciences (India)
2016-03-04
Mar 4, 2016 ... 1Department of Medical Genetics, and 2Department of Neurology, Dicle University, Medical Faculty, ... analysis was performed only in women, the GG genotype of ... tor interacting protein 1 (NRIP1) negatively regulates the ... High FSH levels and low oestrogen levels have been asso- ...... meta-analysis.
Lactobacillus GG and tributyrin supplementation reduce antibiotic-induced intestinal injury.
Cresci, Gail; Nagy, Laura E; Ganapathy, Vadivel
2013-11-01
Antibiotic therapy negatively alters the gut microbiota. Lactobacillus GG (LGG) decreases antibiotic-associated diarrhea (AAD) symptoms, but the mechanisms are unknown. Butyrate has beneficial effects on gut health. Altered intestinal gene expression occurs in the absence of gut microbiota. We hypothesized that antibiotic-induced changes in gut microbiota reduce butyrate production, varying genes involved with gut barrier integrity and water and electrolyte absorption, lending to AAD, and that simultaneous supplementation with LGG and/or tributyrin would prevent these changes. C57BL/6 mice aged 6-8 weeks received a chow diet while divided into 8 treatment groups (± saline, ± LGG, ± tributyrin, or both). Mice received treatments orally for 7 days with ± broad-spectrum antibiotics. Water intake was recorded daily and body weight was measured. Intestine tissue samples were obtained and analyzed for expression of genes and proteins involved with water and electrolyte absorption, butyrate transport, and gut integrity via polymerase chain reaction and immunohistochemistry. Antibiotics decreased messenger RNA (mRNA) expression (butyrate transporter and receptor, Na(+)/H(+) exchanger, Cl(-)/HCO3 (-), and a water channel) and protein expression (butyrate transporter, Na(+)/H(+) exchanger, and tight junction proteins) in the intestinal tract. LGG and/or tributyrin supplementation maintained intestinal mRNA expression to that of the control animals, and tributyrin maintained intestinal protein intensity expression to that of control animals. Broad-spectrum antibiotics decrease expression of anion exchangers, butyrate transporter and receptor, and tight junction proteins in mouse intestine. Simultaneous oral supplementation with LGG and/or tributyrin minimizes these losses. Optimizing intestinal health with LGG and/or tributyrin may offer a preventative therapy for AAD.
DEFF Research Database (Denmark)
Tetens, Inge
consumption on the stimulation of protective immune responses after oral (viral) vaccination and, in the absence of evidence for an effect of LGG consumption on the development of GI infections in the general population, studies on the treatment of GI infections, on diarrhoea during antibiotic use......Following an application from Valio Ltd., submitted pursuant to Article 13(5) of Regulation (EC) No 1924/2006 via the Competent Authority of Finland, the Panel on Dietetic Products, Nutrition and Allergies was asked to deliver an opinion on the scientific substantiation of a health claim related...
Jonsson, Ing-Marie; Juuti, Jarmo T.; Francois, Patrice; AlMajidi, Rana; Pietiainen, Milla; Girard, Myriam; Lindholm, Catharina; Saller, Manfred J.; Driessen, Arnold J. M.; Kuusela, Pentti; Bokarewa, Maria; Schrenzel, Jacques; Kontinen, Vesa P.
2010-01-01
Background: Ecs is an ATP-binding cassette (ABC) transporter present in aerobic and facultative anaerobic Gram-positive Firmicutes. Inactivation of Bacillus subtilis Ecs causes pleiotropic changes in the bacterial phenotype including inhibition of intramembrane proteolysis. The molecule(s)
Ferro-based derivatizing agents for LC/MS an LC/EC/MS
Seiwert, Bettina
2007-01-01
Within this thesis, the development and application of ferrocene-based derivatizing agents for LC/MS and LC/EC/MS is presented. The advantages of derivatization by ferrocenes are the similtaneous introduction of a mass tag and an electroactive group, which make them ideally suited for LC/MS and
DEFF Research Database (Denmark)
Sjödin, Anders Mikael
2016-01-01
Following an application from Anxiofit Ltd. and ExtractumPharma Co Ltd., submitted for authorisation of a health claim pursuant to Article 14 of Regulation (EC) No 1924/2006 via the Competent Authority of Hungary, the EFSA Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked...
Ma, Minmin; Dong, Guanghui; Jia, Xin; Wang, Hui; Cui, Yifu; Chen, Fahu
2017-04-01
:Human diets rely on natural resource availability and can reflect social and cultural values. When environments, societies, and cultures change, diets may also shift. This study traced the extent of dietary change and the factors influencing such change. Through stable carbon and nitrogen isotopic analysis of late Neolithic and early Bronze Age human and animal bone collagen, we found that significant shifts in human diets were closely associated with intercontinental cultural exchanges in Eurasia and climate change in northwestern China. The isotopic evidence indicated that human diets mainly consisted of C4 foodstuffs (presumably millet and/or animals fed with C4 foods) around 4000 calibrated years before the present (cal yr BP), corresponding to the flourishing of millet agriculture in the context of the optimal climate conditions of the mid-Holocene. Subsequently, more C3 foods (probably wheat, barley, and animals fed with C3 foods) were added to human diets post-3600 cal yr BP when the climate became cooler and drier. Such dietary variation is also consistent with the increasing intensity of long-distance exchange after 4000 cal yr BP. While many factors can lead to human dietary shifts (e.g. climate change, population growth, cultural factors, and human migration), climate may have been a key factor in Gansu and Qinghai.
Directory of Open Access Journals (Sweden)
J. C. Stager
2012-05-01
Full Text Available The austral westerlies strongly influence precipitation and ocean circulation in the southern temperate zone, with important consequences for cultures and ecosystems. Global climate models anticipate poleward retreat of the austral westerlies with future warming, but the available paleoclimate records that might test these models have been limited to South America and New Zealand, are not fully consistent with each other and may be complicated by influences from other climatic factors. Here we present the first high-resolution diatom and sedimentological records from the winter rainfall region of South Africa, representing precipitation in the equatorward margin of the westerly wind belt during the last 1400 yr. Inferred rainfall was relatively high ∼1400–1200 cal yr BP, decreased until ∼950 cal yr BP, and rose notably through the Little Ice Age with pulses centred on ∼600, 530, 470, 330, 200, 90, and 20 cal yr BP. Synchronous fluctuations in Antarctic ice core chemistry strongly suggest that these variations were linked to changes in the westerlies. Equatorward drift of the westerlies during the wet periods may have influenced Atlantic meridional overturning circulation by restricting marine flow around the tip of Africa. Apparent inconsistencies among some aspects of records from South America, New Zealand and South Africa warn against the simplistic application of single records to the Southern Hemisphere as a whole. Nonetheless, these findings in general do support model projections of increasing aridity in the austral winter rainfall zones with future warming.
Directory of Open Access Journals (Sweden)
Xue-Ming Li
2015-01-01
Full Text Available Aim of Study: To assess the impact of glutathione S-transferase P1 (GSTP1 Ile105Val polymorphism on the risk of lung cancer in the Chinese population, an updated meta-analysis and review was performed. Materials and Methods: Relevant studies were identified from PubMed, Springer Link, Ovid, Chinese Wanfang Data Knowledge Service Platform, Chinese National Knowledge Infrastructure, and Chinese Biology Medicine published through January 22, 2015. The odds ratios (ORs and 95% confidence intervals (CIs were calculated to estimate the strength of the associations. Results: A total of 13 case-control studies, including 2026 lung cancer cases and 2451 controls, were included in this meta-analysis. Overall, significantly increased lung cancer risk was associated with the variant genotypes of GSTP1 polymorphism in the Chinese population (GG vs. AA: OR = 1.36, 95% CI = 1.01-1.84. In subgroup analyses stratified by geographic area and source of controls, the significant results were found in population-based studies (GG vs. AA: OR = 1.62, 95% CI: 1.13-2.31; GG vs. AG: OR = 1.49, 95% CI: 1.03-2.16; GG vs. AA + AG: OR = 1.55, 95% CI: 1.12-2.26. A gene-gene interaction analysis showed that there was an interaction for individuals with combination of GSTM1 (or GSTT1 null genotype and GSTP1 (AG + GG mutant genotype for lung cancer risk in Chinese. Conclusion: This meta-analysis suggests that GSTP1 Ile105Val polymorphism may increase the risk of lung cancer in the Chinese population.
Energy Technology Data Exchange (ETDEWEB)
Pipke, R. [Bundesanstalt fuer Arbeitschutz und Arbeitsmedizin, Dortmund (Germany)
2004-07-01
The draft of a directive on the protection of workers from risks related to radiation in the range from 100 nm to 1 mm (Laser, UV-radiation) is discussed on EC-level. The European concept of regulations on occupational safety and health is outlined and put into reference with other directives on the protection against physical agents (vibrations, noise, electromagnetic fields). Building up on this the present state of consultation of a directive on optical radiation is represented, including major points of consideration. (orig.)
Bansal, Sangeeta; Katyal, Deeksha; Saluja, Ridhi; Chakraborty, Monojit; Garg, J. K.
2018-02-01
Temperature and area fluctuations in wetlands greatly influence its various physico-chemical characteristics, nutrients dynamic, rates of biomass generation and decomposition, floral and faunal composition which in turn influence methane (CH4) emission rates. In view of this, the present study attempts to up-scale point CH4 flux from the wetlands of Uttar Pradesh (UP) by modifying two-factor empirical process based CH4 emission model for tropical wetlands by incorporating MODIS derived wetland components viz. wetland areal extent and corresponding temperature factors (Ft). This study further focuses on the utility of remotely sensed temperature response of CH4 emission in terms of Ft. Ft is generated using MODIS land surface temperature products and provides an important semi-empirical input for up-scaling CH4 emissions in wetlands. Results reveal that annual mean Ft values for UP wetlands vary from 0.69 (2010-2011) to 0.71(2011-2012). The total estimated area-wise CH4 emissions from the wetlands of UP varies from 66.47 Gg yr-1with wetland areal extent and Ft value of 2564.04 km2 and 0.69 respectively in 2010-2011 to 88.39 Gg yr-1with wetland areal extent and Ft value of 2720.16 km2 and 0.71 respectively in 2011-2012. Temporal analysis of estimated CH4 emissions showed that in monsoon season estimated CH4 emissions are more sensitive to wetland areal extent while in summer season sensitivity of estimated CH4 emissions is chiefly controlled by augmented methanogenic activities at high wetland surface temperatures.
Directory of Open Access Journals (Sweden)
Hiroaki Murata
2012-06-01
Full Text Available Making several simultaneous measurements with different kinds of sensors at the same location in a solution is difficult because of crosstalk between the sensors. In addition, because the conditions at different locations in plant beds differ, in situ measurements in agriculture need to be done in small localized areas. We have fabricated a multimodal sensor on a small Si chip in which a pH sensor was integrated with electrical conductivity (EC and temperature sensors. An ISFET with a Si3N4 membrane was used for the pH sensor. For the EC sensor, the electrical conductivity between platinum electrodes was measured, and the temperature sensor was a p-n junction diode. These are some of the most important measurements required for controlling the conditions in plant beds. The multimodal sensor can be inserted into a plant bed for in situ monitoring. To confirm the absence of crosstalk between the sensors, we made simultaneous measurements of pH, EC, and temperature of a pH buffer solution in a plant bed. When the solution was diluted with hot or cold water, the real time measurements showed changes to the EC and temperature, but no change in pH. We also demonstrated that our sensor was capable of simultaneous in situ measurements in rock wool without being affected by crosstalk.
Energy Technology Data Exchange (ETDEWEB)
Naejus, R.; Coudert, R.; Lemordant, D. [Laboratoire P.I.M.I.R. EA, Sciences et Techniques, 37 - Tours (France); Willmann, P. [CNES, 31 - Toulouse (France)
1996-12-31
Lithium hexa-fluoro-phosphate LiPF{sub 6} is recommended for the replacement of the toxic LiAsF{sub 6} and the explosive perchlorates (like LiClO{sub 4}) in rechargeable lithium electrochemical generators. The aim of this work is to develop a new method of synthesis of this salt and to check its stability with respect to carbonated solvents: ethylene carbonate (EC), propylene carbonate (PC) and dimethyl-carbonate (DMC) in already optimized EC/DMC and PC/DMC binary mixtures. Two methods using HPF{sub 6} are proposed: the first one uses the direct neutralization of this commercial acid by LiOH in aqueous, alcoholic or acetonitrile environment, while in the second one LiPF{sub 6} is obtained from pyridinium hexa-fluoro-phosphate synthesized from HPF{sub 6} using a new and simple protocol. (J.S.) 24 refs.
Energy Technology Data Exchange (ETDEWEB)
Naejus, R; Coudert, R; Lemordant, D [Laboratoire P.I.M.I.R. EA, Sciences et Techniques, 37 - Tours (France); Willmann, P [CNES, 31 - Toulouse (France)
1997-12-31
Lithium hexa-fluoro-phosphate LiPF{sub 6} is recommended for the replacement of the toxic LiAsF{sub 6} and the explosive perchlorates (like LiClO{sub 4}) in rechargeable lithium electrochemical generators. The aim of this work is to develop a new method of synthesis of this salt and to check its stability with respect to carbonated solvents: ethylene carbonate (EC), propylene carbonate (PC) and dimethyl-carbonate (DMC) in already optimized EC/DMC and PC/DMC binary mixtures. Two methods using HPF{sub 6} are proposed: the first one uses the direct neutralization of this commercial acid by LiOH in aqueous, alcoholic or acetonitrile environment, while in the second one LiPF{sub 6} is obtained from pyridinium hexa-fluoro-phosphate synthesized from HPF{sub 6} using a new and simple protocol. (J.S.) 24 refs.
Activities of the Sofia EC Energy Center in the framework of the THERMIE programme
International Nuclear Information System (INIS)
Latinski, K.
1993-01-01
The European Community Energy Center in Sofia is responsible for the EC implementation of the THERMIE programme. The programme's activities are promotion and dissemination of existing European technologies leading to better energy management and covering the fields of rational use of hydrocarbons, solid fuels and renewable energy sources. Application of these technologies would lead to substantial energy savings resulting in significant financial and environmental benefits. During its one-year operation the EC Energy Centre has organized and performed specific action as energy audits (food and beverage industrial units and buildings), demonstration projects (local heating control in buildings, diesel engine regulation of buses), training courses and seminars (in energy management and in space heating measuring and regulation), workshops (energy conservation in buildings, the bricks and clays sector and the food and beverage sector) and studies (wind energy potential, 'clean' coal technologies potential). Some of these actions have had very encouraging results showing potential energy savings of the order of 10-20% just by application of simple measures and with small additional investment. The activities of the EC Energy Centre in the coming year aimed at electricity savings along the entire line of electricity generation, transmission and consumption are outlined. (author)
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 6, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 122 ... Query: 26 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLDLKIRVTGGGQVAQAYAI 85 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRV...TGGGQVAQAYAI Sbjct: 1 ... LQRRKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLDLKIRVTGGGQVAQAYAI 60 ... Query: 146 YR 147 ... YR Sbjct: 121 YR 122
Sangeetha, M.; Mallikarjun, A.; Jaipal Reddy, M.; Siva Kumar, J.
2017-08-01
In the present paper; the FTIR and Temperature dependent DC Ionic conductivity studies of polymer (80 Wt% PVDF-HFP) with inorganic lithium tetra fluoroborate salt (20 Wt% LiBF4) as ionic charge carrier and plasticized with various weight ratios of Ethylene carbonate plasticizer (10 Wt% to 70 Wt% EC) as gel polymer electrolytes. Solution casting method is used for the preparation of plasticized polymer-salt electrolyte films. FTIR analysis shows the good complexation between PVDF-HFP: LiBF4 and the presence of functional groups in the plasticized polymer-salt electrolyte membrane. Also the analysis and results show that the highest DC ionic conductivity of 1.66 × 10-3 SCm -1 was found at 373 K for a particular concentration of 80 Wt% PVDF-HFP: 20 Wt% LiBF4: 40 Wt% EC porous gel type polymer-salt plasticized porous membrane. Increase of temperature results expansion and segmental motion of polymer chain that generates free volume in turn promotes hopping of the lithium ions satisfying Vogel-Tammann-Fulcher equation.
PTP1B inhibitor promotes endothelial cell motility by activating the DOCK180/Rac1 pathway.
Wang, Yuan; Yan, Feng; Ye, Qing; Wu, Xiao; Jiang, Fan
2016-04-07
Promoting endothelial cell (EC) migration is important not only for therapeutic angiogenesis, but also for accelerating re-endothelialization after vessel injury. Several recent studies have shown that inhibition of protein tyrosine phosphatase 1B (PTP1B) may promote EC migration and angiogenesis by enhancing the vascular endothelial growth factor receptor-2 (VEGFR2) signalling. In the present study, we demonstrated that PTP1B inhibitor could promote EC adhesion, spreading and migration, which were abolished by the inhibitor of Rac1 but not RhoA GTPase. PTP1B inhibitor significantly increased phosphorylation of p130Cas, and the interactions among p130Cas, Crk and DOCK180; whereas the phosphorylation levels of focal adhesion kinase, Src, paxillin, or Vav2 were unchanged. Gene silencing of DOCK180, but not Vav2, abrogated the effects of PTP1B inhibitor on EC motility. The effects of PTP1B inhibitor on EC motility and p130Cas/DOCK180 activation persisted in the presence of the VEGFR2 antagonist. In conclusion, we suggest that stimulation of the DOCK180 pathway represents an alternative mechanism of PTP1B inhibitor-stimulated EC motility, which does not require concomitant VEGFR2 activation as a prerequisite. Therefore, PTP1B inhibitor may be a useful therapeutic strategy for promoting EC migration in cardiovascular patients in which the VEGF/VEGFR functions are compromised.
Analysis of Well ER-EC-2a Testing, Western Pahute Mesa-Oasis Valley FY 2000 Testing Program
Energy Technology Data Exchange (ETDEWEB)
None
2002-09-30
This report documents the analysis of the data collected for Well ER-EC-2a during the Western Pahute Mesa - Oasis Valley (WPM-OV) well development and testing program that was conducted during fiscal year (FY) 2000. The data collection for that program is documented in Appendix A, Western Pahute Mesa - Oasis Valley, Well ER-EC-2a Data Report for Development and Hydraulic Testing.
Directory of Open Access Journals (Sweden)
H. M. N. Iqbal
2015-09-01
Full Text Available We have developed novel composites by grafting caffeic acid (CA onto the P(3HB-EC based material and laccase from Trametes versicolor was used for grafting purposes. The resulting composites were designated as CA-g-P(3HB-EC i.e., P(3HB-EC (control, 5CA-g-P(3HB-EC, 10CA-g-P(3HB-EC, 15CA-g-P(3HB-EC and 20CA-g-P(3HB-EC. FT-IR (Fourier-transform infrared spectroscopy was used to examine the functional and elemental groups of the control and laccase-assisted graft composites. Evidently, 15CA-g-P(3HB-EC composite exhibited resilient antibacterial activity against Gram-positive and Gram-negative bacterial strains. Moreover, a significant level of biocompatibility and biodegradability of the CA-g-P(3HB-EC composites was also achieved with the human keratinocytes-like HaCaT cells and soil burial evaluation, respectively. In conclusion, the newly developed novel composites with multi characteristics could well represent the new wave of biomaterials for medical applications, and more specifically have promising future in the infection free would dressings, burn and/or skin regeneration field due to their sophisticated characteristics.
International Nuclear Information System (INIS)
Szidat, S.; Jenk, T.M.; Gaeggeler, H.W.; Synal, H.-A.; Hajdas, I.; Bonani, G.; Saurer, M.
2004-01-01
Measurements of 14 C in the organic carbon (OC) and elemental carbon (EC) fractions, respectively, of fine aerosol particles bear the potential to apportion anthropogenic and biogenic emission sources. For this purpose, the system THEODORE (two-step heating system for the EC/OC determination of radiocarbon in the environment) was developed. In this device, OC and EC are transformed into carbon dioxide in a stream of oxygen at 340 and 650 deg. C, respectively, and reduced to filamentous carbon. This is the target material for subsequent accelerator mass spectrometry (AMS) 14 C measurements, which were performed on sub-milligram carbon samples at the PSI/ETH compact 500 kV AMS system. Quality assurance measurements of SRM 1649a, Urban Dust, yielded a fraction of modern f M in total carbon (TC) of 0.522 ± 0.018 (n=5, 95% confidence level) in agreement with reported values. The results for OC and EC are 0.70 ± 0.05 (n=3) and 0.066 ± 0.020 (n=4), respectively
Combgap Promotes Ovarian Niche Development and Chromatin Association of EcR-Binding Regions in BR-C.
Hitrik, Anna; Popliker, Malka; Gancz, Dana; Mukamel, Zohar; Lifshitz, Aviezer; Schwartzman, Omer; Tanay, Amos; Gilboa, Lilach
2016-11-01
The development of niches for tissue-specific stem cells is an important aspect of stem cell biology. Determination of niche size and niche numbers during organogenesis involves precise control of gene expression. How this is achieved in the context of a complex chromatin landscape is largely unknown. Here we show that the nuclear protein Combgap (Cg) supports correct ovarian niche formation in Drosophila by controlling ecdysone-Receptor (EcR)- mediated transcription and long-range chromatin contacts in the broad locus (BR-C). Both cg and BR-C promote ovarian growth and the development of niches for germ line stem cells. BR-C levels were lower when Combgap was either reduced or over-expressed, indicating an intricate regulation of the BR-C locus by Combgap. Polytene chromosome stains showed that Cg co-localizes with EcR, the major regulator of BR-C, at the BR-C locus and that EcR binding to chromatin was sensitive to changes in Cg levels. Proximity ligation assay indicated that the two proteins could reside in the same complex. Finally, chromatin conformation analysis revealed that EcR-bound regions within BR-C, which span ~30 KBs, contacted each other. Significantly, these contacts were stabilized in an ecdysone- and Combgap-dependent manner. Together, these results highlight Combgap as a novel regulator of chromatin structure that promotes transcription of ecdysone target genes and ovarian niche formation.
Energy Technology Data Exchange (ETDEWEB)
Brand, E. [Universitaet Lueneburg, Lueneburg (Germany); Witthohn, A. [IHK Hannover (Germany)
2002-04-01
This contribution examines the legal basis of authorization and the scope of action of the European legislator with respect to legislation on the energy policy of the EC. The analysis starts with summarising the evolution of the primary law, looking inter alia at the constitutent treaties of the ECSC, EURATOM, and the EEC, and discusses further developments and treaties, as there is no specific, uniform basis of legislative power of the EC in the energy sector of EC. Subsequently, the basis for and secondary law making is discussed, the concluding part of the article giving an outlook on the future. (orig./CB) [German] Zentrale Frage des folgenden Beitrags ist, woraus der europaeische Gesetzgeber seine Kompetenz im Energiebereich ableitet und wie weit seine Regelungen in dem Bereich gehen duerfen. Um diese Fragen zu beantworten, wird zunaechst die Entwicklung des europaeischen Primaerrechts bzw. der Gruendungsvertraege im Energiebereich beleuchtet und werden die einschlaegigen Ermaechtigungsgrundlagen dargestellt. Im Anschluss daran stehen dann die wichtigsten sekundaerrechtlichen Regelungen im Mittelpunkt. Abschliessend wird ein Ausblick auf die weitere Entwicklung gegeben. (orig./CB)
Risk assesment in the context of EC directives on genetically modified organisms
Energy Technology Data Exchange (ETDEWEB)
Meer, P.J. van der [Ministry for the Environment (Netherlands)
1992-07-01
The introduction of these new molecular technologies initiated an international discussion on the safety in biotechnology. In 1974 one of the pioneers of this new technology, Paul Berg, expressed his view on the potential risks of recombinant DNA applications in the famous 'Berg letter', leading to a self-imposed moratorium on certain experiments. Following the Berg letter and the Asilomar convention, much international attention has been given to the question of safety in biotechnology. This attention resulted in hundreds of documents, research programmes, guidelines and regulations. This resulted, among others, in two EC Directives on genetically modified organisms: the EC Directive 90/219/EEC on the contained use of genetically modified micro-organisms, and Directive 90/220/EEC on the release of genetically modified organisms. These directives lay down a system for harmonization of risk assessment and risk management with regard to the safety for human health and the environment.
Risk assesment in the context of EC directives on genetically modified organisms
International Nuclear Information System (INIS)
Meer, P.J. van der
1992-01-01
The introduction of these new molecular technologies initiated an international discussion on the safety in biotechnology. In 1974 one of the pioneers of this new technology, Paul Berg, expressed his view on the potential risks of recombinant DNA applications in the famous 'Berg letter', leading to a self-imposed moratorium on certain experiments. Following the Berg letter and the Asilomar convention, much international attention has been given to the question of safety in biotechnology. This attention resulted in hundreds of documents, research programmes, guidelines and regulations. This resulted, among others, in two EC Directives on genetically modified organisms: the EC Directive 90/219/EEC on the contained use of genetically modified micro-organisms, and Directive 90/220/EEC on the release of genetically modified organisms. These directives lay down a system for harmonization of risk assessment and risk management with regard to the safety for human health and the environment
Barras, F; Chatterjee, A K
1987-10-01
In Erwinia chrysanthemi (EC16) the clustered pelA and pelE genes encode an acidic (pI 4.2) and a basic (pI 10.0) pectate lyase (Pel), respectively. The pelA gene has been isolated on a 1.2 kb restriction fragment and the direction of transcription determined. DNA hybridization analysis showed that the pelE sequence shares DNA homology with pelA but not with pelB or pelC, two genes encoding other Pel species in EC16. Since Pel A and Pel E enzymes showed little similarity in terms of catalytic properties, it is proposed that pelA and pelE are duplicates which have highly diverged.
GSTP1 A>G polymorphism and chemosensitivity of osteosarcoma: A meta-analysis
Directory of Open Access Journals (Sweden)
Fengfeng Wu
2016-01-01
Full Text Available The association between GSTP1 A>G polymorphism and chemosensitivity of osteosarcoma is controversial according to previously published studies. We conducted this meta-analysis to further investigate the role of GSTP1 A>G genetic variation in response to chemotherapy resistance in patients with osteosarcoma. Using the electronic databases of Pubmed, Wanfang and CNIK were searched to find the studies related to the GSTP1 A>G polymorphism and chemosensitivity of osteosarcoma. The genotype of AA, AG and GG were extracted from the chemotherapy sensitivity and chemotherapy resistance group. The association between GSTP1 A>G polymorphism and chemosensitivity was calculated by STATA11.0 software. The correlation between GSTP1 A>G polymorphism and chemotherapy response was assessed by odds ratio (OR and its 95% confidence interval (95%CI. Four studies with 681 cases were finally included in this meta-analysis. The pooled data indicated that there was no significant association between GSTP1 A>G polymorphism and chemosensitivity in patients with osteosarcoma [Homozygous genetic model (GG vs AA: OR=0.53, 95%CI: 0.25-1.12, P=0.10; recessive genetic model (GG vs GA+AA: OR=0.61, 95%CI:0.34-1.11,P=0.11; and dominant genetic model (GG+AG vs AA: OR=0.67, 95%CI:0.42-1.07,P=0.10]. No correlation between GSTP1 A>G polymorphism and chemosensitivity was found according to this present meta-analysis. However, the small number of cases in each included study and significant statistical heterogeneity among the trials means the conclusion should be regarded as conservative.
Agricultural price and income policy in the EC : alternative policies and their implications
Meester, G.
1980-01-01
Alternative forms of income policy without direct supply control. Alternative forms of income policy with direct supply control: quota arrangements. The influence of EC policy on the world market prices of agricultural produce
Energy Technology Data Exchange (ETDEWEB)
Grant, R. F. (Dept. of Renewable Resources, Univ. of Alberta, Edmonton, (Canada)), e-mail: robert.grant@ales.ualberta.ca; Barr, A. G. (Climate Research Branch, Meteorological Service of Canada, Saskatoon (Canada)); Black, T. A. (Faculty of Land and Food Systems, Univ. of British Columbia, Vancouver BC, (Canada)); Margolis, H. A. (Faculte de Foresterie et de Geomatique, Pavillon Abitibi-Price, Universite Laval, Quebec (Canada)); McCaughey, J. H. (Dept. of Geography, Queen' s Univ., Kingston (Canada)); Trofymow, J. A. (Canadian Forest Service, Pacific Forestry Centre, Victoria (Canada))
2010-11-15
Clearcutting strongly affects subsequent forest net ecosystem productivity (NEP). Hypotheses for ecological controls on NEP in the ecosystem model ecosys were tested with CO{sub 2} fluxes measured by eddy covariance (EC) in three post clearcut conifer chronosequences in different ecological zones across Canada. In the model, microbial colonization of postharvest fine and woody debris drove heterotrophic respiration (Rh), and hence decomposition, microbial growth, N mineralization and asymbiotic N{sub 2} fixation. These processes controlled root N uptake, and thereby CO{sub 2} fixation in regrowing vegetation. Interactions among soil and plant processes allowed the model to simulate hourly CO{sub 2} fluxes and annual NEP within the uncertainty of EC measurements from 2003 to 2007 over forest stands from 1 to 80 yr of age in all three chronosequences without site- or species-specific parameterization. The model was then used to study the impacts of increasing harvest removals on subsequent C stocks at one of the chronosequence sites. Model results indicated that increasing harvest removals would hasten recovery of NEP during the first 30 yr after clearcutting, but would reduce ecosystem C stocks by about 15% of the increased removals at the end of an 80-yr harvest cycle
SIPSMetGen: It's Not Just For Aircraft Data and ECS Anymore.
Schwab, M.
2015-12-01
The SIPSMetGen utility, developed for the NASA EOSDIS project, under the EED contract, simplified the creation of file level metadata for the ECS System. The utility has been enhanced for ease of use, efficiency, speed and increased flexibility. The SIPSMetGen utility was originally created as a means of generating file level spatial metadata for Operation IceBridge. The first version created only ODL metadata, specific for ingest into ECS. The core strength of the utility was, and continues to be, its ability to take complex shapes and patterns of data collection point clouds from aircraft flights and simplify them to a relatively simple concave hull geo-polygon. It has been found to be a useful and easy to use tool for creating file level metadata for many other missions, both aircraft and satellite. While the original version was useful it had its limitations. In 2014 Raytheon was tasked to make enhancements to SIPSMetGen, this resulted a new version of SIPSMetGen which can create ISO Compliant XML metadata; provides optimization and streamlining of the algorithm for creating the spatial metadata; a quicker runtime with more consistent results; a utility that can be configured to run multi-threaded on systems with multiple processors. The utility comes with a java based graphical user interface to aid in configuration and running of the utility. The enhanced SIPSMetGen allows more diverse data sets to be archived with file level metadata. The advantage of archiving data with file level metadata is that it makes it easier for data users, and scientists to find relevant data. File level metadata unlocks the power of existing archives and metadata repositories such as ECS and CMR and search and discovery utilities like Reverb and Earth Data Search. Current missions now using SIPSMetGen include: Aquarius, Measures, ARISE, and Nimbus.
PENGARUH FAKTOR PSIKOLOGIS TERHADAP KEPUTUSAN BERKUNJUNG WISATAWAN MICE MELALUI PT. Y&R KE BALI
Ni Putu Masni Nistari; I Putu Sudana; I GPB. Sasrawan Mananda
2017-01-01
Tourism is a global industry sectors and potentially to be developed as a source of government income countries and regions. MICE (Meeting, Incentive, Convention and Exhibition) in Indonesia has great potential and is the flagship product of the tourism industry Indonesia. The purpose of this research is to determine the influence of psychological factors toward MICE tourists visiting decision to Bali through PT. Y&R. Sampling technique used in this research is purposive sampling. Sa...
Analysis of the pelE promoter in Erwinia chrysanthemi EC16.
Gold, S; Nishio, S; Tsuyumu, S; Keen, N T
1992-01-01
The pelE gene of Erwinia chrysanthemi strain EC16 encodes an extracellular pectate lyase protein that is important in virulence on plants. Control of pelE expression is complex, because the gene is regulated by catabolite repression, substrate induction, and growth-phase inhibition. A Tn7-lux reporter gene system was employed to define DNA sequences comprising the pelE promoter. When EC16 cells were grown on medium containing sodium polypectate, pelE transcriptional start sites were observed only at 95 and 96 bases upstream of the translational start site. However, DNA sequences required for pelE expression were also shown by deletion analysis to reside between 196 and 215 base pairs upstream of the translational start site. In addition to these upstream elements, two putative operator sequences that interact with negative regulatory factors occurred downstream of the transcriptional start. Finally, deletion of three bases from a putative catabolite gene activator protein binding site in the pelE promoter eliminated activity. The data demonstrate that the pelE promoter is complex and suggest that it interacts with several regulatory proteins.
Electrosynthesis of Clozapine Drug Derivative via an EC Electrochemical Mechanism
Directory of Open Access Journals (Sweden)
Esmail Tammari
2017-12-01
Full Text Available The fact that oxidation, as one of the main routes of phase I metabolism of drugs, follows by conjugation reactions, and also formation of nitrenium ion as one of the clozapine oxidation products, directed us to investigate the oxidation of clozapine (CLZ in the presence of nucleophile. The oxidation of clozapine (CLZ has been studied on a glassy carbon electrode in the absence and presence of 2-thiobarbituric acid (TBA as nucleophile in aqueous medium by means of cyclic voltammetry and on the graphite rods in controlled-potential coulometry. Cyclic voltammetry studies were realized for CLZ in the pHs 1.0 to 8.0. Results indicate that the electrochemical behavior of CLZ depends on the pH. Based on the obtained electrochemical results, an ECE mechanism was proposed to explain the electrochemical oxidation of CLZ. The results revealed that oxidized CLZ participates in Michael type addition reaction with TBA and via an EC mechanism converts to the corresponding new dibenzodiazepin derivatives. The product has been characterized by IR, 1H NMR, 13C NMR and MS.
Weller, Rolf; Wagenbach, Dietmar; Legrand, Michel; Elsässer, Christoph; Tian-Kunze, Xiangshan; König-Langlo, Gert
2011-01-01
The aerosol climatology at the coastal Antarctic Neumayer Station (NM) was investigated based on continuous, 25-yr long observations of biogenic sulphur components (methanesulfonate and non–sea salt sulphate), sea salt and nitrate. Although significant long-term trends could only be detected for nitrate (−3.6 ± 2.5% per year between 1983 and 1993 and +4.0 ± 3.2% per year from 1993–2007), non-harmonic periodicities between 2 and 5 yr were typical for all species. Dedicated time series analyses...
Cartwright, I.; Gilfedder, B.; Hofmann, H.
2013-05-01
This study compares geochemical and physical methods of estimating baseflow in the upper reaches of the Barwon River, southeast Australia. Estimates of baseflow from physical techniques such as local minima and recursive digital filters are higher than those based on chemical mass balance using continuous electrical conductivity (EC). Between 2001 and 2011 the baseflow flux calculated using chemical mass balance is between 1.8 × 103 and 1.5 × 104 ML yr-1 (15 to 25% of the total discharge in any one year) whereas recursive digital filters yield baseflow fluxes of 3.6 × 103 to 3.8 × 104 ML yr-1 (19 to 52% of discharge) and the local minimum method yields baseflow fluxes of 3.2 × 103 to 2.5 × 104 ML yr-1 (13 to 44% of discharge). These differences most probably reflect how the different techniques characterise baseflow. Physical methods probably aggregate much of the water from delayed sources as baseflow. However, as many delayed transient water stores (such as bank return flow or floodplain storage) are likely to be geochemically similar to surface runoff, chemical mass balance calculations aggregate them with the surface runoff component. The mismatch between geochemical and physical estimates is greatest following periods of high discharge in winter, implying that these transient stores of water feed the river for several weeks to months. Consistent with these interpretations, modelling of bank storage indicates that bank return flows provide water to the river for several weeks after flood events. EC vs. discharge variations during individual flow events also imply that an inflow of low EC water stored within the banks or on the floodplain occurs as discharge falls. The joint use of physical and geochemical techniques allows a better understanding of the different components of water that contribute to river flow, which is important for the management and protection of water resources.
Artificial intelligence in process control: Knowledge base for the shuttle ECS model
Stiffler, A. Kent
1989-01-01
The general operation of KATE, an artificial intelligence controller, is outlined. A shuttle environmental control system (ECS) demonstration system for KATE is explained. The knowledge base model for this system is derived. An experimental test procedure is given to verify parameters in the model.
EC + LH current drive efficiency in the presence of an internal transport barrier
International Nuclear Information System (INIS)
Rosa, P.R. da S; Ziebell, L.F.
2002-01-01
In this paper we study the effects of the presence of an internal transport barrier (ITB) on the current drive efficiency and power deposition profiles in the case of electron cyclotron waves interacting with an extended tail generated by lower hybrid (LH) waves. We study the subject by numerically solving the Fokker-Planck equation, with temperature and density profiles corrected along the time evolution at each collision time, based on the actual time-evolving electron distribution function. The results obtained show that the LH and electron cyclotron (EC) power absorption profiles and the current driven by the combined action of both types of waves are weakly dependent on the depth of the ITB, slightly more dependent on the level of magnetic turbulence and much more dependent on the level of EC wave power. (author)
Energy Technology Data Exchange (ETDEWEB)
Nakamura, T; Uno, K; Tanimoto, T; Yamashita, T [Osaka Sangyo University, Osaka (Japan). Institute for Industrial Research
1994-11-22
This paper describes progress of the cooperation as to the integration of EC market and the change of industrial structure. For the structural change in the industry and economy accompanied by the integration of EC, effects of the Maastricht Treaty on the economic structure of EC are described. It is considered that the EC countries are affected by the political and economical restrictions due to the agreement of this treaty. For the change in the distribution structure accompanied by the integration of EC, obstruction factors of the deregulation of EC transportation market are especially investigated. Differences in the distribution capacity, various regulations and standards, and labor condition among individual countries are pointed out as the obstruction factors. For the unity of Germany and its economical and administrative influence, various problems are pointed out as to the economical confusion, progress in the de-nationalization of enterprises, management of real estate and land, etc. For the structural change in the road freight market in the member nations of EC, the structure of road freight market is made clear for the previous West Germany before the integration of European market. It is confirmed that the internationalization of the German domestic market is being promoted.
Search for EC-decayed neutron-deficient actinide isotopes using gas-jet coupled JAERI-ISOL
Energy Technology Data Exchange (ETDEWEB)
Tsukada, Kazuaki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1997-07-01
To study the nuclear properties of unknown neutron deficient actinide isotopes which decay mainly via orbital electron capture (EC), we have developed a composite system consisting of a gas-jet transport apparatus and a thermal ion-source at the JAERI-ISOL. With this system, search for {sup 236}Am produced in the {sup 235}U({sup 6}Li, 5n) reaction has been performed. Pu KX-rays associated with the EC decay of {sup 236}Am are observed at the mass-236 fraction. The half-life of {sup 236}Am is evaluated to be 4.4min. The outline of the gas-jet coupled JAERI-ISOL system and typical performance are given. (author)
The long-term impact of urbanization on nitrogen patterns and dynamics in Shanghai, China.
Gu, Baojing; Dong, Xiaoli; Peng, Changhui; Luo, Weidong; Chang, Jie; Ge, Ying
2012-12-01
Urbanization is an important process that alters the regional and global nitrogen biogeochemistry. In this study, we test how long-term urbanization (1952-2004) affects the nitrogen flows, emissions and drivers in the Greater Shanghai Area (GSA) based on the coupled human and natural systems (CHANS) approach. Results show that: (1) total nitrogen input to the GSA increased from 57.7 to 587.9 Gg N yr(-1) during the period 1952-2004, mainly attributing to fossil fuel combustion (43%), Haber-Bosch nitrogen fixation (31%), and food/feed import (26%); (2) per capita nitrogen input increased from 13.5 to 45.7 kg N yr(-1), while per gross domestic product (GDP) nitrogen input reduced from 22.2 to 0.9 g N per Chinese Yuan, decoupling of nitrogen with GDP; (3) emissions of reactive nitrogen to the environment transformed from agriculture dominated to industry and human living dominated, especially for air pollution. This study provides decision-makers a novel view of nitrogen management. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Hammarström Lennart
2007-09-01
Full Text Available Abstract Background Rotavirus is a worldwide cause of infectious infantile diarrhea that claims over 600,000 lives annually. Recently, two new vaccine candidates have been developed but their efficacy in developing countries, still remains to be proven. Oral delivery of specific immunoglobulins provides passive immunity and is a fast acting treatment for rotavirus diarrhea. Probiotic bacteria have also gained considerable attention lately as treatment for rotavirus diarrhea. Here we report an evaluation of the therapeutic potential of different probiotics and their combination with anti – rotavirus antibodies in a mouse model of rotavirus diarrhea. Results Of the six probiotic bacteria tested, Lactobacillus rhamnosus strain GG had the strongest influence in reducing prevalence, duration and severity of diarrhea and was therefore chosen for combination treatment with immunoglobulins. The combination treatment reduced the diarrhea outcome measures significantly, prevented histopathological changes and reduced the virus load in the intestines. Conclusion The advantages associated with immunoglobulins and probiotics based therapy is that the treatment provides a rapid therapeutic effect and is cost efficient. These components do not require special storage conditions and could potentially complement the rehydration therapy that is currently used.
2010-07-01
... Which Construction is Commenced After June 20, 1996 Pt. 60, Subpt. Ec, Table 3 Table 3 to Subpart Ec of... Operating parameters to be monitored Minimum frequency Data measurement Data recording Control system Dry scrubber followed by fabric filter Wet scrubber Dry scrubber followed by fabric filter and wet scrubber...
Conference-EC-US Task Force Joint US-EU Workshop on Metabolomics and Environmental Biotechnology
Energy Technology Data Exchange (ETDEWEB)
PI: Lily Y. Young
2009-06-04
Since 1990, the EC-US Task Force on Biotechnology Research has been coordinating transatlantic efforts to guide and exploit the ongoing revolution in biotechnology and the life sciences. The Task Force was established in June 1990 by the European Commission and the White House Office of Science and Technology Policy. The Task Force has acted as an effective forum for discussion, coordination, and development of new ideas for the last 18 years. Task Force members are European Commission and US Government science and technology administrators who meet annually to enhance communication across the Atlantic, and to encourage collaborative research. Through sponsoring workshops, and other activities, the Task Force also brings together scientific leaders and early career researchers from both sides of the Atlantic to forecast research challenges and opportunities and to promote better links between researchers. Over the years, by keeping a focus on the future of science, the Task Force has played a key role in establishing a diverse range of emerging scientific fields, including biodiversity research, neuroinformatics, genomics, nanobiotechnology, neonatal immunology, transkingdom molecular biology, biologically-based fuels, and environmental biotechnology. The EC-US Task Force has sponsored a number of Working Groups on topics of mutual transatlantic interest. The idea to create a Working Group on Environmental Biotechnology research was discussed in the Task Force meeting of October 1993. The EC-US Working Group on Environmental Biotechnology set as its mission 'To train the next generation of leaders in environmental biotechnology in the United States and the European Union to work collaboratively across the Atlantic.' Since 1995, the Working Group supported three kinds of activities, all of which focus one early career scientists: (1) Workshops on the use of molecular methods and genomics in environmental biotechnology; (2) Short courses with theoretical
Szatkowski, George N.; Dudley, Kenneth L.; Smith, Laura J.; Wang, Chuantong; Ticatch, Larry A.
2014-01-01
Traditional methods to protect composite aircraft from lightning strike damage rely on a conductive layer embedded on or within the surface of the aircraft composite skin. This method is effective at preventing major direct effect damage and minimizes indirect effects to aircraft systems from lightning strike attachment, but provides no additional benefit for the added parasitic weight from the conductive layer. When a known lightning strike occurs, the points of attachment and detachment on the aircraft surface are visually inspected and checked for damage by maintenance personnel to ensure continued safe flight operations. A new multi-functional lightning strike protection (LSP) method has been developed to provide aircraft lightning strike protection, damage detection and diagnosis for composite aircraft surfaces. The method incorporates a SansEC sensor array on the aircraft exterior surfaces forming a "Smart skin" surface for aircraft lightning zones certified to withstand strikes up to 100 kiloamperes peak current. SansEC sensors are open-circuit devices comprised of conductive trace spiral patterns sans (without) electrical connections. The SansEC sensor is an electromagnetic resonator having specific resonant parameters (frequency, amplitude, bandwidth & phase) which when electromagnetically coupled with a composite substrate will indicate the electrical impedance of the composite through a change in its resonant response. Any measureable shift in the resonant characteristics can be an indication of damage to the composite caused by a lightning strike or from other means. The SansEC sensor method is intended to diagnose damage for both in-situ health monitoring or ground inspections. In this paper, the theoretical mathematical framework is established for the use of open circuit sensors to perform damage detection and diagnosis on carbon fiber composites. Both computational and experimental analyses were conducted to validate this new method and system for
Wang, Jianjun; Sun, Liguang; Chen, Liqi; Xu, Libin; Wang, Yuhong; Wang, Xinming
2016-06-10
Extreme climatic events have profound impacts on human society. Here we present the results of a study of organic biomarkers within a sedimentary section at the archaeological site of Yuchisi, eastern China, in order to reconstruct climatic variability during the Dawenkou (5,050-4,400 yr BP) and Longshan (4,400-4,000 yr BP) cultures. At ~4,400 yr BP, within the cultural transition horizon, abrupt changes in biomarkers, such as the fatty acid ratio C18:2/C18:0, 2C31/(C27 + C29), n-C18-ol and n-C30-ol, indicate the occurrence of local climate changes over the course of a few decades. These changes occurred during the transition from the Holocene warm period to a subsequent cold period which lasted for the following 600 years. This climatic shift has been recorded at numerous sites worldwide, and it is likely to have been the main cause of the widespread collapse of many isolated cultures at that time. The palaeoclimatic and archaeological data from the Yuchisi sediments may provide new insights into the relationship between climate change and prehistoric cultural transitions.
Directory of Open Access Journals (Sweden)
Wouter-Jan Berends
2010-08-01
Full Text Available Public procurement procedures in the EU are coordinated by Directives 2004/17/EC and 2004/18/EC. The acquis communautaire provides minimum requirements for review procedures against public procurement decisions in order to ensure access to effective remedies for economic operators. These minimum requirements are established in Directives 89/665/ EEC and 92/13/EEC and recently amended by Directive 2007/66/EC. The Helby report identified several substantive concerns over the Dutch proposal on the implementation the of the Remedies Directive; Wet implementatie rechtsbeschermingsrichtlijnen. Although the transposition target date has not been met, the Dutch legislature has succeeded to transpose Directive 2007/66/EC into Dutch law while addressing the concerns of the Helby report.
Matar, A; Kihlbom, U; Höglund, A T
2016-07-01
Reproductive autonomy, medicalization, and discrimination against disabled and parental responsibility are the main ongoing ethical debates concerning reproductive genetic screening. To examine Swedish healthcare professionals' views on preconception expanded carrier screening (ECS), a qualitative study involving academic and clinical institutions in Sweden was conducted in September 2014 to February 2015. Eleven healthcare professionals including clinicians, geneticists, a midwife, and a genetic counselor were interviewed in depth using a semi-structured interview guide. The questionnaire was constructed after reviewing the main literature and meetings with relevant healthcare providers. The interviews were recorded, transcribed verbatim, and content analyzed for categories and subcategories. Participants nurtured many ethical and non-ethical concerns regarding preconception ECS. Among the ethical concerns were the potential for discrimination, medicalization, concerns with prioritization of healthcare resources, and effects on reproductive freedom. The effects of implementation of preconception ECS, its stakeholders, regulations, and motivation are some of non-ethical concerns. These concerns, if not addressed, may affect the uptake and usage of carrier screening within Swedish healthcare system. As this is a qualitative study with a small non-random sample size, the findings cannot be generalized. The participants had little to no working experience with expanded screening panels. Moreover, the interviews were conducted in English, a second language for the participants, which might have limited the expression of their views. However, the authors claim that the findings may be pertinent to similar settings in other Scandinavian countries.
International Nuclear Information System (INIS)
Haffty, Bruce G.; Goyal, Sharad; Kulkarni, Diptee; Green, Camille; Vazquez, Alexi; Schiff, Devora; Moran, Meena S.; Yang Qifeng; Ganesan, Shridar; Hirsfield, Kim M.
2011-01-01
Purpose: TP53BP1 is a key component of radiation-induced deoxyribonucleic acid damage repair. The purpose of this study was to evaluate the significance of a known common single nucleotide polymorphism in this gene (rs560191) in patients treated with breast-conserving surgery and whole-breast irradiation (BCS + RT). Methods and Materials: The population consisted of 176 premenopausal women treated with BCS + RT (median follow-up, 12 years). Genomic deoxyribonucleic acid was processed by use of TaqMan assays. Each allele for rs560191 was either C or G, so each patient was therefore classified as CC, CG, or GG. Patients were grouped as GG if they were homozygous for the variant G allele or CC-CG if they carried at least one copy of the common C allele (CC or CG). Results: Of the 176 women, 124 (71%) were CC-CG and 52 (29%) were GG. The mean age was 44 years for GG vs. 38 years for CC-CG (p < 0.001). GG was more common in African-American women than white women (69% vs. 13%, p < 0.001) and more commonly estrogen receptor negative (70% vs. 49%, p = 0.02). There were no significant correlations of rs560191 with other critical variables. Despite the fact that GG patients were older, the 10-year rate of local relapses was higher (22% for GG vs. 12% for CC-CG, p = 0.04). Conclusions: This novel avenue of investigation of polymorphisms in radiation repair/response genes in patients treated with BCS + RT suggests a correlation to local relapse. Additional evaluation is needed to assess the biological and functional significance of these single nucleotide polymorphisms, and larger confirmatory validation studies will be required to determine the clinical implications.