WorldWideScience

Sample records for german cockroach involves

  1. De novo transcriptome of the Hemimetabolous German cockroach (Blattella germanica.

    Directory of Open Access Journals (Sweden)

    Xiaojie Zhou

    Full Text Available BACKGROUND: The German cockroach, Blattella germanica, is an important insect pest that transmits various pathogens mechanically and causes severe allergic diseases. This insect has long served as a model system for studies of insect biology, physiology and ecology. However, the lack of genome or transcriptome information heavily hinder our further understanding about the German cockroach in every aspect at a molecular level and on a genome-wide scale. To explore the transcriptome and identify unique sequences of interest, we subjected the B. germanica transcriptome to massively parallel pyrosequencing and generated the first reference transcriptome for B. germanica. METHODOLOGY/PRINCIPAL FINDINGS: A total of 1,365,609 raw reads with an average length of 529 bp were generated via pyrosequencing the mixed cDNA library from different life stages of German cockroach including maturing oothecae, nymphs, adult females and males. The raw reads were de novo assembled to 48,800 contigs and 3,961 singletons with high-quality unique sequences. These sequences were annotated and classified functionally in terms of BLAST, GO and KEGG, and the genes putatively coding detoxification enzyme systems, insecticide targets, key components in systematic RNA interference, immunity and chemoreception pathways were identified. A total of 3,601 SSRs (Simple Sequence Repeats loci were also predicted. CONCLUSIONS/SIGNIFICANCE: The whole transcriptome pyrosequencing data from this study provides a usable genetic resource for future identification of potential functional genes involved in various biological processes.

  2. Energetic Cost of Subacute Chlorpyrifos Intoxication in the German Cockroach (Dictyoptera: Blattellidae)

    DEFF Research Database (Denmark)

    Nielsen, Søren Achim; Jensen, Karl-Martin Vagn; Kristensen, Michael

    2006-01-01

    The energetic cost of a sublethal treatment with chlorpyrifos was estimated by use of direct microcalorimetry to measure metabolic heat in susceptible and resistant strains of the German cockroach Blattella germanica L. Moreover, one of the detoxifcation enzyme systems known to be involved in det...

  3. Gut bacteria mediate aggregation in the German cockroach

    Science.gov (United States)

    Wada-Katsumata, Ayako; Zurek, Ludek; Nalyanya, Godfrey; Roelofs, Wendell L.; Zhang, Aijun; Schal, Coby

    2015-01-01

    Aggregation of the German cockroach, Blattella germanica, is regulated by fecal aggregation agents (pheromones), including volatile carboxylic acids (VCAs). We demonstrate that the gut microbial community contributes to production of these semiochemicals. Chemical analysis of the fecal extract of B. germanica revealed 40 VCAs. Feces from axenic cockroaches (no microorganisms in the alimentary tract) lacked 12 major fecal VCAs, and 24 of the remaining compounds were represented at extremely low amounts. Olfactory and aggregation bioassays demonstrated that nymphs strongly preferred the extract of control feces over the fecal extract of axenic cockroaches. Additionally, nymphs preferred a synthetic blend of 6 fecal VCAs over a solvent control or a previously identified VCA blend. To test whether gut bacteria contribute to the production of fecal aggregation agents, fecal aerobic bacteria were cultured, isolated, and identified. Inoculation of axenic cockroaches with individual bacterial taxa significantly rescued the aggregation response to the fecal extract, and inoculation with a mix of six bacterial isolates was more effective than with single isolates. The results indicate that the commensal gut microbiota contributes to production of VCAs that act as fecal aggregation agents and that cockroaches discriminate among the complex odors that emanate from a diverse microbial community. Our results highlight the pivotal role of gut bacteria in mediating insect–insect communication. Moreover, because the gut microbial community reflects the local environment, local plasticity in fecal aggregation pheromones enables colony-specific odors and fidelity to persistent aggregation sites. PMID:26644557

  4. Horizontal transfer of bait in the German cockroach: indoxacarb causes secondary and tertiary mortality.

    Science.gov (United States)

    Buczkowski, Grzegorz; Scherer, Clay W; Bennett, Gary W

    2008-06-01

    Horizontal transfer of indoxacarb in the German cockroach, Blattella germanica (L.), was examined under laboratory conditions. Results show that a single bait-fed adult cockroach (i.e., the donor) transferred indoxacarb to numerous primary recipients (secondary mortality),which then became secondary donors. These recipients subsequently became donors to other cockroaches and caused significant mortality in other members of the aggregation, resulting in tertiary kill. Indoxacarb was effectively transferred among adult cockroaches and resulted in significant secondary mortality. When adult males served as donors and vectored the insecticide to adult males, the donor:recipient ratio affected the mortality of the recipients and the rate of secondary mortality increased with increasing the ratio of donors to recipients. Furthermore, secondary mortality in the untreated cockroaches was significantly affected by the freshness of excretions from the donors, the presence of alternative food, and the duration of contact between the donors and the recipients. Ingested indoxacarb was most effectively translocated when the recipients interacted with freshly symptomatic donors in the absence of alternative food. The transfer of indoxacarb continued beyond secondary mortality and resulted in significant tertiary mortality. Excretions from a single bait-fed adult killed 38/50 (76%) nymphs within 72 h. The dead nymphs then vectored indoxacarb to 20 adult males and killed 16/20 (81%) recipients within 72 h. Behavioral mechanisms involved in the horizontal transfer of indoxacarb may include: contact with excretions, necrophagy, emetophagy, and ingestion of other excretions that originate from the donors.

  5. Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits

    Directory of Open Access Journals (Sweden)

    H Nasirian

    2008-08-01

    Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with re­sidual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran. Methods:  The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method. Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduc­tion in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in compari­son to control area. After 60 days, German cockroaches eliminated completely from these areas. Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cock­roach infested after insecticide spraying control failure German cockroach infested fields where spraying  of pyrethroid insecticides failed to control the situation and confirm previous  reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.

  6. Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits

    Directory of Open Access Journals (Sweden)

    H Nasirian

    2008-06-01

    Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with re­sidual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran.Methods:  The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method.Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduc­tion in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in compari­son to control area. After 60 days, German cockroaches eliminated completely from these areas.Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cock­roach infested after insecticide spraying control failure German cockroach infested fields where spraying  of pyrethroid insecticides failed to control the situation and confirm previous  reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.

  7. Repellent Activity of Apiaceae Plant Essential Oils and their Constituents Against Adult German Cockroaches.

    Science.gov (United States)

    Lee, Hyo-Rim; Kim, Gil-Hah; Choi, Won-Sil; Park, Il-Kwon

    2017-04-01

    We evaluated the repellent activity of 12 Apiaceae plant essential oils and their components against male and female adult German cockroaches, Blattella germanica L., to find new natural repellents. Of all the plant essential oils tested, ajowan (Trachyspermum ammi Sprague) and dill (Anethum graveolens L.) essential oils showed the most potent repellent activity against male and female adult German cockroaches. Repellent activities of chemicals already identified in active oils were also investigated. Of the compounds identified, carvacrol, thymol, and R-(-)-carvone showed >80% repellent activity against male and female adult German cockroaches at 2.5 µg/cm2. S-(+)-Carvone, (+)-dihydrocarvone, and terpinen-4-ol showed >70% repellent activity against male and female adult German cockroaches at 10 µg/cm2. Our results indicated that Apiaceae plant essential oils and their constituents have good potential as natural repellents against adult German cockroaches. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Evaluation of Five Local Formulated Insecticides against German Cockroach (Blattella germanica L. in Southern Iran

    Directory of Open Access Journals (Sweden)

    M Shahi

    2008-06-01

    Full Text Available Background: The German cockroach, Blattella germanica L., is a serious household and public health pest worldwide. Con­trol of this species has been very difficult to achieve. Toxicity of cypermethrin EC10%, deltamethrin EC5%, diazi­non EC0.5%, lambda-cyhalothrin EC5% and Negon® (permethrin+propoxur oil liquid1% commercial for­mula­tions were investigated against adult males of German cockroaches collected from four hospitals of Bandar Abbas City, southern Iran, during 2006. These insecticides have been used for cockroach con­trol in this city.Methods: The tests were carried out only on males by the glass jar contact method recommended by the WHO.Results: Maximum mortality rates of 20, 35, 90, and 100% were obtained after one hour contact to label-recom­mended doses of cypermethrin, deltamethrin, lambad-cyhalothrin, diazinon and permethrin+propoxur insecti­cides, respectively. KT50 results were different from 5.68 min for permethrin+propoxur mixture to 240.37 min for cyper­methrin. German cockroach showed < 80 per cent mortality using three pyrethroid insecticides.Conclusion: It seems that the label-recommended concentrations of these insecticides were wrong and lower than WHO advised for cockroach control. For monitoring of resistance it is recommended to do more tests using the pure ac­tive ingredient of these insecticides.

  9. Evaluation of Five Local Formulated Insecticides against German Cockroach (Blattella germanica L. in Southern Iran

    Directory of Open Access Journals (Sweden)

    M Shahi

    2008-08-01

    Full Text Available Background: The German cockroach, Blattella germanica L., is a serious household and public health pest worldwide. Con­trol of this species has been very difficult to achieve. Toxicity of cypermethrin EC10%, deltamethrin EC5%, diazi­non EC0.5%, lambda-cyhalothrin EC5% and Negon® (permethrin+propoxur oil liquid1% commercial for­mula­tions were investigated against adult males of German cockroaches collected from four hospitals of Bandar Abbas City, southern Iran, during 2006. These insecticides have been used for cockroach con­trol in this city. Methods: The tests were carried out only on males by the glass jar contact method recommended by the WHO. Results: Maximum mortality rates of 20, 35, 90, and 100% were obtained after one hour contact to label-recom­mended doses of cypermethrin, deltamethrin, lambad-cyhalothrin, diazinon and permethrin+propoxur insecti­cides, respectively. KT50 results were different from 5.68 min for permethrin+propoxur mixture to 240.37 min for cyper­methrin. German cockroach showed < 80 per cent mortality using three pyrethroid insecticides. Conclusion: It seems that the label-recommended concentrations of these insecticides were wrong and lower than WHO advised for cockroach control. For monitoring of resistance it is recommended to do more tests using the pure ac­tive ingredient of these insecticides.

  10. First record of the German cockroach Blattella germanica Linnaeus, 1767 in Coquimbo, Coquimbo Region, Chile

    Directory of Open Access Journals (Sweden)

    Natalia Pérez

    2015-08-01

    Full Text Available This study describes the first formal record of the German cockroach in Coquimbo and La Serena, Coquimbo Region, northern Chile. Here, I also briefly discussed the sanitary implications that the occurrence of this insect could have in the Coquimbo Region.

  11. Evaluation of sublethal effects of polymer-based essential oils nanoformulation on the german cockroach.

    Science.gov (United States)

    González, Jorge Werdin; Yeguerman, Cristhian; Marcovecchio, Diego; Delrieux, Claudio; Ferrero, Adriana; Band, Beatriz Fernández

    2016-08-01

    The German cockroach, Blattella germanica (L.), is a serious household and public health pest worldwide. The aim of the present study was to evaluate the sublethal activity of polymer-based essential oils (EOs) nanoparticles (NPs) on adults of B. germanica. The LC50 and LC25 for contact toxicity were determined. To evaluate the repellency of EOs and NPs at LC25, a software was specially created in order to track multiple insects on just-recorded videos, and generate statistics using the obtained information. The effects of EOs and NPs at LC25 and LC50 on the nutritional physiology were also evaluated. The results showed that NPs exerted sublethal effects on the German cockroach, since these products enhance the repellent effects of the EOs and negatively affected the nutritional indices and the feeding deterrence index. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. The prevalence of protozoa in the gut of German cockroaches (Blattella germanica) with special reference to Lophomonas blattarum.

    Science.gov (United States)

    Martínez-Girón, Rafael; Martínez-Torre, Cristina; van Woerden, Hugo Cornelis

    2017-11-01

    The German cockroach (Blattella germanica) is a common domestic pest, which produces allergens that have been associated with broncho-pulmonary disease. Various protozoan species have been identified in the intestine of this cockroach and it has been hypothesised that these protozoa, or their proteases, may contribute to the burden of cockroach-associated allergens and adjuvants present in domestic dust. The aim of this study was therefore to determine the prevalence of protozoan species in the intestine of Blattella germanica. German cockroaches were anesthetised and dissected and gut contents are used to produce wet slides for microscopy. Both, Giemsa and Papanicolaou stains were used to confirm correct identification of Lophomonas blattarum. Representatives of four genera of protozoa were identified in 110 cockroaches: Nyctoterus sp. was observed in 91.8% of cases, Gregarina sp. in 64.5%, Amoeba sp. in 25.4% and Lophomonas blattarum in 13.6%. Nyctoterus and Gregarina were statistically significantly more likely to be found in diseased cockroaches compared to Amoeba or Lophomonas. The prevalence of Lophomonas blattarum was similar to that in published studies of a different species of cockroach, Periplaneta americana. Further work is needed to assess the interplay between protozoa, cockroaches and broncho-pulmonary diseases.

  13. [The intracellular localization of the regulatory proteins of the densovirus of German cockroach, Blattella germanica].

    Science.gov (United States)

    Martynova, E U; Kapelinskaia, T V; Schal, C; Mukha, D V

    2014-01-01

    The intracellular localization of the regulatory proteins encoded by the genome of the densovirus of German cockroach was analyzed using western-blotting of nuclear and cytoplasmic extracts of the densovirus-infected passaging cells tissue culture BGE-2. Two of the three regulatory proteins, NS1 and NS3, were shown to possess mainly nuclear localization, while NS2 protein was distributed between the nucleus and cytoplasm. Data obtained provide new information necessary for prediction of the functions of densovirus regulatory proteins. Intracellular localization of NS3 protein was described for the densoviruses for the first time.

  14. Antibiotics susceptibility patterns of bacteria isolated from American and German cockroaches as potential vectors of microbial pathogens in hospitals

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Fakoorziba

    2014-09-01

    Full Text Available Objective: To identify the cockroach species, their bacterial flora and antibiotics susceptibility patterns of these bacteria in Shiraz. Methods: In the present descriptive study, only two species of cockroaches were recognized. The washing solutions from the digestion systems and surfaces of 156 American and German cockroaches were cultured. The latter was found to be the commonest (89.7% in all places. Results: Overall, 18 species of bacteria were isolated and identified by standard culture methods. The most frequent bacterium isolated from both species of cockroaches in all places was Pseudomonas (41.7%. The second and third commonest bacteria were Enterobacter (39.7% and Klebsiella (32.7%, respectively. Conclusions: The antibiogram profiles showed full (100% resistance of Klebsiella, Citrobacter, Acinetobacter and Proteus to amoxicillin and ampicillin at both hospitals, while Pseudomonas showed resistance (95.7% to cephalothin. Thus it is concluded that German and American cockroaches carry multidrug resistant bacteria in two hospitals which raises alarm for stricter control measures.

  15. Ecological investigation, density, infestation rate and control strategy of German cockroach, Blattella germanica (L. in two hospitals in Ismailia, Egypt

    Directory of Open Access Journals (Sweden)

    M.F. Mahmoud

    2013-12-01

    Full Text Available A study was conducted to investigate the ecological situation, density, infestation rate and control strategy of German cockroach, Blattella germanica indoors in two hospitals in Ismailia Governorate, Egypt. The sticky traps method was used for 12 months in 2012. The cockroach index, sanitation and ventilation rate tables were tools to investigate the effectiveness of sanitation and related factors on B. germanica in Ismailia. Results showed that the population density of B. germanica increased gradually from January to July, and then decreased gradually till December of 2012 in both hospitals. The population density of B. germanica captured from hospital 1 (urban was higher than hospital 2 (rural in all months. Moreover, the number of German cockroach caught from different apartments in both hospitals was very significant different. Among these apartments, kitchen had the highest number of German cockroach, density, infestation rate and percent of nymphs. The highest population density was in kitchen (298.44, followed by dry food store (69.99, furniture room (25.91 and patient room (8.94, for hospital 1. However, the population was low in all apartments in hospital 2. Although several stages of B. germanica were caught from two hospitals, nymphs showed the higher infestation rate in all apartments surveyed in both hospitals. The infestation rate of nymphs was 92.5% in hospital 1 and 63.06% in hospital 2. In addition, temperature and humidity were measured in hospitals to study the relationship between population density of B. germanica and these parameters. There was a positive correlation between temperature and the population density for hospital 1 and for hospital 2. The correlation was negative between humidity and population density in both hospitals. In conclusion, integrated control measures should be taken according to the seasonal fluctuation, population density in hospitals in Ismailia. It should put the emphasis on environmental

  16. Behavioral activity of catnip (Lamiaceae) essential oil components to the German cockroach (Blattodea: Blattellidae).

    Science.gov (United States)

    Peterson, Chris J; Nemetz, Leah T; Jones, Leah M; Coat, Joel R

    2002-04-01

    The essential oil of catnip, Nepeta cataria L., contains two isomers of nepetalactone, E,Z-and Z,E-nepetalactone, and was tested for repellent activity to adult male German cockroaches, Blattella germanica (L.), in a choice-test arena. The two isomers of nepetalactone were purified by using preparative thin-layer chromatography and tested for behavioral activity in the choice-test arena. Significant differences due to concentration were detected by analysis of variance, and the responses were compared by least-squared means analysis. The activities of the essential oil and purified isomers were compared with N,NA-diethyl-3-methylbenzamide (DEET) by a paired t-test. E,Z-Nepetalactone was the most active of the compounds tested, being significantly more active to this species than equivalent doses of DEET, the essential oil, or Z,E-nepetalactone. Antennectomized insects showed no response to concentrations that were active against intact insects.

  17. Hierarchical genetic analysis of German cockroach (Blattella germanica populations from within buildings to across continents.

    Directory of Open Access Journals (Sweden)

    Edward L Vargo

    Full Text Available Understanding the population structure of species that disperse primarily by human transport is essential to predicting and controlling human-mediated spread of invasive species. The German cockroach (Blattella germanica is a widespread urban invader that can actively disperse within buildings but is spread solely by human-mediated dispersal over longer distances; however, its population structure is poorly understood. Using microsatellite markers we investigated population structure at several spatial scales, from populations within single apartment buildings to populations from several cities across the U.S. and Eurasia. Both traditional measures of genetic differentiation and Bayesian clustering methods revealed increasing levels of genetic differentiation at greater geographic scales. Our results are consistent with active dispersal of cockroaches largely limited to movement within a building. Their low levels of genetic differentiation, yet limited active spread between buildings, suggests a greater likelihood of human-mediated dispersal at more local scales (within a city than at larger spatial scales (within and between continents. About half the populations from across the U.S. clustered together with other U.S. populations, and isolation by distance was evident across the U.S. Levels of genetic differentiation among Eurasian cities were greater than those in the U.S. and greater than those between the U.S. and Eurasia, but no clear pattern of structure at the continent level was detected. MtDNA sequence variation was low and failed to reveal any geographical structure. The weak genetic structure detected here is likely due to a combination of historical admixture among populations and periodic population bottlenecks and founder events, but more extensive studies are needed to determine whether signatures of global movement may be present in this species.

  18. Contamination affects the performance of insecticidal baits against German cockroaches (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Appel, Arthur G

    2004-12-01

    The effects of contamination of insecticidal bait formulations, by using mint oil and silica aerogel, were evaluated in a series of laboratory experiments against the German cockroach, Blattella germanica (L.). Bait consumption at 3 d for uncontaminated baits ranged from 0.01 g for Avert dust to 0.399 g for Combat dry bait with hydramethylnon presented in a station. LT50 values for uncontaminated gel bait deposits ranged from 0.4 d for PreEmpt containing imidacloprid to 4.1 d for Maxforce containing hydramethylnon. As a group, significantly more gel bait was consumed than solid formulations even when both formulations had similar concentrations of the same active ingredient. As a result, gel baits were significantly more toxic than solid formulations. Application of mint oil directly to bait deposits significantly decreased bait consumption and increased overall LT50 values. When bait formulation types were examined individually, there was no difference in consumption or toxicity between contaminated and uncontaminated gel formulations. Contaminated solid baits, however, had significantly greater LT50 values and less consumption than uncontaminated solid baits. Gel formulations probably absorbed the contaminants and removed them from the surface of the bait deposits resulting in normal bait consumption and toxicity. Gel and solid bait deposits, inside plastic exposure stations or alone with no station and placed onto mint oil-contaminated substrates, had significantly lower bait consumption and greater LT50 values than baits placed on uncontaminated substrates. Contamination of a baited area is more likely than contamination of just the bait deposit and therefore a more realistic test of the effects of contamination on bait performance. The importance of contamination to the performance of cockroach baits is discussed.

  19. Suboptimal nutrient balancing despite dietary choice in glucose-averse German cockroaches, Blattella germanica.

    Science.gov (United States)

    Jensen, Kim; Schal, Coby; Silverman, Jules

    2015-10-01

    Insects have evolved fine-tuned gustatory and post-ingestive physiological mechanisms that enable them to self-select an optimal composition of macronutrients. Their ability to forage optimally among multiple food sources and maximize fitness parameters depends on their ability not only to taste and perceive the nutritional value of potential foods but also to avoid deleterious components; the strength of such avoidance should reflect the severity of the perceived hazard. In German cockroaches (Blattella germanica), glucose aversion has evolved in some populations in response to anthropogenic selection with glucose-containing insecticidal baits. In four feeding treatments, we gave newly eclosed glucose-averse female cockroaches free choice to feed from two artificial, nutritionally complementary foods varying in protein and carbohydrate composition, with glucose or fructose as the sole carbohydrate source in either food. After 6days of feeding, we measured diet consumption and the length of basal oocytes as an estimate of sexual maturation. The females did not compromise on their aversion to glucose in order to balance their protein and carbohydrate intake, and experienced lower sexual maturation rates as a consequence. Nutrient specific hunger via feedback mechanisms, and adjustments to gustatory sensitivity thus do not override the deterrence of glucose, likely due to strong selection against ingesting even small amounts of toxin associated with glucose in baits. In the absence of baits, glucose aversion would be expected to incur a fitness cost compared to wild-type individuals due to lower overall food availability but also to larger difficulty in attaining a nutritionally balanced diet. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Fumigant Toxicity of Plant Essential Oils and Selected Monoterpenoid Components against the Adult German Cockroach, Blattella germanica (L.) (Dictyoptera: Blattellidae)

    OpenAIRE

    TUNAZ, Hasan; ER, Mehmet Kubilay; IŞIKBER, Ali Arda

    2014-01-01

    The fumigant toxicity of various essential oils and selected monoterpenoid components were tested against the adult German cockroach, Blattella germanica (L.) (Dictyoptera: Blattellidae). Responses varied according to plant material, concentration, and exposure time. High insecticidal activity against adult B. germanica specimens was achieved with allyl isothiocyanate (component of horseradish) and the essential oil of Allium sativum (L.) (Liliales: Liliaceae) at the concentration of 2.5 and ...

  1. Effects of Two Temperature Storage Regimes on the Efficacy of 3 Commercial Gel Baits against the German Cockroach, Blattella germanica L. (Dictyoptera: Blattellidae)

    OpenAIRE

    Oz, E; Cetin, H; Cilek, J E; Deveci, O; Yanikoglu, A

    2010-01-01

    "nBackground: To compare the effectiveness of 3 commercial gel bait formulations containing fipronil (Goliathã Cockroach Gel 0.05% AI), chlorpyrifos-A (Clean Baitã Gel, 2% AI), and chloropyrifos-B (Serpaã Gel 2% AI) against German cock­roaches (Blattella germanica) when stored at 23°C and 30° C after treatment."nMethods: Laboratory bioassays consisted of placing groups of fifteen cockroaches (a random combination of adult, mix...

  2. Insecticidal and acetylcholine esterase inhibition activity of Asteraceae plant essential oils and their constituents against adults of the German cockroach (Blattella germanica).

    Science.gov (United States)

    Yeom, Hwa-Jeong; Jung, Chan-Sik; Kang, Jaesoon; Kim, Junheon; Lee, Jae-Hyeon; Kim, Dong-Soo; Kim, Hyun-Seok; Park, Pil-Sun; Kang, Kyu-Suk; Park, Il-Kwon

    2015-03-04

    The fumigant and contact toxicities of 16 Asteraceae plant essential oils and their constituents against adult male and female Blattella germanica were examined. In a fumigant toxicity test, tarragon oil exhibited 100% and 90% fumigant toxicity against adult male German cockroaches at 5 and 2.5 mg/filter paper, respectively. Fumigant toxicities of Artemisia arborescens and santolina oils against adult male German cockroaches were 100% at 20 mg/filter paper, but were reduced to 60% and 22.5% at 10 mg/filter paper, respectively. In contact toxicity tests, tarragon and santolina oils showed potent insecticidal activity against adult male German cockroaches. Components of active oils were analyzed using gas chromatography, gas chromatography-mass spectrometry, or nuclear magnetic resonance spectrometer. Among the identified compounds from active essential oils, estragole demonstrated potent fumigant and contact toxicity against adult German cockroaches. β-Phellandrene exhibited inhibition of male and female German cockroach acetylcholinesterase activity with IC50 values of 0.30 and 0.28 mg/mL, respectively.

  3. Toxicity of entomopathogenic fungi, Beauveria bassiana and Lecanicillium muscarium against a field-collected strain of the German cockroach Blattella germanica (L.) (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Davari, B; Limoee, M; Khodavaisy, S; Zamini, G; Izadi, S

    2015-09-01

    The German cockroach, Blattella germanica (L.) has been recognized as a serious health problem throughout the world. Control failures due to insecticide resistance and chemical contamination of environment have led some researchers focus on the other alternative strategy controls. Microbial insecticides such as those containing entomo pathogenic fungi could be of high significance. Lecanicillium muscarium and Beauveria bassiana grow naturally in soils throughout the world and act as a parasite on various arthropod species, causing white muscardine disease. Thus, these two species could be considered as entomopathogenic fungi. The current study conducted to evaluate the toxicity of Beauveria bassiana and Lecanicillium muscarium against German cockroach, Blattella germanica. Conidial formulations of L. muscarium (PTCC 5184) and B. bassiana (PTCC5197) were prepared in aqueous suspensions with Tween 20. Bioassays were performed using two methods including submersion of cockroaches in conidial suspension and baiting. Data were analyzed by Probit program and LC50 and LC90 were estimated. The obtained results indicated that both fungi species were toxic against German cockroach however; Beauveria bassiana was significantly 4.8 fold more toxic than L. muscarium against German cockroach using submersion method.

  4. RNA interference and functional characterization of a tergal gland alpha amylase in the German cockroach, Blattella germanica L.

    Science.gov (United States)

    Myers, A J; Gondhalekar, A D; Fardisi, M; Pluchar, K D; Saltzmann, K D; Bennett, G W; Scharf, M E

    2018-04-01

    German cockroach males possess tergal glands that secrete a combination of oligosaccharides, lipids and proteins. Four major proteins occur in the secretion, with one being the 63 kDa alpha-amylase Blattella germanica Tergal Gland protein-1 (BGTG-1). Denaturing and starch gel electrophoresis coupled with peptide sequencing verified amylase activity for the BGTG-1 protein. BGTG-1 gene expression profiles were determined by using quantitative real-time PCR to compare messenger RNA abundance among isolated tissues of males, females and gravid females. Differences in BGTG-1 gene expression occurred among male tissues, with tergal gland tissue showing the highest expression. Tissues of nongravid and gravid females had significantly lower expression in comparison with male tergal glands (gravid females lowest). RNA interference (RNAi) was used to silence BGTG-1 gene expression by injecting BGTG-1 homologous double-stranded RNA (dsRNA) into male cockroaches. Groups injected with BGTG-1 dsRNA showed ∼90% lower BGTG-1 gene and protein expression compared to controls, which correlated with lower amylase activity in colorimetric assays. However, behavioural assays comparing precopulatory behaviour and mating success between RNAi and control males did not reveal differences. These results connect amylase gene expression and activity in tergal gland tissue but suggest other factors, such as other tergal gland components, may contribute more strongly to mating success. © 2017 The Royal Entomological Society.

  5. Human β-defensin HBD3 binds to immobilized Bla g2 from the German cockroach (Blattella germanica).

    Science.gov (United States)

    Dietrich, Deborah E; Martin, Aaron D; Brogden, Kim A

    2014-03-01

    Human β-defensin 3 (HBD3) is a small, well-characterized peptide in mucosal secretions with broad antimicrobial activities and diverse innate immune functions. Among these functions is the ability of HBD3 to bind to antigens. In this study, we hypothesize that HBD3 binds to the allergen Bla g2 from the German cockroach (Blattella germanica). The ability of HBD1 (used as a control β-defensin) and HBD3 to bind to Bla g2 and human serum albumin (HSA, used as a control ligand) was assessed using the SensíQ Pioneer surface plasmon resonance (SPR) spectroscopy biosensor system. HBD1 was observed to bind weakly to Bla g2, while HBD3 demonstrated a stronger affinity for the allergen. HBD3 was assessed under two buffer conditions using 0.15 M and 0.3 M NaCl to control the electrostatic attraction of the peptide to the chip surface. The apparent K(D) of HBD3 binding Bla g2 was 5.9±2.1 μM and for binding HSA was 4.2±0.7 μM, respectively. Thus, HBD3, found in mucosal secretions has the ability to bind to allergens like Bla g2 possibly by electrostatic interaction, and may alter the ability of Bla g2 to induce localized allergic and/or inflammatory mucosal responses. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

  6. Effects of Two Temperature Storage Regimes on the Efficacy of 3 Commercial Gel Baits against the German Cockroach, Blattella germanica L. (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Oz, E; Cetin, H; Cilek, J E; Deveci, O; Yanikoglu, A

    2010-01-01

    To compare the effectiveness of 3 commercial gel bait formulations containing fipronil (Goliath(©) Cockroach Gel 0.05% AI), chlorpyrifos-A (Clean Bait(©) Gel, 2% AI), and chloropyrifos-B (Serpa(©) Gel 2% AI) against German cockroaches (Blattella germanica) when stored at 23(°)C and 30(°) C after treatment. Laboratory bioassays consisted of placing groups of fifteen cockroaches (a random combination of adult, mixed sex and large nymphs-stage 6) into a 5 L cylindrical plastic container with one drop of product (avg 0.10 g ± 0.01 g) applied to a 76 mm x 26 mm glass microscope slide affixed to the bottom of each container (one product tested per container). Cumulative mortality was assessed at 6 h, 1, 2, 3, 4, and 5 d after application. To determine the further effects of storage temperature after treatment on residual activity of the gels, a drop of each product was applied to separate glass microscope slides and stored at either 23(°) C (warm) or 30(°) C (hot) under dark conditions for 0, 1, 7, 14, 30, 45, 60 and 90 d after application. Freshly applied baits (day 0) containing fipronil provided complete cockroach mortality (100%) within 5 d whereas chloryrifos-A and chlorpyrifos-B provided ≈72% and 88% mortality, respectively. Generally, cockroach mortality was greater when gels were stored at 30(°)C compared with 23(°) C. The fipronil gel formulation proved to be as efficacious as the chlorpyrifos gels and in some instances surpased the latter formulations depending on storage time and temperature by providing ≈90% mortality at 90 d post treatment.

  7. Insecticidal and acetylcholine esterase inhibition activity of Apiaceae plant essential oils and their constituents against adults of German cockroach (Blattella germanica).

    Science.gov (United States)

    Yeom, Hwa-Jeong; Kang, Jae Soon; Kim, Gil-Hah; Park, Il-Kwon

    2012-07-25

    We evaluated the insecticidal and acetylcholine esterase (AChE) inhibition activity of 11 Apiaceae plant essential oils and their constituents in adult male and female Blattella germanica. Of the 11 Apiaceae plant essential oils tested, dill (Anethum graveolens), carvi (Carum carvi), and cumin (Cuminum cyminum) demonstrated >90% fumigant toxicity against adult male German cockroaches at a concentration of 5 mg/filter paper. In a contact toxicity test, dill (Anethum graveolens), carvi (Carum carvi), cumin (Cuminum cyminum), and ajowan (Trachyspermum ammi) produced strong insecticidal activity against adult male and female German cockroaches. Among the test compounds, (S)-(+)-carvone, 1,8-cineole, trans-dihydrocarvone, cuminaldehyde, trans-anethole, p-cymene, and γ-terpinene demonstrated strong fumigant toxicity against adult male and female B. germanica. In a contact toxicity test, carveol, cuminaldehyde, (S)-(+)-carvone, trans-anethole, thymol, and p-cymene showed strong contact toxicity against adult male and female B. germanica. IC(50) values of α-pinene, carvacrol, and dihydrocarvone against female AChE were 0.28, 0.17, and 0.78 mg/mL, respectively. The toxicity of the blends of constituents identified in 4 active oils indicated that carvone, cuminaldehyde, and thymol were major contributors to the fumigant activity or contact toxicity of the artificial blend.

  8. First Report of German Cockroaches (Blattella germanica) as Reservoirs of CTX-M-15 Extended-Spectrum-β-Lactamase- and OXA-48 Carbapenemase-Producing Enterobacteriaceae in Batna University Hospital, Algeria.

    Science.gov (United States)

    Loucif, Lotfi; Gacemi-Kirane, Djamila; Cherak, Zineb; Chamlal, Naima; Grainat, Nadia; Rolain, Jean-Marc

    2016-10-01

    Here we report the isolation of extended-spectrum β-lactamase (ESBL)- and carbapenemase-producing Enterobacteriaceae from German cockroaches caught in the burn unit of Batna University Hospital in Algeria. Nine of 12 isolates harbored the blaCTX-M-15 ESBL gene. One Enterobacter cloacae isolate belonging to sequence type 528 coexpressed the blaOXA-48, blaCTX-M-15, and blaTEM genes. Our findings indicate that cockroaches may be one of the most dangerous reservoirs for ESBL and carbapenemase producers in hospitals. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  9. The Use of Double Translocation Heterozygotes To Control Populations of the German Cockroach and the Use of Genetic Mechanisms and Behavioral Characteristics To Control Natural Populations of the German Cockroach.

    Science.gov (United States)

    1986-05-30

    from one of the ships. Monogamy predominated, although re-mating sometimes occurred. removal method of population estimation provided estimates of...cockroaches are generally monogamous, although monogamy is not complete. c. Formal genetics (Ross 1975). The inheritance patterns and linkage...Unit 2, especially LCDR Donald McCroddan, Lt. Robert Gay , HM 1 W. M. Slinker, and others that were active at the time of the sterile male experiment

  10. Cockroach allergy

    African Journals Online (AJOL)

    hi-tech

    2000-11-11

    Nov 11, 2000 ... the effect of associated factors on cockroach sensitisation in Nigeria is largely unknown. Objective: To determine the ... in most of these studies has been on the house dust mite(1-. 5). Since cockroaches are ... location of their residences did not influence the positivity of the test (p=0.46 and p=0.84).

  11. Deltamethrin-resistant German Cockroaches Are Less Sensitive to the Insect Repellents DEET and IR3535 than Non-resistant Individuals.

    Science.gov (United States)

    Mengoni, Sofía L; Alzogaray, Raúl A

    2018-02-05

    The German cockroach, Blattella germanica (L.) (Blattodea: Blattellidae), is a serious worldwide pest with a considerable economical and sanitary impact. It is mainly controlled by the application of synthetic insecticides, but repeated use of these substances has promoted the appearance of resistance in cockroach populations throughout the world. The aim of this study was to compare the behavior of deltamethrin-susceptible (CIPEIN colony) and deltamethrin-resistant (JUBA and VGBA colonies) first instar nymphs exposed to the repellents N,N-diethyl-3-methylbenzamide (DEET) and ethyl 3-[acetyl(butyl)amino]propanoate (IR3535). Firstly, the behavior of the nymphs was assessed in an experimental arena in the absence of repellents. The parameters Distance Traveled, Velocity, Mobility Time, and Time Spent (in each half of the arena) were quantified using an image analyser, and showed that the behavior elicited by the three colonies was similar. After this, the behavior of the nymphs was quantified in an arena, half of which had been treated with repellent. The repellency of DEET increased as a linear function of log concentration for the three colonies. DEET elicited repellency as from a concentration of 97.49 µg/cm2 for the CIPEIN and JUBA colonies and 194.98 µg/cm2 for the VGBA colony. The repellency of IR3535 was weaker and started at a concentration of 389.96 µg/cm2 for the CIPEIN colony, 779.92 μg/cm2 for JUBA, and 1559.84 μg/cm2 for VGBA . Finally, nymphs were exposed to 3:1, 1:1, and 1:3 DEET:IR3535 mixtures, and a synergistic effect was observed only in the CIPEIN colony. © The Author(s) 2018. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  12. REGIONAL EVALUATION OF BACTERIAL CONTAMINATION IN HOSPITAL ENVIRONMENT COCKROACHES

    Directory of Open Access Journals (Sweden)

    A. Vahabi, J. Rafinejad, P. Mohammadi, F. Biglarian

    2007-01-01

    Full Text Available Cockroaches play an important role in transmission of different diseases either mechanically and occasionally biologically. The aim of current study was on the identification of cockroaches and their contamination to different bacteria in two hospitals affiliated to the Kordestan University of Medical Sciences which was performed in 2003. Cockroaches were collected from different parts using sticky traps, direct collection, and by means of vacuum cleaner. Collected cockroaches were identified according to the reliable systematic keys. Some of the collected cockroaches were selected randomly for the presence of bacteria in their external parts as well as in the digestive tract using specific culture media. Totally 450 specimens were collected. From which 44.4% identified as American Cockroach, Periplaneta Americana and remaining German cockroach, Blattella germanica. Among collected cockroaches 58 specimens of German cockroaches and 40 American cockroaches were selected to search for the presence of bacteria. Results of culture media exhibited that 89.8% (88.98 of cockroaches were positive to the bacteria. The bacteria were found mainly on external parts (67% and remaining from alimentary canal. The main common bacteria was found Escherichia coli, however, only 5.1% was Escherichia sp., which was found on external parts. Among two hospitals it is found that Tohid hospital was more infected (97.5%. In the hospitals the infectivity of American cockroaches was more prevalent than other species. All the American cockroaches and 70% of German cockroaches were infected to at least one bacterium. Result showed that the presence of cockroaches in the hospitals can threaten the health of hospitalized patients. Both cosmopolitan species was found infected in the hospitals. Sanitation of different departments as well as different method of control is recommended in the context of Integrated Vector Management for cockroach control.

  13. Cockroach Allergy

    Science.gov (United States)

    ... at School Allergies Types of Allergies Drug Allergy Food Allergy Insect Allergy Cockroach Allergy Dust Mite Allergy Latex ... Climate and Health Epinephrine in Schools Healthy Settings Food Allergies National Asthma Control Program Patient and Family Engagement ...

  14. Differences in susceptibility to German cockroach frass and its associated proteases in induced allergic inflammation in mice

    Directory of Open Access Journals (Sweden)

    Herman Nancy

    2007-12-01

    Full Text Available Abstract Background Cockroach exposure is a major risk factor for the development of asthma. Inhalation of fecal remnants (frass is the likely sensitizing agent; however isolated frass has not been tested for its ability to induce experimental asthma in mice. Methods Mice (Balb/c or C57Bl/6 were sensitized and challenged with GC frass or GC frass devoid of proteases and measurements of airway inflammation and hyperresponsiveness were performed (interleukin (IL-5, -13, and interferon gamma (IFNγ levels in bronchoalveolar lavage fluid, serum IgE levels, airway hyperresponsiveness, cellular infiltration, and mucin production. Results Sensitization and challenge of Balb/c mice with GC frass resulted in increased airway inflammation and hyperresponsiveness. C57Bl/6 mice were not susceptible to this model of sensitization; however they were sensitized to GC frass using a more aggressive sensitization and challenge protocol. In mice that were sensitized by inhalation, the active serine proteases in GC frass played a role in airway hyperresponsiveness as these mice had less airway hyperresponsiveness to acetylcholine and less mucin production. Proteases did not play a role in mediating the allergic inflammation in mice sensitized via intraperitoneal injection. Conclusion While both strains of mice were able to induce experimental asthma following GC frass sensitization and challenge, the active serine proteases in GC frass only play a role in airway hyperresponsiveness in Balb/c mice that were susceptible to sensitization via inhalation. The differences in the method of sensitization suggest genetic differences between strains of mice.

  15. "Ich Brauche Mix-Cough": Cross-Linguistic Influence Involving German, English and Farsi

    Science.gov (United States)

    Kazzazi, Kerstin

    2011-01-01

    This paper deals with cross-linguistic influence (CLI) in early trilingualism involving the languages German, English and Farsi. The data come from the case study of the author's two children growing up in a trilingual family within a monolingual German-speaking environment. Specific types of CLI from the non-dominant language Farsi on German and…

  16. Contamination of cockroaches (Insecta: Blattaria) to medically fungi: A systematic review and meta-analysis.

    Science.gov (United States)

    Nasirian, H

    2017-12-01

    Fungal infections have emerged worldwide. Cockroaches have been proved vectors of medically fungi. A systematic meta-analysis review about cockroach fungal contamination was investigated. Relevant topics were collected between January 2016 and January 2017. After a preliminary review among 392 collected papers, 156 were selected to become part of the detailed systematic meta-analysis review. Cockroaches contaminated to 38 fungi species belonging to 19 families and 12 orders. About 38, 25 and 13 fungal species were recovered from the American, German and brown-banded cockroaches, respectively with a variety of medical importance. Except the fungi isolated from German and brown-banded cockroaches, 15 species have been isolated only from the American cockroaches. The global world mean and trend of cockroach fungal contamination were 84.1 and 50.6-100%, respectively in the human dwelling environments. There is a significant difference between cockroach fungal contamination in the urban and rural environments (P0.05). The external and internal cockroach fungal contamination is more dangerous than entire surfaces, while the internal is more dangerous than the external surface. The German and brown-banded cockroach fungal contamination are more dangerous than the American cockroaches in the hospital environments. The study indicates that globally cockroach fungal contamination has been increased recognizing as agents of human infections and associating with high morbidity and mortality in immune-compromised patients. These facts, along with insecticide resistance emergence and increasing globally cockroach infestation, reveal importance of cockroaches and need for their control more than ever. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  17. Insect-specific irreversible inhibitors of acetylcholinesterase in pests including the bed bug, the eastern yellowjacket, German and American cockroaches, and the confused flour beetle.

    Science.gov (United States)

    Polsinelli, Gregory A; Singh, Sanjay K; Mishra, Rajesh K; Suranyi, Robert; Ragsdale, David W; Pang, Yuan-Ping; Brimijoin, Stephen

    2010-09-06

    Insecticides directed against acetylcholinesterase (AChE) are facing increased resistance among target species as well as increasing concerns for human toxicity. The result has been a resurgence of disease vectors, insects destructive to agriculture, and residential pests. We previously reported a free cysteine (Cys) residue at the entrance to the AChE active site in some insects but not higher vertebrates. We also reported Cys-targeting methanethiosulfonate molecules (AMTSn), which, under conditions that spared human AChE, caused total irreversible inhibition of aphid AChE, 95% inhibition of AChE from the malaria vector mosquito (Anopheles gambia), and >80% inhibition of activity from the yellow fever mosquito (Aedes aegypti) and northern house mosquito (Culex pipiens). We now find the same compounds inhibit AChE from cockroaches (Blattella germanica and Periplaneta americana), the flour beetle (Tribolium confusum), the multi-colored Asian ladybird beetle (Harmonia axyridis), the bed bug (Cimex lectularius), and a wasp (Vespula maculifrons), with IC(50) values of approximately 1-11muM. Our results support further study of Cys-targeting inhibitors as conceptually novel insecticides that may be free of resistance in a range of insect pests and disease vectors and, compared with current compounds, should demonstrate much lower toxicity to mammals, birds, and fish. Copyright (c) 2010 Elsevier Ireland Ltd. All rights reserved.

  18. Involving the Young: The German Approach to Vocational Education

    Science.gov (United States)

    Hirche, Walter

    2012-01-01

    Youth unemployment is a huge challenge for sustainable development in our societies. Statistics offer an alarming picture of the involvement of youth in the labour markets on a global scale. Germany, due to a strong tradition in vocational education and training deeply rooted in its culture, has very low rates of youth unemployment. The so-called…

  19. Pheromones of cockroaches

    NARCIS (Netherlands)

    Persoons, C.J.; Ritter, F.J.

    1979-01-01

    The article presents a review of the bíological significance and the chemistry of several pheromones of cockroaches. The data given are in part based on our own work, and in part taken from the literature.

  20. Natural insect repellents: activitity against mosquitoes and cockroaches

    Science.gov (United States)

    Gretchen Schultz; Chris Peterson; Joel Coats

    2006-01-01

    Recent research has focused on the repellent properties of extracts from the catnip plant (Nepeta cataria) and the Osage orange (Maclura pornifera) fruit. This chapter includes results on German cockroach (Blattella germanica), and house fly (Musca domestics) contact irritancy to catnip...

  1. Comparison of cockroach fungal contamination in the clinical and non-clinical environments from Iran

    Directory of Open Access Journals (Sweden)

    B. Davari

    2017-09-01

    Full Text Available Cockroaches have been associated with human environments threatening human health. A cross-sectional study about cockroach fungal contamination in the hospital, restaurant and household environments from Khorramabad, Lorestan province of Iran between August 2015 and March 2016 was done. Sampling was uniformly carried out monthly from the randomly selected sites. Fungi were isolated from the external surfaces of cockroaches using standard method. Periplaneta americana (66.7% was found the most infested cockroach, less percentage were observed in Blattella germanica (18.6% and Blatta orientalis (14.7%. Hospitals (66.7% were found the most infested places in comparison with households (18.6% and restaurants (14.7%. Households (64.3% were found the most cockroach fungal contaminated places than hospitals (49.0% and restaurants (59.1%. The highest and the lowest infestation of cockroaches were observed in January (30.0% and March (7.0% respectively, while the highest and the lowest cockroach fungal contamination were observed in November (73.3% and March (14.3%. B. germanica (60.7% was the most fungal contaminated cockroach. Candida, Geotrichum and Penicillium were the most frequent cockroach fungal contaminating genera. Statistical analysis revealed significant differences between cockroach infestation places (P=0.022, locality (P=0.03, and monthly (P=0.0001 cockroach fungal contamination, respectively. As a conclusion, the highest cockroach fungal contamination was observed in B. germanica, followed by P. americana and B. orientalis. Some human fungal opportunistic pathogens were also found among the fungal contaminated cockroaches. Recent epidemiological survey showed that the mortality rates of the infective diseases were increased, indicating cockroaches involved in their transferring.

  2. Aspiration of a cockroach

    Directory of Open Access Journals (Sweden)

    Albert Bousso

    2008-12-01

    Full Text Available It is described a five-month-old infant admitted to our pediatricintensive care unit who aspirated a cockroach. The cockroach wasremoved through bronchoscopy. The child arrived at the emergencyroom in cardiopulmonary arrest and despite full respiratory andcardiovascular support was discharged with evidence of severeneurological sequelae. It is known that this is the first case of acockroach aspiration in a five-month-old infant and reinforces thataspiration of an insect must be considered a possibility in patientswith an unidentified organic foreign body aspiration.

  3. Evolutionary convergence and nitrogen metabolism in Blattabacterium strain Bge, primary endosymbiont of the cockroach Blattella germanica.

    Directory of Open Access Journals (Sweden)

    Maria J López-Sánchez

    2009-11-01

    Full Text Available Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state.

  4. Evolutionary Convergence and Nitrogen Metabolism in Blattabacterium strain Bge, Primary Endosymbiont of the Cockroach Blattella germanica

    Science.gov (United States)

    López-Sánchez, Maria J.; Neef, Alexander; Peretó, Juli; Patiño-Navarrete, Rafael; Pignatelli, Miguel; Latorre, Amparo; Moya, Andrés

    2009-01-01

    Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state. PMID:19911043

  5. Polymorphisms in IL12A and cockroach allergy in children with asthma

    Directory of Open Access Journals (Sweden)

    Murphy Amy

    2008-07-01

    Full Text Available Abstract Background IL12A has been implicated in T-cell development and may thus influence the development of atopy and allergic diseases. Methods We tested for association between four linkage disequilibrium (LD-tagging SNPs (rs2243123, rs2243151, rs668998, and rs17826053 in IL12A and asthma and allergy-related (serum total and allergen-specific IgE, and skin test reactivity [STR] to two common allergens phenotypes in two samples: 417 Costa Rican children with asthma and their parents, and 470 families of 503 white children in the Childhood Asthma Management Program (CAMP. The analysis was conducted using the family-based association test (FBAT statistic implemented in the PBAT program. Results Among Costa Rican children with asthma, homozygosity for the minor allele of each of two SNPs in IL12A (rs2243123 and rs2243151 was associated with increased risks of STR to American cockroach (P ≤ 0.03 for both SNPs, STR to German cockroach (P ≤ 0.01 for both SNPs, and having a positive IgE to German cockroach (P IL12A was inversely associated with STR to German cockroach (P = 0.03 and homozygosity for the minor allele of SNP rs17826053 in IL12A was associated with increased risks of STR to American cockroach (P = 0.01 and STR to German cockroach (P = 0.007. There was no significant association between any SNP in IL12A and asthma, STR to dust mite, or total IgE in Costa Rica or CAMP. Conclusion Our findings suggest that variants in IL12A influence cockroach allergy among children with asthma.

  6. Sensory cues involved in social facilitation of reproduction in Blattella germanica females.

    Science.gov (United States)

    Uzsák, Adrienn; Schal, Coby

    2013-01-01

    Cockroaches, like many other animal species, form aggregations in which social stimuli from conspecifics can alter the physiology, morphology, or behavior of individuals. In adult females of the German cockroach, Blattella germanica, social isolation slows oocyte development, sexual maturation, and sexual receptivity, whereas social interactions as minimal as between just two females accelerate reproduction; however, the sensory modalities and pathways that mediate these physiological and behavioral changes are poorly understood. We explored the roles of visual, olfactory, and tactile cues in the reproductive physiology of German cockroach females, and whether their effects are species-specific and related to circadian time. Our results show that tactile cues are the primary sensory input associated with social conditions--with no evidence for involvement of the visual and olfactory systems--and that the antennae play an important role in the reception of these tactile cues. This conclusion is supported by the observation that interactions with other insect species of similar or larger size and with similar antennal morphology also stimulate oocyte development in B. germanica. Social facilitation of reproduction is expected to be influenced by the circadian timing system, as females engage in more social contact during the day when they shelter in aggregations with conspecifics. Surprisingly, however, the female's reproductive rate was unresponsive to social interactions during the photophase, whereas social interactions as short as two hours during the scotophase were sufficient to induce faster reproduction.We discuss the adaptive significance of these sensory-neuroendocrine responses in the German cockroach.

  7. The embodiment of cockroach aggregation behavior in a group of micro-robots.

    Science.gov (United States)

    Garnier, Simon; Jost, Christian; Gautrais, Jacques; Asadpour, Masoud; Caprari, Gilles; Jeanson, Raphaël; Grimal, Anne; Theraulaz, Guy

    2008-01-01

    We report the faithful reproduction of the self-organized aggregation behavior of the German cockroach Blattella germanica with a group of robots. We describe the implementation of the biological model provided by Jeanson et al. in Alice robots, and we compare the behaviors of the cockroaches and the robots using the same experimental and analytical methodology. We show that the aggregation behavior of the German cockroach was successfully transferred to the Alice robot despite strong differences between robots and animals at the perceptual, actuatorial, and computational levels. This article highlights some of the major constraints one may encounter during such a work and proposes general principles to ensure that the behavioral model is accurately transferred to the artificial agents.

  8. Involving private persons and corporations in the planning process according to paragraph 9b German nuclear law - practicability and limits

    International Nuclear Information System (INIS)

    Altmann, J.; Roesel, H.

    1978-01-01

    The 4th Amendment to the German Nuclear Law has procured the legal base for the disposal of radioactive waste in the German Federal Republic. The Nuclear Law states that the Physikalisch-Technische Bundesanstalt (PTB) in Braunschweig is responsible for the disposal of radioactive waste. The PTB can be assisted in its responsibilities by persons and institutions of private character. Involving private persons and corporations in the licensing process figures a legal problem, and there has been a seminar in the PTB discussing such problems. The present contribution gives a brief summary of the opinions stated by the various legal experts taking part in this seminar. (orig./HP) [de

  9. Role of tropomyosin as a cross-reacting allergen in sensitization to cockroach in patients from Martinique (French Caribbean island) with a respiratory allergy to mite and a food allergy to crab and shrimp

    NARCIS (Netherlands)

    Purohit, A.; Shao, J.; Degreef, J. M.; van Leeuwen, A.; van Ree, R.; Pauli, G.; de Blay, F.

    2007-01-01

    BACKGROUND: Tropomyosin has been described as cross-reacting allergen between mite, cockroach and shrimp. METHODS: In 13 patients with asthma and/or rhinitis sensitized to mite and/or German cockroach and presenting urticaria, oral allergy syndrome or angio-edema upon eating shrimp and/or crab, we

  10. Synergism of cockroach ( Periplaneta americana )

    African Journals Online (AJOL)

    Cockroach Periplaneta Americana α-amylase hydrolysed starch to maltose and maltodextrin. However, this enzyme was not active against maltose and maltotriose (2 h of reaction). α-Glucosidase of the same organism exhibited activities toward maltose and maltodextrin to glucose. Synergism was observed especially ...

  11. German Involvement in the War against International Terrorism. End of Civilian Power?

    Directory of Open Access Journals (Sweden)

    Zdeněk Kříž

    2006-08-01

    Full Text Available The September 11, 2001 terrorist attacks forced Germany to face a number of questions. One of them is determining the proper level of German political and military support for the USA in their war against terrorism. For Germany, i.e. for a country, whose foreign and security policies relies on the strategy of civilian power, it is a greater problem than in the case of other countries. American military operations in the fight against international terrorism take place in the context of a nation’s right to individual and collective self-defence. Despite this, the extent to which German participation in these operations is compatible with the policy of a civil power remains unclear. Most of the attributes of a military operation led by a civilian power are present – but not all of them. The main problem is the impossibility of assessing the degree of violence used by German soldiers within Operation Enduring Freedom. However, the findings we have obtained so far do not imply that the German military support of the U.S.A. contradicts a priori the policy expected from a civilian power.

  12. The neural circuitry involved in the reading of German words and pseudowords: A PET study

    NARCIS (Netherlands)

    Hagoort, P.; Indefrey, P.; Brown, C.; Herzog, H.; Steinmetz, H.; Seitz, R.J.

    1999-01-01

    Silent reading and reading aloud of German words and pseudowords were used in a PET study using (15O) butanol to examine the neural correlates of reading and of the phonological conversion of legal letter strings, with or without meaning. The results of 11 healthy, right-handed volunteers in the age

  13. Nest sanitation through defecation: antifungal properties of wood cockroach feces.

    Science.gov (United States)

    Rosengaus, Rebeca B; Mead, Kerry; Du Comb, William S; Benson, Ryan W; Godoy, Veronica G

    2013-11-01

    The wood cockroach Cryptocercus punctulatus nests as family units inside decayed wood, a substrate known for its high microbial load. We tested the hypothesis that defecation within their nests, a common occurrence in this species, reduces the probability of fungal development. Conidia of the entomopathogenic fungus, Metarhizium anisopliae, were incubated with crushed feces and subsequently plated on potato dextrose agar. Relative to controls, the viability of fungal conidia was significantly reduced following incubation with feces and was negatively correlated with incubation time. Although the cockroach's hindgut contained abundant β-1,3-glucanase activity, its feces had no detectable enzymatic function. Hence, these enzymes are unlikely the source of the fungistasis. Instead, the antifungal compound(s) of the feces involved heat-sensitive factor(s) of potential microbial origin. When feces were boiled or when they were subjected to ultraviolet radiation and subsequently incubated with conidia, viability was "rescued" and germination rates were similar to those of controls. Filtration experiments indicate that the fungistatic activity of feces results from chemical interference. Because Cryptocercidae cockroaches have been considered appropriate models to make inferences about the factors fostering the evolution of termite sociality, we suggest that nesting in microbe-rich environments likely selected for the coupling of intranest defecation and feces fungistasis in the common ancestor of wood cockroaches and termites. This might in turn have served as a preadaptation that prevented mycosis as these phylogenetically related taxa diverged and evolved respectively into subsocial and eusocial organizations.

  14. Immediate hypersensitivity to cockroach. Isolation and purification of the major antigens.

    Science.gov (United States)

    Twarog, F J; Picone, F J; Strunk, R S; So, J; Colten, H R

    1977-02-01

    Crude cockroach extract elicited positive skin tests in 50% of patients with positive and in 4% with negative environmental history for cockroach exposure, suggesting a possible role of cockroach in perennial atopic disease. Three major allergens in crude American and German cockroach extracts have been identified using sequential purification steps on Sephadex G-75, diethylaminoethyl (DEAE) cellulose, and agarose gel electrophoresis. Cr-I elicits positive skin tests in 70% of patients sensitive to the crude extracts. It has a molecular weight of approximately 25,500 daltons, is highly acidic, and resists boiling for four hours. Boiling in 4 N acetic acid completely abolishes its allergenicity. The purified allergen elicits positive skin tests at a concentration of 3 mug/ml and is capable of inducing greater than 50% histamine release from sensitive leukocytes at 0.05 ng/ml. A second antigen, Cr-II, elicits positive skin tests also in approximately 70% of cockroach-sensitive individuals, has a molecular weight of approximately 63,000 to 65,000 daltons, and has similar heat stability and acid hydrolysis characteristics to Cr-I. A third, less well-characterized antigen, Cr-III, has a molecular weight less than 10,000 daltons and elicits positive skin tests in 30% of individuals sensitive to the crude extract.

  15. German Involvement in the War against International Terrorism. End of Civilian Power?

    OpenAIRE

    Zdeněk Kříž

    2006-01-01

    The September 11, 2001 terrorist attacks forced Germany to face a number of questions. One of them is determining the proper level of German political and military support for the USA in their war against terrorism. For Germany, i.e. for a country, whose foreign and security policies relies on the strategy of civilian power, it is a greater problem than in the case of other countries. American military operations in the fight against international terrorism take place in the context of a nati...

  16. Modeling population dynamics of two cockroach species: Effects of the circadian clock, interspecific competition and pest control

    Czech Academy of Sciences Publication Activity Database

    Wu, H. H.; Lee, H. J.; Horng, S. B.; Berec, Luděk

    2007-01-01

    Roč. 249, - (2007), s. 473-486 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : German cockroach * Blattella germanica * Blatella bisignata Subject RIV: EH - Ecology, Behaviour Impact factor: 2.323, year: 2007

  17. DICONALE: A Novel German-Spanish Onomasiological Lexicographical Model Involving Paradigmatic and Syntagmatic Information

    Directory of Open Access Journals (Sweden)

    Paloma Sánchez Hernández

    2016-06-01

    Full Text Available This contribution, based on the DICONALE ON LINE and COMBIDIGILEX (FFI2015-64476-P research projects, aims to create an onomasiological bilingual dictionary with online access for German and Spanish verbal lexemes. The objective of this work is to present the most relevant contributions of the dictionary based on two lexemes from the COGNITION conceptual field, the LERNEN/APRENDER subfield. The DICONALE dictionary aims to fill the gap left by the current German–Spanish bilingual lexicography. The novelty is not only the electronic format, but also the inclusion of paradigmatic and syntagmatic information into one dictionary, and the contrastive aspects, subjects that until now have not been found in any onomasiological dictionaries in this area. In addition to the description of the paradigmatic and syntagmatic relationships, it also presents certain characteristics related to the contrastive analysis of the two lexemes. On the one hand, it aims to offer a panoramic view of the most relevant features of the dictionary while, on the other hand, attempting to demonstrate the relevance of said criteria in the contrasting German-Spanish lexicography.

  18. Do Quiescence and Wasp Venom-Induced Lethargy Share Common Neuronal Mechanisms in Cockroaches?

    Directory of Open Access Journals (Sweden)

    Stav Emanuel

    Full Text Available The escape behavior of a cockroach may not occur when it is either in a quiescent state or after being stung by the jewel wasp (Ampulex compressa. In the present paper, we show that quiescence is an innate lethargic state during which the cockroach is less responsive to external stimuli. The neuronal mechanism of such a state is poorly understood. In contrast to quiescence, the venom-induced lethargic state is not an innate state in cockroaches. The Jewel Wasp disables the escape behavior of cockroaches by injecting its venom directly in the head ganglia, inside a neuropile called the central complex a 'higher center' known to regulate motor behaviors. In this paper we show that the coxal slow motoneuron ongoing activity, known to be involved in posture, is reduced in quiescent animals, as compared to awake animals, and it is further reduced in stung animals. Moreover, the regular tonic firing of the slow motoneuron present in both awake and quiescent cockroaches is lost in stung cockroaches. Injection of procaine to prevent neuronal activity into the central complex to mimic the wasp venom injection produces a similar effect on the activity of the slow motoneuron. In conclusion, we speculate that the neuronal modulation during the quiescence and venom-induced lethargic states may occur in the central complex and that both states could share a common neuronal mechanism.

  19. The antennal system and cockroach evasive behavior. II. Stimulus identification and localization are separable antennal functions.

    Science.gov (United States)

    Comer, C M; Parks, L; Halvorsen, M B; Breese-Terteling, A

    2003-02-01

    Cockroaches ( Periplaneta americana) orient their antennae toward moving objects based on visual cues. Presumably, this allows exploration of novel objects by the antennal flagellum. We used videographic and electrophysiological methods to determine if receptors on the flagellum are essential for triggering escape, or if they enable cockroaches to discriminate threatening from non-threatening objects that are encountered. When a flagellum was removed, and replaced with a plastic fiber, deflection of a "prosthetic flagellum" still activated the descending mechanosensory interneurons associated with escape and produced typical escape responses. However, escape was essentially eliminated by constraining the movement of the scape and pedicel at the antennal base. When cockroaches approached and briefly explored the surface of a spider or another cockroach with the flagellum, they produced escape significantly more often in response to subsequent controlled contact from a spider than from a cockroach. This discrimination did not depend on visual or wind-sensory input, but required flagellar palpation of the surface. The crucial sensory cues appear to involve texture rather than surface chemicals. These results indicate that cockroaches acquire basic information on stimulus identity during exploration of surfaces with flagellar receptors, but that basal receptors are triggers for escape behavior.

  20. Cockroach hypersensitivity in asthmatics in Lagos, Nigeria | Adanijo ...

    African Journals Online (AJOL)

    Background: Cockroach allergy occurs frequently in asthmatics in urban areas, where the level of cockroach infestation is usually high. The prevalence of cockroach allergy, as well as the effect of associated factors on cockroach sensitisation in Nigeria is largely unknown. Objective: To determine the prevalence of ...

  1. The epidemiological implications of cockroaches ( Periplaneta ...

    African Journals Online (AJOL)

    The epidemiological implications of cockroaches ( Periplaneta americana ) in the dissemination of human diseases in Owerri, south-east, Nigeria. ... Overall, 14 parasites were recovered which included helminthes, protozoa and acanthocephalans. One hundred and thirty (65.0%) of 200 cockroaches examined were ...

  2. Thresholds of probable problematic gambling involvement for the German population: Results of the Pathological Gambling and Epidemiology (PAGE) Study.

    Science.gov (United States)

    Brosowski, Tim; Hayer, Tobias; Meyer, Gerhard; Rumpf, Hans-Jürgen; John, Ulrich; Bischof, Anja; Meyer, Christian

    2015-09-01

    Consumption measures in gambling research may help to establish thresholds of low-risk gambling as 1 part of evidence-based responsible gambling strategies. The aim of this study is to replicate existing Canadian thresholds of probable low-risk gambling (Currie et al., 2006) in a representative dataset of German gambling behavior (Pathological Gambling and Epidemiology [PAGE]; N = 15,023). Receiver-operating characteristic curves applied in a training dataset (60%) extracted robust thresholds of low-risk gambling across 4 nonexclusive definitions of gambling problems (1 + to 4 + Diagnostic and Statistical Manual for Mental Disorders-Fifth Edition [DSM-5] Composite International Diagnostic Interview [CIDI] symptoms), different indicators of gambling involvement (across all game types; form-specific) and different timeframes (lifetime; last year). Logistic regressions applied in a test dataset (40%) to cross-validate the heuristics of probable low-risk gambling incorporated confounding covariates (age, gender, education, migration, and unemployment) and confirmed the strong concurrent validity of the thresholds. Moreover, it was possible to establish robust form-specific thresholds of low-risk gambling (only for gaming machines and poker). Possible implications for early detection of problem gamblers in offline or online environments are discussed. Results substantiate international knowledge about problem gambling prevention and contribute to a German discussion about empirically based guidelines of low-risk gambling. (c) 2015 APA, all rights reserved).

  3. Dilemmas of involvement in land management – Comparing an active (Dutch) and a passive (German) approach

    NARCIS (Netherlands)

    Thomas, Hartmann; Spit, Tejo

    2015-01-01

    What is the role of spatial planners in urban development? Planners can be very involved in the realization of the land-use plans or they can take a more passive role in development processes. Which role they take depends on the particular institutional arrangements for land management in each

  4. Classical Olfactory Conditioning in the Cockroach Periplaneta americana(Neurobiology)

    OpenAIRE

    Hidehiro, Watanabe; Yuko, Kobayashi; Midori, Sakura; Yukihisa, Matsumoto; Makoto, Mizunami; Graduate School of Life Sciences, Tohoku University; Research Institute for Electronic Science, Hokkaido University; Research Institute for Electronic Science, Hokkaido University; Graduate School of Life Sciences, Tohoku University:Research Institute for Electronic Science, Hokkaido University; Graduate School of Life Sciences, Tohoku University:Research Institute for Electronic Science, Hokkaido University

    2003-01-01

    We established a classical conditioning procedure for the cockroach, Periplaneta americana, by which odors were associated with reward or punishment. Cockroaches underwent differential conditioning trials in which peppermint odor was associated with sucrose solution and vanilla odor was associated with saline solution. Odor preference of cockroaches was tested by allowing them to choose between peppermint and vanilla sources. Cockroaches that had undergone one set of differential conditioning...

  5. Activity of boric acid on German cockroaches: Analysis of residues ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-02-18

    Feb 18, 2009 ... mance and its economic and medical importance. (Gordon, 1996; Grandcolas, 1998). Thus, many conventional pesticides have been replaced by newer biorational or low risk insecticides with novel mode of action like insect growth regulators and biopesticides (Horowitz and Ishaaya, 2002; Dhadialla et.

  6. Cockroaches probably cleaned up after dinosaurs.

    Directory of Open Access Journals (Sweden)

    Peter Vršanský

    Full Text Available Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae, whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.

  7. Cockroaches probably cleaned up after dinosaurs.

    Science.gov (United States)

    Vršanský, Peter; van de Kamp, Thomas; Azar, Dany; Prokin, Alexander; Vidlička, L'ubomír; Vagovič, Patrik

    2013-01-01

    Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae), whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood) and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.

  8. Locomotion control of hybrid cockroach robots

    Science.gov (United States)

    Sanchez, Carlos J.; Chiu, Chen-Wei; Zhou, Yan; González, Jorge M.; Vinson, S. Bradleigh; Liang, Hong

    2015-01-01

    Natural systems retain significant advantages over engineered systems in many aspects, including size and versatility. In this research, we develop a hybrid robotic system using American (Periplaneta americana) and discoid (Blaberus discoidalis) cockroaches that uses the natural locomotion and robustness of the insect. A tethered control system was firstly characterized using American cockroaches, wherein implanted electrodes were used to apply an electrical stimulus to the prothoracic ganglia. Using this approach, larger discoid cockroaches were engineered into a remotely controlled hybrid robotic system. Locomotion control was achieved through electrical stimulation of the prothoracic ganglia, via a remotely operated backpack system and implanted electrodes. The backpack consisted of a microcontroller with integrated transceiver protocol, and a rechargeable battery. The hybrid discoid roach was able to walk, and turn in response to an electrical stimulus to its nervous system with high repeatability of 60%. PMID:25740855

  9. Crystal Structure of a Dimerized Cockroach Allergen Bla g 2 Complexed with a Monoclonal Antibody

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mi; Gustchina, Alla; Alexandratos, Jerry; Wlodawer, Alexander; Wünschmann, Sabina; Kepley, Christopher L.; Chapman, Martin D.; Pomes, Anna (INDOOR Bio.); (VCU); (NIH)

    2008-09-03

    The crystal structure of a 1:1 complex between the German cockroach allergen Bla g 2 and the Fab' fragment of a monoclonal antibody 7C11 was solved at 2.8-{angstrom} resolution. Bla g 2 binds to the antibody through four loops that include residues 60-70, 83-86, 98-100, and 129-132. Cation-{pi} interactions exist between Lys-65, Arg-83, and Lys-132 in Bla g 2 and several tyrosines in 7C11. In the complex with Fab', Bla g 2 forms a dimer, which is stabilized by a quasi-four-helix bundle comprised of an {alpha}-helix and a helical turn from each allergen monomer, exhibiting a novel dimerization mode for an aspartic protease. A disulfide bridge between C51a and C113, unique to the aspartic protease family, connects the two helical elements within each Bla g 2 monomer, thus facilitating formation of the bundle. Mutation of these cysteines, as well as the residues Asn-52, Gln-110, and Ile-114, involved in hydrophobic interactions within the bundle, resulted in a protein that did not dimerize. The mutant proteins induced less {beta}-hexosaminidase release from mast cells than the wild-type Bla g 2, suggesting a functional role of dimerization in allergenicity. Because 7C11 shares a binding epitope with IgE, the information gained by analysis of the crystal structure of its complex provided guidance for site-directed mutagenesis of the allergen epitope. We have now identified key residues involved in IgE antibody binding; this information will be useful for the design of vaccines for immunotherapy.

  10. A parasitoid wasp manipulates the drive for walking of its cockroach prey.

    Science.gov (United States)

    Gal, Ram; Libersat, Frederic

    2008-06-24

    The parasitoid wasp A. compressa hunts cockroaches as a live food supply for its offspring. The wasp selectively injects venom into the cerebral ganglia of the prey to induce long-term hypokinesia [1-5], during which the stung cockroach, although not paralyzed, does not initiate spontaneous walking and fails to escape aversive stimuli. This allows the wasp to grab the cockroach by the antenna and walk it to a nest much like a dog on a leash. There, the wasp lays an egg on the prey, seals the nest, and leaves. The stung cockroach, however, does not fight to escape its tomb but rather awaits its fate, being consumed alive by the hatching larva over several days. We investigated whether the venom-induced hypokinesia is a result of an overall decrease in arousal or, alternatively, a specific decrease in the drive to initiate or maintain walking. We found that the venom specifically affects both the threshold for the initiation and the maintenance of walking-related behaviors. Nevertheless, the walking pattern generator itself appears to be intact. We thus report that the venom, rather than decreasing overall arousal, manipulates neuronal centers within the cerebral ganglia that are specifically involved in the initiation and maintenance of walking.

  11. The shadow response of the cockroach periplaneta americana.

    Science.gov (United States)

    Meyer, D J; Margiotta, J F; Walcott, B

    1981-01-01

    We show that the "escape response" (running) of the cockroach Periplaneta americana is interrupted when the insect runs through a shadow. Shadows were cast by holding an opaque plastic sheet so that the cockroach ran beneath it. In control experiments, a similarly positioned clear plastic sheet was ineffective. Removal of the shadow stimulus allowed running to continue. The likelihood that cockroaches would resume running after removal of the shadow stimulus decreased with the time they were allowed to remain in shadow.

  12. Effectiveness of an integrated pest management intervention in controlling cockroaches, mice, and allergens in New York City public housing.

    Science.gov (United States)

    Kass, Daniel; McKelvey, Wendy; Carlton, Elizabeth; Hernandez, Marta; Chew, Ginger; Nagle, Sean; Garfinkel, Robin; Clarke, Brian; Tiven, Julius; Espino, Christian; Evans, David

    2009-08-01

    Cockroaches and mice, which are common in urban homes, are sources of allergens capable of triggering asthma symptoms. Traditional pest control involves the use of scheduled applications of pesticides by professionals as well as pesticide use by residents. In contrast, integrated pest management (IPM) involves sanitation, building maintenance, and limited use of least toxic pesticides. We implemented and evaluated IPM compared with traditional practice for its impact on pests, allergens, pesticide use, and resident satisfaction in a large urban public housing authority. We assigned IPM or control status to 13 buildings in five housing developments, and evaluated conditions at baseline, 3 months, and 6 months in 280 apartments in Brooklyn and Manhattan, in New York City (New York). We measured cockroach and mouse populations, collected cockroach and mouse urinary protein allergens in dust, and interviewed residents. All statistical models controlled for baseline levels of pests or allergens. Compared with controls, apartments receiving IPM had significantly lower counts of cockroaches at 3 months and greater success in reducing or sustaining low counts of cockroaches at both 3 and 6 months. IPM was associated with lower cockroach allergen levels in kitchens at 3 months and in beds and kitchens at 6 months. Pesticide use was reduced in IPM relative to control apartments. Residents of IPM apartments also rated building services more positively. In contrast to previous IPM studies, which involved extensive cleaning, repeat visits, and often extensive resident education, we found that an easily replicable single IPM visit was more effective than the regular application of pesticides alone in managing pests and their consequences.

  13. Characterization of the juvenile hormone pathway in the viviparous cockroach, Diploptera punctata.

    Directory of Open Access Journals (Sweden)

    Juan Huang

    Full Text Available Juvenile hormones (JHs are key regulators of insect development and reproduction. The JH biosynthetic pathway is known to involve 13 discrete enzymatic steps. In the present study, we have characterized the JH biosynthetic pathway in the cockroach Diploptera punctata. The effect of exogenous JH precursors on JH biosynthesis was also determined. Based on sequence similarity, orthologs for the genes directly involved in the pathway were cloned, and their spatial and temporal transcript profiles were determined. The effect of shutting down the JH pathway in adult female cockroaches was studied by knocking down genes encoding HMG-CoA reductase (HMGR and Juvenile hormone acid methyltransferase (JHAMT. As a result, oocyte development slowed as a consequence of reduction in JH biosynthesis. Oocyte length, fat body transcription of Vg and ovarian vitellin content significantly decreased. In addition, silencing HMGR and JHAMT resulted in a decrease in the transcript levels of other genes in the pathway.

  14. The First Report of Drug Resistant Bacteria Isolated from the Brown-Banded Cockroach, Supella longipalpa, in Ahvaz, South-western Iran

    Science.gov (United States)

    Vazirianzadeh, Babak; Dehghani, Rouhullah; Mehdinejad, Manijeh; Sharififard, Mona; Nasirabadi, Nersi

    2014-01-01

    Background The brown-banded cockroach, Supella longipalpa is known as a carrier of pathogenic bacteria in urban environments, but its role is not well documented regarding the carriage of antibiotic-resistant pathogenic bacteria in Iran. The aim of this study was to determine the resistance bacteria isolated from the brown-banded cockroach in Ahvaz, south west of Iran. Methods: Totally 39 cockroaches were collected from kitchen area of houses and identified. All specimens were cultured to isolate the bacterial agents on blood agar and MacConky agar media. The microorganisms were identified using necessary differential and biochemical tests. Antimicrobial susceptibility tests were performed for isolated organisms by Kirby-Bauer’s disk diffusion according to NCLI guideline, using 18 antibiotics. Results: From the 39 collected S. langipalpa, 179 bacterial agents were isolated, 92 of alimentary ducts and 87 of external body surfaces. Isolated bacteria from cockroaches were identified as Enterobacter spp., Klebsiella spp., Citrobacter spp., Escherichia coli, Salmonella spp., Proteus spp., coagulase negative staphylococci, Serratia marcescens, Staphylococcus aureus, and Bacillus species. The pattern resistance rates were determined for gram negative bacilli and gram positive cocci regarding 18 antibiotics. Conclusion: The brown-banded cockroach can be involved in the spread of drug resistant bacteria and increases the possibility of contacting human environment to drug resistant bacteria. Therefore, the potential of removing this insect should be improved. This is the first original report of drug resistant bacteria isolated from the brown-banded cockroach of Iran. PMID:25629065

  15. Olfactory Receptor Response to the Cockroach Sexual Attractant.

    Science.gov (United States)

    Boeckh, J; Priesner, E; Schneider, D; Jacobson, M

    1963-08-23

    The recently isolated sex attractant of the female American cockroach elicits an electical response in the antennae of males, females, and mymphs of this species. These electroantennograms are known to be summated receptor (generator) potentials of many olfactory sensillae stimulated simultaneously. Many other odorous substances also elicit such responses in the cockroach antenna.

  16. Vectorial Potential of Cockroaches in Transmitting Parasites of ...

    African Journals Online (AJOL)

    A study was conducted to determine the role of cockroaches as potential carriers of parasites of medical importance in Arkilla Federal Low Cost, Sokoto, Nigeria from October 2011 to February 2012. A total of 218 cockroaches, comprising of two species were collected from different locations using sweep net and examined ...

  17. Mite and cockroach sensitisation in patients with allergic rhinitis in ...

    African Journals Online (AJOL)

    No studies have been conducted on sensitisation to the other storage mites, spider mites or cockroaches. We aimed to determine the prevalence of sensitisation to various housedust mites, storage mites, spider mites and cockroaches in patients with allergic rhinitis living in the Free State. Methods. Fifty consecutive patients ...

  18. Vectorial Potential of Cockroaches in Transmitting Parasites of ...

    African Journals Online (AJOL)

    Cockroaches are abundant in most homes in Nigeria, where they are actually called. “landlords” in homes. Cockroaches are among the most notorious pests of premises, they frequently feed on human faeces, and therefore they can disseminate cysts of enteric protozoans in the environment if such faeces are contaminated ...

  19. The Role of Cockroaches ( Blatta Orientalis and Periplaneta ...

    African Journals Online (AJOL)

    A study was carried out on the parasitic profile of cockroaches caught in various sections of many houses in Owerri. A total of 340 cockroaches trapped from different sites (toilet, kitchen, store room and living room) were examined using standard parasitological techniques which included washing and examination of the ...

  20. Multiple-antibiotic-resistant bacteria from cockroaches trapped from ...

    African Journals Online (AJOL)

    The ability of cockroaches, found in and around hospital settings, to harbour multiple- antibioticresistant bacteria poses serious health implications. This study investigated and compared multiple-antibioticresistant bacteria carried by cockroaches from a hospital environment. Antibiotic susceptibility patterns of isolated ...

  1. Active antennal movement in cockroaches - towards understanding multimodal exploration

    DEFF Research Database (Denmark)

    Pequeno-Zurro, Alejandro; Nitschke, Jahn; Szyszka, Paul

    The long and highly mobile cockroach antennae are multifunctional sensory appendages incorporating two of the most fundamental senses – olfaction and touch. Previous laboratory experiments with cockroaches in unisensory tasks have demonstrated the animal’s ability to perform antenna-dependent tasks...

  2. Gerhart Panning (1900-1944): a German forensic pathologist and his involvement in Nazi crimes during Second World War.

    Science.gov (United States)

    Preuss, Johanna; Madea, Burkhard

    2009-03-01

    Twenty years after the Second World War the public were made aware of War Crimes committed by the German forensic pathologist, Gerhart Panning (1900-1944). From 1942 till 1944, Panning was professor at the Institute of Forensic Medicine at the University of Bonn. Panning died of tuberculosis on 22 March 1944. After the Second World War, Panning's widow tried to obtain denazification for her husband. There were no particularly serious doubts. In 1965, Konrad Graf von Moltke, the son of Helmuth James Graf von Moltke (1907-1944), presented to the court a private letter from his father to his mother. In this letter, written in 1941, Panning's experiments on Soviet prisoners are described. In the so-called Callsen trial in the court of Darmstadt from 1960 to 1968, the experiments were confirmed by witnesses. In 1941, Panning performed experiments in cooperation with the Sicherheitsstaffel (Nazi special police) in the Ukraine to prove that captured ammunition of the soviet infantry violated international law. For this purpose, different parts of the bodies of living Soviets were used as firing targets. He published the results of these experiments in a scientific journal without any evidence of the origin of these observations. In this article, Panning's life and crimes have been described.

  3. Pest Prevalence and Evaluation of Community-Wide Integrated Pest Management for Reducing Cockroach Infestations and Indoor Insecticide Residues.

    Science.gov (United States)

    Zha, Chen; Wang, Changlu; Buckley, Brian; Yang, Ill; Wang, Desen; Eiden, Amanda L; Cooper, Richard

    2018-01-18

    Pest infestations in residential buildings are common, but community-wide pest survey data are lacking. Frequent insecticide applications for controlling indoor pests leave insecticide residues and pose potential health risks to residents. In this study, a community-wide pest survey was carried out in a housing complex consisting of 258 units in 40 buildings in New Brunswick, New Jersey. It was immediately followed by implementation of an integrated pest management (IPM) program in all the cockroach-infested apartments and two bed bug apartments with the goal of eliminating pest infestations, reducing pyrethroid residues, and increasing resident satisfaction with pest control services. The IPM-treated apartments were revisited and treated biweekly or monthly for 7 mo. Initial inspection found the top three pests and their infestation rates to be as follows: German cockroaches (Blattella germanica L. [Blattodea: Blattellidae]), 28%; rodents, 11%; and bed bugs (Cimex lectularius L. [Hemiptera: Cimicidae]), 8%. Floor wipe samples were collected in the kitchens and bedrooms of 20 apartments for pyrethroid residue analysis before the IPM implementation; 17 of the 20 apartments were resampled again at 7 mo. The IPM program reduced cockroach counts per apartment by 88% at 7 wk after initial treatment. At 7 mo, 85% of the cockroach infestations found in the initial survey were eliminated. The average number of pyrethroids detected decreased significantly from 6 ± 1 (mean ± SEM) and 5 ± 1 to 2 ± 1 and 3 ± 1 in the kitchens and bedrooms, respectively. The average concentrations of targeted pyrethroids residue also decreased significantly in the kitchens and bedrooms. © The Author(s) 2018. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. Cockroaches (Blattaria) of Ecuador-checklist and history of research.

    Science.gov (United States)

    Vidlička, Lubomír

    2013-01-09

    Cockroaches are an understudied group and the total number of described taxa increases every year. The last checklist of Ecuador species was published in 1926. The main aim of this study was to complete a new checklist of cockroach species recorded in Ecuador supplemented with a research history of cockroaches (Blattaria) on the territory of continental Ecuador. In addition, the checklist contains comments on Ecuadorian faunistic records, including the Galápagos Islands. A total of 114 species (105 in continental Ecuador and 18 in Galápagos Islands) belonging to 6 families and 44 genera are listed. Forty species (38.1 %) occur solely in continental Ecuador and five (27.8 %) are endemic on Galápagos Islands. The results indicate that further research on the cockroach fauna of Ecuador as well as determination of museum collections from this territory is needed.

  5. On triatomines, cockroaches and haemolymphagy under laboratory conditions: new discoveries

    Directory of Open Access Journals (Sweden)

    Pamela Durán

    Full Text Available For a long time, haematophagy was considered an obligate condition for triatomines (Hemiptera: Reduviidae to complete their life cycle. Today, the ability to use haemolymphagy is suggested to represent an important survival strategy for some species, especially those in genus Belminus. As Eratyrus mucronatus and Triatoma boliviana are found with cockroaches in the Blaberinae subfamily in Bolivia, their developmental cycle from egg to adult under a “cockroach diet” was studied. The results suggested that having only cockroach haemolymph as a food source compromised development cycle completion in both species. Compared to a “mouse diet”, the cockroach diet increased: (i the mortality at each nymphal instar; (ii the number of feedings needed to molt; (iii the volume of the maximum food intake; and (iv the time needed to molt. In conclusion, haemolymph could effectively support survival in the field in both species. Nevertheless, under laboratory conditions, the use of haemolymphagy as a survival strategy in the first developmental stages of these species was not supported, as their mortality was very high. Finally, when Triatoma infestans, Rhodnius stali and Panstrongylus rufotuberculatus species were reared on a cockroach diet under similar conditions, all died rather than feeding on cockroaches. These results are discussed in the context of the ecology of each species.

  6. Classical olfactory conditioning in the cockroach Periplaneta americana.

    Science.gov (United States)

    Watanabe, Hidehiro; Kobayashi, Yuko; Sakura, Midori; Matsumoto, Yukihisa; Mizunami, Makoto

    2003-12-01

    We established a classical conditioning procedure for the cockroach, Periplaneta americana, by which odors were associated with reward or punishment. Cockroaches underwent differential conditioning trials in which peppermint odor was associated with sucrose solution and vanilla odor was associated with saline solution. Odor preference of cockroaches was tested by allowing them to choose between peppermint and vanilla sources. Cockroaches that had undergone one set of differential conditioning trials exhibited a significantly greater preference for peppermint odor than did untrained cockroaches. Memory formed by three sets of differential conditioning trials, with an inter-trial interval of 5 min, was retained at least 4 days after conditioning. This conditioning procedure was effective even for cockroaches that had been harnessed in plastic tubes. This study shows, for the first time in hemimetaborous insects, that both freely moving and harnessed insects are capable of forming olfactory memory by classical conditioning procedure. This procedure may be useful for future electrophysiological and pharmacological studies aimed at elucidation of neural mechanisms underlying olfactory learning and memory.

  7. Life style of people and surveillance of management related to cockroaches in Southern Punjab, Pakistan

    OpenAIRE

    NAEEM, Afifa; JALEEL, Waqar; SAEED, Qamar; ZAKA, Syed Muhammad; SAEED, Shafqat; NAQQASH, Muhammad Nadir; BAKHTAWAR, Marryam; AYUB, Waleed Bin

    2014-01-01

    Cockroaches are the major household pests which prefer humid areas for habitation i.e. bathrooms, kitchens, sewerage systems etc., where warmth, moisture and food are satisfactory. Cockroaches are responsible for transmitting microorganisms like pathogenic bacteria, virus and fungi. Some examples of common bacterial diseases of human beings transmitted by cockroaches are Pasteurellapestisand bubonic plague; Shigellaalkalescensand dysentery; Staphylococcus aureusand boils and abscesses; Shigel...

  8. Quality control of involved field radiotherapy in the HD 13 and HD 14 trials. Report of the radiotherapy panel of the German Hodgkin Study Group (GHSG)

    Energy Technology Data Exchange (ETDEWEB)

    Kriz, J.; Haverkamp, U.; Eich, H.T. [University of Muenster, Department of Radiation Oncology, Muenster (Germany); Baues, C. [University of Cologne, Department of Radiation Oncology, Cologne (Germany); Engenhart-Cabillic, R. [University of Marburg, Department of Radiation Oncology, Marburg (Germany); Herfarth, K. [University of Heidelberg, Department of Radiation Oncology, Heidelberg (Germany); Lukas, P. [University of Innsbruck, Department of Radiation Oncology, Innsbruck (Austria); Pluetschow, A.; Fuchs, M.; Engert, A. [University of Cologne, Department of Internal Medicine, Cologne (Germany); Schmidberger, H. [University of Mainz, Department of Radiation Oncology, Mainz (Germany); Staar, S. [Bremen Mitte, Department of Radiation Oncology, Bremen (Germany)

    2017-02-15

    As part of the foundation of the German Hodgkin Study Group (GHSG) in 1978, a central radiotherapy (RT) reference centre was established to evaluate and to improve the quality of treatment. During the study generations, the quality assurance programs (QAP) were continued and adapted to the demands of each study. The purpose of this article is to demonstrate the results of the fifth study generation and to compare them to the previous findings. With the start of the fourth GHSG study generation (HD10-12), a central prospective review of all diagnostic images was established to create an individual treatment plan for each early stage study patient. The quality of involved field RT was retrospectively evaluated by an expert panel of radiation oncologists. In the fifth study generation (HD13-15), the retrospective review of radiotherapy performed was refined and the results were compared with the findings of the fourth generation. The expert panel analyzed the RT planning and application of 1037 (28 %) patients (HD13 n = 465, HD14 n = 572). Simulation films were available in 85 % of cases and verification films in 87 %. RT was assessed as major violation in 46 % (HD13 = 38 %, HD14 = 52 %), minor violation in 9 % (HD13 = 9 %, HD14 = 9 %) and according to the protocol in 45 % (HD13 = 52 %, HD14 = 38 %). The value for QAP of RT within the GHSG trials is well known. Still there were several protocol violations. In the future, the QAP program has to be adapted to the requirements of ''modern RT'' in malignant lymphoma. (orig.) [German] Seit Gruendung der German Hodgkin Study Group (GHSG) im Jahr 1978 wurde ein zentrales Qualitaetssicherungsprogramm (QAP) der Radiotherapie (RT) etabliert, um die Qualitaet der RT sicherzustellen. Waehrend der fortlaufenden Studiengenerationen wurde dieses QAP kontinuierlich weiterentwickelt. In dieser Auswertung werden die Ergebnisse der fuenften Studiengeneration (HD13-15) praesentiert und mit frueheren Ergebnissen

  9. Involved-node radiotherapy in early-stage Hodgkin's lymphoma. Definition and guidelines of the German Hodgkin Study Group (GHSG)

    Energy Technology Data Exchange (ETDEWEB)

    Eich, H.T.; Mueller, R.P. [Dept. of Radiation Oncology, Radiotherapy Reference Center of the German Hodgkin Study Group (GHSG), Univ. of Cologne (Germany); Engenhart-Cabillic, R. [Dept. of Radiation Oncology, Univ. of Marburg-Giessen (Germany); Lukas, P. [Dept. of Radiation Oncology, Univ. of Innsbruck (Austria); Schmidberger, H. [Dept. of Radiation Oncology, Univ. of Mainz (Germany); Staar, S. [Dept. of Radiation Oncology, Klinikum Bremen Mitte (Germany); Willich, N. [Dept. of Radiation Oncology, Univ. of Muenster (Germany)

    2008-08-15

    Background and purpose: radiotherapy of Hodgkin's lymphoma has evolved from extended-field to involved-field (IF) radiotherapy reducing toxicity whilst maintaining high cure rates. Recent publications recommend further reduction in the radiation field to involved-node (IN) radiotherapy; however, this concept has never been tested in a randomized trial. The German Hodgkin Study Group aims to compare it with standard IF radiotherapy in their future HD17 trial. Patients and methods: all patients must be examined by the radiation oncologist before the start of chemotherapy. At that time, patients must have complete staging CT scans. For patients with IN radiotherapy, a radiation planning CT before and after chemotherapy with patients in the treatment position is recommended. Fusion techniques, allowing the overlapping of the pre- and postchemotherapy CT scans, should be used. Usage of PET-CT scans with patients in the treatment position is recommended, whenever possible. Results: the clinical target volume encompasses the initial volume of the lymph node(s) before chemotherapy and incorporates the initial location and extent of the disease taking the displacement of the normal tissues into account. The margin of the planning target volume should be 2 cm in axial and 3 cm in craniocaudal direction. If necessary, it can be reduced to 1-1.5 cm. To minimize lung and cardiac toxicity, the target definition in the mediastinum is different. Conclusion: the concept of IN radiotherapy has been proposed as a means to further improve the therapeutic ratio by reducing the risk of radiation-induced toxicity, including second malignancies. Field sizes will further decrease compared to IF radiotherapy. (orig.)

  10. Radiotherapy for Early Mediastinal Hodgkin Lymphoma According to the German Hodgkin Study Group (GHSG): The Roles of Intensity-Modulated Radiotherapy and Involved-Node Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Koeck, Julia, E-mail: Julia_Koeck@gmx.net [Department of Radiation Oncology, University Medical Center Mannheim, University of Heidelberg, Mannheim (Germany); Abo-Madyan, Yasser [Department of Radiation Oncology, University Medical Center Mannheim, University of Heidelberg, Mannheim (Germany); Department of Radiation Oncology, Faculty of Medicine, Cairo University, Cairo (Egypt); Lohr, Frank; Stieler, Florian [Department of Radiation Oncology, University Medical Center Mannheim, University of Heidelberg, Mannheim (Germany); Kriz, Jan; Mueller, Rolf-Peter [Department of Radiation Oncology, University of Cologne, Cologne (Germany); Wenz, Frederik [Department of Radiation Oncology, University Medical Center Mannheim, University of Heidelberg, Mannheim (Germany); Eich, Hans Theodor [Department of Radiation Oncology, University of Cologne, Cologne (Germany)

    2012-05-01

    Purpose: Cure rates of early Hodgkin lymphoma (HL) are high, and avoidance of late complications and second malignancies have become increasingly important. This comparative treatment planning study analyzes to what extent target volume reduction to involved-node (IN) and intensity-modulated (IM) radiotherapy (RT), compared with involved-field (IF) and three-dimensional (3D) RT, can reduce doses to organs at risk (OAR). Methods and Materials: Based on 20 computed tomography (CT) datasets of patients with early unfavorable mediastinal HL, we created treatment plans for 3D-RT and IMRT for both the IF and IN according to the guidelines of the German Hodgkin Study Group (GHSG). As OAR, we defined heart, lung, breasts, and spinal cord. Dose-volume histograms (DVHs) were evaluated for planning target volumes (PTVs) and OAR. Results: Average IF-PTV and IN-PTV were 1705 cm{sup 3} and 1015 cm{sup 3}, respectively. Mean doses to the PTVs were almost identical for all plans. For IF-PTV/IN-PTV, conformity was better with IMRT and homogeneity was better with 3D-RT. Mean doses to the heart (17.94/9.19 Gy for 3D-RT and 13.76/7.42 Gy for IMRT) and spinal cord (23.93/13.78 Gy for 3D-RT and 19.16/11.55 Gy for IMRT) were reduced by IMRT, whereas mean doses to lung (10.62/8.57 Gy for 3D-RT and 12.77/9.64 Gy for IMRT) and breasts (left 4.37/3.42 Gy for 3D-RT and 6.04/4.59 Gy for IMRT, and right 2.30/1.63 Gy for 3D-RT and 5.37/3.53 Gy for IMRT) were increased. Volume exposed to high doses was smaller for IMRT, whereas volume exposed to low doses was smaller for 3D-RT. Pronounced benefits of IMRT were observed for patients with lymph nodes anterior to the heart. IN-RT achieved substantially better values than IF-RT for almost all OAR parameters, i.e., dose reduction of 20% to 50%, regardless of radiation technique. Conclusions: Reduction of target volume to IN most effectively improves OAR sparing, but is still considered investigational. For the time being, IMRT should be considered for

  11. Food-borne human parasitic pathogens associated with household cockroaches and houseflies in Nigeria

    Directory of Open Access Journals (Sweden)

    Oyetunde T. Oyeyemi

    2016-03-01

    Full Text Available Cockroaches and houseflies pose significant public health threat owning to their ability to mechanically transmit human intestinal parasites and other disease-causing microorganisms. This study aims at assessing the vectoral capacity of cockroaches and houseflies in the transmission of human intestinal parasites. Intestinal parasite external surface contamination of 130 cockroaches and 150 houseflies caught within dwelling places in Ilishan-Remo town, Ogun State, Nigeria was determined. Cockroaches (six parasite species were more contaminated than houseflies (four parasite species. The most prevalent parasites were Trichuris trichiura (74.0% and hookworm (63.0% in houseflies and cockroaches respectively. There were significant differences in the prevalence of hookworm, T. trichiura and Taenia spp. isolated from cockroaches and houseflies (P < 0.05. There is high contamination of human intestinal parasites in cockroaches and houseflies in human dwelling places in the study area, thus they have the ability to transmit these parasites to unkempt food materials.

  12. There are more asthmatics in homes with high cockroach infestation

    Directory of Open Access Journals (Sweden)

    Sarinho E.

    2004-01-01

    Full Text Available Although asthma has been commonly associated with sensitivity to cockroaches, a clear causal relationship between asthma, allergy to cockroaches and exposure levels has not been extensively investigated. The objective of the present study was to determine whether asthma occurs more frequently in children living in homes with high cockroach infestation. The intensity of household infestation was assessed by the number of dead insects after professional pesticide application. Children living in these houses in the metropolitan area of Recife, PE, were diagnosed as having asthma by means of a questionnaire based on the ISAAC study. All children had physician-diagnosed asthma and at least one acute exacerbation in the past year. Children of both sexes aged 4 to 12 years who had been living in the households for more than 2 years participated in this transverse study and had a good socioeconomic status. In the 172 houses studied, 79 children were considered to have been exposed to cockroaches and 93 not to have been exposed. Children living in residences with more than 5 dead cockroaches after pesticide application were considered to be at high infestation exposure. Asthma was diagnosed by the questionnaire in 31.6% (25/79 of the exposed group and in 11.8% (11/93 of the non-exposed group (P = 0.001, with a prevalence ratio of 3.45 (95%CI, 1.48-8.20. The present results indicate that exposure to cockroaches was significantly associated with asthma among the children studied and can be considered a risk factor for the disease. Blattella germanica and Periplaneta americana were the species found in 96% of the infested houses.

  13. Life history and habitat associations of the broad wood cockroach, Parcoblatta lata (Blattaria: Blattellidae) and other native cockroaches in the Coastal Plain of South Carolina.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James, L.

    2002-06-18

    Wood cockroaches are an important prey of the red-cockaded woodpecker, Picoides borealis, an endangered species inhabiting pine forests in the southern United States. These woodpeckers forage on the boles of live pine trees, but their prey consists of a high proportion of wood cockroaches, Parcoblatta spp., that are more commonly associated with dead plant material. Cockroach population density samples were conducted on live pine trees, dead snags and coarse woody debris on the ground. The studies showed that snags and logs are also important habitats of wood cockroaches in pine forests.

  14. The structural basis for water exchange between the female cockroach (Blattella germanica) and her ootheca.

    Science.gov (United States)

    Mullins, Donald E; Mullins, K June; Tignor, Keith R

    2002-10-01

    Female German cockroaches usually carry their oothecae until they hatch. The success of embryogenesis may be dependent on the water-balance relationship between females and their developing oothecae. Oothecae detached from females early in embryogenesis often fail to develop, especially in low-humidity environments. Experiments reported here using tritiated water have confirmed the transport of a significant amount of water to the ootheca from the female during embryogenesis; 18% of the tritiated water injected into gravid females was recovered in their oothecae after 24 h. We describe a structural basis of water absorption by the oothecae. An area located on the proximal end of the ootheca (adjacent to the 'escutcheon-shaped vaginal imprint') contains small pores that penetrate the oothecal covering to access regions of the chorion lying beneath these pores. Experiments using microparabiotic chambers to examine transport of tritiated water and water-soluble materials across the escutcheon region of the oothecal covering, along with dark-field birefringent microscopy of the chorion, support the hypothesis that this chorionic network is capable of conducting water throughout the interior of the ootheca. Furthermore, the structural arrangement and intimate association of the female vestibulum with the oothecal pore field contained in the region of the escutcheon-shaped vaginal imprint appear to provide an efficient conduit to the chorion. The overall structural relationship might be a means for maintaining water balance between females and their oothecae during embryonic development. Evidence presented here supports observations that this species represents an important link in the transition from oviparity to ovoviviparity by internalization of cockroach oothecae.

  15. Leg Regrowth in Blaberus discoidalis (Discoid Cockroach) following Limb Autotomy versus Limb Severance and Relevance to Neurophysiology Experiments

    Science.gov (United States)

    Marzullo, Timothy C.

    2016-01-01

    Background Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1) the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2) the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds. Leg Regrowth Results First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (pbarbs, and a 10% higher electrical microstimulation threshold for movement. Summary It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content. PMID:26824931

  16. Antigenic Determinants of the Bilobal Cockroach Allergen Bla g 2.

    Science.gov (United States)

    Woodfolk, Judith A; Glesner, Jill; Wright, Paul W; Kepley, Christopher L; Li, Mi; Himly, Martin; Muehling, Lyndsey M; Gustchina, Alla; Wlodawer, Alexander; Chapman, Martin D; Pomés, Anna

    2016-01-29

    Bla g 2 is a major indoor cockroach allergen associated with the development of asthma. Antigenic determinants on Bla g 2 were analyzed by mutagenesis based on the structure of the allergen alone and in complex with monoclonal antibodies that interfere with IgE antibody binding. The structural analysis revealed mechanisms of allergen-antibody recognition through cation-π interactions. Single and multiple Bla g 2 mutants were expressed in Pichia pastoris and purified. The triple mutant K132A/K251A/F162Y showed an ∼100-fold reduced capacity to bind IgE, while preserving the native molecular fold, as proven by x-ray crystallography. This mutant was still able to induce mast cell release. T-cell responses were assessed by analyzing Th1/Th2 cytokine production and the CD4(+) T-cell phenotype in peripheral blood mononuclear cell cultures. Although T-cell activating capacity was similar for the KKF mutant and Bla g 2 based on CD25 expression, the KKF mutant was a weaker inducer of the Th2 cytokine IL-13. Furthermore, this mutant induced IL-10 from a non-T-cell source at higher levels that those induced by Bla g 2. Our findings demonstrate that a rational design of site-directed mutagenesis was effective in producing a mutant with only 3 amino acid substitutions that maintained the same fold as wild type Bla g 2. These residues, which were involved in IgE antibody binding, endowed Bla g 2 with a T-cell modulatory capacity. The antigenic analysis of Bla g 2 will be useful for the subsequent development of recombinant allergen vaccines. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  17. Antigenic Determinants of the Bilobal Cockroach Allergen Bla g 2*

    Science.gov (United States)

    Woodfolk, Judith A.; Glesner, Jill; Wright, Paul W.; Kepley, Christopher L.; Li, Mi; Himly, Martin; Muehling, Lyndsey M.; Gustchina, Alla; Wlodawer, Alexander; Chapman, Martin D.; Pomés, Anna

    2016-01-01

    Bla g 2 is a major indoor cockroach allergen associated with the development of asthma. Antigenic determinants on Bla g 2 were analyzed by mutagenesis based on the structure of the allergen alone and in complex with monoclonal antibodies that interfere with IgE antibody binding. The structural analysis revealed mechanisms of allergen-antibody recognition through cation-π interactions. Single and multiple Bla g 2 mutants were expressed in Pichia pastoris and purified. The triple mutant K132A/K251A/F162Y showed an ∼100-fold reduced capacity to bind IgE, while preserving the native molecular fold, as proven by x-ray crystallography. This mutant was still able to induce mast cell release. T-cell responses were assessed by analyzing Th1/Th2 cytokine production and the CD4+ T-cell phenotype in peripheral blood mononuclear cell cultures. Although T-cell activating capacity was similar for the KKF mutant and Bla g 2 based on CD25 expression, the KKF mutant was a weaker inducer of the Th2 cytokine IL-13. Furthermore, this mutant induced IL-10 from a non-T-cell source at higher levels that those induced by Bla g 2. Our findings demonstrate that a rational design of site-directed mutagenesis was effective in producing a mutant with only 3 amino acid substitutions that maintained the same fold as wild type Bla g 2. These residues, which were involved in IgE antibody binding, endowed Bla g 2 with a T-cell modulatory capacity. The antigenic analysis of Bla g 2 will be useful for the subsequent development of recombinant allergen vaccines. PMID:26644466

  18. Cockroach (Insecta: Blattaria) infestation of homes in selected ...

    African Journals Online (AJOL)

    The study was therefore undertaken to determine cockroach infestation of homes in some ten selected communities in the Kumasi Metropolitan area in the Ashanti Region of Ghana using sticky traps. Twenty (20) houses in each community were ran-domly selected for the study. A trap was set up in three areas: living room, ...

  19. Binary Cockroach Swarm Optimization for Combinatorial Optimization Problem

    Directory of Open Access Journals (Sweden)

    Ibidun Christiana Obagbuwa

    2016-09-01

    Full Text Available The Cockroach Swarm Optimization (CSO algorithm is inspired by cockroach social behavior. It is a simple and efficient meta-heuristic algorithm and has been applied to solve global optimization problems successfully. The original CSO algorithm and its variants operate mainly in continuous search space and cannot solve binary-coded optimization problems directly. Many optimization problems have their decision variables in binary. Binary Cockroach Swarm Optimization (BCSO is proposed in this paper to tackle such problems and was evaluated on the popular Traveling Salesman Problem (TSP, which is considered to be an NP-hard Combinatorial Optimization Problem (COP. A transfer function was employed to map a continuous search space CSO to binary search space. The performance of the proposed algorithm was tested firstly on benchmark functions through simulation studies and compared with the performance of existing binary particle swarm optimization and continuous space versions of CSO. The proposed BCSO was adapted to TSP and applied to a set of benchmark instances of symmetric TSP from the TSP library. The results of the proposed Binary Cockroach Swarm Optimization (BCSO algorithm on TSP were compared to other meta-heuristic algorithms.

  20. Genetic diversity of Entamoeba: Novel ribosomal lineages from cockroaches.

    Directory of Open Access Journals (Sweden)

    Tetsuro Kawano

    Full Text Available Our current taxonomic perspective on Entamoeba is largely based on small-subunit ribosomal RNA genes (SSU rDNA from Entamoeba species identified in vertebrate hosts with minor exceptions such as E. moshkovskii from sewage water and E. marina from marine sediment. Other Entamoeba species have also been morphologically identified and described from non-vertebrate species such as insects; however, their genetic diversity remains unknown. In order to further disclose the diversity of the genus, we investigated Entamoeba spp. in the intestines of three cockroach species: Periplaneta americana, Blaptica dubia, and Gromphadorhina oblongonota. We obtained 134 Entamoeba SSU rDNA sequences from 186 cockroaches by direct nested PCR using the DNA extracts of intestines from cockroaches, followed by scrutinized BLASTn screening and phylogenetic analyses. All the sequences identified in this study were distinct from those reported from known Entamoeba species, and considered as novel Entamoeba ribosomal lineages. Furthermore, they were positioned at the base of the clade of known Entamoeba species and displayed remarkable degree of genetic diversity comprising nine major groups in the three cockroach species. This is the first report of the diversity of SSU rDNA sequences from Entamoeba in non-vertebrate host species, and should help to understand the genetic diversity of the genus Entamoeba.

  1. Laboratory evaluation of azadirachtin against the oriental cockroach ...

    African Journals Online (AJOL)

    In this work, the toxicity of azadirachtin applied topically at various doses (300, 600, 1200, 2400, 4800 and 9000 ng/ insect) was evaluated against newly emerged adults of the oriental cockroach, Blatta orientalis L. (Dictyoptera, Blattellidae) under laboratory conditions. Results show that treated insects exhibited toxic ...

  2. Parasitic and microbial profile of cockroaches caught in University of ...

    African Journals Online (AJOL)

    A total of 120 cockroaches trapped and collected from different sites of the male and female hostels were examined using standard parasitological and mirobial techniques. Washing and examination of the external surfaces in saline, disection and examination of digestive tracts; culturing the external surface wash and gut ...

  3. Selected food-borne parasites associated with cockroaches and ...

    African Journals Online (AJOL)

    Of these, 20 (62.5%) were protozoa and 12 (37.5%) were helminthes from the houseflies while 19 (54.3%) were protozoa and 16 (45.7%) were helminthes from the cockroaches. The protozoa that were identified include; cysts of Balantidium coli, cysts of Entamoeba coli, Entamoeba Histolytica and Endolimax nana. Also ...

  4. Genetic diversity of Entamoeba: Novel ribosomal lineages from cockroaches

    Science.gov (United States)

    Kawano, Tetsuro; Imada, Mihoko; Chamavit, Pennapa; Kobayashi, Seiki; Hashimoto, Tetsuo

    2017-01-01

    Our current taxonomic perspective on Entamoeba is largely based on small-subunit ribosomal RNA genes (SSU rDNA) from Entamoeba species identified in vertebrate hosts with minor exceptions such as E. moshkovskii from sewage water and E. marina from marine sediment. Other Entamoeba species have also been morphologically identified and described from non-vertebrate species such as insects; however, their genetic diversity remains unknown. In order to further disclose the diversity of the genus, we investigated Entamoeba spp. in the intestines of three cockroach species: Periplaneta americana, Blaptica dubia, and Gromphadorhina oblongonota. We obtained 134 Entamoeba SSU rDNA sequences from 186 cockroaches by direct nested PCR using the DNA extracts of intestines from cockroaches, followed by scrutinized BLASTn screening and phylogenetic analyses. All the sequences identified in this study were distinct from those reported from known Entamoeba species, and considered as novel Entamoeba ribosomal lineages. Furthermore, they were positioned at the base of the clade of known Entamoeba species and displayed remarkable degree of genetic diversity comprising nine major groups in the three cockroach species. This is the first report of the diversity of SSU rDNA sequences from Entamoeba in non-vertebrate host species, and should help to understand the genetic diversity of the genus Entamoeba. PMID:28934335

  5. Species Diversity and Distributional Pattern of Cockroaches in Lahore, Pakistan

    Directory of Open Access Journals (Sweden)

    Hafsa Memona

    2017-06-01

    Full Text Available Background: Cockroaches are found as the most common urban pests of tropical countries, prompting economic and serious health risk problem for humans by carrying microbes and allergens, acting as vector for various patho­gens of diseases. The present study was conducted from April 2013 to March 2014 in various human dwelling local­ities of urban area of district Lahore, Pakistan.Methods: Cockroaches were collected randomly by hand, food baited and sticky traps throughout the year. Four species of cockroaches (Periplaneta Americana (P. amercana, Blattella germanica (B. germanica, Blatta orientalis (B. orientalis, and Blatta lateralis (B. lateralis were collected and identified from the study site.Results: B. germanica was the most dominant indoor species with highest diversity indices in study areas. Overall cockroach species diversity was highest in July–September, 2013 with highest Simpson index of diversity and Shan­non index as well. P. americana was found second broadly distributed in the study area followed by B. orientalis and B. lateralis were intermediately distributed in residential areas and narrowly distributed in hospitals. Residential ar­eas and hospitals were highly infested with B. germanica followed by P. americana. Population index of B. ger­manica for hospitals was double than residential areas. B. lateralis was observed as displacing B. orientalis in out­door habitat through competing with its habitat and food sources.Conclusion: The infestation rate of different species depends on availability of food sources, sanitary conditions and climatic conditions. Cockroach infestation can be controlled with knowledge about their biology and behavior, at­tention to sanitation and effective use of commercial insecticides.

  6. Food-borne human parasitic pathogens associated with household cockroaches and houseflies in Nigeria

    OpenAIRE

    Oyeyemi, Oyetunde T.; Agbaje, Mariam O.; Okelue, Uchechi B.

    2016-01-01

    Cockroaches and houseflies pose significant public health threat owning to their ability to mechanically transmit human intestinal parasites and other disease-causing microorganisms. This study aims at assessing the vectoral capacity of cockroaches and houseflies in the transmission of human intestinal parasites. Intestinal parasite external surface contamination of 130 cockroaches and 150 houseflies caught within dwelling places in Ilishan-Remo town, Ogun State, Nigeria was determined. Cockr...

  7. Octopaminergic agonists for the cockroach neuronal octopamine receptor

    Directory of Open Access Journals (Sweden)

    Akinori Hirashima

    2003-04-01

    Full Text Available The compounds 1-(2,6-diethylphenylimidazolidine-2-thione and 2-(2,6-diethylphenylimidazolidine showed the almost same activity as octopamine in stimulating adenylate cyclase of cockroach thoracic nervous system among 70 octopamine agonists, suggesting that only these compounds are full octopamine agonists and other compounds are partial octopamine agonists. The quantitative structure-activity relationship of a set of 22 octopamine agonists against receptor 2 in cockroach nervous tissue, was analyzed using receptor surface modeling. Three-dimensional energetics descriptors were calculated from receptor surface model/ligand interaction and these three-dimensional descriptors were used in quantitative structure-activity relationship analysis. A receptor surface model was generated using some subset of the most active structures and the results provided useful information in the characterization and differentiation of octopaminergic receptor.

  8. Cockroach allatostatin-immunoreactive neurons and effects of cockroach allatostatin in earwigs.

    Science.gov (United States)

    Rankin, S M; Stay, B; Chan, K; Jackson, E S

    1998-01-01

    A monoclonal antibody to allatostatin I of the cockroach Diploptera punctata was used to demonstrate the presence of allatostatin-immunoreactive cells and fiber tracts in the neuroendocrine system of the earwig Euborellia annulipes. The corpora cardiaca cells were not immunoreactive, nor were the neurosecretory endings of fiber tracts from the brain to the corpora cardiaca. No immunoreactive material was detected in the corpus allatum, although the corpus allatum contained neurosecretory endings, and some cells of the brain, including medial and lateral protocerebral cells, showed immunoreactivity. In addition, the recurrent and esophageal nerves were allatostatin-positive. The last abdominal ganglion contained immunoreactive somata, and immunoreactive axons of the proctodeal nerve innervated the rectum, anterior intestine, and posterior midgut. We did not detect reactive endocrine cells in the midgut. Allatostatin I at concentrations of 10(-5) and 10(-7) M did not inhibit juvenile hormone biosynthesis by E. annulipes corpora allata in vitro. This was true for glands of low activity from 2-day females and brooding females, as well as for relatively high activity glands from 10-day females. In contrast, 10(-7) M allatostatin I significantly and reversibly decreased hindgut motility. Motility was decreased in hindguts of high endogenous motility from 2-day females and in those of relatively low activity from brooding females. These results support the notion that a primary function of allatostatin might be to reduce gut motility.

  9. Effects of DDT, DDE, and PCBs on mitochondrial respiration. [Cockroaches

    Energy Technology Data Exchange (ETDEWEB)

    Khan, H.M.; Cutkomp, L.K.

    1982-11-01

    Data dealing with the action of DDT, its metabolite DDE and other related chlorinated compounds such as polychlorinated biphenyls (PCBs) are presented in this study. Results show that both DDT and DDE effectively reduce oxidative phosphorylation as determined from cockroach muscle mitochondria. DDT is more effective as was also determined for inhibition of oligomycin-sensitive Mg/sup 2 +/ATPase. The PCBs tested were uncouplers of oxidative phosphorylation. (JMT)

  10. Synanthropic Cockroaches (Blattidae: Periplaneta spp.) Harbor Pathogenic Leptospira in Colombia.

    Science.gov (United States)

    Gonzalez-Astudillo, Viviana; Bustamante-Rengifo, Javier A; Bonilla, Álvaro; Lehmicke, Anna Joy J; Castillo, Andrés; Astudillo-Hernández, Miryam

    2016-01-01

    Leptospirosis cases in Colombia are typically linked to peridomestic rodents; however, empirical data suggest that Leptospira-infected patients with no apparent exposure to these reservoirs are common. Cockroaches (Periplaneta spp.) have equal or greater interaction with humans than rodents, yet their potential role as carriers of Leptospira has not been assessed. We determined if pathogenic Leptospira is harbored by Periplaneta spp. in Cali (Colombia) and the variables influencing this relationship. Fifty-nine cockroaches were captured from seven sites and DNA was extracted from the body surface and digestive tract for a multiplex polymerase chain reaction, targeting genes secY and flaB. Logistic regression models and proportion tests showed a higher likelihood for Leptospira to be isolated from body surfaces (P > 0.001) and from individuals inside houses (six times more likely). These findings are the first to demonstrate an association between Periplaneta spp. and Leptospira, suggesting the need to investigate the potential for cockroaches to serve as reservoirs or transport hosts for Leptospira. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Reversible brain inactivation induces discontinuous gas exchange in cockroaches.

    Science.gov (United States)

    Matthews, Philip G D; White, Craig R

    2013-06-01

    Many insects at rest breathe discontinuously, alternating between brief bouts of gas exchange and extended periods of breath-holding. The association between discontinuous gas exchange cycles (DGCs) and inactivity has long been recognised, leading to speculation that DGCs lie at one end of a continuum of gas exchange patterns, from continuous to discontinuous, linked to metabolic rate (MR). However, the neural hypothesis posits that it is the downregulation of brain activity and a change in the neural control of gas exchange, rather than low MR per se, which is responsible for the emergence of DGCs during inactivity. To test this, Nauphoeta cinerea cockroaches had their brains inactivated by applying a Peltier-chilled cold probe to the head. Once brain temperature fell to 8°C, cockroaches switched from a continuous to a discontinuous breathing pattern. Re-warming the brain abolished the DGC and re-established a continuous breathing pattern. Chilling the brain did not significantly reduce the cockroaches' MR and there was no association between the gas exchange pattern displayed by the insect and its MR. This demonstrates that DGCs can arise due to a decrease in brain activity and a change in the underlying regulation of gas exchange, and are not necessarily a simple consequence of low respiratory demand.

  12. A behavioral syndrome linking courtship behavior toward males and females predicts reproductive success from a single mating in the hissing cockroach, Gromphadorhina portentosa

    OpenAIRE

    David M. Logue; Sandeep Mishra; David McCaffrey; Deborah Ball; William H. Cade

    2009-01-01

    Suites of correlated behaviors, or "behavioral syndromes," have been shown to occur throughout the animal kingdom. Behavioral syndromes involving sexual selection are expected to have significant evolutionary ramifications, but few studies have linked behavioral syndromes to sexual selection. We measured the behavior of male hissing cockroaches (Gromphadorhina portentosa) during male--male competition, female choice, and 3 other ecologically relevant contexts and quantified between-context co...

  13. Cockroaches ’ bacterial infections in wards of hospitals, Hamedan city, west of Iran

    Directory of Open Access Journals (Sweden)

    Nejati Jalil

    2012-10-01

    Full Text Available Objective: To identify the relationship between different species of cockroaches with their bacterial infection in different wards of Hamedan county hospitals, western Iran. Methods: Using sticky trap, hand collection and glass trap, 250 cockroaches were collected from 14 wards of 5 hospitals. After having their identification determined by detection key, all of them were used to isolate bacteria from cuticle and alimentary tract. Results: From four identified species, Blatella germanica were the most common in all of the wards (88.8% and next was the Periplaneta Americana (8%. 20 bacteria species isolated from cockroaches' surface and 21 from digestive organ. Escherichia coli were the most predominant bacteria isolated from external surface (26.5 % as well as alimentary tract (30.8%. The frequency of investigated bacteria on cockroaches' body surface was not significantly different between Periplaneta Americana and Blattella germanica except for Kllebsiella oxytoca (P<0.001 and Providensia Spp (P=0.035. Also, frequency of detected bacteria in cockroaches' digestive organ was not significantly different between these two species. Furthermore, the frequency of bacteria isolated from the cockroaches' external surface was not significantly different from that of digestive organ except for shigella disantery (P<0.001, Pseudomonas aeroginosa (P<0.001 and Klebsiella oxytoca (P=0.01 3. Conclusions: Since cockroaches can carry pathogenic bacteria, so their existence in the hospitals could be a serious public health problem. It is suggested to compile programs in order to control cockroaches especially in the hospitals.

  14. Microbial Carriage of Cockroaches at a Tertiary Care Hospital in Ghana

    Directory of Open Access Journals (Sweden)

    Patience B. Tetteh-Quarcoo

    2013-01-01

    Full Text Available Cockroaches are common in the environment of many hospitals in Ghana; however, little is known about their public health risks. To evaluate potential risks, we investigated the external and internal microbial flora of 61 cockroaches from a tertiary hospital in Ghana and evaluated the antibiotic resistance profiles of the common bacterial species. Standard methods were used in all the microbiological investigations and antibiotic susceptibility testing. A rotavirus carriage rate of 19.7% was observed among the cockroaches. Four types of intestinal parasites were carried externally by the cockroaches, and the most prevalent was Hookworm (4.9%. Eight nosocomial bacteria were isolated from the cockroaches, and the most prevalent was Klebsiella pneumoniae , which occurred internally in 29.5% of the cockroaches and 26.2% externally. Multiple drug resistance among common bacteria isolated from the cockroaches ranged from 13.8% ( Escherichia coli to 41.1% ( Klebsiella pneumoniae . Cockroaches constitute an important reservoir for pathogenic microorganisms, and may be important vectors of multiple resistant nosocomial pathogens in the studied hospital.

  15. Chow Down! Using Madagascar Hissing Cockroaches to Explore Basic Nutrition Concepts

    Science.gov (United States)

    Wagler, Ron

    2009-01-01

    The Madagascar hissing cockroach ("Gromphadorhina portentosa") is one of the most exciting and enjoyable animals to incorporate into your science curriculum. Madagascar hissing cockroaches (MHCs) do not bite, are easy to handle, produce little odor compared to many terrarium animals, have a fascinating social structure, are easy to breed, teach…

  16. Cloning and characterization of the adipokinetic hormone receptor from the cockroach Periplaneta americana

    DEFF Research Database (Denmark)

    Hansen, Karina K; Hauser, Frank; Cazzamali, Giuseppe

    2006-01-01

    Cockroaches have long been used as insect models to investigate the actions of biologically active neuropeptides. Here, we describe the cloning and functional expression in Chinese hamster ovary cells of an adipokinetic hormone (AKH) G protein-coupled receptor from the cockroach Periplaneta ameri...

  17. Comparative analysis of pathogenic organisms in cockroaches from different community settings in Edo State, Nigeria.

    Science.gov (United States)

    Isaac, Clement; Orue, Philip Ogbeide; Iyamu, Mercy Itohan; Ehiaghe, Joy Imuetiyan; Isaac, Osesojie

    2014-04-01

    Cockroaches are abundant in Nigeria and are seen to harbour an array of pathogens. Environmental and sanitary conditions associated with demographic/socio-economic settings of an area could contribute to the prevalence of disease pathogens in cockroaches. A total of 246 cockroaches (Periplaneta americana) in urban (Benin, n=91), semi-urban (Ekpoma, n=75) and rural (Emuhi, n=70) settings in Edo State, Nigeria were collected within and around households. The external body surfaces and alimentary canal of these cockroaches were screened for bacterial, fungal, and parasitological infections. Bacillus sp. and Escherichia coli were the most common bacteria in cockroaches. However, Enterococcus faecalis could not be isolated in cockroaches trapped from Ekpoma and Emuhi. Aspergillus niger was the most prevalent fungus in Benin and Ekpoma, while Mucor sp. was predominant in Emuhi. Parasitological investigations revealed the preponderance of Ascaris lumbricoides in Benin and Emuhi, while Trichuris trichura was the most predominant in Ekpoma. The prevalence and burden of infection in cockroaches is likely to be a reflection of the sanitary conditions of these areas. Also, cockroaches in these areas making incursions in homes may increase the risk of human infections with these disease agents.

  18. Pseudoanaplectinia yumotoi, A New Ovoviviparous Myrmecophilous Cockroach Genus and Species from Sarawak (Blattaria: Blattellidae; Blattellinae)

    OpenAIRE

    Roth, Louis M.

    1995-01-01

    Pseudoanaplectinia yumotoi, a new myrmecophilous cockroach genus and species, is described from Sarawak. Based on the male genital phallomeres, it is placed in the Blattellidae: Blattellinae. The genus is ovoviviparous and probably arose from an anaplectinoid-like ancestor. This is the third case of ovoviviparity arising in the Blattellidae. The cockroach has a symbiotic relationship with an ant Crematogaster sp.

  19. Pseudoanaplectinia yumotoi, A New Ovoviviparous Myrmecophilous Cockroach Genus and Species from Sarawak (Blattaria: Blattellidae; Blattellinae

    Directory of Open Access Journals (Sweden)

    Louis M. Roth

    1995-01-01

    Full Text Available Pseudoanaplectinia yumotoi, a new myrmecophilous cockroach genus and species, is described from Sarawak. Based on the male genital phallomeres, it is placed in the Blattellidae: Blattellinae. The genus is ovoviviparous and probably arose from an anaplectinoid-like ancestor. This is the third case of ovoviviparity arising in the Blattellidae. The cockroach has a symbiotic relationship with an ant Crematogaster sp.

  20. Investigation on American cockroaches medically important bacteria in Khorramshahr hospital, Iran

    Directory of Open Access Journals (Sweden)

    Hamid Kassiri

    2014-06-01

    Full Text Available Objective: To investigate American cockroaches' infection to various bacteria in Khorramshahr Vali-e-Asr hospital, which was done in 2008. Methods: In this descriptive cross-sectional study, 20 American cockroaches were caught via direct collection. Medically important bacteria were extracted from their outer surface of bodies by standard procedures. Results: Culturing outer surface wash of cockroaches resulted in the separation of Klebsiella, Pseudomonas, Escherichia coli, Staphylococcus, Proteus and Streptococcus. The main common bacteria were Klebsiella (35% and Pseudomonas (30%. Also, results of culture media showed that about 90% of cockroaches infected to at least one bacterium. Conclusions: American cockroaches can transmit pathogenic and potential pathogenic bacteria, therefore their presence in hospitals may be a sanitation challenge. It is recommended to assess plans in purpose to combat these pests in the hospitals.

  1. Effects of uv irradiation of nymphs of Blattella germanic and Periplaneta americana

    International Nuclear Information System (INIS)

    Cohen, S.H.; Sousa, J.A.; Roach, J.F.; Gingrich, J.B.

    1975-01-01

    Certain effects of uv irradiation on nymphs of the American cockroach, Periplaneta americana (L.), and the German cockroach, Blattella germanica (L.), were investigated. Of 7 wavelengths to which the nymphs were exposed, 254 and 265 nm were the most effective in producing mortality. The approximate LD 50 dose for nymphs exposed to germicidal (254 nm) uv was 4.56 x 10 4 μ j cm -2 for P. americana and 1.9 x 10 4 μj cm -2 for B. germanica. UV irradiation resulted in retarded feeding and delay in weight gain and molting. Structural abnormalities were observed among adults of those nymphs which were exposed to either pulsed or continuous uv. Pulsed uv was more effective in producing mortality than continuous uv exposure. Nymphs lured to a specific area by food, water, food and water, contaminated filter paper, or filter paper containing a crude extract of aggregation pheromone were killed when irradiated with germicidal (254 nm) uv

  2. The Use of Genetic Mechanisms and Behavioral Characteristics to Control Natural Populations of the German Cockroach.

    Science.gov (United States)

    1982-03-01

    supported by this Contract, Brian L. Bret (M.S. thesis research, directed by M. H. Ross). The experiment was conducted in glass acquaria measuring 32 cm x 22...harborages were supplied for each replicate. The acquaria were washed thoroughly after each use. -2- The statistical analysis was done with the help of Dr...corner of the acquaria or in cracks betweenthe shelters. However, within the shelter, their aggregation was clearly related to that of other components

  3. Further studies on the multiple effects of carbon dioxide anesthesia in the German cockroach, Blattella germanica

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, A.

    Effects of repeated carbon dioxide anesthesia during particular instars on the number of molts, larval duration and the body size of resulting adults were investigated. Concentration of carbon dioxide administered was 70%, and each anesthesia lasted for 5 min. Anesthesia was repeated four times during a particular instar. Anesthesia administered during the 1st, 2nd, or 3rd instar increased the number of instars required to reach maturity. When larvae were anesthetized during both the 1st and 2nd instar, the number of instars was greatly increased. However, anesthesia during the 4th instar scarcely influenced the number of instars. On the other hand, repeated anesthesia prolonged larval duration whenever administered from the 1st instar through the 4th. The body size of resulting adults remained almost the same as that for controls after the repeated carbon dioxide anesthesia during larval life. Detailed analyses of adult sizes, however, revealed that tibia length was more affected with the gas than femur length. The ratio of tibia length to femur length was also influenced by the experience of extra molt(s).

  4. Leg Regrowth in Blaberus discoidalis (Discoid Cockroach following Limb Autotomy versus Limb Severance and Relevance to Neurophysiology Experiments.

    Directory of Open Access Journals (Sweden)

    Timothy C Marzullo

    Full Text Available Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1 the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2 the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds.First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (p<0.05 than coxa-cut legs (29% of full size at first appearance. Regenerated legs in both groups grew in size with each subsequent molt; the autotomy-removed legs grew to full size within 18 weeks, whereas coxa-cut legs took longer than 28 weeks to regrow. Removal of the metathoracic leg in both conditions did not have an effect on mortality compared to matched controls with unmolested legs.Autotomy-removed legs had lower spontaneous firing rates, similar marked increased firing rates upon tactile manipulation of tibial barbs, and a 10% higher electrical microstimulation threshold for movement.It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content.

  5. [Asymmetry of antennal grooming in the cockroach (Periplaneta americana)].

    Science.gov (United States)

    2014-07-01

    The present study was conducted to determine the key features of antennal grooming of male American cockroaches in neutral circumstances. It was shown for the first time that the right antenna was cleaned significantly more often than the left one, which indicates the presence of functional asymmetry of antennal grooming in this insect species. At the same time, no statistically significant asymmetry was found for grooming of antennal bases and legs. Morphological asymmetries of antennae and legs and/or brain lateralization are the plausible sources of observed behavioral asymmetry in antennal grooming.

  6. Medically Important Parasites Carried by Cockroaches in Melong Subdivision, Littoral, Cameroon

    Directory of Open Access Journals (Sweden)

    R. J. Atiokeng Tatang

    2017-01-01

    Full Text Available Cockroaches have been recognized as mechanical vectors of pathogens that can infest humans or animals. A total of 844 adult cockroaches (436 males and 408 females were caught. In the laboratory, cockroaches were first washed in saturated salt solution to remove ectoparasites and then rinsed with 70% alcohol, dried, and dissected for endoparasites. An overall transport rate of 47.39% was recorded. Six genera of parasites were identified. These were Ascaris (33.76%, Trichuris (11.97%, Capillaria (6.16%, Toxocara (4.86%, Hook Worm (4.86%, and Eimeria (2.73%. The parasites were more recorded on the external surface (54.27% of cockroaches than in the internal surface (GIT, 38.51%. The same tendency was obtained between sexes with female cockroaches having a higher transport rate (36.69%. Cockroaches caught in toilets carried more parasites (31.99% as compared to those from kitchens (22.63% and houses (11.14%. Almost all encountered parasites were recognized as responsible of zoonosis and they can be consequently released in nature by hosts and easily disseminated by cockroaches as mechanical vectors. Sanitary education, reenforcement of worms’ eradication programs, and the fight against these insects remain a necessity in the Mélong Subdivision.

  7. Gut Bacterial Community of the Xylophagous Cockroaches Cryptocercus punctulatus and Parasphaeria boleiriana

    Science.gov (United States)

    Berlanga, Mercedes; Llorens, Carlos; Comas, Jaume; Guerrero, Ricardo

    2016-01-01

    Cryptocercus punctulatus and Parasphaeria boleiriana are two distantly related xylophagous and subsocial cockroaches. Cryptocercus is related to termites. Xylophagous cockroaches and termites are excellent model organisms for studying the symbiotic relationship between the insect and their microbiota. In this study, high-throughput 454 pyrosequencing of 16S rRNA was used to investigate the diversity of metagenomic gut communities of C. punctulatus and P. boleiriana, and thereby to identify possible shifts in symbiont allegiances during cockroaches evolution. Our results revealed that the hindgut prokaryotic communities of both xylophagous cockroaches are dominated by members of four Bacteria phyla: Bacteroidetes, Firmicutes, Proteobacteria, and Actinobacteria. Other identified phyla were Spirochaetes, Planctomycetes, candidatus Saccharibacteria (formerly TM7), and Acidobacteria, each of which represented 1–2% of the total population detected. Community similarity based on phylogenetic relatedness by unweighted UniFrac analyses indicated that the composition of the bacterial community in the two species was significantly different (P cockroach species clustered with sequences previously described in termites and other cockroaches, but not with those from other animals or environments. These results suggest that, during their evolution, those cockroaches conserved several bacterial communities from the microbiota of a common ancestor. The ecological stability of those microbial communities may imply the important functional role for the survival of the host of providing nutrients in appropriate quantities and balance. PMID:27054320

  8. Cockroaches as a Source of High Bacterial Pathogens with Multidrug Resistant Strains in Gondar Town, Ethiopia.

    Science.gov (United States)

    Moges, Feleke; Eshetie, Setegn; Endris, Mengistu; Huruy, Kahsay; Muluye, Dagnachew; Feleke, Tigist; G/Silassie, Fisha; Ayalew, Getenet; Nagappan, Raja

    2016-01-01

    Background. Cockroaches are source of bacterial infections and this study was aimed to assess bacterial isolates and their antimicrobial profiles from cockroaches in Gondar town, Ethiopia. Methods. A total of 60 cockroaches were collected from March 1 to May 30, 2014, in Gondar town. Bacterial species were isolated from external and internal parts of cockroaches. Disk diffusion method was used to determine antibiotic susceptibility patterns. Data were entered and analyzed by using SPSS version 20; P values cockroaches, respectively. Klebsiella pneumoniae 32 (17.7%), Escherichia coli 29 (16%), and Citrobacter spp. 27 (15%) were the predominant isolates. High resistance rate was observed to cotrimoxazole, 60 (33.1%), and least resistance rate was noted to ciprofloxacin, 2 (1.1%). Additionally, 116 (64.1%) of the isolates were MDR strains; Salmonella spp. were the leading MDR isolates (100%) followed by Enterobacter (90.5%) and Shigella spp. (76.9%). Conclusion. Cockroaches are the potential source of bacteria pathogens with multidrug resistant strains and hence effective preventive and control measures are required to minimize cockroach related infections.

  9. Chemical disguise of myrmecophilous cockroaches and its implications for understanding nestmate recognition mechanisms in leaf-cutting ants.

    Science.gov (United States)

    Nehring, Volker; Dani, Francesca R; Calamai, Luca; Turillazzi, Stefano; Bohn, Horst; Klass, Klaus-Dieter; d'Ettorre, Patrizia

    2016-08-05

    Cockroaches of the genus Attaphila regularly occur in leaf-cutting ant colonies. The ants farm a fungus that the cockroaches also appear to feed on. Cockroaches disperse between colonies horizontally (via foraging trails) and vertically (attached to queens on their mating flights). We analysed the chemical strategies used by the cockroaches to integrate into colonies of Atta colombica and Acromyrmex octospinosus. Analysing cockroaches from nests of two host species further allowed us to test the hypothesis that nestmate recognition is based on an asymmetric mechanism. Specifically, we test the U-present nestmate recognition model, which assumes that detection of undesirable cues (non-nestmate specific substances) leads to strong rejection of the cue-bearers, while absence of desirable cues (nestmate-specific substances) does not necessarily trigger aggression. We found that nests of Atta and Acromyrmex contained cockroaches of two different and not yet described Attaphila species. The cockroaches share the cuticular chemical substances of their specific host species and copy their host nest's colony-specific cuticular profile. Indeed, the cockroaches are accepted by nestmate but attacked by non-nestmate ant workers. Cockroaches from Acromyrmex colonies bear a lower concentration of cuticular substances and are less likely to be attacked by non-nestmate ants than cockroaches from Atta colonies. Nest-specific recognition of Attaphila cockroaches by host workers in combination with nest-specific cuticular chemical profiles suggest that the cockroaches mimic their host's recognition labels, either by synthesizing nest-specific substances or by substance transfer from ants. Our finding that the cockroach species with lower concentration of cuticular substances receives less aggression by both host species fully supports the U-present nestmate recognition model. Leaf-cutting ant nestmate recognition is thus asymmetric, responding more strongly to differences than to

  10. Pavlov's cockroach: classical conditioning of salivation in an insect.

    Directory of Open Access Journals (Sweden)

    Hidehiro Watanabe

    Full Text Available Secretion of saliva to aid swallowing and digestion is an important physiological function found in many vertebrates and invertebrates. Pavlov reported classical conditioning of salivation in dogs a century ago. Conditioning of salivation, however, has been so far reported only in dogs and humans, and its underlying neural mechanisms remain elusive because of the complexity of the mammalian brain. We previously reported that, in cockroaches Periplaneta americana, salivary neurons that control salivation exhibited increased responses to an odor after conditioning trials in which the odor was paired with sucrose solution. However, no direct evidence of conditioning of salivation was obtained. In this study, we investigated the effects of conditioning trials on the level of salivation. Untrained cockroaches exhibited salivary responses to sucrose solution applied to the mouth but not to peppermint or vanilla odor applied to an antenna. After differential conditioning trials in which an odor was paired with sucrose solution and another odor was presented without pairing with sucrose solution, sucrose-associated odor induced an increase in the level of salivation, but the odor presented alone did not. The conditioning effect lasted for one day after conditioning trials. This study demonstrates, for the first time, classical conditioning of salivation in species other than dogs and humans, thereby providing the first evidence of sophisticated neural control of autonomic function in insects. The results provide a useful model system for studying cellular basis of conditioning of salivation in the simpler nervous system of insects.

  11. The professional perspective on patient involvement in the development of quality indicators: a qualitative analysis using the example of chronic heart failure in the German health care setting

    Directory of Open Access Journals (Sweden)

    Pohontsch NJ

    2015-01-01

    Full Text Available Nadine Janis Pohontsch,1 Heidrun Herzberg,2 Stefanie Joos,3 Felix Welti,4 Martin Scherer,1 Eva Blozik1 1Department of Primary Medical Care, University Medical Center Hamburg-Eppendorf, Hamberg, Germany; 2Faculty of Health, Nursing, Management, Neubrandenburg University of Applied Sciences, Neubrandenburg, Germany; 3Department of General Practice and Health Services Research, Heidelberg University Hospital, Heidelberg, Germany; 4Faculty of Human Sciences, University of Kassel, Kassel, Germany Purpose: There is an international consensus that quality indicators (QIs of health care ought to represent patient-relevant aspects. Therefore, patient involvement in the development process is essential. However, there is no methodological gold standard for involving patients in QI development. The aim of this study is to explore experts’ views on the representation of patient-relevant aspects in the QI development process using the QIs developed in the context of the German National Disease Management Guideline for Heart Failure as an example. Methods: Semi-structured, open telephone interviews were conducted with 15 German experts (patient representatives, physicians, researchers, and methodologists involved in guideline development or quality assessment. Interview themes were the relevance of the exemplary set of QIs for patients, as well as the legitimacy of, competence of, and collaboration with the patient representative who participated in the development process. Interviews were fully transcribed and content analyzed. Deductive categories derived from the research questions were supplemented by inductively formed categories during the review of the interview material.Results: The qualitative analysis suggests a discrepancy between the guidelines’ QIs and those relevant to patients from an expert’s point of view, such as physician-patient communication and quality of counseling. Experts reported only minor communication and cooperation

  12. Cockroaches (Blattella germanica) as carriers of microorganisms of medical importance in hospitals.

    OpenAIRE

    Fotedar, R.; Shriniwas, U. B.; Verma, A.

    1991-01-01

    A study was conducted to isolate and identify microorganisms of medical importance from cockroaches (Blattella germanica) and to ascertain their vector potential in the epidemiology of nosocomial infections. Bacteria, fungi and parasites of medical importance were isolated and identified. Important bacterial pathogens responsible for wound infections, were further studies by antibiograms. One hundred and fifty-eight out of 159 (99.4%) cockroaches collected from hospital (test) and 113 out of ...

  13. Cockroaches (Insecta, Blattodea from caves of Polillo Island (Philippines, with description of a new species

    Directory of Open Access Journals (Sweden)

    Cristian C. Lucanas

    2016-09-01

    Full Text Available Cockroaches collected during a protracted series of fieldwork in several limestone caves in Polillo Island, Philippines were taxonomically studied. A new species of Nocticola (Nocticolidae, N. gonzalezi Lucañas & Lit, sp. n., is described. The male of Periplaneta banksi Hanitsch (Blattidae is described for the first time. Altogether, the present cave cockroach fauna of the island consists of six species.

  14. Microbial Carriage of Cockroaches at a Tertiary Care Hospital in Ghana

    OpenAIRE

    Eric S. Donkor; Patience B. Tetteh-Quarcoo; Patrick F. Ayeh-Kumi; Simon K. Attah; Kwabena O. Duedu; Emmanuel Afutu; Isaac Boamah; Michael Olu-Taiwo; Isaac Anim-Baidoo

    2013-01-01

    Cockroaches are common in the environment of many hospitals in Ghana; however, little is known about their public health risks. To evaluate potential risks, we investigated the external and internal microbial flora of 61 cockroaches from a tertiary hospital in Ghana and evaluated the antibiotic resistance profiles of the common bacterial species. Standard methods were used in all the microbiological investigations and antibiotic susceptibility testing. A rotavirus carriage rate of 19.7% was o...

  15. Bacterial, fungal and parasitic contamination of cockroaches in public hospitals of Hamadan, Iran.

    Science.gov (United States)

    Salehzadeh, A; Tavacol, P; Mahjub, H

    2007-06-01

    To determine the possible role of cockroaches in dissemination of medically important microorganisms, a study was carried out in public hospitals and residential areas of Hamadan city, west of Iran. Bacteria, fungi and parasites of medical importance were isolated and identified. The total number of Blattella germanica collected from hospitals were 133 as the case group. The cockroaches collected from residential areas were 45 as the control group. A total of 178 cockroaches were collected, over a period of two years (133 from hospitals; and 45 from residential areas) in Hamadan. Medically important microorganisms were isolated from external and internal surfaces using standard methods. In the case group, 130 out of 133 (98%) Blattella germanica showed contamination with high bacterial load (more than 1 x 10(3)) whereas only 2 out of 45 (4.45%) cockroaches of the control group were carrying medically important bacteria with high bacterial load. Bacteriological examinations revealed that almost all test cockroaches had at least one of the following microorganisms either in their body surface or digestive tract. Enterobacter (22.6%), Klebsiela (21%), Enterococcus (17.3%), Staphylococcus (16.5%), Esherichia coli and Streptococcus (8.3%), Pseudomonas (3%), and also Shigella, Haemophilus and group A beta-hemolytic Streptococcus each less than 1%. In addition the results showed (74.4.%) of test cockroaches harboured fungi-Candida (48.9%), Mucor (10.5%), Aspergillus niger (7.5%), Rhizopus (4.5) and also Penicillium and Aspergillus fumigans each 1.5%. Some parasitic worms of medical importance were also isolated from the test cockroaches, but carriage rates were low. The data from this study emphasise the importance of cockroaches as potential vectors of medically important microorganisms such as pathogenic bacteria and fungi in hospital environments.

  16. Grooming behavior in American cockroach is affected by novelty and odor.

    Science.gov (United States)

    Zhukovskaya, Marianna I

    2014-01-01

    The main features of grooming behavior are amazingly similar among arthropods and land vertebrates and serve the same needs. A particular pattern of cleaning movements in cockroaches shows cephalo-caudal progression. Grooming sequences become longer after adaptation to the new setting. Novelty related changes in grooming are recognized as a form of displacement behavior. Statistical analysis of behavior revealed that antennal grooming in American cockroach, Periplaneta americana L., was significantly enhanced in the presence of odor.

  17. Profile of antimicrobial resistance of bacteria isolated from cockroaches (Periplaneta americana) in a Brazilian health care institution

    OpenAIRE

    Prado, Marinésia Aparecida; Gir, Elucir; Pereira, Milca Severino; Reis, Cleomenes; Pimenta, Fabiana Cristina

    2006-01-01

    Cockroaches carry microorganisms to sterilized materials, equipment and non-contaminated food in hospitals and in homes. Hence, they are regarded as major microbial vectors. We isolated and identified microorganisms from living cockroaches captured from a Brazilian health care institution and we determined the antimicrobial susceptibility profile of the isolates. Following collection, cockroaches were immobilized at 4ºC for 10 to 20 minutes, immersed in 0.8% saline solution and then homogeniz...

  18. Deterministic Assembly of Complex Bacterial Communities in Guts of Germ-Free Cockroaches.

    Science.gov (United States)

    Mikaelyan, Aram; Thompson, Claire L; Hofer, Markus J; Brune, Andreas

    2016-02-15

    The gut microbiota of termites plays important roles in the symbiotic digestion of lignocellulose. However, the factors shaping the microbial community structure remain poorly understood. Because termites cannot be raised under axenic conditions, we established the closely related cockroach Shelfordella lateralis as a germ-free model to study microbial community assembly and host-microbe interactions. In this study, we determined the composition of the bacterial assemblages in cockroaches inoculated with the gut microbiota of termites and mice using pyrosequencing analysis of their 16S rRNA genes. Although the composition of the xenobiotic communities was influenced by the lineages present in the foreign inocula, their structure resembled that of conventional cockroaches. Bacterial taxa abundant in conventional cockroaches but rare in the foreign inocula, such as Dysgonomonas and Parabacteroides spp., were selectively enriched in the xenobiotic communities. Donor-specific taxa, such as endomicrobia or spirochete lineages restricted to the gut microbiota of termites, however, either were unable to colonize germ-free cockroaches or formed only small populations. The exposure of xenobiotic cockroaches to conventional adults restored their normal microbiota, which indicated that autochthonous lineages outcompete foreign ones. Our results provide experimental proof that the assembly of a complex gut microbiota in insects is deterministic. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  19. Juvenile hormone and the ontogeny of cockroach aggression.

    Science.gov (United States)

    Kou, Rong; Chou, Szu-Ying; Chen, Shu-Chun; Huang, Zachary Y

    2009-09-01

    Our previous study [Kou et al., 2008. Juvenile hormone levels are increased in winners of cockroach fights. Horm. Behav. 52, 252-260] showed that the basic principle of the challenge hypothesis (hormone levels can respond to social stimuli to modulate aggression in vertebrates] could be applied to juvenile hormone (JH) levels and aggression in the lobster cockroach Nauphoeta cinerea. In that study, 80- to 85-day-old socially naïve males were used, as fighting is much more easily initiated in these older animals than in younger males, and JH III levels in the dominant were found to be significantly increased after an encounter compared to before the encounter and were significantly higher than those in the subordinates. In N. cinerea, newly emerged males usually show no aggressiveness towards each other and aggression is only initiated after several days of close contact. To investigate the development of aggression from an early age, in the present study, newly emerged males were paired to investigate the relationship between JH levels and aggression. The results showed that injection of JH III significantly increased the probability of the young males being fight winners. In each age group in which aggression was initiated, the dominants had significantly higher JH levels than either the subordinates or the same aged non-fighters. JH injection of subordinates on the day of rank establishment had no effect on the probability of rank switch. These results indicate that, (i) in newly emerged male pairs, JH plays a decisive role in rank establishment and the fact that dominant status is significantly associated with a higher JH titer and subordinate status with a lower JH titer is consistent with the basic principle of the challenge hypothesis, and (ii) after rank establishment, the lack of effect of JH treatment on rank change is consistent with the idea of "social inertia" in vertebrates.

  20. Rubella (German Measles)

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español Rubella (German Measles) KidsHealth / For Parents / Rubella (German Measles) ... Call the Doctor Print en español Rubéola About Rubella Rubella — commonly known as German measles or 3- ...

  1. Rare earth germanates

    International Nuclear Information System (INIS)

    Bondar', I.A.; Vinogradova, N.V.; Dem'yanets, L.N.

    1983-01-01

    From the viewpoint of structural chemistry and general regularities controlling formation reactions of compounds and phases in melts, solid and gaseous states, recent achievements in the chemistry of rare earth germanates are generalized. Methods of synthesizing germanates, systems on the base of germanium oxides and rare earths are considered. The data on crystallochemical characteristics are tabulated. Individual compounds of scandium germanate are also characterized. Processes of germanate formation using the data of IR-spectroscopy, X-ray phase analysis are studied. The structure and morphotropic series of rare earth germanates and silicates are determined. Fields of their present and possible future application are considered

  2. Quality control of involved-field radiotherapy for patients with early stage Hodgkin's lymphoma based on a central prospective review. Comparison of the results between two study generations of the German Hodgkin Study Group

    Energy Technology Data Exchange (ETDEWEB)

    Kriz, J.; Haverkamp, U.; Eich, H.T. [Muenster Univ. (Germany). Dept. of Radiation Oncology; Bangard, C. [Koeln Univ. (Germany). Dept. of Radiology; Bongartz, R.; Baues, C.; Mueller, R.P. [Koeln Univ. (Germany). Dept. of Radiation Oncology; Engert, A. [Koeln Univ. (Germany). Dept. of Medical Oncology

    2012-08-15

    Purpose: Based on experience in trials HD10 and HD11 (1998-2003), the radiotherapy reference center of the German Hodgkin Study Group (GHSG) continued their central prospective radiation oncological review in trials HD13 and HD14. The purpose of this analysis was to identify the impact of this procedure on radiotherapeutic management and to compare findings with former trials. Methods: Between 2003 and 2009, 1,710 patients were enrolled in the HD13 trial (early favorable stages) and 2,039 patients in the HD14 trial (early unfavorable stages). All patients received a total of 30 Gy involved-field (IF) radiotherapy within a combined modality approach. Results: For patients in HD13, there was a correction of disease involvement in 847/1,518 patients (56%), and for patients in HD14 in 1,370/1,905 patients (72%). Most discrepancies were observed in the lower mediastinum (19.2%), infraclavicular (31.7%), upper cervical (12.7%), and supraclavicular (10.8%) lymph nodes. This resulted in a change of disease stage in 241 (7%) patients and a shift into another study protocol in 66 (2%) patients. Due to the incorrect lymph node documentation of the participating study centers, the IF radiotherapy volume had to be enlarged in 1,063/3,423 patients (31%) and reduced in 244/3,423 patients (7.1%). These findings are comparable to the results of the quality control in the trials HD10 and HD11 (2,611 patients reviewed). Conclusion: Central review of the diagnostic imaging and clinical findings of Hodgkin's lymphoma patients shows a considerable number of discrepancies compared with the local evaluation. Thus, meticulous evaluation of all imaging information in close collaboration between the radiation oncologist and diagnostic radiologist is mandatory. (orig.)

  3. Effect of thiamethoxam on cockroach locomotor activity is associated with its metabolite clothianidin.

    Science.gov (United States)

    Benzidane, Yassine; Touinsi, Sarra; Motte, Emilie; Jadas-Hécart, Alain; Communal, Pierre-Yves; Leduc, Lionel; Thany, Steeve H

    2010-12-01

    In the present study, the effect of thiamethoxam and clothianidin on the locomotor activity of American cockroach, Periplaneta americana (L.), was evaluated. Because it has been proposed that thiamethoxam is metabolised to clothianidin, high-performance liquid chromatography coupled with mass spectrometry was used to evaluate the amount of clothianidin on thiamethoxam-treated cockroaches. One hour after neonicotinoid treatment, the time spent in the open-field-like apparatus significantly increased, suggesting a decrease in locomotor activity. The percentage of cockroaches displaying locomotor activity was significantly reduced 1 h after haemolymph application of 1 nmol g(-1) neonicotinoid, while no significant effect was found after topical and oral administration. However, at 24 and 48 h, all neonicotinoids were able to reduce locomotor activity, depending on their concentrations and the way they were applied. Interestingly, it was found that thiamethoxam was converted to clothianidin 1 h after application, but the amount of clothianidin did not rise proportionately to thiamethoxam, especially after oral administration. The data suggest that the effect of thiamethoxam on cockroach locomotor activity is due in part to clothianidin action because (1) thiamethoxam levels remained persistent 48 h after application and (2) the amount of clothianidin in cockroach tissues was consistent with the toxicity of thiamethoxam. Copyright © 2010 Society of Chemical Industry.

  4. Design and Implementation of Markerless Augmented Reality Application for Cockroach Phobia Therapy Using Adaptive Threshold

    Directory of Open Access Journals (Sweden)

    Fiandra Fatharany

    2017-01-01

    Full Text Available Augmented reality (AR technology is useful for treating several psychological problems, including phobias such as fear of flying, agoraphobia, claustrophobia, and phobia to insects and small animals. However, the currently existing applications for therapy of cockroach phobia that uses AR technology are still very dependent towards the presence of markers, which might lessen the feeling of being in an actual scenario from everyday lives. In this paper, we created a system that is able to use everyday things as a replacement for markers for phobia therapy for cockroach. There are five main processes: getting the live streaming feed from camera, preprocessing, extracting the center point of the objects, tracking the marker-substitute objects, and lastly, instantiating cockroaches randomly after user lifts the objects according to the number and mode of the cockroaches, whether it is moving or not, that are predetermined by the user. The evaluation in this paper includes eight participants that are carefully selected based on their Fear of Spiders Questionnaire (FSQ score that is translated into Indonesian and modified to accommodate cockroaches instead of spiders. The results is that the system can induce anxiety level on participants with the highest score of 10, which is the highest score in Standard Unit of Discomfort scale (SUDs. While the presence and reality judgment of this paper has the highest score of 7 which is also the highest score in Slater-Usoh-Steed Questionnaire (SUS.

  5. INVESTIGATION OF BACTERIOLOGICAL INFECTIONS OF THE AMERICAN COCKROACHES IN PAVEH CITY, KERMANSHAH PROVINCE

    Science.gov (United States)

    Sayyad, Sirvan; Vahabi, Ahmad; Vahabi, Boshra; Sayyadi, Mahnaz; Sahne, Shahnaz Haji

    2016-01-01

    Introduction: American cockroaches, Periplaneta americana, are the most important pests in hospitals and dwelling environments. They are mechanical vectors of some bacterial pathogens. Goal: The present investigation was carried out in Ghods hospital and 5 dwelling localities of Paveh city to evaluate bacterial infestations of American cockroaches in this region of Iran. Methods: The samples were randomly collected from hospital environments and toilets and kitchens of the dwelling localities from December-March 2012 and July-September 2013. The samples were captured using sterile test tubes and sterile hand gloves. Results: Totally, 98 cockroaches were collected from hospital (45.9%) and dwelling (54.1%) environments. Eight groups of bacteria including: Pseudomonas spp., Proteus spp., Klebsiella spp., Staphylococcus spp., Bacillus spp., Serratia spp., Entrobacter spp. and Escherichia coli were extracted. Conclusions: The findings of the present study revealed that the American cockroaches are very important in transmission of some bacterial pathogens, so health education and using the effective control methods to elimination and reduction of cockroaches are necessary. PMID:27047261

  6. A German format for pupils’ training

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    Every year CERN welcomes thousands of pupils from schools worldwide for a half-day visit to the Laboratory. However, since 2011 about ten selected students from Germany have been given the opportunity to experience CERN in much greater depth. They are fully sponsored by the German Ministry of Education and supported by an organising structure at TU Dresden - the Dresden University of Technology - led by Michael Kobel. It’s an investment that's paying off in Germany.   The German teachers who participated in the “Netzwerk Teilchenwelt” project, at CERN last week. “Netzwerk Teilchenwelt” is a project that involves 23 German universities, the DESY Laboratory, several schools and, of course, CERN. Launched in 2010 with a contribution from the German Ministry for Science and Research of about 1 million euros over three years, the project has so far involved over 4,000 students and 500 teachers. “Thanks to this project, both pupils...

  7. Maury Journals - German Vessels

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — German vessels observations, after the 1853 Brussels Conference that set International Maritime Standards, modeled after Maury Marine Standard Observations.

  8. Transcriptome analysis and RNA interference of cockroach phototransduction indicate three opsins and suggest a major role for TRPL channels

    Directory of Open Access Journals (Sweden)

    Andrew S French

    2015-07-01

    Full Text Available Our current understanding of insect phototransduction is based on a small number of species, but insects occupy many different visual environments. We created the retinal transcriptome of a nocturnal insect, the cockroach, Periplaneta americana to identify proteins involved in the earliest stages of compound eye phototransduction, and test the hypothesis that different visual environments are reflected in different molecular contributions to function. We assembled five novel mRNAs: two green opsins, one UV opsin, and one each TRP and TRPL ion channel homologs. One green opsin mRNA (pGO1 was 100-1000 times more abundant than the other opsins (pGO2 and pUVO, while pTRPL mRNA was 10 times more abundant than pTRP, estimated by transcriptome analysis or quantitative PCR (qPCR. Electroretinograms were used to record photoreceptor responses. Gene-specific in vivo RNA interference (RNAi was achieved by injecting long (596-708 bp double-stranded RNA into head hemolymph, and verified by qPCR. RNAi of the most abundant green opsin reduced both green opsins by more than 97% without affecting UV opsin, and gave a maximal reduction of 75% in ERG amplitude seven days after injection that persisted for at least 19 days. RNAi of pTRP and pTRPL genes each specifically reduced the corresponding mRNA by 90%. Electroretinogram reduction by pTRPL RNAi was slower than for opsin, reaching 75% attenuation by 21 days, without recovery at 29 days. pTRP RNAi attenuated ERG much less; only 30% after 21 days. Combined pTRP plus pTRPL RNAi gave only weak evidence of any cooperative interactions. We conclude that silencing retinal genes by in vivo RNAi using long dsRNA is effective, that visible light transduction in Periplaneta is dominated by pGO1, and that pTRPL plays a major role in cockroach phototransduction.

  9. The majority of cockroaches from the Samutprakarn province of Thailand are carriers of parasitic organisms.

    Science.gov (United States)

    Chamavit, Pennapa; Sahaisook, Panupong; Niamnuy, Nunthawadee

    2011-01-01

    We undertook a study of the mechanical transmission of parasitic organisms in cockroaches in the Samutprakarn province of Thailand. In this study, 920 cockroaches were obtained from 18 open-air shopping markets in 5 districts and 1 subdistrict of this province. All cockroaches were captured during their feeding time in their natural habitat. Direct wet smear and modified acid-fast bacilli staining were used to identify the parasites from the external surface or cuticle of the cockroaches. The results show that 498 (54.1 %) of the cockroaches harbored parasitic organisms. Of these, 56.1 % were protozoa and the remaining 43.9 % were helminthes (pathogenic helminthes- 1.4 %, non-pathogenic helminthes- 42.5 %). Of the pathogenic helminthes, the species included Strongyloides stercoralis (6 instances of the free-living adult male, 0.8 %), Ascaris lumbricoides (2 decorticated eggs, 0.3 %), Trichuris trichiura (2, 0.3 %), and Taenia spp . (1 egg, 0.1 %). The protozoa types that were identified included Cyclospora spp. (10 oocysts, 1.3 %) , Endolimax nana (10 cysts, 1.3 %) , B. hominis (9 instances of the vacuolated form, 1.2 %) , Isospora belli (75 oocysts, 9.6 %) , Entamoeba histolytica/E. dispar (36 cysts, 4.6 %) , Cryptosporidium spp . (220 oocysts, 28.1 %), Chilomastix mesnilli (2 cysts, 0.3 %), Entamoeba coli (31 cysts, 4.0 %), Balantidium coli (45 trophozoites, 5.8 %), and Iodamoeba butschlii (1 cyst, 0.1 %). These results show that cockroaches isolated from these markets are carriers of several parasitic organisms that cause commonly found symptoms of illness such as diarrhea or bowel disorder.

  10. Mucosal exposure to cockroach extract induces allergic sensitization and allergic airway inflammation

    Directory of Open Access Journals (Sweden)

    Arizmendi Narcy G

    2011-12-01

    Full Text Available Abstract Background Allergic sensitization to aeroallergens develops in response to mucosal exposure to these allergens. Allergic sensitization may lead to the development of asthma, which is characterized by chronic airway inflammation. The objective of this study is to describe in detail a model of mucosal exposure to cockroach allergens in the absence of an exogenous adjuvant. Methods Cockroach extract (CE was administered to mice intranasally (i.n. daily for 5 days, and 5 days later mice were challenged with CE for 4 consecutive days. A second group received CE i.n. for 3 weeks. Airway hyperresponsiveness (AHR was assessed 24 h after the last allergen exposure. Allergic airway inflammation was assessed by BAL and lung histology 48 h after the last allergen exposure. Antigen-specific antibodies were assessed in serum. Lungs were excised from mice from measurement of cytokines and chemokines in whole lung lysate. Results Mucosal exposure of Balb/c mice to cockroach extract induced airway eosinophilic inflammation, AHR and cockroach-specific IgG1; however, AHR to methacholine was absent in the long term group. Lung histology showed patchy, multicentric damage with inflammatory infiltrates at the airways in both groups. Lungs from mice from the short term group showed increased IL-4, CCL11, CXCL1 and CCL2 protein levels. IL4 and CXCL1 were also increased in the BAL of cockroach-sensitized mice in the short-term protocol. Conclusions Mucosal exposure to cockroach extract in the absence of adjuvant induces allergic airway sensitization characterized by AHR, the presence of Th2 cytokines in the lung and eosinophils in the airways.

  11. Midgut Transcriptome of the Cockroach Periplaneta americana and Its Microbiota: Digestion, Detoxification and Oxidative Stress Response.

    Directory of Open Access Journals (Sweden)

    Jianhua Zhang

    Full Text Available The cockroach, Periplaneta americana, is an obnoxious and notorious pest of the world, with a strong ability to adapt to a variety of complex environments. However, the molecular mechanism of this adaptability is mostly unknown. In this study, the genes and microbiota composition associated with the adaptation mechanism were studied by analyzing the transcriptome and 16S rDNA pyrosequencing of the P. americana midgut, respectively. Midgut transcriptome analysis identified 82,905 unigenes, among which 64 genes putatively involved in digestion (11 genes, detoxification (37 genes and oxidative stress response (16 genes were found. Evaluation of gene expression following treatment with cycloxaprid further revealed that the selected genes (CYP6J1, CYP4C1, CYP6K1, Delta GST, alpha-amylase, beta-glucosidase and aminopeptidase were upregulated at least 2.0-fold at the transcriptional level, and four genes were upregulated more than 10.0-fold. An interesting finding was that three digestive enzymes positively responded to cycloxaprid application. Tissue expression profiles further showed that most of the selected genes were midgut-biased, with the exception of CYP6K1. The midgut microbiota composition was obtained via 16S rDNA pyrosequencing and was found to be mainly dominated by organisms from the Firmicutes phylum, among which Clostridiales, Lactobacillales and Burkholderiales were the main orders which might assist the host in the food digestion or detoxification of noxious compounds. The preponderant species, Clostridium cellulovorans, was previously reported to degrade lignocellulose efficiently in insects. The abundance of genes involved in digestion, detoxification and response to oxidative stress, and the diversity of microbiota in the midgut might provide P. americana high capacity to adapt to complex environments.

  12. Health Information in German (Deutsch)

    Science.gov (United States)

    ... Supplements Videos & Tools You Are Here: Home → Multiple Languages → German (Deutsch) URL of this page: https://medlineplus.gov/languages/german.html Health Information in German (Deutsch) To use ...

  13. Utility of mtDNA-COI Barcode Region for Phylogenetic Relationship and Diagnosis of Five Common Pest Cockroaches

    Directory of Open Access Journals (Sweden)

    Saedeh Sadat Hashemi-Aghdam

    2017-06-01

    Full Text Available Background: Cockroaches are of vital importance medically and hygienically as they can disperse human patho­genic agents and are especially responsible for food contamination and spreading of food borne pathogens. In this study, part of mtDNA-COI gene of five common pest cockroaches was tested for diagnostic and phylogenetic pur­poses.Methods: We have described barcode region of mtDNA-COI gene of five cockroach species: Blattella germanica, Blatta orientalis, Periplaneta americana, Shelfordella lateralis, and Supella longipalpa, along with the development of a PCR-RFLP method for rapid detection and differentiation of these health pest species.Results: The PCR generates a single 710 bp-sized amplicon in all cockroach specimens, followed by direct se­quencing. AluI predicted from the sequencing data provided different RFLP profiles among five species. There was a significant intra-species variation within the American cockroach populations, but no genetic variation within other species. Accordingly, phylogenetic analysis demonstrates common monophyly for cockroach families in agreement with conventional taxonomy. However S. longipalpa (Ectobiidae diverged as an early ancestor of other cockroaches and was not associated with other Ectobiidae.Conclusion: The PCR-RFLP protocol might be useful when the conventional taxonomic methods are not able to identify specimens, particularly when only small body parts of specimens are available or they are in a decaying condition. mtDNA-COI gene shows potentially useful for studying phylogenetic relationships of Blattodea order.

  14. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites.

    Science.gov (United States)

    Richards, Callum; Otani, Saria; Mikaelyan, Aram; Poulsen, Michael

    2017-01-01

    The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within this "bioreactor", and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming sub-family of higher termites has become similar in gut microbiota to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut microbiotas from 49 gut samples showed a step-wise gradient pattern in community similarity that correlated with an increase in the proportion of fungal material provided to the cockroaches. Comparison of the taxonomic composition of manipulated communities to that of gut communities of a fungus-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut community composition, but at the same time exemplifies how original community compositions constrain the magnitude of such change.

  15. Biophysical analysis of the acute toxicity of radiotherapy in Hodgkin's lymphoma-a comparison between extended field and involved field radiotherapy based on the data of the German Hodgkin Study Group

    International Nuclear Information System (INIS)

    Eich, Hans Theodor; Haverkamp, Uwe; Engert, Andreas; Kocher, Martin; Skripnitchenko, Roman; Brillant, Corinne; Sehlen, Susanne; Duehmke, Eckhart; Diehl, Volker; Mueller, Rolf-Peter

    2005-01-01

    Purpose: To determine biophysical parameters from the complication probability data during and after radiotherapy of Hodgkin's lymphoma (HL), based on the number of gastrointestinal side effects that were found in the multicenter HD8 trial of the German Hodgkin Lymphoma Study Group. Methods and Materials: Between 1993 and 1998, 1204 patients with newly diagnosed, histology-proven HL in clinical Stages I/IIA/IIB with defined risk factors and stage IIIA without risk factors were enrolled into the multicenter HD8 study. Patients were randomized to receive two cycles of COPP (cyclophosphamide, vincristine, procarbazine, prednisone) alternating with two cycles of ABVD (doxorubicin, bleomycin, vinblastine, dacarbazine) followed by radiotherapy (RT) of 30 Gy extended field plus 10 Gy to bulky disease (Arm A) or 30 Gy involved field plus 10 Gy to bulky disease (Arm B). For 910 patients, the rates of acute gastrointestinal side effects during and after RT could be determined. Comparison showed differences between Arms A and B (Grade 1-2: 16.6 vs. 3.9; Grade 3-4: 0.9 vs. 0.2; p 3 ), we determined the normal tissue complication probability (NTCP) (V, D, m, n, TD 50 ), the biophysical parameter TD 50 , and n (volume dependent) in such a manner that the observed NTCP in Arm A in cases of supradiaphragmatic involvement only and in cases of infradiaphragmatic involvement correlated with the calculated values. Results: Of 1,204 patients randomized, 1,064 patients were informative for the comparison of study arms. The median observation time was 54 months. The overall survival for all eligible patients was 91%, and freedom from treatment failure was 83%. Survival rates at 5 years after start of RT revealed no differences in terms of freedom from treatment failure (85.8% in Arm A, 84.2% in Arm B) and overall survival (90.8% and 92.4%). There were also no differences between the two arms in terms of complete remission, progressive disease, relapse, death, and secondary neoplasias. In

  16. Ultraviolet-induced changes in cuticular waxes of American cockroaches, Periplaneta americana (L.)(Dictyoptera: Blattaria: Blattidae)

    International Nuclear Information System (INIS)

    Gingrich, J.B.

    1975-01-01

    Dorsal cuticles of fully tanned American cockroaches irradiated with sublethal ultraviolet radiation (254 nm) were compared with nonirradiated cockroaches for wax composition. Of the six waxes compared, four (C 18 , C 19 , C 25 , and 3-methylpentacosane) showed increases of more than 50% in UV-irradiated cockroaches while C 17 and C 27 (heptacosa-6,9-diene) showed smaller increases of 27 and 11%, respectively. Traces of C 20 , C 22 , C 23 , and C 24 hydrocarbons were indicated but these were not compared since their identification has not been substantiated by other authors. The possible explanations of cellular damage vs. stimulated production are discussed. (author)

  17. Pioglitazone is as effective as dexamethasone in a cockroach allergen-induced murine model of asthma

    Directory of Open Access Journals (Sweden)

    Lukacs Nicholas W

    2007-12-01

    Full Text Available Abstract Background While glucocorticoids are currently the most effective therapy for asthma, associated side effects limit enthusiasm for their use. Peroxisome proliferator-activated receptor-γ (PPAR-γ activators include the synthetic thiazolidinediones (TZDs which exhibit anti-inflammatory effects that suggest usefulness in diseases such as asthma. How the ability of TZDs to modulate the asthmatic response compares to that of glucocorticoids remains unclear, however, because these two nuclear receptor agonists have never been studied concurrently. Additionally, effects of PPAR-γ agonists have never been examined in a model involving an allergen commonly associated with human asthma. Methods We compared the effectiveness of the PPAR-γ agonist pioglitazone (PIO to the established effectiveness of a glucocorticoid receptor agonist, dexamethasone (DEX, in a murine model of asthma induced by cockroach allergen (CRA. After sensitization to CRA and airway localization by intranasal instillation of the allergen, Balb/c mice were challenged twice at 48-h intervals with intratracheal CRA. Either PIO (25 mg/kg/d, DEX (1 mg/kg/d, or vehicle was administered throughout the period of airway CRA exposure. Results PIO and DEX demonstrated similar abilities to reduce airway hyperresponsiveness, pulmonary recruitment of inflammatory cells, serum IgE, and lung levels of IL-4, IL-5, TNF-α, TGF-β, RANTES, eotaxin, MIP3-α, Gob-5, and Muc5-ac. Likewise, intratracheal administration of an adenovirus containing a constitutively active PPAR-γ expression construct blocked CRA induction of Gob-5 and Muc5-ac. Conclusion Given the potent effectiveness shown by PIO, we conclude that PPAR-γ agonists deserve investigation as potential therapies for human asthma.

  18. Insecticidal Properties of Essential Oils and Some of Their Constituents on the Turkestan Cockroach (Blattodea: Blattidae).

    Science.gov (United States)

    Gaire, Sudip; O'Connell, Mary; Holguin, Francisco O; Amatya, Anup; Bundy, Scott; Romero, Alvaro

    2017-04-01

    The Turkestan cockroach, Blatta lateralis (Walker), has become the most important peridomestic species in urban areas of the Southwestern United States. The aim of this study was to evaluate the use of botanical compounds to control this urban pest. We tested the acute toxicity and repellency of six botanical constituents and three essential oils on Turkestan cockroach nymphs. Chemical composition of the essential oils was also determined. Topical and fumigant assays with nymphs showed that thymol was the most toxic essential oil constituent, with a LD50 of 0.34 mg/nymph and a LC50 of 27.6 mg/liter air, respectively. Contact toxicity was also observed in assays with trans-Cinnamaldehyde, eugenol, geraniol, methyl eugenol, and p-Cymene. Methyl eugenol and geraniol had limited fumigant toxicity. The essential oils from red thyme, clove bud, and Java citronella exhibited toxicity against nymphs. Cockroaches avoided fresh dry residues of thymol and essential oils. Chemical analysis of the essential oils confirmed high contents of effective essential oil constituents. Our results demonstrated that essential oils and some of their constituents have potential as eco-friendly insecticides for the management of Turkestan cockroaches. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Diet shapes the gut microbiota of the omnivorous cockroach Blattella germanica.

    Science.gov (United States)

    Pérez-Cobas, Ana Elena; Maiques, Elisa; Angelova, Alexandra; Carrasco, Purificación; Moya, Andrés; Latorre, Amparo

    2015-04-01

    The gut microbiota of insects contributes positively to the physiology of its host mainly by participating in food digestion, protecting against pathogens, or provisioning vitamins or amino acids, but the dynamics of this complex ecosystem is not well understood so far. In this study, we have characterized the gut microbiota of the omnivorous cockroach Blattella germanica by pyrosequencing the hypervariable regions V1-V3 of the 16S rRNA gene of the whole bacterial community. Three diets differing in the protein content (0, 24 and 50%) were tested at two time points in lab-reared individuals. In addition, the gut microbiota of wild adult cockroaches was also analyzed. In contrast to the high microbial richness described on the studied samples, only few species are shared by wild and lab-reared cockroaches, constituting the bacterial core in the gut of B. germanica. Overall, we found that the gut microbiota of B. germanica is highly dynamic as the bacterial composition was reassembled in a diet-specific manner over a short time span, with no-protein diet promoting high diversity, although the highest diversity was found in the wild cockroaches analyzed. We discuss how the flexibility of the gut microbiota is probably due to its omnivorous life style and varied diets. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  20. Home Sweet Home: How to Build a Madagascar Hissing Cockroach Habitat out of Recycled Materials

    Science.gov (United States)

    Wagler, Ron

    2010-01-01

    Madagascar hissing cockroaches (MHC) are amazing insects that can be an integral part of an effective science learning and teaching environment. MHCs have a fascinating social structure. They make excellent pets, teach students how to properly care for animals, and their large size adds to their "wow" factor. These characteristics make them unique…

  1. Ecological niche models for four native cockroach species (Blattaria: Blattellidae: Ectobiinae) in the Netherlands

    NARCIS (Netherlands)

    Ciliberti, P.; Jong, de H.; Schouten, M.A.; Verweij, P.A.; Heitmans, W.R.B.

    2009-01-01

    This paper aims at modelling the spatial distribution of the cockroach species Capraiellus panzeri, Ectobius lapponicus, Ectobius pallidus and Ectobius sylvestris within the Netherlands and comparing the habitat preferences of these species. Maxent was used to calculate habitat suitability and to

  2. Ecological niche models for four native cockroach species (Blattaria: Blattellidae:Ectobiinae) in the Netherlands

    NARCIS (Netherlands)

    Ciliberti, P.; de Jong, Herman; Schouten, M.A.; Verweij, P.A.; Heitmans, W.R.B.

    2009-01-01

    This paper aims at modelling the spatial distribution of the cockroach species Capraiellus panzeri, Ectobius lapponicus, Ectobius pallidus and Ectobius sylvestris within the Netherlands and comparing the habitat preferences of these species. Maxent was used to calculate habitat suitability and to

  3. X-irradiation effects on the activity of dehydrogenases in the cockroach, Periplaneta Americana L

    Energy Technology Data Exchange (ETDEWEB)

    Vijayalakshmi, S. (Sri Sathya Sai Inst. of Higher Learning, Anantpur (India))

    1984-05-01

    Sublethal dose of X-irradiation caused an early increase and subsequent normalization in succinate and lactate dehydrogenases of the cockroach, while lethal dose produced an irreversible fall in succinate dehydrogenase and a gradual elevation in lactate dehydrogenase at all post-irradiation periods studied, suggesting dose dependent impairment of aerobic and anaerobic pathways.

  4. Afro-Asian cockroach from Chiapas amber and the lost Tertiary American entomofauna

    Science.gov (United States)

    Vršanský, Peter; Cifuentes-Ruiz, Paulina; Vidlička, Ľubomír; Čiampor, Fedor; Vega, Francisco J.

    2011-10-01

    Cockroach genera with synanthropic species (Blattella, Ectobius, Supella, Periplaneta, Diploptera and ?Blatta), as well as other insects such as honeybees, although natively limited to certain continents nowadays, had circumtropic distribution in the past. The ease of their reintroduction into their former range suggests a post-Early Miocene environmental stress which led to the extinction of cosmopolitan Tertiary entomofauna in the Americas, whilst in Eurasia, Africa and Australia this fauna survived. This phenomenon is demonstrated here on a low diversity (10 spp.) living cockroach genus Supella, which is peculiar for the circumtropical synanthropic brownbanded cockroach S. longipalpa and also for its exclusively free-living cavicolous species restricted to Africa. S. (Nemosupella) miocenica sp. nov. from the Miocene amber of Chiapas in Mexico is a sister species to the living S. mirabilis from the Lower Guinea forests and adjacent savannas. The difference is restricted to the shape of the central macula on the pronotum, and size, which may indicate the around-Miocene origin of the living, extremely polymorphic Supella species and possibly also the isochronic invasion into the Americas. The species also has a number of characteristics of the Asian (and possibly also Australian) uniform genus Allacta (falling within the generic variability of Supella) suggesting Supella is a direct ancestor of the former. The present species is the first significant evidence for incomplete hiati between well defined cockroach genera — a result of the extensive fossil record of the group. The reported specimen is covered by a mycelium of a parasitic fungus Cordyceps or Entomophthora.

  5. Diversity of Trypanosomatids in Cockroaches and the Description of Herpetomonas tarakana sp n.

    Czech Academy of Sciences Publication Activity Database

    Yurchenko, V.; Kostygov, A.; Havlová, J.; Grybchuk-Ieremenko, A.; Ševčíková, T.; Lukeš, Julius; Ševčík, J.; Votýpka, Jan

    2016-01-01

    Roč. 63, č. 2 (2016), s. 198-209 ISSN 1066-5234 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Monoxenous Trypanosomatidae * parasites of cockroaches * taxonomy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.692, year: 2016

  6. Some Guides to Discovery About Elm Trees, Owls, Cockroaches, Earthworms, Cement and Concrete.

    Science.gov (United States)

    Busch, Phyllis S.

    The introduction emphasizes the need for environmental and conservation education, and advocates an inquiry approach. Outdoor resources available to every school are listed. Detailed suggestions are made for investigating cement and concrete, cockroaches, earthworms, elm trees, and owls. In each case general background information and a list of…

  7. Becoming German: Integration, Citizenship and Territorialization of Germanness

    DEFF Research Database (Denmark)

    Fogelman, Tatiana

    2017-01-01

    transforms Germanness into more of a lived experience of the territorially grounded, emplaced German society, opening up more space to migrants to become-German. In the conclusion, I consider how this potential opening up of Germanness continues to be threatened by concomitant developments, including...

  8. A sodium channel mutation identified in Aedes aegypti selectively reduces cockroach sodium channel sensitivity to type I, but not type II pyrethroids

    Science.gov (United States)

    Hu, Zhaonong; Du, Yuzhe; Nomura, Yoshiko; Dong, Ke

    2010-01-01

    Voltage-gated sodium channels are the primary target of pyrethroid insecticides. Numerous point mutations in sodium channel genes have been identified in pyrethroid-resistant insect species, and many have been confirmed to reduce or abolish sensitivity of channels expressed in Xenopus oocytes to pyrethroids. Recently, several novel mutations were reported in sodium channel genes of pyrethroid-resistant Aedes mosquito populations. One of the mutations is a phenylalanine (F) to cysteine (C) change in segment 6 of domain III (IIIS6) of the Aedes mosquito sodium channel. Curiously, a previous study showed that alanine substitution of this F did not alter the action of deltamethrin, a type II pyrethroid, on a cockroach sodium channel. In this study, we changed this F to C in a pyrethroid-sensitive cockroach sodium channel and examined mutant channel sensitivity to permethrin as well as five other type I or type II pyrethroids in Xenopus oocytes. Interestingly, the F to C mutation drastically reduced channel sensitivity to three type I pyrethroids, permethrin, NRDC 157 (a deltamethrin analogue lacking the α-cyano group) and bioresemthrin, but not to three type II pyrethroids, cypermethrin, deltamethrin and cyhalothrin. These results confirm the involvement of the F to C mutation in permethrin resistance, and raise the possibility that rotation of type I and type II pyrethroids might be considered in the control of insect pest populations where this particular mutation is present. PMID:20869441

  9. Structures of Two Major Allergens, Bla g 4 and Per a 4, From Cockroaches and Their IgE Binding Epitopes

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Y.; Chan, S; Ong, T; Yit, L; Tiong, Y; Chew, F; Sivaraman, J; Mok, Y

    2009-01-01

    Inhalant allergens from cockroaches are an important cause of asthma to millions of individuals worldwide. Here we report for the first time the structures of two major cockroach allergens, Bla g 4 and Per a 4, that adopt a typical lipocalin fold but with distinct structural features as compared with other known lipocalin allergens. Both Bla g 4 and Per a 4 contain two long-range disulfide bonds linking the N and C termini to a beta-barrel. The C-terminal helix of Bla g 4 is bent and greatly extended toward the N terminus. Bla g 4 is found to be a monomer, whereas Per a 4 exists as a dimer in solution with a novel dimeric interface involving residues from loops at the top and bottom of the beta-barrel. Putative ligand binding sites of both allergens are determined by docking of the juvenile hormone III inside the beta-barrel and found to interact with the ligand using non-conserved residues. Bla g 4 and Per a 4 are found to be cross-reactive in sera IgE binding, at least in the Singaporean Chinese population tested. A major IgE binding epitope unique to Per a 4 is found on the loops at the bottom of the beta-barrel that may aid the development of hypoallergens for immunotherapy.

  10. Symbiotic essential amino acids provisioning in the American cockroach, Periplaneta americana (Linnaeus under various dietary conditions

    Directory of Open Access Journals (Sweden)

    Paul A. Ayayee

    2016-05-01

    Full Text Available Insect gut microbes have been shown to provide nutrients such as essential amino acids (EAAs to their hosts. How this symbiotic nutrient provisioning tracks with the host’s demand is not well understood. In this study, we investigated microbial essential amino acid (EAA provisioning in omnivorous American cockroaches (Periplaneta americana, fed low-quality (LQD and comparatively higher-quality dog food (DF diets using carbon stable isotope ratios of EAAs (δ13CEAA. We assessed non-dietary EAA input, quantified as isotopic offsets (Δ13C between cockroach (δ13CCockroach EAA and dietary (δ13CDietary EAA EAAs, and subsequently determined biosynthetic origins of non-dietary EAAs in cockroaches using 13C-fingerprinting with dietary and representative bacterial and fungal δ13CEAA. Investigation of biosynthetic origins of de novo non-dietary EAAs indicated bacterial origins of EAA in cockroach appendage samples, and a mixture of fungal and bacterial EAA origins in gut filtrate samples for both LQD and DF-fed groups. We attribute the bacteria-derived EAAs in cockroach appendages to provisioning by the fat body residing obligate endosymbiont, Blattabacterium and gut-residing bacteria. The mixed signatures of gut filtrate samples are attributed to the presence of unassimilated dietary, as well as gut microbial (bacterial and fungal EAAs. This study highlights the potential impacts of dietary quality on symbiotic EAA provisioning and the need for further studies investigating the interplay between host EAA demands, host dietary quality and symbiotic EAA provisioning in response to dietary sufficiency or deficiency.

  11. [Enterobacteria isolated from cockroaches (Periplaneta americana) captured in a Brazilian hospital].

    Science.gov (United States)

    Prado, Marinésia A; Pimenta, Fabiana C; Hayashid, Miyeko; Souza, Paula R; Pereira, Milca S; Gir, Elucir

    2002-02-01

    To isolate and identify microorganisms from cockroaches that were captured in a public hospital and to test the antimicrobial susceptibility of these microorganisms. Cockroaches were captured in the morning and at night. They were placed in flasks rinsed with 70% alcohol, transferred to sterilized flasks, and then taken to the laboratory. Only cockroaches captured whole and live were utilized for the study. After being immobilized at 0 degree C, each cockroach was placed in a test tube with sterile saline solution (0.8%) and then homogenized. The resulting solution was then placed in the following five culture media: MacConkey agar, nutrient broth, brain-heart infusion agar, Sabouraud agar, and mannitol. The cultures were examined using a stereomicroscope, and colony-forming units were counted. The disk diffusion test was used to determine antimicrobial susceptibility. We found a 56% prevalence of enterobacteria and an 18% prevalence of coagulase-negative staphylococci. Fifteen species of enterobacteria were identified. The most frequent were Klebsiella pneumoniae (17%), Enterobacter aerogenes (14%), Serratia marcescens (13%), Hafnia alvei (12%), Enterobacter gergoviae and Enterobacter cloacae (each 9%), and Serratia spp. (6%). Both the enterobacteria and the coagulase-negative staphylococci showed significant resistance to antimicrobials, including oxacillin. The prevalence of enteropathogenic bacteria and coagulase-negative staphylococci isolated from Periplaneta americana cockroaches in the studied hospital reflects the weakness of the measures adopted both for vector control and for antimicrobial use. The results show the need to implement effective health-institution programs focusing on hygiene and the rational use of antimicrobials.

  12. German-Chinese wedding

    Energy Technology Data Exchange (ETDEWEB)

    Iken, Joern

    2010-07-01

    German wind power technology is widely regarded as being ahead of its competitors worldwide. Combine this technology with production in China and a renowned designer and you should get a competitive product. (orig.)

  13. Germanic Verb Particle Variation

    DEFF Research Database (Denmark)

    Vikner, Sten

    2017-01-01

    This paper has two closely related goals. The more "global" one is to present an overview of the variation conceming verb particles across the Germanic languages (see e.g. den Dikken 1995; Haiden 2005; Mclntyre 2007 and many others), and the more "local" one is to use some of this variation data...... to argue for Yiddish being an SOV-language like German and Dutch rather than an SVO-language like English and the Scandinavian languages....

  14. German Business in Russia

    Directory of Open Access Journals (Sweden)

    Irakliy D. Gvazava

    2013-01-01

    Full Text Available Since Perestroika German-Russian relationships have been steadily developing fueled by close contacts between the leaders of both countries. Boris Yeltsin and Helmut Kohl, Vladimir Putin and Gerhard Schröder, Dmitry Medvedev and Angela Merkel had friendly relations resulted in some fruitful business projects, intergovernmental economic forums etc. In my article I will consider the activities of German companies in Russia, advantages, barriers and expectations

  15. Phylogeny of cockroaches (Insecta, Dictyoptera, Blattodea), with placement of aberrant taxa and exploration of out-group sampling

    DEFF Research Database (Denmark)

    Djernæs, Marie; Klass, Klaus-Dieter; Picker, Mike D.

    2012-01-01

    We addressed the phylogeny of cockroaches using DNA sequence data from a broad taxon sample of Dictyoptera and other non-endopterygotan insect orders. We paid special attention to several taxa in which relationships are controversial, or where no molecular evidence has been used previously......: Nocticolidae, a family of small, often cave-dwelling cockroaches, has been suggested to be the sister group of the predaceous Mantodea or of the cockroach family Polyphagidae; Lamproblatta, traditionally placed in Blattidae, has recently been given family status and placed as sister to Polyphagidae......; and Saltoblattella montistabularis Bohn, Picker, Klass & Colville, a jumping cockroach, which has not yet been included in any phylogenetic studies. We used mitochondrial (COI + COII and 16S) and nuclear (18S and 28S) genes, and analysed the data using Bayesian inference (BI) and maximum likelihood (ML...

  16. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites

    DEFF Research Database (Denmark)

    Richards, Callum; Otani, Saria; Mikaelyan, Aram

    2017-01-01

    The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within...... this “bioreactor”, and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming subfamily of higher termites has become similar in gut microbiota...... to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut...

  17. Latest German-English Terminology in CADCAM & Robotics

    Science.gov (United States)

    Hussain, S. M.

    2014-07-01

    As a technical translator who speaks German fluently, the author would like to study and display the latest bilingual technical terminology in German being used in hardware, software and process technology involved in CADCAM & ROBOTICS. This will greatly help technical translators to correctly translate difficult texts from this area of technology.

  18. Latest German-English Terminology in CADCAM and Robotics

    International Nuclear Information System (INIS)

    Hussain, S M

    2014-01-01

    As a technical translator who speaks German fluently, the author would like to study and display the latest bilingual technical terminology in German being used in hardware, software and process technology involved in CADCAM and ROBOTICS. This will greatly help technical translators to correctly translate difficult texts from this area of technology

  19. The Madagascar hissing cockroach as a novel surrogate host for Burkholderia pseudomallei, B. mallei and B. thailandensis

    Directory of Open Access Journals (Sweden)

    Fisher Nathan A

    2012-06-01

    Full Text Available Abstract Background Burkholderia pseudomallei and Burkholderia mallei are gram-negative pathogens responsible for the diseases melioidosis and glanders, respectively. Both species cause disease in humans and animals and have been designated as category B select agents by the Centers for Disease Control and Prevention (CDC. Burkholderia thailandensis is a closely related bacterium that is generally considered avirulent for humans. While it can cause disease in rodents, the B. thailandensis 50% lethal dose (LD50 is typically ≥ 104-fold higher than the B. pseudomallei and B. mallei LD50 in mammalian models of infection. Here we describe an alternative to mammalian hosts in the study of virulence and host-pathogen interactions of these Burkholderia species. Results Madagascar hissing cockroaches (MH cockroaches possess a number of qualities that make them desirable for use as a surrogate host, including ease of breeding, ease of handling, a competent innate immune system, and the ability to survive at 37°C. MH cockroaches were highly susceptible to infection with B. pseudomallei, B. mallei and B. thailandensis and the LD50 was 50 for Escherichia coli in MH cockroaches was >105 cfu. B. pseudomallei, B. mallei, and B. thailandensis cluster 1 type VI secretion system (T6SS-1 mutants were all attenuated in MH cockroaches, which is consistent with previous virulence studies conducted in rodents. B. pseudomallei mutants deficient in the other five T6SS gene clusters, T6SS-2 through T6SS-6, were virulent in both MH cockroaches and hamsters. Hemocytes obtained from MH cockroaches infected with B. pseudomallei harbored numerous intracellular bacteria, suggesting that this facultative intracellular pathogen can survive and replicate inside of MH cockroach phagocytic cells. The hemolymph extracted from these MH cockroaches also contained multinuclear giant cells (MNGCs with intracellular B. pseudomallei, which indicates that infected hemocytes can

  20. Larvae of the parasitoid wasp Ampulex compressa sanitize their host, the American cockroach, with a blend of antimicrobials

    OpenAIRE

    Herzner, Gudrun; Schlecht, Anja; Dollhofer, Veronika; Parzefall, Christopher; Harrar, Klaus; Kreuzer, Andreas; Pilsl, Ludwig; Ruther, Joachim

    2013-01-01

    Food resources contaminated with spoilage or pathogenic microorganisms pose severe problems to all higher organisms. Here, we describe a food-hygienic strategy of the emerald cockroach wasp Ampulex compressa. The wasp larvae develop on and inside the American cockroach Periplaneta americana, a host that can harbor various putrefactive microbes, as well as human and insect pathogens. From P. americana, we isolated the Gram-negative bacterium Serratia marcescens, which is a potent entomopathoge...

  1. Physicochemical conditions, metabolites and community structure of the bacterial microbiota in the gut of wood-feeding cockroaches (Blaberidae: Panesthiinae).

    Science.gov (United States)

    Bauer, Eugen; Lampert, Niclas; Mikaelyan, Aram; Köhler, Tim; Maekawa, Kiyoto; Brune, Andreas

    2015-02-01

    While the gut microbiota of termites and its role in symbiotic digestion have been studied for decades, little is known about the bacteria colonizing the intestinal tract of the distantly related wood-feeding cockroaches (Blaberidae: Panesthiinae). Here, we show that physicochemical gut conditions and microbial fermentation products in the gut of Panesthia angustipennis resemble that of other cockroaches. Microsensor measurements confirmed that all gut compartments were anoxic at the center and had a slightly acidic to neutral pH and a negative redox potential. While acetate dominated in all compartments, lactate and hydrogen accumulated only in the crop. The high, hydrogen-limited rates of methane emission from living cockroaches were in agreement with the restriction of F420-fluorescent methanogens to the hindgut. The gut microbiota of both P. angustipennis and Salganea esakii differed strongly between compartments, with the highest density and diversity in the hindgut, but similarities between homologous compartments of both cockroaches indicated a specificity of the microbiota for their respective habitats. While some lineages were most closely related to the gut microbiota of omnivorous cockroaches and wood- or litter-feeding termites, others have been encountered also in vertebrates, reinforcing the hypothesis that strong environmental selection drives community structure in the cockroach gut. © FEMS 2014. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. Vowel Epenthesis in Early Germanic Runic Inscriptions

    OpenAIRE

    Damsma, Levi; Versloot, Arjen

    2015-01-01

    A number of runic inscriptions from the entire Germanic area from between A.D. 200 and 800 exhibit non-etymological, epenthetic vowels, such as worahto for *worhto ‘did’. An analysis of all (likely) instances of epen­thesis in early Ger­manic languages shows that epenthesis developed only in clusters involv­ing /r/, /l/ or /n/. Epenthesis was an optional feature of nearly every early Germanic dialect, being most abundantly attested in southern Sweden. There is no statis­ti­cally sig­nif­icant...

  3. German for physicists

    Science.gov (United States)

    Stein, Ben

    2009-04-01

    "German is the language of science" I remember my father telling me as a boy growing up in the Bronx in New York during the 1970s. As I watched astronomy programmes on TV with my father and older brothers, I imagined having to speak ceaselessly in fluent German if I was ever to become a scientist as a grown-up. But when I started my studies at university in New York in the 1980s, I realized my father's advice - sought from weekly trips to the neighbourhood public library - was way out of date. Not only did my physics professors present their research in English at conferences all around the world, but they also published in English-language journals - thus seemingly not needing a single word of German.

  4. Open-Framework Germanates and Nickel Germanates : Synthesis and Characterization

    OpenAIRE

    Huang, Shiliang

    2012-01-01

    Microporous materials have a wide range of important applications in separation, gas adsorption, ion-exchange and catalysis. Open-framework germanates are a family of microporous compounds and are of particular interest. This thesis focuses on the synthesis and characterization of new open-framework germanates as well as introducing the transition-metal nickel into germanate structures. One new microporous germanosilicate, SU-78 and four new open-framework germanates, SU-74, SU-75, SU-69 and ...

  5. A wasp manipulates neuronal activity in the sub-esophageal ganglion to decrease the drive for walking in its cockroach prey.

    Directory of Open Access Journals (Sweden)

    Ram Gal

    Full Text Available BACKGROUND: The parasitoid Jewel Wasp hunts cockroaches to serve as a live food supply for its offspring. The wasp stings the cockroach in the head and delivers a cocktail of neurotoxins directly inside the prey's cerebral ganglia. Although not paralyzed, the stung cockroach becomes a living yet docile 'zombie', incapable of self-initiating spontaneous or evoked walking. We show here that such neuro-chemical manipulation can be attributed to decreased neuronal activity in a small region of the cockroach cerebral nervous system, the sub-esophageal ganglion (SEG. A decrease in descending permissive inputs from this ganglion to thoracic central pattern generators decreases the propensity for walking-related behaviors. METHODOLOGY AND PRINCIPAL FINDINGS: We have used behavioral, neuro-pharmacological and electrophysiological methods to show that: (1 Surgically removing the cockroach SEG prior to wasp stinging prolongs the duration of the sting 5-fold, suggesting that the wasp actively targets the SEG during the stinging sequence; (2 injecting a sodium channel blocker, procaine, into the SEG of non-stung cockroaches reversibly decreases spontaneous and evoked walking, suggesting that the SEG plays an important role in the up-regulation of locomotion; (3 artificial focal injection of crude milked venom into the SEG of non-stung cockroaches decreases spontaneous and evoked walking, as seen with naturally-stung cockroaches; and (4 spontaneous and evoked neuronal spiking activity in the SEG, recorded with an extracellular bipolar microelectrode, is markedly decreased in stung cockroaches versus non-stung controls. CONCLUSIONS AND SIGNIFICANCE: We have identified the neuronal substrate responsible for the venom-induced manipulation of the cockroach's drive for walking. Our data strongly support previous findings suggesting a critical and permissive role for the SEG in the regulation of locomotion in insects. By injecting a venom cocktail directly into the

  6. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites.

    Directory of Open Access Journals (Sweden)

    Callum Richards

    Full Text Available The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within this "bioreactor", and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming sub-family of higher termites has become similar in gut microbiota to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut microbiotas from 49 gut samples showed a step-wise gradient pattern in community similarity that correlated with an increase in the proportion of fungal material provided to the cockroaches. Comparison of the taxonomic composition of manipulated communities to that of gut communities of a fungus-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut community composition, but at the same time exemplifies how original community compositions constrain the magnitude of such change.

  7. Cross-reactive IgE antibody responses to tropomyosins from Ascaris lumbricoides and cockroach.

    Science.gov (United States)

    Santos, Ana Beatriz R; Rocha, Gutemberg M; Oliver, Constance; Ferriani, Virgínia P L; Lima, Rodrigo C; Palma, Mário S; Sales, Valéria S F; Aalberse, Rob C; Chapman, Martin D; Arruda, L Karla

    2008-04-01

    Evidence indicates that infection with Ascaris lumbricoides may promote development of allergy and asthma. To study the role of tropomyosin, a pan-allergen in invertebrates, in IgE responses to A lumbricoides. Recombinant A lumbricoides and Periplaneta americana tropomyosins were expressed in Pichia pastoris. Levels of IgE to tropomyosins from A lumbricoides and P americana were determined by chimeric ELISA in sera from 119 children living in a parasite-endemic area and 112 patients with cockroach allergy from the allergy clinics. Presence of tropomyosin in A lumbricoides larvae at L3 stage was evaluated by immunofluorescence using mAb 1A6, directed against mite tropomyosin. Molecular modeling of P americana and A lumbricoides tropomyosins was performed by using the MODELLER program. A lumbricoides tropomyosin showed 69% to 98% sequence identity to tropomyosins from other invertebrates. The predicted structure of A lumbricoides tropomyosin was similar to that of P americana tropomyosin and showed the characteristic coiled-coil structure. Strong correlation was found for IgE antibodies to tropomyosins from A lumbricoides and P americana in sera from children living in a parasite-endemic area and from patients with cockroach allergy. Larvae of A lumbricoides reacted strongly with mAb 1A6. Tropomyosin induces IgE responses in A lumbricoides-infected children and in patients allergic to cockroach.

  8. Analysis of Cockroach Fauna and Frequency in Human Residential Habitats of North of Isfahan, Iran

    Directory of Open Access Journals (Sweden)

    Dehghani R.1 PhD,

    2016-08-01

    Full Text Available Aims Considering the medical significance of cockroaches as insect vectors of food toxicities, and triggering allergy in respiratory system and skin, this survey was conducted to study the frequency of infestation and their effective factors in Shahin Shahr, Iran. Materials & Methods This cross-sectional descriptive study was carried out in 2010 in Shahin Shahr, Isfahan, Iran. Data gathering instrument was a researcher-made questionnaire regarding to the research aims. Data were analyzed by SPSS 11.5 software using Chi square and Fisher exact tests. Findings 675 of 1000 studied houses (67.5% were infested by all life stages of the cockroaches and 32.5% had no infestation. 46% of infested houses had few, 30% had medium and 24% had high infestation. the bathrooms and toilets were recognized as the most infested places (41%. There were significant relationships between infestation of houses and the age of building (p<0.001, the type of building (p=0.009 and the education level of the family (p<0.001. Significant difference was found between houses equipped their doors and windows by tulles and without tulles (p=0.03. Most infection was found in houses sheltering 5 and more people (72.3%. Significant correlation was found between the infection and the number of family members (p=0.0012. Conclusion Infestation rate of cockroaches in Shahin Shahr houses is high and is mostly of P. americana species.

  9. Species Delimitation and Phylogenetic Relationships in Ectobiid Cockroaches (Dictyoptera, Blattodea from China.

    Directory of Open Access Journals (Sweden)

    Yanli Che

    Full Text Available We collected Ectobiidae cockroach specimens from 44 locations in the south of the Yangtze valley. We obtained 297 COI sequences specimens and carried out phylogenetic and divergence dating analyses, as well as species delimitation analysis using a General Mixed Yule Coalescent (GMYC framework. The intraspecific and interspecific sequence divergence in Ectobiidae cockroaches ranged from 0.0 to 7.0% and 4.6 to 30.8%, respectively. GMYC analysis resulted in 53 (confidence interval: 37-65 entities (likelihood ratio = 103.63 including 14 downloaded species. The COI GMYC groups partly corresponded to the ectobiid species and 52 ectobiid species were delimited successfully based on the combination of GMYC result with morphological information. We used the molecular data and 6 cockroach fossil calibrations to obtain a preliminary estimate of the timescale of ectobiid evolution. The major subfamilies in the group were found to have diverged between ~125-110 Ma, and morphospecies pairs were found to have diverged ~10 or more Ma.

  10. De Novo Transcriptome Analysis and Detection of Antimicrobial Peptides of the American Cockroach Periplaneta americana (Linnaeus).

    Science.gov (United States)

    Kim, In-Woo; Lee, Joon Ha; Subramaniyam, Sathiyamoorthy; Yun, Eun-Young; Kim, Iksoo; Park, Junhyung; Hwang, Jae Sam

    2016-01-01

    Cockroaches are surrogate hosts for microbes that cause many human diseases. In spite of their generally destructive nature, cockroaches have recently been found to harbor potentially beneficial and medically useful substances such as drugs and allergens. However, genomic information for the American cockroach (Periplaneta americana) is currently unavailable; therefore, transcriptome and gene expression profiling is needed as an important resource to better understand the fundamental biological mechanisms of this species, which would be particularly useful for the selection of novel antimicrobial peptides. Thus, we performed de novo transcriptome analysis of P. americana that were or were not immunized with Escherichia coli. Using an Illumina HiSeq sequencer, we generated a total of 9.5 Gb of sequences, which were assembled into 85,984 contigs and functionally annotated using Basic Local Alignment Search Tool (BLAST), Gene Ontology (GO), and Kyoto Encyclopedia of Genes and Genomes (KEGG) database terms. Finally, using an in silico antimicrobial peptide prediction method, 86 antimicrobial peptide candidates were predicted from the transcriptome, and 21 of these peptides were experimentally validated for their antimicrobial activity against yeast and gram positive and -negative bacteria by a radial diffusion assay. Notably, 11 peptides showed strong antimicrobial activities against these organisms and displayed little or no cytotoxic effects in the hemolysis and cell viability assay. This work provides prerequisite baseline data for the identification and development of novel antimicrobial peptides, which is expected to provide a better understanding of the phenomenon of innate immunity in similar species.

  11. Functional symbiosis and communication in microbial ecosystems. The case of wood-eating termites and cockroaches.

    Science.gov (United States)

    Berlanga, Mercedes

    2015-09-01

    Animal hosts typically have strong specificity for microbial symbionts and their functions. The symbiotic relationships have enhanced the limited metabolic networks of most eukaryotes by contributing several prokaryotic metabolic capabilities, such as methanogenesis, chemolithoautotrophy, nitrogen assimilation, etc. This review will examine the characteristics that determine bacterial "fidelity" to certain groups of animals (e.g., xylophagous insects, such as termites and cockroaches) over generations and throughout evolution. The hindgut bacteria of wood-feeding termites and cockroaches belong to several phyla, including Proteobacteria, especially Deltaproteobacteria, Bacteroidetes, Firmicutes, Actinomycetes, Spirochetes, Verrucomicrobia, and Actinobacteria, as detected by 16S rRNA. Termites effectively feed on many types of lignocelluloses assisted by their gut microbial symbionts. Although the community structures differ between the hosts (termites and cockroaches), with changes in the relative abundances of particular bacterial taxa, the composition of the bacterial community could reflect at least in part the host evolution in that the microbiota may derive from the microbiota of a common ancestor. Therefore, factors other than host phylogeny, such as diet could have had strong influence in shaping the bacterial community structure. Copyright© by the Spanish Society for Microbiology and Institute for Catalan Studies.

  12. The orange spotted cockroach (Blaptica dubia, Serville 1839) is a permissive experimental host for Francisella tularensis

    Science.gov (United States)

    Eklund, Bridget E.; Mahdi, Osama; Huntley, Jason F.; Collins, Elliot; Martin, Caleb; Horzempa, Joseph; Fisher, Nathan A.

    2018-01-01

    Francisella tularensis is a zoonotic bacterial pathogen that causes severe disease in a wide range of host animals, including humans. Well-developed murine models of F. tularensis pathogenesis are available, but they do not meet the needs of all investigators. However, researchers are increasingly turning to insect host systems as a cost-effective alternative that allows greater increased experimental throughput without the regulatory requirements associated with the use of mammals in biomedical research. Unfortunately, the utility of previously-described insect hosts is limited because of temperature restriction, short lifespans, and concerns about the immunological status of insects mass-produced for other purposes. Here, we present a novel host species, the orange spotted (OS) cockroach (Blaptica dubia), that overcomes these limitations and is readily infected by F. tularensis. Intrahemocoel inoculation was accomplished using standard laboratory equipment and lethality was directly proportional to the number of bacteria injected. Progression of infection differed in insects housed at low and high temperatures and F. tularensis mutants lacking key virulence components were attenuated in OS cockroaches. Finally, antibiotics were delivered to infected OS cockroaches by systemic injection and controlled feeding; in the latter case, protection correlated with oral bioavailability in mammals. Collectively, these results demonstrate that this new host system provides investigators with a new tool capable of interrogating F. tularensis virulence and immune evasion in situations where mammalian models are not available or appropriate, such as undirected screens of large mutant libraries. PMID:29578544

  13. New predatory cockroaches (Insecta: Blattaria: Manipulatoridae fam.n.) from the Upper Cretaceous Myanmar amber

    Science.gov (United States)

    Vršanský, Peter; Bechly, Günter

    2015-04-01

    We describe a new extinct lineage Manipulatoridae (new family) of cockroaches from the Upper Cretaceous (Cenomanian) amber of Myanmar. Manipulator modificaputis gen. et sp. n. is a morphologically unique extinct cockroach that represents the first (of a total of 29 known worldwide) cockroach family reported exclusively from the Myanmar amber. This family represents an early side branch of the stem group of Mantodea (most probably a sister group of Eadiidae within Blattaria/Corydioidea) because it has some synapomorphies with the Mantodea (including the stem group and Eadiidae). This family also retains symplesiomorphies that exclude a position in the crown group, and furthermore has unique autapomorphies that exclude a position as a direct ancestor of Mantodea. The unique adaptations such as strongly elongated extremities and freely movable head on a long neck suggest that these animals were pursuit predators. Five additional specimens (including two immatures) reported from the Myanmar amber suggest that this group was relatively rare but belonged to the indigenous and autochthonous inhabitants of the ancient amber forest of the Myanmar region.

  14. On German Unity 1

    African Journals Online (AJOL)

    On 3 October 1990 the division of Germany into two states came to an end. The. German Democratic Republic (GDR) acceded to the Federal Republic of Germany and in doing so ceased to exist. This epoch-making event took place peacefully and in agreement with all Germany's friends, allies and European neighbours.

  15. German Jewish Intellectuals and the German Occupation of Belgium

    Directory of Open Access Journals (Sweden)

    Ulrich Wyrwa

    2016-10-01

    Full Text Available In August 1914 the majority of German Jews expressed their patriotic approval of the war and their loyalty to the German state. They identified with Germany, and a large number signed up voluntarily for military service at the front. The Jewish population in Germany affirmed the war not least because it was directed against Russia, the harshest adversary of the Jews. This paper concentrates on the first acts of war conducted by the German military forces during the German occupation of Belgium; it examines whether and in what way German-Jewish Intellectuals perceived Germany’s violation of Belgian neutrality and the new feature of war as a war against a civilian population. The first part examines autobiographical sources to reconstruct the experiences and the perception of German Jewish soldiers, German military rabbis, and other German Jewish witnesses to the war. The second part then analyzes the coverage of German Jewish newspapers regarding the warfare against Belgium; and, finally, the third and last part scrutinizes the commentaries of German Jewish intellectuals and socialist Jews [Jewish socialists?] regarding the German war against Belgium.

  16. Profile of antimicrobial resistance of bacteria isolated from cockroaches (Periplaneta americana) in a Brazilian health care institution.

    Science.gov (United States)

    Prado, Marinésia Aparecida; Gir, Elucir; Pereira, Milca Severino; Reis, Cleomenes; Pimenta, Fabiana Cristina

    2006-02-01

    Cockroaches carry microorganisms to sterilized materials, equipment and non-contaminated food in hospitals and in homes. Hence, they are regarded as major microbial vectors. We isolated and identified microorganisms from living cockroaches captured from a Brazilian health care institution and we determined the antimicrobial susceptibility profile of the isolates. Following collection, cockroaches were immobilized at 4 degrees C for 10 to 20 minutes, immersed in 0.8% saline solution and then homogenized. Next, the suspension was seeded in culture media: brain and heart agar infusion, MacConkey agar, Naito agar, and they were incubated for up to 48 hours at 37 degrees C. Sabouraud agar cultures were incubated at ambient temperature. The microbial colonies were analyzed with a stereomicroscope to count and phenotypically identify the colony-forming units (cfu). The disc-diffusion method was used to determine the profile of susceptibility to antimicrobials. Among the 103 cockroaches analyzed, fungi were found in 97%, enterobacteria in 74.6% and coagulase-negative staphylococci (CNS) in 25.40%. Among the enterobacteria, 96% were resistant to gentamicin, 84% to ampicillin, 75.3% to caphalothin, 66.7% to ampicillin-sulbactam, 50% to aztreonam and 30% to chloramphenicol. Among the CNS, 61% were resistant to oxacillin. We concluded that cockroaches carry organisms associated with nosocomial infections and that are resistant to antimicrobials. This fact contributes to the epidemiological chain, complicating therapeutics, and consequently, medical costs are increased.

  17. Profile of antimicrobial resistance of bacteria isolated from cockroaches (Periplaneta americana in a Brazilian health care institution

    Directory of Open Access Journals (Sweden)

    Marinésia Aparecida Prado

    Full Text Available Cockroaches carry microorganisms to sterilized materials, equipment and non-contaminated food in hospitals and in homes. Hence, they are regarded as major microbial vectors. We isolated and identified microorganisms from living cockroaches captured from a Brazilian health care institution and we determined the antimicrobial susceptibility profile of the isolates. Following collection, cockroaches were immobilized at 4ºC for 10 to 20 minutes, immersed in 0.8% saline solution and then homogenized. Next, the suspension was seeded in culture media: brain and heart agar infusion, MacConkey agar, Naito agar, and they were incubated for up to 48 hours at 37ºC. Sabouraud agar cultures were incubated at ambient temperature. The microbial colonies were analyzed with a stereomicroscope to count and phenotypically identify the colony-forming units (cfu. The discdiffusion method was used to determine the profile of susceptibility to antimicrobials. Among the 103 cockroaches analyzed, fungi were found in 97%, enterobacteria in 74.6% and coagulase-negative staphylococci (CNS in 25.40%. Among the enterobacteria, 96% were resistant to gentamicin, 84% to ampicillin, 75.3% to caphalothin, 66.7% to ampicillin-sulbactam, 50% to aztreonam and 30% to chloramphenicol. Among the CNS, 61% were resistant to oxacillin. We concluded that cockroaches carry organisms associated with nosocomial infections and that are resistant to antimicrobials. This fact contributes to the epidemiological chain, complicating therapeutics, and consequently, medical costs are increased.

  18. Brain-Computer Interface Controlled Cyborg: Establishing a Functional Information Transfer Pathway from Human Brain to Cockroach Brain.

    Science.gov (United States)

    Li, Guangye; Zhang, Dingguo

    2016-01-01

    An all-chain-wireless brain-to-brain system (BTBS), which enabled motion control of a cyborg cockroach via human brain, was developed in this work. Steady-state visual evoked potential (SSVEP) based brain-computer interface (BCI) was used in this system for recognizing human motion intention and an optimization algorithm was proposed in SSVEP to improve online performance of the BCI. The cyborg cockroach was developed by surgically integrating a portable microstimulator that could generate invasive electrical nerve stimulation. Through Bluetooth communication, specific electrical pulse trains could be triggered from the microstimulator by BCI commands and were sent through the antenna nerve to stimulate the brain of cockroach. Serial experiments were designed and conducted to test overall performance of the BTBS with six human subjects and three cockroaches. The experimental results showed that the online classification accuracy of three-mode BCI increased from 72.86% to 78.56% by 5.70% using the optimization algorithm and the mean response accuracy of the cyborgs using this system reached 89.5%. Moreover, the results also showed that the cyborg could be navigated by the human brain to complete walking along an S-shape track with the success rate of about 20%, suggesting the proposed BTBS established a feasible functional information transfer pathway from the human brain to the cockroach brain.

  19. School of German Language

    Directory of Open Access Journals (Sweden)

    Sergei V. Evteev

    2014-01-01

    Full Text Available Department of German is one of the oldest language departments at MGIMO. Since its foundation in 1944 the military experienced teachers of the department, most of whom were native speakers, have begun to develop a unique method of teaching the German language, thereby revolutionize learning this foreign language. The first steps made under the supervision of the Department of Antonina V. Celica. The department refused to conventional time and is still used in universities such as the Moscow Linguistic University, separate teaching phonetics, grammar and vocabulary, which was due to the specific objectives set for the teaching staff: prepare for short term specialists in international relations, active Germanspeaking. The department can be proud of its graduates, many of whom continue his career in the walls of native high school. Many graduates have dedicated their lives to serving the State in the Ministry of Foreign Affairs.

  20. [German ophthalmologists and NSDAP

    Science.gov (United States)

    Rohrbach, Jens Martin

    2008-01-01

    Approximately 40-45 % of all German physicians joined the National Socialist German Workers Party (NSDAP) until 1945. Reasons for party membership are manifold and still a matter of debate. Very likely, the extraordinary high representation of medical doctors in the NSDAP was rather a result of active entry than recruitment by the party. There are only few data concerning the willingness of ophthalmologists to become a party member ("Parteigenosse", "Pg"). According to the list of University teachers in Germany ("Hochschullehrerkarte"; Federal Archive, Berlin), the list of the members of the German Ophthalmological Society (DOG) of 1934 and especially the list of NSDAP-members (Federal Archive, Berlin) the following conclusions can be drawn: 1. Directors of German University eye hospitals (chairmen) were members of the NSDAP with a frequency of 23% in 1933 and 48% in 1938 as well as in 1943. The motivation for joining the party was most likely the perspective of acceleration of the academic career. 2. "Only" 30% of the ophthalmologists working in private praxis were "Pg" (until 1945). 3. Both chairmen and ophthalmologists in private praxis were equally hindered to join the NSDAP between May 1st 1933 and May 1st 1937 when the party temporarily stopped registration. 4. The majority of ophthalmologists who joined the NSDAP were born between 1880 and 1900 and thus had taken part in World War I as soldiers or had experienced the times of need after WW I. Only few ophthalmologists succeeded in the NS-hierarchy and probably only one ophthalmologist, Walther Löhlein from Berlin, came in personal contact with Adolf Hitler who was constantly in fear for his sight after his eye injury in October 1918. The "Law for the prevention of genetically disabled offsprings" ("Gesetz zur Verhütung erbkranken Nachwuchses") from July 14th, 1933 separated ophthalmologists into two parties: those advocating sterilization to a high degree and those recommending sterilization only

  1. Aerobic Bacterial Community of American Cockroach Periplaneta americana,a Step toward Finding Suitable Paratransgenesis Candidates.

    Science.gov (United States)

    Akbari, Sanaz; Oshaghi, Mohammad Ali; Hashemi-Aghdam, Saedeh Sadat; Hajikhani, Sara; Oshaghi, Ghazaleh; Shirazi, Mohammad Hasan

    2015-06-01

    Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate. Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods. The analytical profile index (API) kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y. intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional plating method revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2). 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequence was identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species. A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.

  2. Aerobic Bacterial Community of American Cockroach Periplaneta americana,a Step toward Finding Suitable Paratransgenesis Candidates

    Directory of Open Access Journals (Sweden)

    Sanaz Akbari

    2015-10-01

    Full Text Available Background: Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate.Methods: Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods.Results: The analytical profile index (API kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y.intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional platingmethod revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2. 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequencewas identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species.Conclusion: A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.

  3. THE PAINT FORMULATION IN LAMBDACYHALOTHRIN USAGE AS P. americana COCKROACH CONTROL MEASURES

    Directory of Open Access Journals (Sweden)

    Lulus Susanti

    2014-06-01

    Full Text Available ABSTRAKKecoa adalah salah satu jenis serangga yang dianggap kotor dan merupakan seranggavektor. Scbagian besar kecoa yang ditemukan di sekitar pemukiman adalah Periplanetaamericana, Periplaneta brunea, Periplaneta australisea, Blatella germanica, Supellalongipalpa, Neostylopiga rhombifoUa dan Nauphaeta cinerea. Beberapa kecoa juga dapatmenularkan virus, bakteria, worm, protozoit dan jamur.Pengcndalian kecoa secara fogging dengan menggunakan insektisida masih kurangefektif dan praktis, sehingga dibutuhkan alternatif pengcndali. Dalam rangka untuk mencarimetode alternatif pengcndalian kecoa, maka akan dilakukan percobaan menggunakan cat kayuyang ditambahkan dengan insektisida.Dalam penelitian ini, insektisida cat kayu menggunakan bahan aktif Lambdacyhalothrin10WP. Pertama-tama dibuat beberapa solusi dari cat insektisida dalam dosis banyak. Kemudiancat papan kayu lapis. Setelah kcring sekitar satu hari, kemudian melakukan pengujian bioassayterhadap kecoa {Periplaneta americana . Hasil penelitian ini menunjukkan bahwa kayuinsektisida cat dengan dosis minimal 1,591% efektif untuk membunuh kecoa hingga 95%.Kata kunci: kecoa, cat berinsektisida, lambdacyhalothrinABSTRATCCockroaches are still considered to be disgusting insects and vector. Mostlycockroaches that are found around the resident, such as Periplaneta americana, Periplanetabrunea,Periplaneta australisea, Blatella germanica, Supella longipalpa, NeostylopigarhombifoUa and Nauphaeta cinerea. There are can transmit virus, bakteria, worm, protozoit andfungi.The methods for cocroaches control by using the fogging with insecticide is still lesseffective and practical, so it will need a controlling alternative. In order to find the alternativemethods for control the cockroach, it will conduct an experiments using impregnated paint woodby insecticide.In this research, insecticide paint wood using an active materials Lambdacyhalothrin10WP. For the first, it make some solution from insecticide paint in

  4. Experimental transmission of Toxocara canis from Blattella germanica and Periplaneta americana cockroaches to a paratenic host.

    Science.gov (United States)

    González-García, T; Muñoz-Guzmán, M A; Sánchez-Arroyo, H; Prado-Ochoa, M G; Cuéllar-Ordaz, J A; Alba-Hurtado, F

    2017-11-15

    The present study assessed the capacity of Blattella germanica and Periplaneta americana to disseminate and transmit infective phases of T. canis to rats, which were used as a model paratenic host. P. americana and B. germanica inoculated orally with T. canis larvated eggs shed eggs and larvae in their fecal matter during the first 6days post-inoculation. Larvae were recovered from the brain, lungs, kidneys and liver of rats that had been inoculated with either infected cockroaches or their feces. ELISAs of serum detected an increase of antibodies anti-T. canis excretion-secretion antigens, whereas Western Blot (WB) showed 4 bands (120, 50, 35 and 28kDa) that were similar to those found in positive control rats. Macroscopically, the liver and kidneys of infected rats had hemorrhagic areas with milk-spot-like lesions. The lungs showed diffuse grey protuberances. Histologically, hemorrhagic areas with leucocytic infiltrate were observed in the liver, lungs and kidneys. Some larvae were found within a granuloma that was surrounded by eosinophils and other leucocytic infiltrates. Larvae were found in the brain, but without inflammatory infiltrate. Both cockroach species that ingested larvated eggs of T. canis may shed viable larvae or eggs in their fecal matter. The induction of specific serum antibodies, presence of larvae in tissues and characteristic lesions associated with larval migration in the organs of rats that had ingested either whole adults or feces of B. germanica or P. americana demonstrate the capacity of these cockroaches to transmit toxocariosis to paratenic hosts. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Population ecology and movement of the American cockroach (Dictyoptera: Blattidae) in sewers.

    Science.gov (United States)

    Tee, Hui-Siang; Saad, Ahmad Ramli; Lee, Chow-Yang

    2011-07-01

    The population size, age-class structure, and movement of the American cockroach, Periplaneta americana (L.) (Dictyoptera: Blattidae), were studied in three sewers in Penang, Malaysia, from September 2008 to October 2009. Eighteen to 20 glass-jar traps (two per manhole) were deployed for a 24-h period during each sampling occasion at each sewer. Adults and nymphs were active throughout the study period, with an average monthly trap catch of 57-97 adults and 79-99 nymphs. The mean proportions of adults and nymphs at the three sewers ranged from 0.47 to 0.57. Of the 2177 male and 2717 female cockroaches marked and released over the three sewers, recapture rates were 29.4-45.8 and 30.8-47.0%, respectively. The proportion of marked males and females did not differ significantly from the proportion of recaptured marked males and females. However, the mean number of times a marked female was recaptured was significantly greater than that of males. Of the 783 males and 1,030 females that were marked and recaptured, 19.4 and 24.7%, respectively, had moved between manholes, and significantly more females than males moved between manholes. Of the 406 recaptured marked adults that moved between manholes, 90.4% moved a distance of 2-20 m from their initial release site; one male moved 192 m, the longest distance recorded. Trap catch on each sampling occasion was positively correlated with daily mean temperature. The number of cockroach movements between manholes also was correlated with the mean daily minimum temperature.

  6. How old are Germanic lambs?

    DEFF Research Database (Denmark)

    Vrieland, Seán D.

    2017-01-01

    Gothic and Gutnish lamb with the meaning ‘sheep’ sets these two languages apart from the rest of Germanic, and is the most common piece of evidence used to claim they share a close connection. Yet the same meaning is found in the descendants of Proto-Fennic *lambaz, a loan from Proto-Germanic, an......Gothic and Gutnish lamb with the meaning ‘sheep’ sets these two languages apart from the rest of Germanic, and is the most common piece of evidence used to claim they share a close connection. Yet the same meaning is found in the descendants of Proto-Fennic *lambaz, a loan from Proto......-Germanic, and speaks for Gothic and Gutnish preserving the original Proto-Germanic meaning of the etymon. These semantics provide a missing link for connecting Pro-to-Germanic *lambiz- with PIE *h₁él-n-/*h₁l-ón- ‘red deer’....

  7. Biogeography and Phylogeny of Wood-feeding Cockroaches in the Genus Cryptocercus

    Directory of Open Access Journals (Sweden)

    Kiyoto Maekawa

    2011-07-01

    Full Text Available Subsocial, xylophagous cockroaches of the genus Cryptocercus exhibit a disjunct distribution, with representatives in mature montane forests of North America, China, Korea and the Russian Far East. All described species are wingless and dependent on rotting wood for food and shelter at all stages of their life cycle; consequently, their distribution is tied to that of forests and strongly influenced by palaeogeographical events. Asian and American lineages form distinct monophyletic groups, comprised of populations with complex geographic substructuring. We review the phylogeny and distribution of Cryptocercus, and discuss splitting events inferred from molecular data.

  8. The cockroach Periplaneta americana as a potential paratenic host of the lungworm Aelurostrongylus abstrusus.

    Science.gov (United States)

    Falsone, Luigi; Colella, Vito; Napoli, Ettore; Brianti, Emanuele; Otranto, Domenico

    2017-11-01

    Aelurostrongylus abstrusus is a well-known nematode affecting the respiratory system of felids worldwide. Snails and slugs act as intermediate hosts of this parasite, whereas rodents, birds and reptiles may serve as paratenic hosts. Periplaneta americana, the American brown cockroach, shares the same habitat and ecological features (e.g. nocturnal activity) with both snails and cats. The aim of this study was to evaluate the capability of P. americana to maintain alive A. abstrusus third stage larvae (L3s) after artificial inoculation. Twenty-five specimens of P. americana were infected with 100 A. abstrusus L3s collected from experimentally infected Cornu aspersum snails, whereas five specimens were used as control group. After the infection, cockroaches were maintained in individual plastic boxes until dissection for the presence of L3s at 1 (T1), 5 (T5), 10 (T10), 15 (T15), and 20 (T20) days post-infection. Except for T15, alive A. abstrusus L3s (n = 63) were found at all time-points, being 26, 19, 16 and 2 L3s retrieved at T1, T5, T10 and T20, respectively. Eleven (17.4%) L3s were found within the digestive tract, 10 (15.9%) in other-than-digestive organs and 42 (66.7%) in the exoskeleton and associated tissues. Nine out of the twenty-five experimentally inoculated cockroaches (36%) died soon after the artificial infection (T1), while in the control group, two out of the five (40%) died before the end of the study (T15) with no difference in the mortality rate between groups. Results of this study suggest that P. americana could act as a paratenic host of A. abstrusus. Periplaneta americana cockroaches, have a ubiquitous distribution and may be preyed by cats, representing a potential source of infection to cats living in endemic areas. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. The German drought monitor

    Science.gov (United States)

    Zink, Matthias; Samaniego, Luis; Kumar, Rohini; Thober, Stephan; Mai, Juliane; Schäfer, David; Marx, Andreas

    2016-07-01

    The 2003 drought event in Europe had major implications on many societal sectors, including energy production, health, forestry and agriculture. The reduced availability of water accompanied by high temperatures led to substantial economic losses on the order of 1.5 Billion Euros, in agriculture alone. Furthermore, soil droughts have considerable impacts on ecosystems, forest fires and water management. Monitoring soil water availability in near real-time and at high-resolution, i.e., 4 × 4 km2, enables water managers to mitigate the impact of these extreme events. The German drought monitor was established in 2014 as an online platform. It uses an operational modeling system that consists of four steps: (1) a daily update of observed meteorological data by the German Weather Service, with consistency checks and interpolation; (2) an estimation of current soil moisture using the mesoscale hydrological model; (3) calculation of a quantile-based soil moisture index (SMI) based on a 60 year data record; and (4) classification of the SMI into five drought classes ranging from abnormally dry to exceptional drought. Finally, an easy to understand map is produced and published on a daily basis on www.ufz.de/droughtmonitor. Analysis of the ongoing 2015 drought event, which garnered broad media attention, shows that 75% of the German territory underwent drought conditions in July 2015. Regions such as Northern Bavaria and Eastern Saxony, however, have been particularly prone to drought conditions since autumn 2014. Comparisons with historical droughts show that the 2015 event is amongst the ten most severe drought events observed in Germany since 1954 in terms of its spatial extent, magnitude and duration.

  10. Baltic, Slavic, Germanic

    Directory of Open Access Journals (Sweden)

    Frederik Kortlandt

    2017-02-01

    Full Text Available The western Indo-European vocabulary in Baltic and Slavic is the result of an Indo-European substratum which contained an older non-Indo-European layer and was part of the Corded Ware horizon. The numbers show that a considerable part of the vocabulary was borrowed after the split between Baltic and Slavic, which came about when their speakers moved westwards north and south of the Pripet marshes. Germanic and Balto-Slavic were never contiguous Indo-European dialects at any stage of their prehistory.

  11. Electricity: the German example

    International Nuclear Information System (INIS)

    Huet, Sylvestre

    2013-01-01

    The author proposes some comments on the content of the Energiewende, i.e. the definition of the energy transition in Germany which aims at producing and consuming a green energy, without carbon nor nuclear. He comments the German energy mix for 2010 in terms of electricity production per origin (nuclear, coal and lignite, gas, oil, wind, solar photovoltaic, other renewable sources) and of installed capacities per origin. He notices that gas and coal still have a major weight in this mix, and discusses the content of a scenario based 100 per cent renewable energies as it has been studied by the Fraunhofer Institute, notably in terms of production level and of costs

  12. The German Humpback

    DEFF Research Database (Denmark)

    Aabo, Tom; Ploeen, Rasmus

    2014-01-01

    Previous studies find a monotonic positive relationship between a firm’s internationalization and its foreign exchange hedging. We argue that high levels of internationalization can reduce the need for foreign exchange hedging through diversification (e.g. sales to several markets) and operational...... hedging (matching of cash flows and operational flexibility). We employ multivariate regression analysis and find an inverse U-shape relationship (“humpback”) for large listed non-financial German firms. Foreign exchange hedging activity peaks when half of sales (or long-term assets) is outside Europe. We...

  13. Die Deutschen in Wisconsin (Germans in Wisconsin).

    Science.gov (United States)

    Wisconsin State Dept. of Public Instruction, Madison.

    The following curriculum units comprise this course book: (1) Germans in a New Home, (2) Contributions of the Germans in Wisconsin, (3) A Letter to Germany, (4) Germans Come to Kingston, (5) First a Soldier, Then a Man of the Church (about Heinrich von Rohr), (6) A Visiting German, and (7) Germans and Music. Each unit begins with a reading of…

  14. The German power supply situation

    International Nuclear Information System (INIS)

    Rauscher, K.

    2005-01-01

    The first key statement of this paper runs like this: The situation of power supply in Germany basically is good. However, two qualifications should be added: The current situation is still good. Power outages as a consequence of power plant failures of the kind experienced in other countries must not be expected to occur in Germany. German utilities work hard to offer this assurance also for the future. This is where politics comes in with the need to guarantee reliable framework conditions. After deregulation of the electricity market, reregulation resulting from government interventions is becoming potentially more and more problematic. Energy issues remain at the top of the political agenda, e.g. with the amendment to the Power Economy Act. This is a matter involving a variety of questions and projects on the part of legislators which require delicate handling because, in addition to the prices to be paid by consumers, they also involve as the most important factor the continuity of supply. Nuclear power today covers a major part of our baseload supply, in addition to lignite and hard coal which are used mainly in the medium-load range. Supported by the findings of recent studies, such as the dena Study, the Prognos and EWI Energy Report, the problem is how to replace this share reliably, in a way protecting the climate and economically viable, in line with the political conditions stipulating residual electricity outputs of nuclear power plants. Other countries can be seen to pursue different policies in using nuclear power. (orig.)

  15. Aromatic hexamerin subunit from adult female cockroaches (Blaberus discoidalis) : Molecular cloning, suppression by juvenile hormone, and evolutionary perspectives

    NARCIS (Netherlands)

    Jamroz, RC; Beintema, JJ; Stam, WT; Bradfield, JY

    In an effort to identify several polypeptides that are strongly suppressed by juvenile hormone (JH) in fat body of adult female Blaberus discoidalis cockroaches, we have cloned a cDNA representing a polypeptide member of the hexamerin family of arthropod serum proteins. The deduced primary

  16. IgE antibodies reactive with silverfish, cockroach and chironomid are frequently found in mite-positive allergic patients

    NARCIS (Netherlands)

    Witteman, A. M.; van den Oudenrijn, S.; van Leeuwen, J.; Akkerdaas, J.; van der Zee, J. S.; Aalberse, R. C.

    1995-01-01

    Approximately 30% of the house dust mite allergic patients in The Netherlands have IgE antibodies reactive with silverfish, cockroach and/or chironomid. In allergic patients without IgE antibodies against Dermatophagoides pteronyssinus less than 5% have IgE antibodies reactive with these insects. By

  17. CIRCADIAN CONTROL OF VISUAL INFORMATION-PROCESSING IN THE OPTIC LOBE OF THE GIANT COCKROACH BLABERUS-GIGANTEUS

    NARCIS (Netherlands)

    BULT, R; MASTEBROEK, HAK

    1993-01-01

    Extracellular spike activity from three different types of visual interneurons found in the optic lobe of the giant cockroach Blaberus giganteus was recorded. The spike rate of all three types of neurons fluctuated in a circadian manner in constant darkness (DD). Two types, so-called ''on'' neurons

  18. Subsocial Cockroaches Nauphoeta cinerea Mate Indiscriminately with Kin Despite High Costs of Inbreeding

    Science.gov (United States)

    Bouchebti, Sofia; Durier, Virginie; Pasquaretta, Cristian; Rivault, Colette; Lihoreau, Mathieu

    2016-01-01

    Many animals have evolved strategies to reduce risks of inbreeding and its deleterious effects on the progeny. In social arthropods, such as the eusocial ants and bees, inbreeding avoidance is typically achieved by the dispersal of breeders from their native colony. However studies in presocial insects suggest that kin discrimination during mate choice may be a more common mechanism in socially simpler species with no reproductive division of labour. Here we examined this possibility in the subsocial cockroach Nauphoeta cinerea, a model species for research in sexual selection, where males establish dominance hierarchies to access females and control breeding territories. When given a binary choice between a sibling male and a non-sibling male that had the opportunity to establish a hierarchy prior to the tests, females mated preferentially with the dominant male, irrespective of kinship or body size. Despite the lack of kin discrimination during mate choice, inbred-mated females incurred significant fitness costs, producing 20% less offspring than outbred-mated females. We discuss how the social mating system of this territorial cockroach may naturally limit the probability of siblings to encounter and reproduce, without the need for evolving active inbreeding avoidance mechanisms, such as kin recognition. PMID:27655156

  19. Effective Stimulus Parameters for Directed Locomotion in Madagascar Hissing Cockroach Biobot.

    Directory of Open Access Journals (Sweden)

    Jonathan C Erickson

    Full Text Available Swarms of insects instrumented with wireless electronic backpacks have previously been proposed for potential use in search and rescue operations. Before deploying such biobot swarms, an effective long-term neural-electric stimulus interface must be established, and the locomotion response to various stimuli quantified. To this end, we studied a variety of pulse types (mono- vs. bipolar; voltage- vs. current-controlled and shapes (amplitude, frequency, duration to parameters that are most effective for evoking locomotion along a desired path in the Madagascar hissing cockroach (G. portentosa in response to antennal and cercal stimulation. We identified bipolar, 2 V, 50 Hz, 0.5 s voltage controlled pulses as being optimal for evoking forward motion and turns in the expected contraversive direction without habituation in ≈50% of test subjects, a substantial increase over ≈10% success rates previously reported. Larger amplitudes for voltage (1-4 V and current (50-150 μA pulses generally evoked larger forward walking (15.6-25.6 cm; 3.9-5.6 cm/s but smaller concomitant turning responses (149 to 80.0 deg; 62.8 to 41.2 deg/s. Thus, the radius of curvature of the initial turn-then-run locomotor response (≈10-25 cm could be controlled in a graded manner by varying the stimulus amplitude. These findings could be used to help optimize stimulus protocols for swarms of cockroach biobots navigating unknown terrain.

  20. Transition by head-on collision: mechanically mediated manoeuvres in cockroaches and small robots

    Science.gov (United States)

    Mongeau, Jean-Michel; Mohapatra, Anand; Birkmeyer, Paul; Fearing, Ronald S.; Full, Robert J.

    2018-01-01

    Exceptional performance is often considered to be elegant and free of ‘errors’ or missteps. During the most extreme escape behaviours, neural control can approach or exceed its operating limits in response time and bandwidth. Here we show that small, rapid running cockroaches with robust exoskeletons select head-on collisions with obstacles to maintain the fastest escape speeds possible to transition up a vertical wall. Instead of avoidance, animals use their passive body shape and compliance to negotiate challenging environments. Cockroaches running at over 1 m or 50 body lengths per second transition from the floor to a vertical wall within 75 ms by using their head like an automobile bumper, mechanically mediating the manoeuvre. Inspired by the animal's behaviour, we demonstrate a passive, high-speed, mechanically mediated vertical transitions with a small, palm-sized legged robot. By creating a collision model for animal and human materials, we suggest a size dependence favouring mechanical mediation below 1 kg that we term the ‘Haldane limit’. Relying on the mechanical control offered by soft exoskeletons represents a paradigm shift for understanding the control of small animals and the next generation of running, climbing and flying robots where the use of the body can off-load the demand for rapid sensing and actuation. PMID:29445036

  1. Cellular elements for seeing in the dark: voltage-dependent conductances in cockroach photoreceptors

    Directory of Open Access Journals (Sweden)

    Salmela Iikka

    2012-08-01

    Full Text Available Abstract Background The importance of voltage-dependent conductances in sensory information processing is well-established in insect photoreceptors. Here we present the characterization of electrical properties in photoreceptors of the cockroach (Periplaneta americana, a nocturnal insect with a visual system adapted for dim light. Results Whole-cell patch-clamped photoreceptors had high capacitances and input resistances, indicating large photosensitive rhabdomeres suitable for efficient photon capture and amplification of small photocurrents at low light levels. Two voltage-dependent potassium conductances were found in the photoreceptors: a delayed rectifier type (KDR and a fast transient inactivating type (KA. Activation of KDR occurred during physiological voltage responses induced by light stimulation, whereas KA was nearly fully inactivated already at the dark resting potential. In addition, hyperpolarization of photoreceptors activated a small-amplitude inward-rectifying (IR current mediated at least partially by chloride. Computer simulations showed that KDR shapes light responses by opposing the light-induced depolarization and speeding up the membrane time constant, whereas KA and IR have a negligible role in the majority of cells. However, larger KA conductances were found in smaller and rapidly adapting photoreceptors, where KA could have a functional role. Conclusions The relative expression of KA and KDR in cockroach photoreceptors was opposite to the previously hypothesized framework for dark-active insects, necessitating further comparative work on the conductances. In general, the varying deployment of stereotypical K+ conductances in insect photoreceptors highlights their functional flexibility in neural coding.

  2. Fast and Powerful: Biomechanics and Bite Forces of the Mandibles in the American Cockroach Periplaneta americana.

    Directory of Open Access Journals (Sweden)

    Tom Weihmann

    Full Text Available Knowing the functionality and capabilities of masticatory apparatuses is essential for the ecological classification of jawed organisms. Nevertheless insects, especially with their outstanding high species number providing an overwhelming morphological diversity, are notoriously underexplored with respect to maximum bite forces and their dependency on the mandible opening angles. Aiming for a general understanding of insect biting, we examined the generalist feeding cockroach Periplaneta americana, characterized by its primitive chewing mouth parts. We measured active isometric bite forces and passive forces caused by joint resistance over the entire mandibular range with a custom-built 2D force transducer. The opening angle of the mandibles was quantified by using a video system. With respect to the effective mechanical advantage of the mandibles and the cross-section areas, we calculated the forces exerted by the mandible closer muscles and the corresponding muscle stress values. Comparisons with the scarce data available revealed close similarities of the cockroaches' mandible closer stress values (58 N/cm2 to that of smaller specialist carnivorous ground beetles, but strikingly higher values than in larger stag beetles. In contrast to available datasets our results imply the activity of faster and slower muscle fibres, with the latter becoming active only when the animals chew on tough material which requires repetitive, hard biting. Under such circumstances the coactivity of fast and slow fibres provides a force boost which is not available during short-term activities, since long latencies prevent a specific effective employment of the slow fibres in this case.

  3. Endogenous rhythm and pattern-generating circuit interactions in cockroach motor centres

    Directory of Open Access Journals (Sweden)

    Izhak David

    2016-09-01

    Full Text Available Cockroaches are rapid and stable runners whose gaits emerge from the intricate, and not fully resolved, interplay between endogenous oscillatory pattern-generating networks and sensory feedback that shapes their rhythmic output. Here we studied the endogenous motor output of a brainless, deafferented preparation. We monitored the pilocarpine-induced rhythmic activity of levator and depressor motor neurons in the mesothoracic and metathoracic segments in order to reveal the oscillatory networks’ architecture and interactions. Data analyses included phase relations, latencies between and overlaps of rhythmic bursts, spike frequencies, and the dependence of these parameters on cycle frequency. We found that, overall, ipsilateral connections are stronger than contralateral ones. Our findings revealed asymmetries in connectivity among the different ganglia, in which meta-to-mesothoracic ascending coupling is stronger than meso-to-metathoracic descending coupling. Within-ganglion coupling between the metathoracic hemiganglia is stronger than that in the mesothoracic ganglion. We also report differences in the role and mode of operation of homologue network units (manifested by levator and depressor nerve activity. Many observed characteristics are similar to those exhibited by intact animals, suggesting a dominant role for feedforward control in cockroach locomotion. Based on these data we posit a connectivity scheme among components of the locomotion pattern generating system.

  4. Subsocial Cockroaches Nauphoeta cinerea Mate Indiscriminately with Kin Despite High Costs of Inbreeding.

    Directory of Open Access Journals (Sweden)

    Sofia Bouchebti

    Full Text Available Many animals have evolved strategies to reduce risks of inbreeding and its deleterious effects on the progeny. In social arthropods, such as the eusocial ants and bees, inbreeding avoidance is typically achieved by the dispersal of breeders from their native colony. However studies in presocial insects suggest that kin discrimination during mate choice may be a more common mechanism in socially simpler species with no reproductive division of labour. Here we examined this possibility in the subsocial cockroach Nauphoeta cinerea, a model species for research in sexual selection, where males establish dominance hierarchies to access females and control breeding territories. When given a binary choice between a sibling male and a non-sibling male that had the opportunity to establish a hierarchy prior to the tests, females mated preferentially with the dominant male, irrespective of kinship or body size. Despite the lack of kin discrimination during mate choice, inbred-mated females incurred significant fitness costs, producing 20% less offspring than outbred-mated females. We discuss how the social mating system of this territorial cockroach may naturally limit the probability of siblings to encounter and reproduce, without the need for evolving active inbreeding avoidance mechanisms, such as kin recognition.

  5. Digital Divide: Low German and Other Minority Languages

    Science.gov (United States)

    Wiggers, Heiko

    2017-01-01

    This paper investigates the online presence of Low German, a minority language spoken in northern Germany, as well as several other European regional and minority languages. In particular, this article presents the results of two experiments, one involving "Wikipedia" and one involving "Twitter," that assess whether and to…

  6. German visits to CERN

    CERN Multimedia

    2007-01-01

    State secretary to Germany's Federal Ministry of Education and Research, Frieder Meyer-Krahmer, with CERN's Director-General Robert Aymar.On 21 February, Professor Frieder Meyer-Krahmer, State Secretary to Germany's Federal Ministry of Education and Research, came to CERN. He visited the ALICE and ATLAS experiments and the computing centre before meeting the CERN's Director-General, some German physicists and members of the top management. The Minister of Science, Research and the Arts of the Baden-Württemberg regional government, Peter Frankenberg, and CERN's Director-General, Robert Aymar, signing an agreement on education. In the background: Sigurd Lettow, CERN's Director of Finance and Human Resources, and Karl-Heinz Meisel, Rector of the Fachhochschule Karlsruhe. The Minister of Science, Research and the Arts of the Baden-Württemberg regional government, Prof. Peter Frankenberg, visited CERN on 23 February. He was accompanied by the Rector of the Fachhochschule Karlsruhe, Prof. Karl-Heinz Meisel, and b...

  7. German approach to VLLW management

    International Nuclear Information System (INIS)

    Broecking, D.

    1997-01-01

    Waste generated in German nuclear facilities is exhaustively and selectively manage through a system adapted to the waste's characteristics. The management of the waste ensures that the impact on the workers, population and the environment is acceptable. This is done through a detailed documentation and quality assurance program which applies not only to radioactive waste but also to cleanable material used within a licensed practice. In Germany the producer is responsible for the waste generated in a licensed facility and is therefore responsible for the correct disposal, which depends on the waste's characteristics. Since the waste producer requires a license for all activities involving radioactive substances, the atomic authority is continuously informed and can therefore monitor the producer for compliance with the regulations. The use and disposal of all material in a licensed practice is documented and can therefore be traced by the authorities. Clearance is seen in Germany as the best way of managing non-radioactive material in a licensed practice. Germany has developed clearance procedures which guarantee that after clearance the radiological impact is negligible. (author)

  8. High load of multi-drug resistant nosocomial neonatal pathogens carried by cockroaches in a neonatal intensive care unit at Tikur Anbessa specialized hospital, Addis Ababa, Ethiopia

    OpenAIRE

    Tilahun, Birkneh; Worku, Bogale; Tachbele, Erdaw; Terefe, Simegn; Kloos, Helmut; Legesse, Worku

    2012-01-01

    Abstract Background Cockroaches have been described as potential vectors for various pathogens for decades; although studies from neonatal intensive care units are scarce. This study assessed the vector potential of cockroaches (identified as Blatella germanica) in a neonatal intensive care unit setup in Tikur Anbessa Hospital, Addis Ababa, Ethiopia. Methods A total of 400 Blatella germanica roaches were aseptically collected for five consecutive months. Standard laboratory procedures were us...

  9. … but You Are Not German." -- Afro-German Culture and Literature in the German Language Classroom

    Science.gov (United States)

    Schenker, Theresa; Munro, Robert

    2016-01-01

    Units and classes dedicated to multiculturalism in Germany have predominantly focused on Turkish-German literature and culture. Afro-Germans have been a minority whose culture and literature have only marginally been included in German classes, even though Afro-Germans have been a part of Germany for centuries and have undergone efforts at…

  10. Mark Twain and "The Awful German Language."

    Science.gov (United States)

    Hedderich, Norbert

    2003-01-01

    Analyzes Mark Twain's 1869 essay "The Awful German Language" in terms of Twain's comments on morphological, syntactical, lexical, and phonological features of German. The topic is presented in the context of Twain's German language learning experience. Relevance of the article for German language instruction today is also described.…

  11. Layers of root nouns in Germanic

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2017-01-01

    The root-noun declension became productive in early Germanic, containing (I) inherited root nouns, (IIa) original substrate or loan words, and transitions from other declensions in (IIb) Proto-Germanic and (III) North Germanic. As ablaut was abolished, the inherited type would display ablaut grades...... that, in late Proto-Germanic, became predictable from the phonotactic structure of the root....

  12. Impact of deltamethrin on cockroaches (Periplaneta americana and its residue on environment

    Directory of Open Access Journals (Sweden)

    Endang Puji Astuti

    2015-01-01

    Full Text Available AbstrakLatar belakang: Penggunaan insektisida secara intensif tidak hanya memberikan dampak pada spesies target, namun juga pada spesies non-target dan lingkungan. Pada penelitian ini dilakukan penilaian pengaruh residu deltametrin terhadap kecoa (Periplanetaamericana, ikan lele (Clarias batrachus, dan nila (Oreochromis niloticus. Selain itu laju infiltrasi residu pada tipe tanah dengan komposisi tanah yang berbeda juga diukur. Metode: Percobaan dilakukan terhadap kecoa yang dikembangbiakan  di laboratorium di Institut Pertanian Bogor. Perlakuan dengan tiga ulangan dan lima taraf konsentrasi deltamethrin: 0.8%, 0.4%, 0.2%, 0.1% and 0.05% (v/v dilakukan untuk mengukur pengaruh residu terhadap kecoa selama 24 dan 48 jam. Penentuan LC  dilakukan dengan analisis Probit. Konsentrasi letal yang didapatkan kemudiandiujikan kepada ikan lele dan nila dengan metode semprot. Untuk perbandingan, uji efek organofosfat dengan konsentrasi 1 ppm dan 10 ppm dilakukan melalui metode soaking kepada dua jenis ikan tersebut. Laju infiltrasi residu pada tiga tipe komposisi tanah diukur menggunakan lysimeter. Hasil: Hasil penelitian menunjukkan bahwa LC50 residu deltamethrin terhadap kecoa tercapai pada konsentrasi 0,2% pada 24-jam perlakuan. Lima puluh persen ikan nila mati pada perlakuan deltamethrin0,2% selama 24 jam. Laju infiltrasi residu lebih tinggi pada jenis tanah berpasir (5 ml/menit dibandingkan jenis tanah yang didominasi tanah liat. Kesimpulan: Selain memiliki efek mematikan pada kecoa, Deltamethrin 0,2% mencemari tanah dan air, serta membunuh ikan nila (O. niloticus. (Health Science Indones 2014;2:94-9Kata kunci: deltamethrin, efek residu, P. americana, O. niloticus, tanahAbstractBackground: Intensive use of chemical insecticides not only affect the targetspecies, but also non-target species and environment. In this study, we examined residual effect of deltamethrin on cockroaches (Periplaneta americana, catfishes (Clarias batrachus and nile

  13. Establishing health standards for indoor foreign proteins related to asthma: Dust mite, cat and cockroach

    Energy Technology Data Exchange (ETDEWEB)

    Platts-Mills, T.A.E.; Chapman, M.D.; Pollart, S.M.; Heymann, P.W.; Luczynska, C.M. (Univ. of Virginia, Charlottesville (United States))

    1990-01-01

    There is no doubt that a large number of individuals become allergic to foreign proteins that are predominantly or exclusively present indoors. In each case this immune response can be demonstrated either by immediate skin test responses or by measuring serum IgE antibodies. It has also been obvious for some time that patients presenting with asthma, perennial rhinitis and atopic dermatitis have an increased prevalence of IgE antibodies to these indoor allergens. More recently several epidemiological surveys have suggested that both mite exposure and IgE antibodies are important risk factors for asthma. The present situation is that assays have been developed capable of measuring the presence of mite, cockroach and cat allergens in house dust. Further clinical studies will be necessary to test the proposed standards for mite allergens and to define risk levels for other allergens.

  14. Change in sex pheromone expression by nutritional shift in male cockroaches

    DEFF Research Database (Denmark)

    Jensen, Kim; Shearman, Melanie; Rapkin, James

    2017-01-01

    vs. carbohydrates) in male Nauphoeta cinerea cockroaches on consumption, final lipid reserves, and sex pheromone levels subsequent to completing sexual maturation on a specific diet, at high and low concentration of dietary nutrients. Consumption, lipid reserves, and sex pheromone levels were highly...... affected by dietary nutrient composition with higher values on carbohydrate-biased diet, and males had significantly higher and lower levels of consumption, lipid reserves, and sex pheromones when shifted to a carbohydrate-biased and a protein-biased diet, respectively, compared with males maintained...... on either initial diet throughout the experiment. Males shifted to a carbohydrate-biased diet at high nutrient concentration fully recouped their sex pheromone levels, attaining levels that were not significantly lower than those in males maintained on carbohydrate-biased diet at high nutrient concentration...

  15. Danish-German Submarine Cooperation

    DEFF Research Database (Denmark)

    Sender, Johannes F.; Lucas, Edward R.

    Germany has invited the Royal Danish Navy to participate in training missions and exercises on board German submarines. This brief examines the benefits and challenges of this proposed cooperation for both Denmark and NATO more broadly.......Germany has invited the Royal Danish Navy to participate in training missions and exercises on board German submarines. This brief examines the benefits and challenges of this proposed cooperation for both Denmark and NATO more broadly....

  16. Coursebook of German: Gender Aspect

    OpenAIRE

    Aleksandra Valeryevna Filippova

    2015-01-01

    The present article regards Aspekte 1 coursebook of German as a foreign language in the context of the gender policy initiated at the end of the last century by sociolinguists and by the representatives of the so called feminist criticism of the German language. This policy has been carried out up to date, and, according to many sociological and linguistic research, it is aimed at destructing gender stereotypes in teaching and reference materials. The use of this policy is conditioned by the ...

  17. The Optic Lobes Regulate Circadian Rhythms of Olfactory Learning and Memory in the Cockroach.

    Science.gov (United States)

    Lubinski, Alexander J; Page, Terry L

    2016-04-01

    The cockroach, Leucophaea maderae, can be trained in an associative olfactory memory task by either classical or operant conditioning. When trained by classical conditioning, memory formation is regulated by a circadian clock, but once the memory is formed, it can be recalled at any circadian time. In contrast, when trained via operant conditioning, animals can learn the task at any circadian phase, but the ability to recall the long-term memory is tied to the phase of training. The optic lobes of the cockroach contain a circadian clock that drives circadian rhythms of locomotor activity, mating behavior, sensitivity of the compound eye to light, and the sensitivity of olfactory receptors in the antennae. To evaluate the role of the optic lobes in regulating learning and memory processes, the authors examined the effects of surgical ablation of the optic lobes on memory formation in classical conditioning and memory recall following operant conditioning. The effect of optic lobe ablation was to "rescue" the deficit in memory acquisition at a time the animals normally cannot learn and "rescue" the animal's ability to recall a memory formed by operant conditioning at a phase where memory was not normally expressed. The results suggested that the optic lobe pacemaker regulates these processes through inhibition at "inappropriate" times of day. As a pharmacological test of this hypothesis, the authors showed that injections of fipronil, an antagonist of GABA and glutamate-activated chloride channels, had the same effects as optic lobe ablation on memory formation and recall. The data suggest that the optic lobes contain the circadian clock(s) that regulate learning and memory processes via inhibition of neural processes in the brain. © 2015 The Author(s).

  18. Identification and characterization of antibacterial compound(s) of cockroaches (Periplaneta americana).

    Science.gov (United States)

    Ali, Salwa Mansur; Siddiqui, Ruqaiyyah; Ong, Seng-Kai; Shah, Muhammad Raza; Anwar, Ayaz; Heard, Peter J; Khan, Naveed Ahmed

    2017-01-01

    Infectious diseases remain a significant threat to human health, contributing to more than 17 million deaths, annually. With the worsening trends of drug resistance, there is a need for newer and more powerful antimicrobial agents. We hypothesized that animals living in polluted environments are potential sources of antimicrobials. Under polluted milieus, organisms such as cockroaches encounter different types of microbes, including superbugs. Such creatures survive the onslaught of superbugs and are able to ward off disease by producing antimicrobial substances. Here, we characterized antibacterial properties in extracts of various body organs of cockroaches (Periplaneta americana) and showed potent antibacterial activity in crude brain extract against methicillin-resistant Staphylococcus aureus and neuropathogenic Escherichia coli K1. The size-exclusion spin columns revealed that the active compound(s) are less than 10 kDa in molecular mass. Using cytotoxicity assays, it was observed that pre-treatment of bacteria with lysates inhibited bacteria-mediated host cell cytotoxicity. Using spectra obtained with LC-MS on Agilent 1290 infinity liquid chromatograph, coupled with an Agilent 6460 triple quadruple mass spectrometer, tissues lysates were analysed. Among hundreds of compounds, only a few homologous compounds were identified that contained the isoquinoline group, chromene derivatives, thiazine groups, imidazoles, pyrrole-containing analogs, sulfonamides, furanones, and flavanones and known to possess broad-spectrum antimicrobial properties and anti-inflammatory, anti-tumour, and analgesic properties. Further identification, characterization, and functional studies using individual compounds can act as a breakthrough in developing novel therapeutics against various pathogens including superbugs.

  19. Antagonist pharmacology of desensitizing and non-desensitizing nicotinic acetylcholine receptors in cockroach neurons.

    Science.gov (United States)

    Salgado, Vincent L

    2016-09-01

    Two α-bungarotoxin-sensitive nicotinic acetylcholine (ACh) receptor subtypes in neurons of the American cockroach have been identified as desensitizing (nAChD) and selectively inhibitable with 100nM imidacloprid, and non-desensitizing (nAChN) and selectively inhibitable with 100pM methyllycaconitine. In this paper, the single-electrode voltage-clamp technique was used to measure concentration-response relations for the action of ACh and five antagonists on pharmacologically separated nAChD and nAChN receptors of acutely dissociated neurons from thoracic ganglia of the American cockroach. A dual bath and U-tube perfusion system was used to achieve rapid application of ACh in the continued presence of antagonists, which was essential to accurately measure inhibition by rapidly-reversible antagonists. ACh activated both receptors with an EC 50 of 7μM and the antagonist potencies were (nAChD/nAChN in nM): dihydro-β-erythroidine: 1.0/5.6, d-tubocurarine: 1000/34, condelphine: 0.39/0.65, phencyclidine: 74/980 and mecamylamine 47/1150. While each of these antagonists displayed some subtype selectivity, none are selective enough to be used as subtype-selective tools. These results bring to a total of 16 the number of nicotinic compounds that have been measured on nAChD and nAChN currents. Characterization of these receptors is important for understanding the role of nAChRs in the insect nervous system and the mechanism of action of insecticides. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Gas exchange patterns and water loss rates in the Table Mountain cockroach, Aptera fusca (Blattodea: Blaberidae).

    Science.gov (United States)

    Groenewald, Berlizé; Bazelet, Corinna S; Potter, C Paige; Terblanche, John S

    2013-10-15

    The importance of metabolic rate and/or spiracle modulation for saving respiratory water is contentious. One major explanation for gas exchange pattern variation in terrestrial insects is to effect a respiratory water loss (RWL) saving. To test this, we measured the rates of CO2 and H2O release ( and , respectively) in a previously unstudied, mesic cockroach, Aptera fusca, and compared gas exchange and water loss parameters among the major gas exchange patterns (continuous, cyclic, discontinuous gas exchange) at a range of temperatures. Mean , and per unit did not differ among the gas exchange patterns at all temperatures (P>0.09). There was no significant association between temperature and gas exchange pattern type (P=0.63). Percentage of RWL (relative to total water loss) was typically low (9.79±1.84%) and did not differ significantly among gas exchange patterns at 15°C (P=0.26). The method of estimation had a large impact on the percentage of RWL, and of the three techniques investigated (traditional, regression and hyperoxic switch), the traditional method generally performed best. In many respects, A. fusca has typical gas exchange for what might be expected from other insects studied to date (e.g. , , RWL and cuticular water loss). However, we found for A. fusca that expressed as a function of metabolic rate was significantly higher than the expected consensus relationship for insects, suggesting it is under considerable pressure to save water. Despite this, we found no consistent evidence supporting the conclusion that transitions in pattern type yield reductions in RWL in this mesic cockroach.

  1. Intelligibility of Standard German and Low German to Speakers of Dutch

    NARCIS (Netherlands)

    Gooskens, C.S.; Kürschner, Sebastian; van Bezooijen, R.

    2011-01-01

    This paper reports on the intelligibility of spoken Low German and Standard German for speakers of Dutch. Two aspects are considered. First, the relative potential for intelligibility of the Low German variety of Bremen and the High German variety of Modern Standard German for speakers of Dutch is

  2. Larvae of the parasitoid wasp Ampulex compressa sanitize their host, the American cockroach, with a blend of antimicrobials.

    Science.gov (United States)

    Herzner, Gudrun; Schlecht, Anja; Dollhofer, Veronika; Parzefall, Christopher; Harrar, Klaus; Kreuzer, Andreas; Pilsl, Ludwig; Ruther, Joachim

    2013-01-22

    Food resources contaminated with spoilage or pathogenic microorganisms pose severe problems to all higher organisms. Here, we describe a food-hygienic strategy of the emerald cockroach wasp Ampulex compressa. The wasp larvae develop on and inside the American cockroach Periplaneta americana, a host that can harbor various putrefactive microbes, as well as human and insect pathogens. From P. americana, we isolated the Gram-negative bacterium Serratia marcescens, which is a potent entomopathogen that can rapidly kill insect larvae. It is also known as a food contaminant and as an opportunistic human pathogen. Using behavioral observations and chemical analyses, we demonstrated that A. compressa larvae impregnate their cockroach hosts from inside with large amounts of an oral secretion containing a blend of γ-lactones and isocoumarins with (R)-(-)-mellein [(R)-(-)-3,4-diydro-8-hydroxy-3-methylisocoumarin] and micromolide [(4R,9Z)-octadec-9-en-4-olide] as dominant components. We fractionated hexane extracts of the secretion and investigated the antimicrobial properties of the fraction containing the lactones and isocoumarins, as well as of synthetic (R)-(-)-mellein and micromolide, against S. marcescens and a Gram-positive bacterium, Staphylococcus hyicus, in broth microdilution assays. The test fraction inhibited growth of both tested bacteria. The activity of the fraction against S. marcescens was explained by (R)-(-)-mellein alone, and the activity against S. hyicus was explained by the combined action of (R)-(-)-mellein and micromolide. Our data suggest that the specific combination of antimicrobials in the larval secretion provides an effective frontline defense against the unpredictable spectrum of microbes that A. compressa larvae may encounter during their development inside their cockroach hosts.

  3. Cuticle Fatty Acid Composition and Differential Susceptibility of Three Species of Cockroaches to the Entomopathogenic Fungi Metarhizium anisopliae (Ascomycota, Hypocreales).

    Science.gov (United States)

    Gutierrez, Alejandra C; Gołębiowski, Marek; Pennisi, Mariana; Peterson, Graciela; García, Juan J; Manfrino, Romina G; López Lastra, Claudia C

    2015-04-01

    Differences in free fatty acids (FFAs) chemical composition of insects may be responsible for susceptibility or resistance to fungal infection. Determination of FFAs found in cuticular lipids can effectively contribute to the knowledge concerning insect defense mechanisms. In this study, we have evaluated the susceptibility of three species of cockroaches to the entomopathogenic fungi Metarhizium anisopliae (Metschnikoff) Sorokin by topical application. Mortality due to M. anisopliae was highly significant on adults and nymphs of Blattella germanica L. (Blattodea: Blattellidae). However, mortality was faster in adults than in nymphs. Adults of Blatta orientalis L. (Blattodea: Blattidae) were not susceptible to the fungus, and nymphs of Blaptica dubia Serville (Blattodea: Blaberidae) were more susceptible to the fungus than adults. The composition of cuticular FFAs in the three species of cockroaches was also studied. The analysis indicated that all of the fatty acids were mostly straight-chain, long-chain, saturated or unsaturated. Cuticular lipids of three species of cockroaches contained 19 FFAs, ranging from C14:0 to C24:0. The predominant fatty acids found in the three studied species of cockroaches were oleic, linoleic, palmitic, and stearic acid. Only in adults of Bl. orientalis, myristoleic acid, γ-linolenic acid, arachidic acid, dihomolinoleic acid, and behenic acid were identified. Lignoceric acid was detected only in nymphs of Bl. orientalis. Heneicosylic acid and docosahexaenoic acid were identified in adults of Ba. dubia. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  4. Caffeine-supplemented diet modulates oxidative stress markers and improves locomotor behavior in the lobster cockroach Nauphoeta cinerea.

    Science.gov (United States)

    da Silva, Cícera Simoni; de Cássia Gonçalves de Lima, Rita; Elekofehinti, Olusola Olalekan; Ogunbolude, Yetunde; Duarte, Antonia Eliene; Rocha, João Batista Teixeira; Alencar de Menezes, Irwin Rose; Barros, Luiz Marivando; Tsopmo, Appolinaire; Lukong, Kiven Erique; Kamdem, Jean Paul

    2018-02-25

    The effects of caffeine supplementation is well documented in conventional animal models, however, in the lobster cockroaches Nauphoeta cinerea, they have not been reported. Thus, the aim of this study was to investigate the locomotor behavior and biochemical endpoints in the head of the nymphs of N. cinerea following 60 days exposure to food supplemented with 0, 0.5, 1.0, 2.5, 5.0 and 10.0 mg of caffeine/g of diet. The analysis of the locomotor behavior using the video-tracking software, Any-maze, for 12 min revealed that caffeine supplementation caused significant behavioral improvement. There was increase in distance travelled, velocity, frequency of rotation and turn angle (stereotypical behavior such as circling movements), and this was supported by the representative track plots of the path travelled by cockroaches in the open-field arena. In addition, caffeine supplementation markedly increased total thiol and non-protein thiol glutathione (GSH) levels in the heads of cockroaches, and this was in parallel with significant reduction of lipid peroxidation and free Fe(II) content. Taking together, our results indicate that long-term caffeine supplementation may exert preventive effects against oxidative stress and support the use of N. cinerea as an efficient alternative model to assess the efficacy of food molecules. Copyright © 2018 Elsevier B.V. All rights reserved.

  5. Isolation and Purification of an Antibacterial Protein from Immune Induced Haemolymph of American Cockroach,Periplaneta americana.

    Science.gov (United States)

    Basseri, Hamid Reza; Dadi-Khoeni, Amir; Bakhtiari, Ronak; Abolhassani, Mandan; Hajihosseini-Baghdadabadi, Reza

    2016-12-01

    Antimicrobial peptides play a role as effectors substances in the immunity of vertebrate and invertebrate hosts. In the current study, antimicrobial peptide was isolated from the haemolymph of the American cockroach, Periplaneta americana . Micrococcus luteus as Gram-positive bacteria and Escherichia coli as Gram-negative bacteria were candidate for injection. Induction was done by injecting both bacteria into the abdominal cavity of two groups of cockroaches separately. The haemolymphs were collected 24 hours after post injection and initially tested against both bacteria. Subsequently, the immune induced haemolymph was purified by high performance liquid chromatography (HPLC) to separate the proteins responsible for the antibacterial activity. The non-induced haemolymph did not show any activity against both bacteria whereas induced haemolymph exhibited high activity against M. luteus but did less against E. coli . Two fractions showed antibacterial activity against M. luteus. Finally the molecular weight of the isolated antibacterial proteins were determined as 72 kDa and 62 kDa using SDS-PAGE. Induced haemolymph of American cockroaches has the ability to produce peptides to combat against Gram-positive bacteria when an immune challenge is mounted. Further work has to be done to sequence of the protein, which it would be advantageous.

  6. Ontogeny of hemocyanin in the ovoviviparous cockroach Blaptica dubia suggests an embryo-specific role in oxygen supply.

    Science.gov (United States)

    Pick, Christian; Schneuer, Marco; Burmester, Thorsten

    2010-05-01

    For a long time it had been assumed that specific oxygen transport proteins are absent in insects. Only recently it has been demonstrated that hemocyanins occur in the hemolymph of many ametabolous and hemimetabolous insect taxa, but not in the Eumetabola (Hemiptera+Holometabola). Therefore, the loss of respiratory hemocyanin in insects is not correlated with the evolution of an efficient tracheal system. The specific contribution of hemocyanin to oxygen supply in insects, however, has remained uncertain. Here we investigate the stage-specific expression of hemocyanin in the ovoviviparous cockroach Blaptica dubia (Blattaria), which consists of two distinct subunit types (Hc1 and Hc2). Employing quantitative real-time RT-PCR and Western blotting, we showed that the expression of hemocyanin is restricted to late embryos, thus being detectable also in whole female extracts and oothecae. Hemocyanin protein is also present in 1st instar nymphs, but not in later developmental stages. The ontogeny of hemocyanin in cockroaches is distinct from that known from Zygentoma and Plecoptera, in which hemocyanin occurs in both nymphal and adult stages. Our findings suggest a specific role of hemocyanin in embryonic cockroaches, which may be related to an enhanced oxygen supply in the oothecae. For some reason, the fundamental physiological changes associated to the evolution of holometaboly have made hemocyanin unnecessary. Copyright 2009 Elsevier Ltd. All rights reserved.

  7. The German Debate on Tactical Nuclear Weapons

    International Nuclear Information System (INIS)

    Meier, Olivier

    2008-01-01

    This report analyses the debate in Germany about tactical nuclear weapons deployments in Europe. It is mainly based on interviews conducted with senior officials from the German Federal Foreign Ministry, the Federal Ministry of Defence, senior members of Parliament as well as experts from research institutes and think-tanks. The interviews focused on the more recent past in the German debate as well as the future of tactical nuclear weapon deployments in Germany and Europe. The report concludes that while a change of Germany's position on tactical nuclear weapons is unlikely to change in the short-term, several developments will make it unlikely that the continued involvement of Germany in NATO nuclear sharing will have to be debated in the medium term. Should the next Parliamentary elections, which will take place in 2009 at the latest, result in a Social Democrat-led government, a push for a reduction of Germany's involvement in NATO nuclear sharing appears possible. A conservative-led government is likely to maintain the nuclear status quo within NATO

  8. Bullying Involvement of Korean Children in Germany and in Korea

    Science.gov (United States)

    Bae, Hwa-ok

    2016-01-01

    This study compared bullying involvement of Korean or Korean-German children living in Germany with children in Korea, and examined children's perceptions of school environment associated with bullying involvement of the children. This study included 105 Korean or Korean-German children living in the Bayern State of Germany as the study sample and…

  9. Anglo-german – a colloquial language?

    Directory of Open Access Journals (Sweden)

    Rodica Teodora BIRIŞ

    2011-01-01

    Full Text Available In the last years more and more words from English entered in German language, which ledto the formation of a colloquial language called "Denglisch" from "Deutsch - German" and"Englisch - English". Denglisch differs from the Anglicisms through the fact that here are observedsyntactic and morphological rules of the German language, which proves the power of Germangrammar.In the article below we follow the areas where the colloquial language is used morefrequently and how it is used by German speakers. Denglisch is fought by the German linguists,who recommended the use of English words, only if there is not a similar term in German.

  10. Immobile Complex Verbs in Germanic

    DEFF Research Database (Denmark)

    Vikner, Sten

    2005-01-01

    Certain complex verbs in Dutch, German, and Swiss German do not undergo verb movement. The suggestion to be made in this article is that these ‘‘immobile'' verbs have to fulfill both the requirements imposed on complex verbs of the V° type (=verbs with non-separable prefixes) and the requirements...... imposed on complex verbs of the V* type (=verbs with separable prefixes). This results in such verbs being morphologically unexceptional, i.e., having a full set of forms but syntactically peculiar (‘‘immobile''), i.e., they can only occur in their base position. Any movement is incompatible with either...... frequent type with only one prefix-like part (e.g., German bauchreden/Dutch buikspreken ‘to ventriloquize'). This analysis will try to account not only for the data discussed in Haider (1993) and Koopman (1995) but also for the following: - why immobile verbs include verbs with only one prefix-like part...

  11. The Core Gut Microbiome of the American Cockroach, Periplaneta americana, Is Stable and Resilient to Dietary Shifts.

    Science.gov (United States)

    Tinker, Kara A; Ottesen, Elizabeth A

    2016-11-15

    The omnivorous cockroach Periplaneta americana hosts a diverse hindgut microbiota encompassing hundreds of microbial species. In this study, we used 16S rRNA gene sequencing to examine the effect of diet on the composition of the P. americana hindgut microbial community. Results show that the hindgut microbiota of P. americana exhibit a highly stable core microbial community with low variance in compositions between individuals and minimal community change in response to dietary shifts. This core hindgut microbiome is shared between laboratory-hosted and wild-caught individuals, although wild-caught specimens exhibited a higher diversity of low-abundance microbes that were lost following extended cultivation under laboratory conditions. This taxonomic stability strongly contrasts with observations of the gut microbiota of mammals, which have been shown to be highly responsive to dietary change. A comparison of P. americana hindgut samples with human fecal samples indicated that the cockroach hindgut community exhibited higher alpha diversity but a substantially lower beta diversity than the human gut microbiome. This suggests that cockroaches have evolved unique mechanisms for establishing and maintaining a diverse and stable core microbiome. The gut microbiome plays an important role in the overall health of its host. A healthy gut microbiota typically assists with defense against pathogens and the digestion and absorption of nutrients from food, while dysbiosis of the gut microbiota has been associated with reduced health. In this study, we examined the composition and stability of the gut microbiota from the omnivorous cockroach Periplaneta americana. We found that P. americana hosts a diverse core gut microbiome that remains stable after drastic long-term changes in diet. While other insects, notably ant and bee species, have evolved mechanisms for maintaining a stable association with specific gut microbiota, these insects typically host low-diversity gut

  12. Classical Music at a German Inner-City School: The German Philharmonic Chamber Orchestra Bremen at Comprehensive School Bremen East

    Directory of Open Access Journals (Sweden)

    Anna-Lena Musiol

    2013-12-01

    Full Text Available The German Philharmonic Chamber Orchestra Bremen, a world famous orchestra for classical music, and the Comprehensive School Bremen East, a school in a deprived area, in North American terms an inner-city school, are cooperating since 2007. A three-year follow-up evaluation study was conducted to find out, if projects facilitated by the presence of the orchestra have a positive impact on the self-reported well-being and the grades of students. Results showed that involvement in the projects distinctly benefited boys: They experience a better class climate and a higher satisfaction with school as well as improved German grades.

  13. Occupied Europe and German art historiography: methodology and morals

    Directory of Open Access Journals (Sweden)

    Arnold Witte

    2017-06-01

    Full Text Available Review of Kunstgeschichte in den besetzten Gebieten 1939-1945, edited by Magdalena Bushart, Agnieszka Gasior and Alena Janatkova. Cologne/Weimar/Vienna: Böhlau, 2016. The art historiography of the period of German National-Socialism has made significant methodological progress in the last two decades, and the present volume widens the geographical scope to include the territories occupied between 1939 and 1945 by the German army. How did art historians in these countries respond to the expectations and demands of these new authorities? A range of studies on Czech, Polish, Dutch, Belgian and Lithuanian academics shows how they were either lured into cooperation with the Germans on the basis of ‘Aryan’ concepts of art and culture, or ostracized when not considered part of the German race. A range of other essays on German art historians show how they were actively involved in propaganda activities in occupied countries. Notwithstanding its geographical bias towards eastern Europe, this volume shows how important this exchange was for the course of the discipline in various regions, and that using archival research is a sine-qua-non for the study of art historiography in times of regime change.

  14. Synergistic effect of some essential oils on toxicity and knockdown effects, against mosquitos, cockroaches and housefly

    Directory of Open Access Journals (Sweden)

    Idin Zibaee

    2015-12-01

    Full Text Available The toxicity and knockdown effect of Eucalyptus globulus, Rosmarinus officinalis essential oils and their mixed formulation on Periplaneta Americana (L., Blattella germanica (L., Supella longipalpa, Culex pipiens, Anopheles stephensi and Musca domestica were evaluated in a series of laboratory experiments. In all bioassay five different doses (0.625, 1.25, 2.5, 5 and 10% were used by filter paper (cm2 and aerosol (cm3 bioassay methods, all essential oils was toxic to cockroaches, mosquitos and housefly species the lowest and the highest LC50 belong to mixed formulation on B. germanica (LC50 6.1 and E. globulus on P. americana (LC50 27.7 respectively. In continuous exposure experiments, Mortality (LT50 values for cockroaches ranged from 1403.3 min with 0.625% E. globulus (for P. americana to 2.2 min with 10% mixed formulation for A. stephensi. The KT50 values ranged from 0.1 to 1090.8 min for 10% and 0.625 for mixed formulation and R. officinalis respectively. The mortality after 24 h for mixed formulation was 100% but for single essential oils ranged from 81.5 to 98.3 for P. americana treated with R. officinalis and A. stephensi treated with E. globulus respectively. Studies on persistence of essential oils on impregnated paper revealed that it has more adulticidal activity for longer period at low storage temperature. Gas chromatographic-mass spectrometric analysis of essential oil showed 14 and 16 peaks for E. globules and R. officinalis respectively. α-Pinene (39.8%, 1, 8-Cineole (13.2%, Camphene (9.1% and Borneol (3.7% were present in major amounts for R. officinalis and 1,8-Cineole (31.4%, α-Pinene (15.3%, d-Limonene (9.7% and α-Terpinolen (5.3% were present in major amounts for E. globulus respectively. Our results showed that two surveyed essential oils has compatible with synergistic effect on various insect species, furthermore it is useful for applying as integrated pest management tool for studied insects management, especially in

  15. The Danish Press during the German Occupation

    DEFF Research Database (Denmark)

    Roslyng-Jensen, Palle

    2010-01-01

    Censorship, self-censorship in Danish newspapers and Danish Radio during the German occupation of Denmark 1940-45......Censorship, self-censorship in Danish newspapers and Danish Radio during the German occupation of Denmark 1940-45...

  16. Levelling in the German Verb Paradigm

    Science.gov (United States)

    Newman, John

    1974-01-01

    Levelling processes in the history of the German verb paradigm from Old High German to the present are discussed. It is asserted that the theory of transformational generative grammar provides a proper framework for the study of linguistic change. (RM)

  17. German 1990: Intensive and Diverse.

    Science.gov (United States)

    Kempf, Franz R.

    1990-01-01

    Suggests the following methods for improving university-level German language education curricula: reduce skill-development time through immersion programs, adopt Zertifikat Deutsch als Fremdsprache as the proficiency standard for advanced students, and include literature from a variety of liberal arts disciplines in the reading materials for…

  18. Dividend Policy of German Firms

    NARCIS (Netherlands)

    Goergen, M.; Renneboog, L.D.R.; Correia Da Silva, L.

    2004-01-01

    German firms pay out a lower proportion of their cash flows than UK and US firms.However, on a published profits basis, the pattern is reversed.Company law provisions and accounting policies account for these conflicting results.A partial adjustment model is used to estimate the implicit target

  19. German urologists under national socialism.

    Science.gov (United States)

    Krischel, Matthis

    2014-08-01

    The first full-time professorship for urology at a German university was established in 1937 and in 1942, a rare teaching qualification (Habilitation) for urology was granted, both at the prestigious Berlin University. At the same time, nearly a third of all physicians who worked in the field of urology were classified as "non-Aryan" according to Nazi race laws and were forced out of their profession and their homeland. Many of them committed suicide or, if they refused to flee, were murdered in concentration camps. German urologists also contributed to compulsory sterilization of men according to the "law for the prevention of hereditarily diseased offspring" between 1934 and 1945. Historical sources on the history of urology in Nazi Germany were reviewed and analyzed. These include textbooks and medical journals from the 1930s and 1940s, as well as files from different state and university archives. For urologists, the changing political environment in Germany after 1933 offered possibilities to assert their personal and professional interests. Unfortunately, in many cases, moral principles were thrown overboard, and physicians advanced their own careers and the specialty of urology at the expense of their patients and their Jewish colleagues. Under national socialism, German urologists backed Nazi health and race policies and in exchange gained further professionalization for their specialty, including university positions and increased independence from surgery. Only in recent years has this chapter of German urology's past become a topic of debate among members of the professional society.

  20. Anglo-german – a colloquial language?

    OpenAIRE

    Rodica Teodora BIRIŞ

    2011-01-01

    In the last years more and more words from English entered in German language, which ledto the formation of a colloquial language called "Denglisch" from "Deutsch - German" and"Englisch - English". Denglisch differs from the Anglicisms through the fact that here are observedsyntactic and morphological rules of the German language, which proves the power of Germangrammar.In the article below we follow the areas where the colloquial language is used morefrequently and how it is used by German s...

  1. [German resuscitation registry : science and resuscitation research].

    Science.gov (United States)

    Gräsner, J-T; Seewald, S; Bohn, A; Fischer, M; Messelken, M; Jantzen, T; Wnent, J

    2014-06-01

    Sudden death due to cardiac arrest represents one of the greatest challenges facing modern medicine, not only because of the massive number of cases involved but also because of its tremendous social and economic impact. For many years, the magic figure of 1 per 1000 inhabitants per year was generally accepted as an estimate of the annual incidence of sudden death in the industrialized world, with a survival rate of 6 %. This estimate was based on large numbers of published reports of local, regional, national and multinational experience in the management of cardiac arrest. Measuring the global incidence of cardiac arrest is challenging as many different definitions of patient populations are used. Randomized controlled trials (RCT) provide insights into the value of specific treatments or treatment strategies in a well-defined section of a population. Registries do not compete with clinical studies, but represent a useful supplement to them. Surveys and registries provide insights into the ways in which scientific findings and guidelines are being implemented in clinical practice. However, as with clinical studies, comprehensive preparations are needed in order to establish a registry. This is all the more decisive because not all of the questions that may arise are known at the time when the registry is established. The German resuscitation registry started in May 2007 and currently more than 230 paramedic services and hospitals take part. More than 45,000 cases of out-of-hospital cardiac arrest and in-hospital cardiac arrest are included. With this background the German resuscitation registry is one of the largest databases in emergency medicine in Germany. After 5 years of running the preclinical care dataset was revised in 2012. Data variables that reflect current or new treatment were added to the registry. The postresuscitation basic care and telephone cardiopulmonary resuscitation (CPR) datasets were developed in 2012 and 2013 as well. The German

  2. German Submarine Offensives and South African Countermeasures

    African Journals Online (AJOL)

    Evert

    direct result of the successful German submarine operations in the North Atlantic during 1939–1942. The first German .... The presence of Japanese and German warships in the Southern Atlantic and Indian Oceans was ..... sailed at great speed from the equator in order to arrive off Cape Town for the commencement of the.

  3. Enriching the Curriculum with Pennsylvania German

    Science.gov (United States)

    Meindl, Joerg

    2016-01-01

    The German classroom should prepare students for the linguistic diversity of the target culture, including regional varieties and German spoken outside of the D-A-CH region. Because textbooks do not often include materials on regional varieties, this article presents a model to incorporate Pennsylvania German (PG) into the curriculum. The model…

  4. Bioelimination of /sup 51/Cr and /sup 85/Sr by cockroaches, Gromphadorhina portentosa (orthoptera: blaberidae), as affected by mites, Gromphadorholaelaps schaeferi (parasitiformes: laelapidae)

    Energy Technology Data Exchange (ETDEWEB)

    Schowalter, T.D.; Crossley, D.A. Jr.

    1982-03-01

    The rates of Chromium-51 and Strontium-85 assimilation and bioelimination by the hissing cockroach, Gromphadorhina portentosa (Schaum) are described when the symbiotic mite, Gromphadorholaelaps schaeferi Till, was present or removed. Mite-infested cockroaches had significantly higher rates of /sup 51/Cr elimination relative to mite-free cockroaches, implying more rapid gut clearance times. The authors did not find a significant mite effect on /sup 85/Sr elimination by the host, but mite effects could have been masked by the apparently unique process of nutrient assimilation and elimination by G. portentosa. Conventional models of radioactive tracer bioelimination predict a rapid initial loss of tracer due to gut clearance, followed by a slower loss due to excretion of assimilated tracer. The results indicated that assimilated /sup 85/Sr was eliminated earlier than unassimilated /sup 85/Sr, which was lost by defecation.

  5. Bioelimination of /sup 51/Cr and /sup 85/Sr by cockroaches, Gromphadorhina portentosa (Orthoptera: Blaberidae), as affected by mites, Gromphadorholaelaps schaeferi (parasitiformes: laelapidae)

    Energy Technology Data Exchange (ETDEWEB)

    Schowalter, T.D.; Crossley, D.A. Jr.

    1982-03-01

    This paper describes rates of Chromium-51 and Strontium-85 assimilation and bioelimination by the hissing cockroach, Gromphadorhina portentosa (Schaum), when the symbiotic mite, Gromphadorholaelaps schaeferi Till, was present or removed. Mite-infested cockroaches had significantly higher rates of /sup 51/Cr elimination relative to mite-free cockroaches, implying more rapid gut clearance times. We did not find a significant mite effect on /sup 85/Sr elimination by the host, but mite effects could have been masked by the apparently unique process of nutrient assimilation and elimination by G. portentosa. Conventional models of radioactive tracer bioelimination predict a rapid initial loss of tracer due to gut clearance, followed by a slower loss due to excretion of assimilated tracer. Our results indicated that assimilated /sup 85/Sr was eliminated earlier than unassimilated /sup 85/Sr was lost by defecation.

  6. Laboratory Evaluation of Toxicity of Insecticide Formulations from Different Classes against American Cockroach (Dictyoptera: Blattidae.

    Directory of Open Access Journals (Sweden)

    Ruhma Syed

    2014-06-01

    Full Text Available The present study was designed to investigate the insecticidal efficacy of four different classes of insecticides: pyrethroids, organophosphates, phenyl-pyrazoles and neo-nicotenoids. One representative chemical from each class was selected to compare the toxicity: deltamethrin from pyrethroids, Dichlorovinyl Dimethyl Phosphate (DDVP from organophosphates, fipronil from phenyl-pyrazoles and imidacloprid from neo-nicotenoids. The objective of this study was to determine which of these insecticides were most effective against American cockroach.These insecticides were tested for their LC50 values against Periplaneta americana under topical bioassay method, using different concentrations for each chemical.Fipronil 2.5% EC was highly effective at all concentrations applied, while DDVP 50% EC was least toxic amongst all. One way analysis of variance confirmed significant differences between mortality of P. americana and different concentrations applied (P< 0.05.Locality differentiation is an important factor in determining the range of resistance between various localities, as all three localities behaved differently in terms of their levels of resistance.

  7. An augmented reality system validation for the treatment of cockroach phobia.

    Science.gov (United States)

    Bretón-López, Juani; Quero, Soledad; Botella, Cristina; García-Palacios, Azucena; Baños, Rosa Maria; Alcañiz, Mariano

    2010-12-01

    Augmented reality (AR) is a new technology in which various virtual elements are incorporated into the user's perception of the real world. The most significant aspect of AR is that the virtual elements add relevant and helpful information to the real scene. AR shares some important characteristics with virtual reality as applied in clinical psychology. However, AR offers additional features that might be crucial for treating certain problems. An AR system designed to treat insect phobia has been used for treating phobia of small animals, and positive preliminary data about the global efficacy of the system have been obtained. However, it is necessary to determine the capacity of similar AR systems and their elements that are designed to evoke anxiety in participants; this is achieved by testing the correspondence between the inclusion of feared stimuli and the induction of anxiety. The objective of the present work is to validate whether the stimuli included in the AR-Insect Phobia system are capable of inducing anxiety in six participants diagnosed with cockroach phobia. Results support the adequacy of each element of the system in inducing anxiety in all participants.

  8. Neuromodulation of Olfactory Sensitivity in the Peripheral Olfactory Organs of the American Cockroach, Periplaneta americana

    Science.gov (United States)

    Jung, Je Won; Kim, Jin-Hee; Pfeiffer, Rita; Ahn, Young-Joon; Page, Terry L.; Kwon, Hyung Wook

    2013-01-01

    Olfactory sensitivity exhibits daily fluctuations. Several studies have suggested that the olfactory system in insects is modulated by both biogenic amines and neuropeptides. However, molecular and neural mechanisms underlying olfactory modulation in the periphery remain unclear since neuronal circuits regulating olfactory sensitivity have not been identified. Here, we investigated the structure and function of these signaling pathways in the peripheral olfactory system of the American cockroach, Periplaneta americana, utilizing in situ hybridization, qRT-PCR, and electrophysiological approaches. We showed that tachykinin was co-localized with the octopamine receptor in antennal neurons located near the antennal nerves. In addition, the tachykinin receptor was found to be expressed in most of the olfactory receptor neurons in antennae. Functionally, the effects of direct injection of tachykinin peptides, dsRNAs of tachykinin, tachykinin receptors, and octopamine receptors provided further support for the view that both octopamine and tachykinin modulate olfactory sensitivity. Taken together, these findings demonstrated that octopamine and tachykinin in antennal neurons are olfactory regulators in the periphery. We propose here the hypothesis that octopamine released from neurons in the brain regulates the release of tachykinin from the octopamine receptor neurons in antennae, which in turn modulates the olfactory sensitivity of olfactory receptor neurons, which house tachykinin receptors. PMID:24244739

  9. Neuromodulation of olfactory sensitivity in the peripheral olfactory organs of the American cockroach, Periplaneta americana.

    Directory of Open Access Journals (Sweden)

    Je Won Jung

    Full Text Available Olfactory sensitivity exhibits daily fluctuations. Several studies have suggested that the olfactory system in insects is modulated by both biogenic amines and neuropeptides. However, molecular and neural mechanisms underlying olfactory modulation in the periphery remain unclear since neuronal circuits regulating olfactory sensitivity have not been identified. Here, we investigated the structure and function of these signaling pathways in the peripheral olfactory system of the American cockroach, Periplaneta americana, utilizing in situ hybridization, qRT-PCR, and electrophysiological approaches. We showed that tachykinin was co-localized with the octopamine receptor in antennal neurons located near the antennal nerves. In addition, the tachykinin receptor was found to be expressed in most of the olfactory receptor neurons in antennae. Functionally, the effects of direct injection of tachykinin peptides, dsRNAs of tachykinin, tachykinin receptors, and octopamine receptors provided further support for the view that both octopamine and tachykinin modulate olfactory sensitivity. Taken together, these findings demonstrated that octopamine and tachykinin in antennal neurons are olfactory regulators in the periphery. We propose here the hypothesis that octopamine released from neurons in the brain regulates the release of tachykinin from the octopamine receptor neurons in antennae, which in turn modulates the olfactory sensitivity of olfactory receptor neurons, which house tachykinin receptors.

  10. Characterization of an Invertebrate-Type Dopamine Receptor of the American Cockroach, Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Britta Troppmann

    2014-01-01

    Full Text Available We have isolated a cDNA coding for a putative invertebrate-type dopamine receptor (Peadop2 from P. americana brain by using a PCR-based strategy. The mRNA is present in samples from brain and salivary glands. We analyzed the distribution of the PeaDOP2 receptor protein with specific affinity-purified polyclonal antibodies. On Western blots, PeaDOP2 was detected in protein samples from brain, subesophageal ganglion, thoracic ganglia, and salivary glands. In immunocytochemical experiments, we detected PeaDOP2 in neurons with their somata being located at the anterior edge of the medulla bilaterally innervating the optic lobes and projecting to the ventro-lateral protocerebrum. In order to determine the functional and pharmacological properties of the cloned receptor, we generated a cell line constitutively expressing PeaDOP2. Activation of PeaDOP2-expressing cells with dopamine induced an increase in intracellular cAMP. In contrast, a C-terminally truncated splice variant of this receptor did not exhibit any functional property by itself. The molecular and pharmacological characterization of the first dopamine receptor from P. americana provides the basis for forthcoming studies focusing on the significance of the dopaminergic system in cockroach behavior and physiology.

  11. Hormonal control of carbohydrate metabolism in the American cockroach, Periplaneta americana L

    Energy Technology Data Exchange (ETDEWEB)

    Sevala, V.L.

    1987-01-01

    Hormonal control of trehalose synthesis in the fat body of the cockroach, Periplaneta americana, is accompanied by a large decrease in the flux of metabolites through the glycolytic pathway. The decrease in glycolytic flux was investigated by measuring time-dependent changes in the concentrations of glycolytic intermediates at various times after treating the fat body with corpus cardiacum (CC) extract. The concentration of glucose 6-phosphate in fat body which had been treated with CC extract increased by 360 percent after 30 min, whereas that of fructose 6-phosphate and fructose 1,6-bisphosphate increased by only 138 and 150 percent respectively. The concentration of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate were not affected by CC extract. The level of glycerol 3-phosphate in the fat body was increased by 116 percent at 30 minutes. The data provide the first evidence that the decrease in glycolytic activity due to the CC results from the inhibition of aldolase and phosphoglucoisomerase. The data show also that phosphoglucoisomerase is inhibited by glycerol 3-phosphate in the concentration range that occurs in CC treated tissue. The enzyme is also inhibited by erythrose 4-phosphate and 6-phosphogluconate. CC extract showed no apparent effect on the incorporation of /sup 14/C into trehalose or glycogen from /sup 14/C labelled amino acids.

  12. Control of obstacle climbing in the cockroach, Blaberus discoidalis. I. Kinematics.

    Science.gov (United States)

    Watson, James T; Ritzmann, Roy E; Zill, Sasha N; Pollack, Alan J

    2002-02-01

    An advantage of legged locomotion is the ability to climb over obstacles. We studied deathhead cockroaches as they climbed over plastic blocks in order to characterize the leg movements associated with climbing. Movements were recorded as animals surmounted 5.5-mm or 11-mm obstacles. The smaller obstacles were scaled with little change in running movements. The higher obstacles required altered gaits, leg positions and body posture. The most frequent sequence used was to first tilt the front of the body upward in a rearing stage, and then elevate the center of mass to the level of the top of the block. A horizontal running posture was re-assumed in a leveling-off stage. The action of the middle legs was redirected by rotations of the leg at the thoracal-coxal and the trochanteral-femoral joints. The subsequent extension movements of the coxal-trochanteral and femoral-tibial joints were within the range seen during horizontal running. The structure of proximal leg joints allows for flexibility in leg use by generating subtle, but effective changes in the direction of leg movement. This architecture, along with the resulting re-direction of movements, provides a range of strategies for both animals and walking machines.

  13. Development-dependent and -independent ubiquitin expression in divisions of the cockroach mushroom body.

    Science.gov (United States)

    Brown, Sheena M; Strausfeld, Nicholas J

    2006-06-01

    It has been proposed that the alpha and beta divisions of the mushroom bodies support intermediate and long-term memory whereas the gamma lobes support short-term memory. Here we investigate developmentally dependent versus developmentally independent alterations of mushroom body structure with special emphasis on its lobes. We show that in the cockroach mushroom bodies there are two types of plastic remodeling. One is developmental, in which episodic addition of new circuitry to the alpha and beta lobes is accomplished by newly born Kenyon cells. The second is revealed as a persistent alteration of structure within the gamma lobe. In the alpha/beta lobes, newly generated Kenyon cell axons extend glutamate-immunoreactive collaterals across layers of the axons of mature Kenyon cells. At specific times in each developmental episode (instar) these collaterals express ubiquitin, undergo localized degeneration, and are scavenged by glial cells. In contrast, the mature Kenyon cells that comprise the gamma lobe express detectable ubiquitin throughout each developmental episode. This pattern of ubiquitin expression suggests that the gamma lobe circuitry undergoes continuous modification independent of development.

  14. Isolation and Purification of an Antibacterial Protein from Immune Induced Haemolymph of American Cockroach, Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Hamid Reza Basseri

    2016-10-01

    Full Text Available Background: Antimicrobial peptides play a role as effectors substances in the immunity of vertebrate and inverte­brate hosts. In the current study, antimicrobial peptide was isolated from the haemolymph of the American cock­roach, Periplaneta americana.Methods: Micrococcus luteus as Gram-positive bacteria and Escherichia coli as Gram-negative bacteria were candi­date for injection. Induction was done by injecting both bacteria into the abdominal cavity of two groups of cock­roaches separately. The haemolymphs were collected 24 hours after post injection and initially tested against both bacteria. Subsequently, the immune induced haemolymph was purified by high performance liquid chromatography (HPLC to separate the proteins responsible for the antibacterial activity.Results: The non-induced haemolymph did not show any activity against both bacteria whereas induced haemo­lymph exhibited high activity against M. luteus but did less against E. coli. Two fractions showed antibacterial activ­ity against M. luteus. Finally the molecular weight of the isolated antibacterial proteins were determined as 72 kDa and 62 kDa using SDS-PAGE.Conclusion: Induced haemolymph of American cockroaches has the ability to produce peptides to combat against Gram-positive bacteria when an immune challenge is mounted. Further work has to be done to sequence of the pro­tein, which it would be advantageous.

  15. Motivations of German Hospice Volunteers: How Do They Compare to Nonhospice Volunteers and US Hospice Volunteers?

    Science.gov (United States)

    Stelzer, Eva-Maria; Lang, Frieder R

    2016-03-01

    We examined reasons of volunteering for hospice and nonhospice organizations in a study with 125 volunteers (22-93 years) from the United States and Germany. Motives of US and German hospice volunteers revealed similarities and few differences. Hospice volunteers are involved because they seek to help others, seek new learning experiences, seek social contacts, or seek personal growth. The US hospice volunteers reported motives related to altruistic concerns, enhancement, and social influence as more influential, while German hospice volunteers rated career expectations as being more important. Comparison of German hospice with nonhospice volunteers revealed stronger differences: German hospice volunteers scored higher on altruistic motives, while German nonhospice volunteers yielded higher scores on self-serving motives. Findings contribute to improved understanding of volunteering motivation and of activating or retaining hospice volunteers. © The Author(s) 2014.

  16. "We call it Springbok-German!": language contact in the German communities in South Africa.

    OpenAIRE

    Franke, Katharina

    2017-01-01

    Varieties of German are spoken all over the world, some of which have been maintained for prolonged periods of time. As a result, these transplanted varieties often show traces of the ongoing language contact as specific to their particular context. This thesis explores one such transplanted German language variety – Springbok- German – as spoken by a small subset of German Lutherans in South Africa. Specifically, this study takes as its focus eight rural German communities acr...

  17. Dictionary of surfactants English/German and German/English

    Energy Technology Data Exchange (ETDEWEB)

    Siekmann, K.

    1987-01-01

    This dictionary is supplement to the monograph ''Surfactants in Consumer Products'' edited by Professor Dr. J. Falbe. It comprises approximately 3.200 keywords of the chemistry, technology and applications of surfactants in English/German and German/English. In the monograph the physical-chemical principles of action of the surfactants, their production and their application in laundry detergents, dishwashing detergents and cleaning agents as well as in cosmetics and toiletries are discussed. The technological aspects of application and formulation along with those of production and manufacturing processes are illustrated. Ecological and toxicological questions are probed in depth. Finally, important economic data concerning this branch of industry as well as an attempt to provide a perspective with regard to the future of the surfactant market round out the picture.

  18. [German Urological Associations under National Socialism].

    Science.gov (United States)

    Krischel, M; Moll, F; Fangerau, H

    2011-09-01

    The Deutsche Gesellschaft für Urologie (German Urological Association), established in 1907, was a German-Austrian medical society in which Jewish physicians held important positions. When the Nazis seized power in 1933, the Austrian Hans Rubritius was president of the society. The non-German presidency and the exclusion of Jewish colleagues from the professional society and medical practice led to a halt of the society's activities. At the same time in the mid 1930s, German urologists founded the Gesellschaft Reichsdeutscher Urologen (Association of Reichs-German Urologists) whose members aligned themselves with Nazi health policies and in turn received professional and personal benefits.

  19. Word order in the Germanic languages

    DEFF Research Database (Denmark)

    Holmberg, Anders; Rijkhoff, Jan

    1998-01-01

    The Germanic branch of Indo-European consists of three main groups (Ruhlen 1987: 327):- East Germanic: Gothic, Vandalic, Burgundian (all extinct);- North Germanic (or: Scandinavian): Runic (extinct), Danish, Swedish, Norwegian, Icelandic, Faroese;- West Germanic: German, Yiddish, Luxembourgeois......, Dutch, Afrikaans, Frisian, English.Here we will only consider the languages that are currently spoken in geographical Europe. Thus Afrikaans, which is spoken in South Africa, and the extinct languages Gothic, Vandalic, Burgundian, and Runic will not be taken into account (but see e.g. König & van der...

  20. Great nuclear debate: German--American disagreements

    International Nuclear Information System (INIS)

    Kaiser, K.

    1978-01-01

    The post-war international consensus on nuclear nonproliferation has been eroding because of the debate over actions taken by some countries and because of the U.S. response with a unilateral change in nuclear policy. The chronology of developments is traced, noting that the 1973--74 oil crisis, India's nuclear explosion in 1974, and the exchange of Brazilian uranium for German technology all had a major role in the policy controversy. New nonproliferation proposals by the Carter administration, by precipitating debate between those wanting tighter export controls and those with nuclear commercial interests, also introduced several foreign-relations problems because of the emphasis on international agreements and a technological approach. The U.S. is credited with taking a constructive step to correct the inadequacies of the present policies and exerting pressure for global involvement in reassessing the rules on armaments and proliferation. Significant U.S. leadership could also take the form of lower energy consumption

  1. Aryl Hydrocarbon Receptor (AhR Modulates Cockroach Allergen-Induced Immune Responses through Active TGFβ1 Release

    Directory of Open Access Journals (Sweden)

    Yufeng Zhou

    2014-01-01

    Full Text Available Background. Aryl hydrocarbon receptor (AhR, a multifunctional regulator that senses and responds to environmental stimuli, plays a role in normal cell development and immune regulation. Recent evidence supports a significant link between environmental exposure and AhR in the development of allergic diseases. We sought to investigate whether AhR plays a role in mediating cockroach allergen-induced allergic immune responses. Methods. AhR expression in human lung fibroblasts from asthmatic and healthy individuals and in cockroach extract (CRE treated human lung fibroblasts (WI-38 was examined. The role of AhR in modulating CRE induced TGFβ1 production was investigated by using AhR agonist, TCDD, antagonist CH122319, and knockdown of AhR. The role of latent TGFβ1 binding protein-1 (LTBP1 in mediating TCDD induced active TGFβ1 release was also examined. Results. AhR expression was higher in airway fibroblasts from asthmatic subjects as compared to healthy controls. AhR in fibroblasts was activated by TCDD with an increased expression of cyp1a1 and cyp1b1. Increased AhR expression was observed in CRE-treated fibroblasts. Importantly, CRE induced TGFβ1 production in fibroblasts was significantly enhanced by TCDD but inhibited by CH122319. Reduced TGFβ1 production was further confirmed in fibroblasts with AhR knockdown. Moreover, AhR knockdown inhibited CRE induced fibroblast differentiation. Furthermore, TCDD induced active TGFβ1 release was significantly inhibited by LTBP1 knockdown. Conclusion. These results provide evidence for the role of AhR in modulating cockroach allergen-induced immune responses through controlling the active TGFβ1 release, suggesting a possible synergistic effect between exposure to allergens and environmental chemicals on the development of allergic diseases.

  2. The cockroaches of Balta Tepper from China, with the description of four new species (Blattodea, Ectobiidae, Pseudophyllodromiinae

    Directory of Open Access Journals (Sweden)

    Zhi-Wei Qiu

    2017-11-01

    Full Text Available Four new species of cockroach genus Balta Tepper, 1893 are described and illustrated: B. crena sp. n., B. maculata sp. n., B. tangi sp. n., and B. yaoi sp. n. Balta picea (Bey-Bienko, 1958 is now regarded as a new synonym of Balta hwangorum (Bey-Bienko, 1958, which is redescribed and illustrated. Two new combinations are proposed: B. nodigera (Bey-Bienko, 1958, comb. n. and B. valida (Bey-Bienko, 1958, comb. n., and both species are redescribed and illustrated. A key to all species from China is provided.

  3. The cockroaches of Balta Tepper from China, with the description of four new species (Blattodea, Ectobiidae, Pseudophyllodromiinae)

    Science.gov (United States)

    Qiu, Zhi-Wei; Che, Yan-Li; Zheng, Yu-Hong; Wang, Zong-Qing

    2017-01-01

    Abstract Four new species of cockroach genus Balta Tepper, 1893 are described and illustrated: B. crena sp. n., B. maculata sp. n., B. tangi sp. n., and B. yaoi sp. n. Balta picea (Bey-Bienko, 1958) is now regarded as a new synonym of Balta hwangorum (Bey-Bienko, 1958), which is redescribed and illustrated. Two new combinations are proposed: B. nodigera (Bey-Bienko, 1958), comb. n. and B. valida (Bey-Bienko, 1958), comb. n., and both species are redescribed and illustrated. A key to all species from China is provided. PMID:29290699

  4. German cross-cultural psychology

    OpenAIRE

    Trommsdorff, Gisela

    1986-01-01

    The present study deals with German-language cross-cultural research in different fields of psychology which attempts to achieve one Or more goals of cross-cultural psychology. First, methodological problems are discussed, followed by a selective presentation of cross-cultural research in personality, clinical, ethological, developmental, and social psychology. The theoretical and methodological advancement of these studies is investigated with respect to four approaches - universals in cross...

  5. German industrial policy: An overview

    OpenAIRE

    Vitols, Sigurt

    1996-01-01

    Despite intense study as an attractive model for adjustment to slower worldwide growth and increasing competition from low-wage producers, the sources of German institutional comparative advantage remain controversial, particularly with regard to the role of the national state. This paper argues that the national state plays a key -- though mainly indirect -- role in supporting the modernization of industry. On the one hand, the national regulation of labor markets has discouraged price compe...

  6. Signaling of pigment-dispersing factor (PDF in the Madeira cockroach Rhyparobia maderae.

    Directory of Open Access Journals (Sweden)

    Hongying Wei

    Full Text Available The insect neuropeptide pigment-dispersing factor (PDF is a functional ortholog of vasoactive intestinal polypeptide, the coupling factor of the mammalian circadian pacemaker. Despite of PDF's importance for synchronized circadian locomotor activity rhythms its signaling is not well understood. We studied PDF signaling in primary cell cultures of the accessory medulla, the circadian pacemaker of the Madeira cockroach. In Ca²⁺ imaging studies four types of PDF-responses were distinguished. In regularly bursting type 1 pacemakers PDF application resulted in dose-dependent long-lasting increases in Ca²⁺ baseline concentration and frequency of oscillating Ca²⁺ transients. Adenylyl cyclase antagonists prevented PDF-responses in type 1 cells, indicating that PDF signaled via elevation of intracellular cAMP levels. In contrast, in type 2 pacemakers PDF transiently raised intracellular Ca²⁺ levels even after blocking adenylyl cyclase activity. In patch clamp experiments the previously characterized types 1-4 could not be identified. Instead, PDF-responses were categorized according to ion channels affected. Application of PDF inhibited outward potassium or inward sodium currents, sometimes in the same neuron. In a comparison of Ca²⁺ imaging and patch clamp experiments we hypothesized that in type 1 cells PDF-dependent rises in cAMP concentrations block primarily outward K⁺ currents. Possibly, this PDF-dependent depolarization underlies PDF-dependent phase advances of pacemakers. Finally, we propose that PDF-dependent concomitant modulation of K⁺ and Na⁺ channels in coupled pacemakers causes ultradian membrane potential oscillations as prerequisite to efficient synchronization via resonance.

  7. Immediate responses of the cockroach Blaptica dubia after the exposure to sulfur mustard.

    Science.gov (United States)

    Popp, Tanja; Lüling, Robin; Boekhoff, Ingrid; Seeger, Thomas; Branoner, Francisco; Gudermann, Thomas; Thiermann, Horst; Worek, Franz; Steinritz, Dirk

    2018-01-01

    The chemical agent sulfur mustard (SM) causes erythema, skin blisters, ulcerations, and delayed wound healing. It is accepted that the underlying molecular toxicology is based on DNA alkylation. With an expected delay, DNA damage causes impairment of protein biosynthesis and disturbance of cell division. However, using the cockroach model Blaptica dubia, the presented results show that alkylating compounds provoke immediate behavior responses along with fast changes in the electrical field potential (EFP) of neurons, suggesting that lesions of DNA are probably not the only effect of alkylating compounds. Blaptica dubia was challenged with SM or 2-chloroethyl-ethyl sulfide (CEES). Acute toxicity was objectified by a disability score. Physiological behavior responses (antennae pullback reflex, escape attempts, and grooming) were monitored after exposure. To estimate the impact of alkylating agents on neuronal activity, EFP recordings of the antennae and the thoracic ganglion were performed. After contact to neat SM, a pullback reflex of the antennae was the first observation. Subsequently, a striking escape behavior occured which was characterized by persistent movement of the legs. In addition, an instantaneous processing of the electrical firing pattern from the antennae to the descending ganglia was detectable. Remarkably, comparing the toxicity of the applied alkylating agents, effects induced by CEES were much more pronounced compared to SM. In summary, our findings document immediate effects of B. dubia after exposure to alkylating substances. These fast responses cannot be interpreted as a consequence of DNA alkylation. Therefore, the dogma that DNA alkylation is the exclusive cause for SM toxicity has to be questioned.

  8. Cockroach sensitization mitigates allergic rhinoconjunctivitis symptom severity in patients allergic to house dust mites and pollen.

    Science.gov (United States)

    He, Weijing; Jimenez, Fabio; Martinez, Hernan; Harper, Nathan L; Manoharan, Muthu Saravanan; Carrillo, Andrew; Ingale, Puraskar; Liu, Ya-Guang; Ahuja, Seema S; Clark, Robert A; Rather, Cynthia G; Ramirez, Daniel A; Andrews, Charles P; Jacobs, Robert L; Ahuja, Sunil K

    2015-09-01

    Modifiers of symptom severity in patients with allergic rhinoconjunctivitis (AR) are imprecisely characterized. The hygiene hypothesis implicates childhood microbial exposure as a protective factor. Cockroach sensitization (C+) might be a proxy for microbial exposure. We sought to determine whether C+ assayed by means of skin prick tests influenced AR symptom severity in controlled and natural settings. Total symptom scores (TSSs) were recorded by 21 participants with house dust mite allergy (M+) in the natural setting and during repeated exposures of 3 hours per day to house dust mite allergen in an allergen challenge chamber (ACC). In M+ participants the peripheral blood and nasal cells were assayed for T-cell activation and transcriptomic profiles (by using RNA sequencing), respectively. Participants allergic to mountain cedar (n = 21), oak (n = 34), and ragweed (n = 23) recorded TSSs during separate out-of-season exposures to these pollens (any pollen sensitization [P+]) in the ACC; a subset recorded TSSs in the pollination seasons. The hierarchy of TSSs (highest to lowest) among M+ participants tracked the following skin prick test sensitization statuses: M+P+C- > M+P+C+ > M+P-C- > M+P-C+. In nasal cells and peripheral blood the immune/inflammatory responses were rapidly resolved in M+P+C+ compared with M+P+C- participants. Among those allergic to pollen, C+ was associated with a lower TSS during pollen challenges and the pollination season. After aggregated analysis of all 4 ACC studies, C+ status was associated with a 2.8-fold greater likelihood of a lower TSS compared with C- status (odds ratio, 2.78; 95% CI, 1.18-6.67; P = .02). C+ status is associated with mitigation of AR symptom severity in adults with AR. Published by Elsevier Inc.

  9. Intersegmental coordination of cockroach locomotion: adaptive control of centrally coupled pattern generator circuits

    Directory of Open Access Journals (Sweden)

    Einat eFuchs

    2011-01-01

    Full Text Available Animals’ ability to demonstrate both stereotyped and adaptive locomotor behavior is largely dependent on the interplay between centrally-generated motor patterns and the sensory inputs that shape them. We utilized a combined experimental and theoretical approach to investigate the relative importance of CPG interconnections vs. intersegmental afferents in the cockroach: an animal that is renowned for rapid and stable locomotion. We simultaneously recorded coxal levator and depressor motor neurons (MN in the thoracic ganglia of Periplaneta americana, while sensory feedback was completely blocked or allowed only from one intact stepping leg. In the absence of sensory feedback, we observed a coordination pattern with consistent phase relationship that shares similarities with a double tripod gait, suggesting central, feedforward control. This intersegmental coordination pattern was then reinforced in the presence of sensory feedback from a single stepping leg. Specifically, we report on transient stabilization of phase differences between activity recorded in the middle and hind thoracic MN following individual front-leg steps, suggesting a role for afferent phasic information in the coordination of motor circuits at the different hemiganglia. Data were further analyzed using stochastic models of coupled oscillators and maximum likelihood techniques to estimate underlying physiological parameters, such as uncoupled endogenous frequencies of hemisegmental oscillators and coupling strengths and directions. We found that descending ipsilateral coupling is stronger than ascending coupling, while left-right coupling in both the meso- and meta-thoracic ganglia appear to be symmetrical. We discuss our results in comparison with recent findings in stick insects that share similar neural and body architectures, and argue that the two species may exemplify opposite extremes of a fast-slow locomotion continuum, mediated through different intersegmental

  10. Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut.

    Science.gov (United States)

    Bodláková, Karolina; Jedlička, Pavel; Kodrík, Dalibor

    2017-04-01

    This study examined the biochemical characteristics of α-amylase and hormonal (adipokinetic hormone: AKH) stimulation of α-amylase activity in the cockroach (Periplaneta americana) midgut. We applied two AKHs in vivo and in vitro, then measured resultant amylase activity and gene expression, as well as the expression of AKH receptor (AKHR). The results revealed that optimal amylase activity is characterized by the following: pH: 5.7, temperature: 38.4 °C, K m (Michaelis-Menten constant): 2.54 mg starch/mL, and V max (maximum reaction velocity): 0.185 μmol maltose/mL/min. In vivo application of AKHs resulted in significant increase of amylase activity: by two-fold in the gastric caeca and 4-7 fold in the rest of the midgut. In vitro experiments supported results seen in vivo: a 24-h incubation with the hormones resulted in the increase of amylase activity by 1.4 times in the caeca and 4-9 times in the midgut. Further, gene expression analyses reveal that AKHR is expressed in both the caeca and the rest of the midgut, although expression levels in the former were 23 times higher than levels in the latter. A similar pattern was found for the amylase (AMY) gene. Hormonal treatment did not affect the expression of either gene. This study is the first to provide evidence indicating direct AKH stimulation of digestive enzyme activity in the insect midgut, supported by specific AKHR gene expression in this organ. © 2016 Institute of Zoology, Chinese Academy of Sciences.

  11. Harold Pinter’s The Dumb Waiter in German: What’s Missing in Translation?

    Directory of Open Access Journals (Sweden)

    Renée von Paschen

    2012-06-01

    Full Text Available Several of Harold Pinter’s works have been adapted as screenplays and filmed. This paper investigates director Robert Altman’s TV movie The Dumb Waiter in comparison with the German dubbed version, Der stumme Diener, as well as the reception of Pinter’s play in German. The translation of Pinter’s dialogue into German involves stylistic aspects, such as Pinter’s dry, concise style, as well as the subliminal wit, sarcasm and irony. Humour is particularly difficult to translate, often involving compensation or transfer from one (cultural context to another. As one of the “comedies of menace”, The Dumb Waiter employs black humour and ironic wit to create threat and dramatic tension. The unknown threat is counterbalanced by “black comic relief”. The lack of a classical German tradition of black comedy problematizes the translation of Pinter’s dialogue, while the limits of audiovisual translation add additional hurdles.

  12. Pyrotag sequencing of the gut microbiota of the cockroach Shelfordella lateralis reveals a highly dynamic core but only limited effects of diet on community structure.

    Directory of Open Access Journals (Sweden)

    Christine Schauer

    Full Text Available Although blattid cockroaches and termites share a common ancestor, their diets are distinctly different. While termites consume a highly specialized diet of lignocellulose, cockroaches are omnivorous and opportunistic feeders. The role of the termite gut microbiota has been studied intensively, but little is known about the cockroach gut microbiota and its function in digestion and nutrition, particularly the adaptation to different diets. Our analyses of the bacterial gut microbiota of the blattid cockroach Shelfordella lateralis combining terminal restriction fragment length polymorphism of their 16S rRNA genes with physiological parameters (microbial metabolites, hydrogen and methane emission indicated substantial variation between individuals but failed to identify any diet-related response. Subsequent deep-sequencing of the 16S rRNA genes of the colonic gut microbiota of S. lateralis fed either a high- or a low-fiber diet confirmed the absence of bacterial taxa that responded to diet. Instead, we found a small number of abundant phylotypes that were consistently present in all samples and made up half of the community in both diet groups. They varied strongly in abundance between individual samples at the genus but not at the family level. The remaining phylotypes were inconsistently present among replicate batches. Our findings suggest that S. lateralis harbors a highly dynamic core gut microbiota that is maintained even after fundamental dietary shifts, and that any dietary effects on the gut community are likely to be masked by strong individual variations.

  13. Look at That!: Using Madagascar Hissing Cockroaches to Develop and Enhance the Scientific Inquiry Skill of Observation in Middle School Students

    Science.gov (United States)

    Wagler, Ron

    2011-01-01

    Middle school students can develop and enhance their observation skills by participating in teacher-guided scientific inquiry (NRC 1996) activities where they observe animals that tend to act in known, predictable ways. Madagascar hissing cockroaches ("Gromphadorhina portentosa") are one such animal. This article presents beginning, intermediate,…

  14. Purification and partial genome characterization of the bacterial endosymbiont Blattabacterium cuenoti from the fat bodies of cockroaches

    Directory of Open Access Journals (Sweden)

    Yamada Akinori

    2008-11-01

    Full Text Available Abstract Background Symbiotic relationships between intracellular bacteria and eukaryotes are widespread in nature. Genome sequencing of the bacterial partner has provided a number of key insights into the basis of these symbioses. A challenging aspect of sequencing symbiont genomes is separating the bacteria from the host tissues. In the present study, we describe a simple method of endosymbiont purification from complex environment, using Blattabacterium cuenoti inhabiting in cockroaches as a model system. Findings B. cuenoti cells were successfully purified from the fat bodies of the cockroach Panesthia angustipennis by a combination of slow- and fast-speed centrifugal fractionations, nylon-membrane filtration, and centrifugation with Percoll solutions. We performed pulse-field electrophoresis, diagnostic PCR and random sequencing of the shoutgun library. These experiments confirmed minimal contamination of host and mitochondrial DNA. The genome size and the G+C content of B. cuenoti were inferred to be 650 kb and 32.1 ± 7.6%, respectively. Conclusion The present study showed successful purification and characterization of the genome of B. cuenoti. Our methodology should be applicable for future symbiont genome sequencing projects. An advantage of the present purification method is that each step is easily performed with ordinary microtubes and a microcentrifuge, and without DNase treatment.

  15. Pharmacological characterization of the dopamine-sensitive adenylate cyclase in cockroach brain: evidence for a distinct dopamine receptor

    Energy Technology Data Exchange (ETDEWEB)

    Orr, G.L.; Gole, J.W.D.; Notman, H.J.; Downer, R.G.H.

    1987-12-21

    Dopamine increases cyclic AMP production in crude membrane preparations of cockroach brain with plateaus in cyclic AMP production occurring between 1-10 ..mu..M and 10 mM. Maximal production of cyclic AMP is 2.25 fold greater than that of control values. Octopamine also increases cyclic AMP production with a Ka of 1.4 ..mu..M and maximal production 3.5 fold greater than that of control. 5-Hydroxytryptamine does not increase cyclic AMP production. The effects of octopamine and dopamine are fully additive. The vertebrate dopamine agonists ADTN and epinine stimulate the dopamine-sensitive adenylate cyclase (AC) with Ka values of 4.5 and 0.6 ..mu..M respectively and with maximal effectiveness 1.7 fold greater than that of control. The selective D/sub 2/-dopamine agonist LY-171555 stimulates cyclic AMP production to a similar extent with a Ka of 50 ..mu..M. Other dopamine agonists have no stimulatory effects. With the exception of mianserin, /sup 3/H-piflutixol is displaced from brain membranes by dopamine antagonists with an order of potency similar to that observed for the inhibition of dopamine-sensitive AC. The results indicate that the octopamine- and dopamine-sensitive AC in cockroach brain can be distinguished pharmacologically and the dopamine receptors coupled to AC have pharmacological characteristics distinct from vertebrate D/sup 1/- and D/sup 2/-dopamine receptors. 33 references, 3 figures, 2 tables.

  16. Pharmacological characterization of the dopamine-sensitive adenylate cyclase in cockroach brain: evidence for a distinct dopamine receptor

    International Nuclear Information System (INIS)

    Orr, G.L.; Gole, J.W.D.; Notman, H.J.; Downer, R.G.H.

    1987-01-01

    Dopamine increases cyclic AMP production in crude membrane preparations of cockroach brain with plateaus in cyclic AMP production occurring between 1-10 μM and 10 mM. Maximal production of cyclic AMP is 2.25 fold greater than that of control values. Octopamine also increases cyclic AMP production with a Ka of 1.4 μM and maximal production 3.5 fold greater than that of control. 5-Hydroxytryptamine does not increase cyclic AMP production. The effects of octopamine and dopamine are fully additive. The vertebrate dopamine agonists ADTN and epinine stimulate the dopamine-sensitive adenylate cyclase (AC) with Ka values of 4.5 and 0.6 μM respectively and with maximal effectiveness 1.7 fold greater than that of control. The selective D 2 -dopamine agonist LY-171555 stimulates cyclic AMP production to a similar extent with a Ka of 50 μM. Other dopamine agonists have no stimulatory effects. With the exception of mianserin, 3 H-piflutixol is displaced from brain membranes by dopamine antagonists with an order of potency similar to that observed for the inhibition of dopamine-sensitive AC. The results indicate that the octopamine- and dopamine-sensitive AC in cockroach brain can be distinguished pharmacologically and the dopamine receptors coupled to AC have pharmacological characteristics distinct from vertebrate D 1 - and D 2 -dopamine receptors. 33 references, 3 figures, 2 tables

  17. Geogenic heavy metal concentrations in German soils

    International Nuclear Information System (INIS)

    Hindel, R.; Fleige, H.

    1990-01-01

    In the area of the German Federal Republic, 6,300 soil samples of 526 soil profiles were examined for the concentrations of lead, copper, zinc, cadmium, nickel, cobalt, mercury, antimony, arsenic and lithium. The soil profiles were selected so that the prevailing loose and solid rock floors of the German Federal Republic were represented. The analysis data of these samples formed the basis for the calculation of average geogenic heavy metal concentrations in the soils of the German Federal Republic. (orig.) [de

  18. Gyama Bugibugi (German gunpowder) : a history of German presence in Nawuriland, Ghana

    NARCIS (Netherlands)

    Ntewusu, SA

    2016-01-01

    This paper discusses general political and economic issues in Nawuriland during and after German colonialism. The paper argues that the legacies of German colonialism are still largely seen and felt in Nawuriland especially in plantation projects, land and chieftaincy.

  19. German Librarianship and Munich Libraries

    Directory of Open Access Journals (Sweden)

    Osman Ümit Özen

    1994-06-01

    Full Text Available There are 27 municipal libraries including the Central Public Library in Munich. The other important libraries in the city are Bayern State National Library, Maximillian University Library, a technical highschool library and the "Deutsches Musuem" Library. All these libraries are financed locally. The author introduces these libraries briefly and compares German libraries with Turkish libraries. He concludes that although theoretically there are not distinctive differences, in practice, buildings and their layout are better in Germany where more variety of services are offered. In Turkey standardization has not been realized yet. Turkey needs to computerize and network to improve the services offered in an efficient way.

  20. 63rd German radiological congress

    International Nuclear Information System (INIS)

    1982-01-01

    The book of abstracts contains abstracts of 171 papers read at the German Radiological Congress in Berlin as well as abstracts of two papers not read for lack of time. Further, there are 31 brief descriptions of the scientific exhibition. Subjects: Diagnosis of gall bladder diseases and inflammatory diseases of the large intestine; hyperthermia and irradiation in tumour therapy; nuclear methods in the diagnosis of growing and displacing processes, skeletal diseases, thromboses, embolisms, gastrointestinal and liver affections; new techniques and methods, diagnostics of the spinal tract; radiooncology; carcinoma of the ovaries; diagnostics and therapy of tumours of the lungs; computerized tomography; angiography; ultrasonic diagnosis. (MG) [de

  1. German versus Nordic Board Models

    DEFF Research Database (Denmark)

    Ringe, Georg

    2016-01-01

    changes and developments in business practice, the article argues that board practices in the two systems effectively blur the structural distinction, and that board organization is converging in practice. It thereby contributes to the broader debates on functionality and comparative corporate law......Board structure is an important component of the individual governance of firms, and the appropriateness of the various models is one of the most debated issues in corporate governance today. A comparison of the Nordic and German approaches to the structure of corporate boards reveals stark...

  2. German family policy at the crossroads

    DEFF Research Database (Denmark)

    Wüst, Miriam

    2009-01-01

    . Simulation makes those reforms comparable over time and across countries. Results show that the profile of the German scheme is changing from "general family" towards "dual-earner" support. Furthermore, the recent reforms make the German scheme converge towards the Swedish leave scheme. The recent reforms....... Microsimulation helps to overcome these problems. It compares policy options - actual reforms or reform plans - simultaneously and provides a comparable measure: the disposable income of model families. This article uses a type-case approach to investigate recent reforms of the German parental leave benefit...... introduce a new concept of fairness and a focus on gender equality to German family policies....

  3. Identification of differentially expressed genes in American cockroach ovaries and testes by suppression subtractive hybridization and the prediction of its miRNAs.

    Science.gov (United States)

    Chen, Wan; Jiang, Guo-Fang; Sun, Shu-Hong; Lu, Yong; Ma, Fei; Li, Bin

    2013-11-01

    Studies on the cockroach have contributed to our understanding of several important developmental processes, especially those that can be easily studied in the embryo. However, our knowledge on late events such as gonad differentiation in the cockroach is still limited. The major aim of the present study was to identify sex-specific genes between adult female and male Periplaneta americana. Two cDNA libraries were constructed using the suppression subtractive hybridization method; a total of 433 and 599 unique sequences were obtained from the forward library and the reverse library, respectively, by cluster assembly, and sequence alignment of 1,032 expressed sequence tags. The analysis of the differentially expressed gene functions allowed these genes to be categorized into three groups: biological process, molecular function, and cellular component. The differentially expressed genes were suggested to be related to the development of the gonads of P. americana. Twelve differentially expressed genes were randomly selected and verified using relative quantitative real-time polymerase chain reaction (qRT-PCR). Meanwhile, by adopting a range of filtering criteria, we predicted two potential microRNA sequences for P. americana, pam-miR100-3p and pam-miR7. To confirm the expression of potential microRNAs (miRNAs) in American cockroach, a qRT-PCR approach was also employed. The data presented here offer the insights into the molecular foundation of sex differences in American cockroach, and the first report for the miRNAs in this species. In addition, the results can be used as a reference for unraveling candidate genes associated with the sex and reproduction of cockroaches.

  4. [German language physician rating sites].

    Science.gov (United States)

    Strech, D; Reimann, S

    2012-08-01

    In physician rating sites (PRS), patients are able to share their experiences and indicate their satisfaction in qualitative and quantitative form. This information should support other patients in the search for a suitable physician and can serve as a form of anonymous feedback for physicians. Medical association representatives are often concerned that such reviews primarily aim at defamation. Furthermore, there are various aspects of medical work that cannot be adequately evaluated solely through the patients. In the United States of America, the majority of such previous reviews were shown to be positive. It has yet to be examined in the German and English speaking regions where distinct criteria presently allow patients to express their satisfaction through PRS. Based on the systematic review of patient satisfaction questionnaires, a set of criteria was created that represents the dimensions of patient satisfaction. German and English language physician rating sites were systematically researched using the Internet search machines "Google" and "Yahoo". The identified PRS were then evaluated with the help of the aforementioned set of criteria. In order to survey the tendency of the amount and content of reviews, a stratified sample of members of the Panel Doctor's Association in Hamburg and Thuringia was generated. A total of 298 randomly selected physicians were searched for in 6 German-language PRS regarding potential reviews. Some of the key features of the relation-ship between physicians and patients, such as medical competence, information, and consultation, were surveyed by more than three-fourths of the German-speaking PRS; however, other features such as communication were only sampled by one. As opposed to formal points of view, office facilities and organisation were assessed by all PRS. General reviews on treatment success and satisfaction were displayed in more than half of the reviews. Between 75% and 98% of physicians from the random sampling

  5. Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis.

    Science.gov (United States)

    Liu, Zichao; Yuan, Kehua; Zhang, Ruopeng; Ren, Xuchen; Liu, Xiaolong; Zhao, Shuhua; Wang, Dingkang

    2016-01-01

    Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects. The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests. A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera). This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea

  6. German Schools Abroad: Hotspots of Elite Multilingualism?

    Science.gov (United States)

    Sander, Anne E; Admiraal, Wilfried

    2016-01-01

    While multilingualism itself is a widely analyzed topic, a study about multilingualism at German schools abroad is so far unique. This quantitative study investigates the differences in the size of German expressive and receptive vocabulary between monolingual and multilingual students, aged between 5 and 11 years. A cohort of 65 multilingual…

  7. Facebook Used in a German Film Project

    Science.gov (United States)

    Leier, Vera

    2011-01-01

    Looking for a way to make German language study more relevant and to step out of the conventional classroom setting, I introduced Facebook (FB) as a learning platform to my intermediate German students at the University of Canterbury, New Zealand. The students took part in a film competition. A FB group was created and the films were uploaded. The…

  8. Language History for Teaching and Learning German

    Science.gov (United States)

    Lightfoot, Douglas

    2007-01-01

    This article presents information about the history of the German language and makes pertinent suggestions for teaching German as a Foreign Language. The reasoning for such an approach is presented, along with supportive new empirical data and a related professional directive. A selected survey of historical, explanatory points from the literature…

  9. DIMA – Annotation guidelines for German intonation

    DEFF Research Database (Denmark)

    Kügler, Frank; Smolibocki, Bernadett; Arnold, Denis

    2015-01-01

    This paper presents newly developed guidelines for prosodic annotation of German as a consensus system agreed upon by German intonologists. The DIMA system is rooted in the framework of autosegmental-metrical phonology. One important goal of the consensus is to make exchanging data between groups...

  10. German Spelling Reform: Kangaroos, Emus, and Cockatoos.

    Science.gov (United States)

    Ohlendorf, Harald

    1997-01-01

    The latest movement to reform German spelling is discussed, focusing on the need for greater consistency in spelling of words from other languages and the major changes proposed. Issues addressed include capitalization, specific idiosyncracies in German spelling, concerns related to computerization, public opinion, and the scope of the reform.…

  11. German Rap Music in the Classroom.

    Science.gov (United States)

    Schmidt, Johannes

    2003-01-01

    Provides background information on German rap artists and bands and discusses how to implement the music in various classroom situations at all levels. Highlights some of the available material on German rap music and provides information on how to locate rap texts, information, and other material via the Internet and other sources. (Author/VWL)

  12. The Teaching of German Literature in Translation.

    Science.gov (United States)

    Rippley, LaVern J.

    The present-day status of language instruction at St. Olaf College is viewed in the perspective of past requirements at the college. Reasons for student interest in German, the most popular modern language, focus on the influence of family ties with speakers of Norwegian. A discussion of methods of teaching German literature in translation is…

  13. The Role of German in Japan.

    Science.gov (United States)

    Sang, Juergen

    This historical overview of German studies in Japan, dating from the birth of modern Japan in the 1870's to the present time, includes commentary on the nature and scope of existing language programs. The importance of German idealism--reflected in the philosophy of Kant, Hegel, Schopenhauer, Nietzsche, and Marx--on Japanese culture is noted.…

  14. The Dividend Policy of German Firms

    NARCIS (Netherlands)

    Andres, C.; Betzer, A.; Goergen, M.; Renneboog, L.D.R.

    2008-01-01

    Abstract: German firms pay out a lower proportion of their cash flows, but a higher proportion of their published profits than UK and US firms. We estimate partial adjustment models and report two major findings. First, German firms base their dividend decisions on cash flows rather than published

  15. The Dividend Policy of German Firms

    NARCIS (Netherlands)

    Andres, C.; Betzer, A.; Goergen, M.; Renneboog, L.D.R.

    2008-01-01

    German firms pay out a lower proportion of their cash flows, but a higher proportion of their published profits than UK and US firms. We estimate partial adjustment models and report two major findings. First, German firms base their dividend decisions on cash flows rather than published earnings as

  16. Teaching a Course in the German Cinema.

    Science.gov (United States)

    Phillips, Klaus

    1978-01-01

    Describes a course in German film offered by the Department of Germanic Languages and Literatures at the University of Illinois. A sample syllabus is given, which includes a list of the films and textbooks used, as well as a selective listing of films available in the United States. (CFM)

  17. When do German Firms Change their Dividends?

    NARCIS (Netherlands)

    Correia Da Silva, L.; Goergen, M.; Renneboog, L.D.R.

    2002-01-01

    Anecdotal evidence suggests that the dividend policy of German firms is more flexible than the one of their Anglo-American counterparts.This paper analyses the decision to change the dividend for a panel of 221 German firms from 1984 to 1994.The choice of the period of study is motivated by the fact

  18. Swiss Themes in Three "Pluricentric" German Language Textbooks.

    Science.gov (United States)

    Boss, Bettina

    2003-01-01

    Examines three current textbooks for German as a foreign language with regard to their coverage of Switzerland as a German-speaking nation. Concludes by suggesting that pluricentric German language textbooks for beginners are rare. (Author/VWL)

  19. Urban Green Infrastructure: German Experience

    Directory of Open Access Journals (Sweden)

    Diana Olegovna Dushkova

    2016-06-01

    Full Text Available The paper presents a concept of urban green infrastructure and analyzes the features of its implementation in the urban development programmes of German cities. We analyzed the most shared articles devoted to the urban green infrastructure to see different approaches to definition of this term. It is based on materials of field research in the cities of Berlin and Leipzig in 2014-2015, international and national scientific publications. During the process of preparing the paper, consultations have been held with experts from scientific institutions and Administrations of Berlin and Leipzig as well as local experts from environmental organizations of both cities. Using the German cities of Berlin and Leipzig as examples, this paper identifies how the concept can be implemented in the program of urban development. It presents the main elements of green city model, which include mitigation of negative anthropogenic impact on the environment under the framework of urban sustainable development. Essential part of it is a complex ecological policy as a major necessary tool for the implementation of the green urban infrastructure concept. This ecological policy should embody not only some ecological measurements, but also a greening of all urban infrastructure elements as well as implementation of sustainable living with a greater awareness of the resources, which are used in everyday life, and development of environmental thinking among urban citizens. Urban green infrastructure is a unity of four main components: green building, green transportation, eco-friendly waste management, green transport routes and ecological corridors. Experience in the development of urban green infrastructure in Germany can be useful to improve the environmental situation in Russian cities.

  20. German General Staff Officer Education and Current Challenges

    National Research Council Canada - National Science Library

    Groeters, Thomas

    2006-01-01

    "German General Staff Officer Education and Current Challenges" examines the institutional education of German General Staff Officers, as experienced by the author, and offers a "Conceptual Competency...

  1. Evaluation of gamma irradiated essential oils to control stored-grain weevil, Sitophilus zeamais and cockroach, Blattella germanica

    International Nuclear Information System (INIS)

    Potenza, Marcos Roberto; Gomes, Davinni Habral Passini; Silvestre, Denise de Fatima; Da Silva, Rita de Cassia; Arthur, Valter

    2004-01-01

    Most of the essential oils have insecticidal activity and are alternatives to plant protection and urban pest control. The gamma radiation has been used to control microorganisms and insects in dehydrate herbs, spices, medicinal plants and other materials. This work aimed to evaluate the effect of irradiated essential oils as contact poison on Stored grain, weevil, Sitophilus zeamais and as stomach poison in cockroach, Blattella germanica. The bioassay with B. germanica demonstrated efficiency between 22.0 and 30.0% and between 30.0 and 42.0% respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation promoted changes in essential oils Eucalyptus citriodora and E. globulus and showed increased effectiveness on B. germanica nymphs besides a significative reduction of repellency. Gamma radiation thus interfered on behavior of some essential oils by increasing or reducing activating or inactivating their efficiency to pest control. (author)

  2. Catechol conjugation with hemolymph proteins and their incorporation into the cuticle of the American cockroach, Periplaneta americana

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, W.D.; Kimbrough, T.D.; Mills, R.R. [Department of Biology, Virginia Commonwealth University, Richmond, VA 23284-2012 (United States)

    1999-01-01

    Newly ecdysed American cockroaches, Periplaneta americana (six to last instar)were injected with radioactive dopamine. In addition, the reinjection of radiolabeled protein of any size resulted in the incorporation of the label into the newly sclerotized cuticle. Hemolymph proteins were synthesized in vivo using [{sup 14}C]leucine and subsequently double labeled in vivo with [{sup 3}H]dopamine. After sclerotization (7 h post-ecdysis) the cuticle was extirpated, hydrolyzed and counted. An identical ratio of {sup 14}C to {sup 3}H was found in cuticle extracts as in the double-labeled hemolymph proteins, suggesting that the phenol-bound protein was incorporated in the cuticle unchanged. It appears that the catechol bound to the proteins exists as a {beta}-glucoside. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  3. Folding wings like a cockroach: a review of transverse wing folding ensign wasps (Hymenoptera: Evaniidae: Afrevania and Trissevania.

    Directory of Open Access Journals (Sweden)

    István Mikó

    Full Text Available We revise two relatively rare ensign wasp genera, whose species are restricted to Sub-Saharan Africa: Afrevania and Trissevania. Afrevania longipetiolata sp. nov., Trissevania heatherae sp. nov., T. hugoi sp. nov., T. mrimaensis sp. nov. and T. slideri sp. nov. are described, males and females of T. anemotis and Afrevania leroyi are redescribed, and an identification key for Trissevaniini is provided. We argue that Trissevania mrimaensis sp. nov. and T. heatherae sp. nov. populations are vulnerable, given their limited distributions and threats from mining activities in Kenya. We hypothesize that these taxa together comprise a monophyletic lineage, Trissevaniini, tr. nov., the members of which share the ability to fold their fore wings along two intersecting fold lines. Although wing folding of this type has been described for the hind wing of some insects four-plane wing folding of the fore wing has never been documented. The wing folding mechanism and the pattern of wing folds of Trissevaniini is shared only with some cockroach species (Blattodea. It is an interesting coincidence that all evaniids are predators of cockroach eggs. The major wing fold lines of Trissevaniini likely are not homologous to any known longitudinal anatomical structures on the wings of other Evaniidae. Members of the new tribe share the presence of a coupling mechanism between the fore wing and the mesosoma that is composed of a setal patch on the mesosoma and the retinaculum of the fore wing. While the setal patch is an evolutionary novelty, the retinaculum, which originally evolved to facilitate fore and hind wing coupling in Hymenoptera, exemplifies morphological exaptation. We also refine and clarify the Semantic Phenotype approach used in previous taxonomic revisions and explore the consequences of merging new with existing data. The way that semantic statements are formulated can evolve in parallel, alongside improvements to the ontologies themselves.

  4. The Litvinenko 210polonium case. German experiences

    International Nuclear Information System (INIS)

    Kroeger, Emily Alice

    2009-01-01

    The high scientific standards of the BfS were necessary in order to characterize and evaluate the low activities of 210 Po found during the deployment in Hamburg. The evaluation of the measurements enabled the BfS to offer effective radiation protection advice and to assist the police investigation. The majority of the 210 Po traces were found in places that had been in skin contact with Kovtun, leading to the conclusion that Kovtun had most probably incorporated 210 Po before his visit to Hamburg in October 2006. As yet, no formal charges have been brought by the German authorities against Kovtun and the costs of the operation remain under discussion. Strategies to improve the internal and external deployment communication of the ZUB are being developed and implemented to deal with both the real and the perceived threats that occur during such an incident. Open communication from the onset of a deployment is essential, both between the institutions involved and between deployment leaders and the press. This will save precious time and resources, lower anxiety in the public and emergency workers and could, in a culture of trust where radiation protection advice is listened to and followed, ultimately save lives. (orig.)

  5. [The boycott against German scientists and the German language after World War I].

    Science.gov (United States)

    Reinbothe, R

    2013-12-01

    After the First World War, the Allied academies of sciences staged a boycott against German scientists and the German language. The objective of the boycott was to prevent the re-establishment of the prewar dominance of German scientists, the German language and German publications in the area of international scientific cooperation. Therefore the Allies excluded German scientists and the German language from international associations, congresses and publications, while they created new international scientific organizations under their leadership. Medical associations and congresses were also affected, e. g. congresses on surgery, ophthalmology and tuberculosis. Allied physicians replaced the "International Anti-Tuberculosis Association" founded in Berlin in 1902 with the "Union Internationale contre la Tuberculose"/"International Union against Tuberculosis", founded in Paris in 1920. Only French and English were used as the official languages of the new scientific organizations, just as in the League of Nations. The boycott was based on the fact that the German scientists had denied German war guilt and war crimes and glorified German militarism in a manifesto "To The Civilized World!" in 1914. The boycott first started in 1919 and had to be abolished in 1926, when Germany became a member of the League of Nations. Many German and foreign physicians as well as other scientists protested against the boycott. Some German scientists and institutions even staged a counter-boycott impeding the resumption of international collaboration. The boycott entailed an enduring decline of German as an international scientific language. After the Second World War scientists of the victorious Western Powers implemented a complete reorganization of the international scientific arena, based on the same organizational structures and language restrictions they had built up in 1919/1920. At the same time scientists from the U.S.A. staged an active language and publication policy, in

  6. German causative events with placement verbs

    Directory of Open Access Journals (Sweden)

    De Knop Sabine

    2016-06-01

    Full Text Available Several studies have described the semantic uses of German posture verbs, but only few have dealt with German placement verbs. The present study wants to make up for this gap. Starting from a collection of examples from the core corpora of the Digitales Wörterbuch der Deutschen Sprache (DWDS and some former studies on posture verbs, it first describes the variety of the most common German placement verbs stellen (‘to put upright’, legen (‘to lay down’, setzen (‘to set’ and stecken (‘to stick’.

  7. Polarjugend.de - an IPY Education and Outreach Project of the German Youth Steering Committee

    Science.gov (United States)

    Sachs, T.; Kaiser, B.; Richter, A.; Schofield, R.; Lantuit, H.; Salmon, R.; Haase, D.

    2007-12-01

    The online network polarjugend.de is a project being initiated by the German Youth Steering Committee for the International Polar Year (GYSC) in cooperation with the International Youth Steering Committe and the IPY Education and Outreach. Two goals integral to the YSC are firstly the networking of young polar researchers across all disciplines early in their careers to enable collaboration, and secondly for this network to be involved in outreach to other youth. To meet these two aims with a project coordinated by the youth for the youth, the German YSC has created an online platform in German to facilitate the collaboration among high-school students, teachers and young polar researchers in and outside the classroom. The GYSC coordinates presentations and discussions at high schools throughout Germany by networking teachers and researchers and providing educational material and resources. The GYSC makes available brief online presentations and articles for further use in the classroom. An event calendar provides teachers and students with subject-relevant information on the Polar Regions. An online discussion forum considers student questions dealing with polar issues. The project aims at reducing the language barrier of polar education and outreach activities for a German- speaking audience by providing polar-related information and further means of communication specifically in German. The project is designed to continue beyond the timeline of the IPY, and the GYSC is confident that it will exert a lasting effect on German high-school education and the integration and discussion of Polar issues into the curriculum.

  8. Sensitivity to Pigment-Dispersing Factor (PDF) Is Cell-Type Specific among PDF-Expressing Circadian Clock Neurons in the Madeira Cockroach.

    Science.gov (United States)

    Gestrich, Julia; Giese, Maria; Shen, Wen; Zhang, Yi; Voss, Alexandra; Popov, Cyril; Stengl, Monika; Wei, HongYing

    2018-02-01

    Transplantation studies have pinpointed the circadian clock of the Madeira cockroach to the accessory medulla (AME) of the brain's optic lobes. The AME is innervated by approximately 240 adjacent neuropeptidergic neurons, including 12 pigment-dispersing factor (PDF)-expressing neurons anterior to the AME (aPDFMEs). Four of the aPDFMEs project contralaterally, controlling locomotor activity rhythms of the night-active cockroach. The present in vitro Ca 2+ imaging analysis focuses on contralaterally projecting AME neurons and their responses to PDF, GABA, and acetylcholine (ACh). First, rhodamine-dextran backfills from the contralateral optic stalk identified contralaterally projecting AME neurons, which were then dispersed in primary cell cultures. After characterization of PDF, GABA, and ACh responses, PDF immunocytochemistry identified ipsilaterally and contralaterally projecting PDFMEs. All PDF-sensitive clock neurons, PDF-immunoreactive clock neurons, and the majority of ipsilaterally and contralaterally projecting cells were excited by ACh. GABA inhibited all PDF-expressing clock neurons, and about half of other ipsilaterally projecting and most contralaterally projecting clock neurons. For the first time, we identified PDF autoreceptors in PDF-secreting cockroach circadian pacemakers. The medium-sized aPDFMEs and all other contralaterally projecting PDF-sensitive clock cells were inhibited by PDF. The ipsilaterally remaining small PDF-sensitive clock cells were activated by PDF. Only the largest aPDFME did not express PDF autoreceptors. We hypothesize that opposing PDF signaling generates 2 different ensembles of clock cells with antiphasic activity, regulating and maintaining a constant phase relationship between rest and activity cycles of the night-active cockroach.

  9. [Effect of population density on enzymatic activity of antioxidative and phenol oxidase systems of imagoes and nymphs of the marble cockroach Nauphoeta cinerea].

    Science.gov (United States)

    Murzagulov, G S; Saltykova, E S; Gaĭfullina, L R; Nikolenko, A G

    2013-01-01

    The work deals with effect of density of population on functional activity of components pf protective system of adult individuals and nymphs of the marble cockroach. The resistance of individuals has been noted to decrease both at individual maintenance and under conditions of overpopulation. Changes in activities of enzymes of antioxidative and phenoloxidase systems are studied ion the insect hemolymph and intestine. Possible consequences of isolation and overpopulation are discussed both for stability and for individual development.

  10. German-Brazilian nuclear deal

    International Nuclear Information System (INIS)

    Krugmann, H.

    1981-01-01

    Examination of the arguments in favor of the nuclear deal with West Germany and the resulting program suggests that revisions of both are in order to make them more compatible with Brazil's national interests. The deficiencies of current policy appear to be too weighty and numerous to be ignored. Sooner or later the government will have to move toward adjusting its nuclear agreement with West Germany, if not for the reasons discussed here then for lack of capital. Current estimates of the nuclear package lie in the range of $25 to $30 billion, compared to an initial projection of about $5 billion. The deal has become so expensive that it would draw capital from the hydropower and alcohol programs essential for the short and medium-term energy needs of the country. Mr. Krugman feels the Brazilian government should hold off on further nuclear contracts. And it should thoroughly reassess what Brazil's nuclear energy and technology requirements are and how to meet them. There are indications that the reassessment process is already underway. As long as the German nuclear industry depends on the sale of technology to Brazil, the Brazilian government will have considerable bargaining power to enforce further changes in the deal. If this power is used wisely, the result could be cooperation between the two countries toward nuclear options that are consistent with Brazil's energy and development needs

  11. German innovation initiative for nanotechnology

    Science.gov (United States)

    Rieke, Volker; Bachmann, Gerd

    2004-10-01

    In many areas of nanotechnology, Germany can count on a good knowledge basis due to its diverse activities in nanosciences. This knowledge basis, when paired with the production and sales structures needed for implementation and the internationally renowned German talent for system integration, should consequently lead to success in the marketplace. And this is exactly the field of application for the innovation initiative "Nanotechnologie erobert Märkte" (nanotechnology conquers markets) and for the new BMBF strategy in support of nanotechnology. Until now, aspects of nanotechnology have been advanced within the confines of their respective technical subject areas. However, the primary aim of incorporating them into an overall national strategy is to build on Germany's well-developed and internationally competitive research in science and technology to tap the potential of Germany's important industrial sectors for the application of nanotechnology through joint research projects (leading-edge innovations) that strategically target the value-added chain. This development is to be supported by government education policy to remedy a threatening shortage of skilled professionals. To realize that goal, forward-looking political policymaking must become oriented to a uniform concept of innovation, one that takes into consideration all facets of new technological advances that can contribute to a new culture of innovation in Germany. And that includes education and research policy as well as a climate that encourages and supports innovation in science, business and society.

  12. German innovation initiative for nanotechnology

    International Nuclear Information System (INIS)

    Rieke, Volker; Bachmann, Gerd

    2004-01-01

    In many areas of nanotechnology, Germany can count on a good knowledge basis due to its diverse activities in nanosciences. This knowledge basis, when paired with the production and sales structures needed for implementation and the internationally renowned German talent for system integration, should consequently lead to success in the marketplace. And this is exactly the field of application for the innovation initiative 'Nanotechnologie erobert Maerkte' (nanotechnology conquers markets) and for the new BMBF strategy in support of nanotechnology. Until now, aspects of nanotechnology have been advanced within the confines of their respective technical subject areas. However, the primary aim of incorporating them into an overall national strategy is to build on Germany's well-developed and internationally competitive research in science and technology to tap the potential of Germany's important industrial sectors for the application of nanotechnology through joint research projects (leading-edge innovations) that strategically target the value-added chain. This development is to be supported by government education policy to remedy a threatening shortage of skilled professionals. To realize that goal, forward-looking political policymaking must become oriented to a uniform concept of innovation, one that takes into consideration all facets of new technological advances that can contribute to a new culture of innovation in Germany. And that includes education and research policy as well as a climate that encourages and supports innovation in science, business and society

  13. NPPCI - topics in the German Democratic Republic

    International Nuclear Information System (INIS)

    Ziegenbein, D.

    1986-01-01

    This paper summarizes research and development activities in the field of computerized operator support systems, self-powered detectors, boiling diagnostic and loose part detection systems in the German Democratic Republic

  14. The German Physical Society Under National Socialism

    Science.gov (United States)

    Hoffmann, Dieter; Walker, Mark

    2004-12-01

    The history of the German Physical Society from 1933 to 1945 is not the same as a comprehensive history of physics under Adolf Hitler, but it does reflect important aspects of physicists' work and life during the Third Reich.

  15. High load of multi-drug resistant nosocomial neonatal pathogens carried by cockroaches in a neonatal intensive care unit at Tikur Anbessa specialized hospital, Addis Ababa, Ethiopia

    Directory of Open Access Journals (Sweden)

    Tilahun Birkneh

    2012-03-01

    Full Text Available Abstract Background Cockroaches have been described as potential vectors for various pathogens for decades; although studies from neonatal intensive care units are scarce. This study assessed the vector potential of cockroaches (identified as Blatella germanica in a neonatal intensive care unit setup in Tikur Anbessa Hospital, Addis Ababa, Ethiopia. Methods A total of 400 Blatella germanica roaches were aseptically collected for five consecutive months. Standard laboratory procedures were used to process the samples. Results From the external and gut homogenates, Klebsiella oxytoca, Klebsiella pneumoniae, Citrobacter spp. Enterobacter cloacae, Citrobacter diversus, Pseudomonas aeruginosa, Providencia rettgeri, Klebsiella ozaenae, Enterobacter aeruginosa, Salmonella C1, Non Group A streptococcus, Staphylococcus aureus, Escherichia coli, Acinetobacter spp. and Shigella flexneri were isolated. Multi-drug resistance was seen in all organisms. Resistance to up to all the 12 antimicrobials tested was observed in different pathogens. Conclusion Cockroaches could play a vector role for nosocomial infections in a neonatal intensive care unit and environmental control measures of these vectors is required to reduce the risk of infection. A high level of drug resistance pattern of the isolated pathogens was demonstrated.

  16. Brain-midgut cross-talk and autocrine metabolastat via the sNPF/CCAP negative feed-back loop in the American cockroach, Periplaneta americana.

    Science.gov (United States)

    Mikani, Azam; Watari, Yasuhiko; Takeda, Makio

    2015-12-01

    Immunohistochemical reactivities against short neuropeptide F (sNPF-ir) and crustacean cardioactive peptide (CCAP-ir) were detected in both the brain-subesophageal ganglion (Br-SOG) and midgut epithelial cells of the male American cockroach, Periplaneta americana. Four weeks of starvation increased the number of sNPF-ir cells and decreased the CCAP-ir cells in the Br-SOG, whereas refeeding reversed these effects. The contents of sNPF in the Br-SOG, midgut and hemolymph titer decreased in response to an injection of CCAP into the hemocoel of normally fed male cockroaches, while CCAP titers/contents decreased in response to an injection of sNPF. The results of a double-labeling experiment demonstrated that sNPF-ir co-existed in CCAP-ir cells in the pars intercerebralis (PI), dorsolateral region of protocerebrum (DL), deutocerebrum (De) and SOG. sNPF-ir and CCAP-ir were also colocalized in the midgut. sNPF and CCAP are neuropeptides and midgut factors that interact with each other. Since the two peptides are known to be secreted by identical cells that affect each other, this constitutes autocrine negative feedback regulation for a quick response to food accessibility/inaccessibility. These peptides not only constitute the switch in the digestive mechanism but also couple digestive adaptation with behavior. A CCAP injection suppressed locomotor activity when cockroaches were starved, whereas sNPF activated it when they were fed.

  17. High load of multi-drug resistant nosocomial neonatal pathogens carried by cockroaches in a neonatal intensive care unit at Tikur Anbessa specialized hospital, Addis Ababa, Ethiopia.

    Science.gov (United States)

    Tilahun, Birkneh; Worku, Bogale; Tachbele, Erdaw; Terefe, Simegn; Kloos, Helmut; Legesse, Worku

    2012-03-16

    Cockroaches have been described as potential vectors for various pathogens for decades; although studies from neonatal intensive care units are scarce. This study assessed the vector potential of cockroaches (identified as Blatella germanica) in a neonatal intensive care unit setup in Tikur Anbessa Hospital, Addis Ababa, Ethiopia. A total of 400 Blatella germanica roaches were aseptically collected for five consecutive months. Standard laboratory procedures were used to process the samples. From the external and gut homogenates, Klebsiella oxytoca, Klebsiella pneumoniae, Citrobacter spp. Enterobacter cloacae, Citrobacter diversus, Pseudomonas aeruginosa, Providencia rettgeri, Klebsiella ozaenae, Enterobacter aeruginosa, Salmonella C1, Non Group A streptococcus, Staphylococcus aureus, Escherichia coli, Acinetobacter spp. and Shigella flexneri were isolated. Multi-drug resistance was seen in all organisms. Resistance to up to all the 12 antimicrobials tested was observed in different pathogens. Cockroaches could play a vector role for nosocomial infections in a neonatal intensive care unit and environmental control measures of these vectors is required to reduce the risk of infection. A high level of drug resistance pattern of the isolated pathogens was demonstrated.

  18. Crossing the Lexicon: Anglicisms in the German Hip Hop Community

    Science.gov (United States)

    Garley, Matthew E.

    2012-01-01

    The influence of English on German has been an ongoing subject of intense popular and academic interest in the German sphere. In order to better understand this language contact situation, this research project investigates anglicisms--instances of English language material in a German language context--in the German hip hop community, where the…

  19. The German Sea Rescue Service (SAR).

    Science.gov (United States)

    2002-01-01

    The German Sea Rescue Service (GSRS) history, organisation and operations are presented. The institution was founded in 1865 to provide sea rescue services for the German coasts in the North Sea and in the Baltic Sea. Its fleet counts 61 vessels based in 54 stations of the service. In 2001, the rescue crafts were called for assistance 2428 times and 207 lives were saved. The service is supported by voluntary donations.

  20. A German Perspective on Security Research

    Science.gov (United States)

    Thoma, Klaus; Hiller, Daniel; Leismann, Tobias; Drees, Birgit

    Prior to 2007, there was no coherent federal approach to conceptualise and fund security research in Germany. This changed with the initiation of the national program for civil security research, managed by the German Ministry for Education and Research (BMBF). Over the course of only four years a continuous build-up of national capacities on civil security was established to better protect German citizens, commodities and infrastructures against terrorism, organised crime and the effects of man-made and natural disasters.

  1. The Great War and German Memory

    DEFF Research Database (Denmark)

    Leese, Peter

    2012-01-01

    Review essay on Jason Crouthamel, The Great War and German Memory. Society, Politics and Psychological Trauma, 1914-18 (2009) and Anton Kaes, Shell Shock Cinema: Weimar Culture and the Wounds of War (2009)......Review essay on Jason Crouthamel, The Great War and German Memory. Society, Politics and Psychological Trauma, 1914-18 (2009) and Anton Kaes, Shell Shock Cinema: Weimar Culture and the Wounds of War (2009)...

  2. On the intonation of German intonation questions

    DEFF Research Database (Denmark)

    Petrone, Caterina; Niebuhr, Oliver

    2014-01-01

    German questions and statements are distinguished not only by lexical and syntactic but also by intonational means. This study revisits, for Northern Standard German, how questions are signalled intonationally in utterances that have neither lexical nor syntactic cues. Starting from natural......, but represents a separate attitudinal meaning dimension. Moreover, the findings support that both prenuclear and nuclear fundamental frequency (F0) patterns must be taken into account in the analysis of tune meaning....

  3. Gender in Italian-German Bilinguals: A Comparison with German L2 Learners of Italian

    Science.gov (United States)

    Bianchi, Giulia

    2013-01-01

    This study compares mastery of gender assignment and agreement in Italian by adult Italian-German bilinguals who have acquired two languages simultaneously (2L1), and by adult German highly proficient second language learners (L2ers) of Italian. Our data show that incompleteness in bilingual acquisition and in second language (L2) acquisition…

  4. Dictionary for veterinary science and biosciences. German-English/English-German. With trilingual appendix: Latin terms

    International Nuclear Information System (INIS)

    Mack, R.

    1988-01-01

    This dictionary has been compiled as a result of many years experience of translating German texts in the biological sciences, particularly veterinary medicine. The author's aim is to supplement the standard German-English general dictionaries with technical terms to in the fields of anatomy, microbiology, physiology, parasitology, pathology, pharmacology, toxicology and zootechny, with special reference to domestic animals and their diseases. (orig.) [de

  5. Do Lemmas Speak German? A Verb Position Effect in German Structural Priming

    Science.gov (United States)

    Chang, Franklin; Baumann, Michael; Pappert, Sandra; Fitz, Hartmut

    2015-01-01

    Lexicalized theories of syntax often assume that verb-structure regularities are mediated by lemmas, which abstract over variation in verb tense and aspect. German syntax seems to challenge this assumption, because verb position depends on tense and aspect. To examine how German speakers link these elements, a structural priming study was…

  6. How do German bilingual schoolchildren process German prepositions? - A study on language-motor interactions.

    Science.gov (United States)

    Ahlberg, Daniela Katharina; Bischoff, Heike; Strozyk, Jessica Vanessa; Bryant, Doreen; Kaup, Barbara

    2018-01-01

    While much support is found for embodied language processing in a first language (L1), evidence for embodiment in second language (L2) processing is rather sparse. In a recent study, we found support for L2 embodiment, but also an influence of L1 on L2 processing in adult learners. In the present study, we compared bilingual schoolchildren who speak German as one of their languages with monolingual German schoolchildren. We presented the German prepositions auf (on), über (above), and unter (under) in a Stroop-like task. Upward or downward responses were made depending on the font colour, resulting in compatible and incompatible trials. We found compatibility effects for all children, but in contrast to the adult sample, there were no processing differences between the children depending on the nature of their other language, suggesting that the processing of German prepositions of bilingual children is embodied in a similar way as in monolingual German children.

  7. How do German bilingual schoolchildren process German prepositions? – A study on language-motor interactions

    Science.gov (United States)

    Bischoff, Heike; Strozyk, Jessica Vanessa; Bryant, Doreen; Kaup, Barbara

    2018-01-01

    While much support is found for embodied language processing in a first language (L1), evidence for embodiment in second language (L2) processing is rather sparse. In a recent study, we found support for L2 embodiment, but also an influence of L1 on L2 processing in adult learners. In the present study, we compared bilingual schoolchildren who speak German as one of their languages with monolingual German schoolchildren. We presented the German prepositions auf (on), über (above), and unter (under) in a Stroop-like task. Upward or downward responses were made depending on the font colour, resulting in compatible and incompatible trials. We found compatibility effects for all children, but in contrast to the adult sample, there were no processing differences between the children depending on the nature of their other language, suggesting that the processing of German prepositions of bilingual children is embodied in a similar way as in monolingual German children. PMID:29538404

  8. German neutron scattering conference. Programme and abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Brueckel, Thomas (ed.)

    2012-07-01

    The German Neutron Scattering Conference 2012 - Deutsche Neutronenstreutagung DN 2012 offers a forum for the presentation and critical discussion of recent results obtained with neutron scattering and complementary techniques. The meeting is organized on behalf of the German Committee for Research with Neutrons - Komitee Forschung mit Neutronen KFN - by the Juelich Centre for Neutron Science JCNS of Forschungszentrum Juelich GmbH. In between the large European and international neutron scattering conferences ECNS (2011 in Prague) and ICNS (2013 in Edinburgh), it offers the vibrant German and international neutron community an opportunity to debate topical issues in a stimulating atmosphere. Originating from ''BMBF Verbundtreffen'' - meetings for projects funded by the German Federal Ministry of Education and Research - this conference series has a strong tradition of providing a forum for the discussion of collaborative research projects and future developments in the field of research with neutrons in general. Neutron scattering, by its very nature, is used as a powerful probe in many different disciplines and areas, from particle and condensed matter physics through to chemistry, biology, materials sciences, engineering sciences, right up to geology and cultural heritage; the German Neutron Scattering Conference thus provides a unique chance for exploring interdisciplinary research opportunities. It also serves as a showcase for recent method and instrument developments and to inform users of new advances at neutron facilities.

  9. Psychiatric care in the German prison system.

    Science.gov (United States)

    Lehmann, Marc

    2012-01-01

    The purpose of this paper is to describe the nature of medical care within the German penal system. German prison services provide health care for all inmates, including psychiatric care. The reached level of equivalence of care and ethical problems and resource limitations are discussed and the way of legislation in this field since 2006 reform on federal law is described. The article summarizes basic data on German prison health care for mentally ill inmates. The legislation process and factors of influence are pointed out. A description of how psychiatric care is organized in German prisons follows. It focuses on the actual legal situation including European standards of prison health care and prevention of torture, psychiatric care in German prisons themselves, self harm and addiction. Associated problems such as blood born diseases and tuberculosis are included. The interactions between prison staff and health care personal and ethic aspects are discussed. The legislation process is still going on and there is still a chance to improve psychiatric care. Mental health problems are the major challenge for prison health care. Factors such as special problems of migrants, shortage of professionals and pure statistic data are considered. The paper provides a general overview on psychiatric services in prison and names weak points and strengths of the system.

  10. German neutron scattering conference. Programme and abstracts

    International Nuclear Information System (INIS)

    Brueckel, Thomas

    2012-01-01

    The German Neutron Scattering Conference 2012 - Deutsche Neutronenstreutagung DN 2012 offers a forum for the presentation and critical discussion of recent results obtained with neutron scattering and complementary techniques. The meeting is organized on behalf of the German Committee for Research with Neutrons - Komitee Forschung mit Neutronen KFN - by the Juelich Centre for Neutron Science JCNS of Forschungszentrum Juelich GmbH. In between the large European and international neutron scattering conferences ECNS (2011 in Prague) and ICNS (2013 in Edinburgh), it offers the vibrant German and international neutron community an opportunity to debate topical issues in a stimulating atmosphere. Originating from ''BMBF Verbundtreffen'' - meetings for projects funded by the German Federal Ministry of Education and Research - this conference series has a strong tradition of providing a forum for the discussion of collaborative research projects and future developments in the field of research with neutrons in general. Neutron scattering, by its very nature, is used as a powerful probe in many different disciplines and areas, from particle and condensed matter physics through to chemistry, biology, materials sciences, engineering sciences, right up to geology and cultural heritage; the German Neutron Scattering Conference thus provides a unique chance for exploring interdisciplinary research opportunities. It also serves as a showcase for recent method and instrument developments and to inform users of new advances at neutron facilities.

  11. Corpus Linguistics and Bilingual Terminology: The AntConc Program and Term Extraction in German

    Directory of Open Access Journals (Sweden)

    Cristina Alberts-Franco

    2015-07-01

    Full Text Available This paper discusses three researches involving Corpus Linguistics and Terminology German/Portuguese using program AntConc. The first aimed to extract terms related to Economics in German electronic newspapers. The second and third aimed to extract terms related to the Indian material culture in works by Koch-Grünberg; the purpose: compile a bilingual glossary.  The first and second researches, using tools Word List, Concordance, and File View, shortly allowed extraction of large number of terms, whose frequency was reliably established. The third, in initial phase, will allow us to enlarge the results produced with the second, presently with 257 terms and their translation.

  12. Enteric methane emissions from German dairy cows

    DEFF Research Database (Denmark)

    Dammgen, U; Rosemann, C; Haenel, H D

    2012-01-01

    Up to now, the German agricultural emission inventory used a model for the assessment of methane emissions from enteric fermentation that combined an estimate of the energy and feed requirements as a function of performance parameters and diet composition, with the constant methane conversion rate......, as stated by IPCC. A methane emission model was selected here that is based on German feed data. It was combined with the hitherto applied model describing energy requirements. The emission rates thus calculated deviate from those previously obtained. In the new model, the methane conversion rate is back......-calculated from emission rates and gross energy intake rates. For German conditions of animal performance and diet composition, the national means of methane conversion rates range between 71 kJ MJ(-1) and 61 kJ MJ(-1) for low and high performances (4700 kg animal(-1) a(-1) in 1990 to 7200 kg animal(-1) a(-1...

  13. The German risk study. Pt. 2

    International Nuclear Information System (INIS)

    Burkart, K.

    1980-01-01

    A severe nuclear power plant accident can be followed by a considerable release of radioactive effluents into the atmosphere. Due to atmospheric dispersion, areas of different sizes can be contaminated. The corresponding doses can cause early illnesses, early fatalities, latent effects and genetic effects. They are accompanied by economic effects. Within the consequence model of the German Risk Study, early and late fatalities and genetically significant doses are calculated. The calculations are based on real data or phenomena such as the population around 19, present or future German sites, or 115 real weather sequences, as well as on models such as an atmospheric dispersion model, a dose model, a model of protective actions or a health effects model. Within this lecture, the consequence model applied in the German Risk Study will be discussed in detail and the results will be presented. (orig./RW)

  14. Standard metabolic rate is associated with gestation duration, but not clutch size, in speckled cockroaches Nauphoeta cinerea.

    Science.gov (United States)

    Schimpf, Natalie G; Matthews, Philip G D; White, Craig R

    2012-12-15

    Metabolic rate varies significantly between individuals, and these differences persist even when the wide range of biotic and abiotic factors that influence metabolism are accounted for. It is important to understand the life history implications of variation in metabolic rate, but they remain poorly characterised despite a growing body of work examining relationships between metabolism and a range of traits. In the present study we used laboratory-bred families (one sire to three dams) of Nauphoeta cinerea (Olivier) (speckled cockroaches) to examine the relationship between standard metabolic rate (SMR) and reproductive performance (number of offspring and gestation duration). We show that SMR is negatively associated with female gestation duration. Age at mating is negatively associated with gestation duration for females, and mass is negatively associated with the average gestation duration of the females a male was mated with. In addition to the results in the current literature, the results from the present study suggest that the association between metabolism and life history is more complex than simple relationships between metabolism and various fitness traits. Future work should consider longitudinal, ontogenetic as well as selective and quantitative genetic breeding approaches to fully examine the associations between metabolism and fitness.

  15. Standard metabolic rate is associated with gestation duration, but not clutch size, in speckled cockroaches Nauphoeta cinerea

    Directory of Open Access Journals (Sweden)

    Natalie G. Schimpf

    2012-09-01

    Metabolic rate varies significantly between individuals, and these differences persist even when the wide range of biotic and abiotic factors that influence metabolism are accounted for. It is important to understand the life history implications of variation in metabolic rate, but they remain poorly characterised despite a growing body of work examining relationships between metabolism and a range of traits. In the present study we used laboratory-bred families (one sire to three dams of Nauphoeta cinerea (Olivier (speckled cockroaches to examine the relationship between standard metabolic rate (SMR and reproductive performance (number of offspring and gestation duration. We show that SMR is negatively associated with female gestation duration. Age at mating is negatively associated with gestation duration for females, and mass is negatively associated with the average gestation duration of the females a male was mated with. In addition to the results in the current literature, the results from the present study suggest that the association between metabolism and life history is more complex than simple relationships between metabolism and various fitness traits. Future work should consider longitudinal, ontogenetic as well as selective and quantitative genetic breeding approaches to fully examine the associations between metabolism and fitness.

  16. Group living enhances individual resources discrimination: the use of public information by cockroaches to assess shelter quality.

    Directory of Open Access Journals (Sweden)

    Stéphane Canonge

    Full Text Available In group-living organisms, consensual decision of site selection results from the interplay between individual responses to site characteristics and to group-members. Individuals independently gather personal information by exploring their environment. Through social interaction, the presence of others provides public information that could be used by individuals and modulates the individual probability of joining/leaving a site. The way that individual's information processing and the network of interactions influence the dynamics of public information (depending on population size that in turn affect discrimination in site quality is a central question. Using binary choice between sheltering sites of different quality, we demonstrate that cockroaches in group dramatically outperform the problem-solving ability of single individual. Such use of public information allows animals to discriminate between alternatives whereas isolated individuals are ineffective (i.e. the personal discrimination efficiency is weak. Our theoretical results, obtained from a mathematical model based on behavioral rules derived from experiments, highlight that the collective discrimination emerges from competing amplification processes relying on the modulation of the individual sheltering time without shelters comparison and communication modulation. Finally, we well demonstrated here the adaptive value of such decision algorithm. Without any behavioral change, the system is able to shift to a more effective strategy when alternatives are present: the modification of the spatio-temporal distributions of individuals leading to the collective selection of the best resource. This collective discrimination implying such parsimonious and widespread mechanism must be shared by many group living-species.

  17. Responsiveness of the adult cricket (Gryllus bimaculatus and Acheta domesticus) retrocerebral complex to allatostatin-1 from a cockroach, Diploptera punctata.

    Science.gov (United States)

    Neuhüser, T; Sorge, D; Stay, B; Hoffmann, K H

    1994-01-01

    Brain-retrocerebral complexes of female crickets, Gryllus bimaculatus and Acheta domesticus, treated with antibody to allatostatin-1 from a cockroach, Diploptera punctata, show extensive immunoreactivity. The results suggest that allostatins or allatostatin-like molecules are produced in neurosecretory cells of the brain and are delivered to the corpora allata through nervous connections and/or via haemolymph. Radiochemical measurements of juvenile hormone III biosynthesis by isolated corpora cardiaca-corpora allata complexes from adult G. bimaculatus have been used to demonstrate an in vitro sensitivity of these glands to allatostatin-1 from D. punctata. Allatostatin-1 is a relatively potent inhibitor of juvenile hormone III biosynthesis in corpora allata of both young adult females and males. In glands taken from 3-day virgin females, 50% inhibition of hormone biosynthesis is reached at ca. 3 nmol.l-1 allatostatin-1. The inhibitory action of allatostatin-1 is rapid, dose-dependent and reversible. Addition of 200 mumol.l-1 farnesol to the incubation medium prevents inhibition of juvenile hormone III biosynthesis by allatostatin-1. Juvenile hormone III biosynthesis by isolated corpora allata of 3-day female house crickets, A. domesticus, is also susceptible to inhibition by 1 mumol.l-1 allatostatin-1.

  18. Fifty years of German nuclear legislation

    International Nuclear Information System (INIS)

    Heller, W.

    2006-01-01

    The political situation and the state of legislation after World War II make it difficult to pinpoint a precise date of origin of German nuclear legislation. The restrictions imposed by the Allied High Commission (AHC) without any exception put a ban on the production of uranium and thorium metal as well as the construction of nuclear reactors. These restrictions were lifted expressly when the German Atomic Energy Act (AtG) entered into force on January 1, 1960, i.e. much later than the formal step of gaining sovereignty, which was marked by the protocol of May 5, 1955 terminating the Occupation Statute. In October 1955, the German federal government established the then Federal Ministry for Atomic Matters also in an attempt to reconnect to developments in nuclear fission in other parts of the Western world. To supersede the AHC law, the German federal government in December 1956 publicized a draft Atomic Energy Act. It is safe, therefore, to consider that year the starting point of German atomic legislation. This step was followed by deliberations preparatory to the adoption of the Atomic Energy Act. In 1957, however, adoption failed because no two-thirds majority was reached to amend the Basic Law, i.e. the Constitution. As a consequence, some federal states saw the need to adopt state legislation to regulate this area. On December 3, 1959, a new draft Atomic Energy Act was adopted by the German federal parliament after the second and third readings - coupled with an amendment to the Basic Law on that same day - with the votes of the opposition and with one abstention. (orig.)

  19. THE ROLE OF PREPOSITIONAL PARTICLES WITH SPATIAL MEANING IN THE SEMANTIC OF GERMAN COLLOQUIAL VERBAL UNITS

    Directory of Open Access Journals (Sweden)

    Yushkova, L.A.

    2016-06-01

    Full Text Available The purpose of this article is to analyze the role and place of German preverbal units with adverbial character under verbalization of the conceptual category "space". The article presents the results of semantic and functional specificity (peculiarities of German preverbal particle aus- studies based on the corpus of colloquial German with word-formative and cognitive analysis involved. Reference to etymology and semantics of the preverbal particle reveals cognitive and semantic potentiality of aus-. The author suggests the system of meanings of preverbal articles formed around the space invariant either directly or indirectly determined by its existence. The study differentiates the main word- formative patterns of verbal units including the above mentioned particle: verbal units with locative and verbal units with aggressive meaning. Thus, the author analyses the specificity and regularity (patterns of preverbal particle semantics depending on the semantics of the producing verb within the framework of the detected models.

  20. Brazilian and German perspectives: a study on perception, interculturality and foreign language and culture teaching

    Directory of Open Access Journals (Sweden)

    Mergenfel A. Vaz Ferreira

    2011-12-01

    Full Text Available This article aims to present a comparative study of the perception of multimodal texts, more specifically, advertisements printed in Brazilian and German magazines, by Brazilian learners of GFL(German as a Foreign Language and German learners of PFL (Portuguese as a Foreign Language , with special attention to the intercultural dimension involved in this process. Through the analysis developed in the study, it was possible to identify not only cultural aspects strictly related to language phenomena (as the use of personal pronouns and forms of treatment, for instance, but also more subjective cultural aspects (such as emotional states, the view about work, among others. This study also discusses the implications of the link between culture and language choices for the area of teaching and learning foreign languages / cultures.

  1. West German Jewry: Guilt, Power and Pluralism

    OpenAIRE

    Anthony d. Kauders

    2010-01-01

    The essay will address the history of West German Jewry using the concept of guilt as its guiding theme. Jews in West Germany had a bad conscience on account of living in the “land of the murderers.” This bad conscience not only distinguished them from other Jewish communities, it also explains much of what characterized West German Jewry from 1945 to 1989: its particular economic structure; its especially close ties to Israel; its preoccupation with democratization; its power arrangements; a...

  2. War, suffering and modern German history.

    Science.gov (United States)

    Hansen, Randall

    2011-01-01

    This introduction proceeds in five steps. First, it briefly considers the etymology of the term "suffering," as well as the way in which scholars from different disciplines have approached it conceptually and empirically. Second, drawing on the contributions to this issue, it raises general themes emerging from the study of the Thirty Years, Franco-Prussian and First World Wars, with particular attention to gender, the disabled, and Jewish-German veterans. Finally, it considers the most politically contested field of German suffering - the Second World War - and reflects on how that suffering can be narrated and understood without running into the intellectual dead ends of either self-pity or collective guilt.

  3. Structure of the German electricity industry

    International Nuclear Information System (INIS)

    1992-01-01

    The German integrated association is a union of those electric power supply utilities in the Federal Republic of Germany which cooperate in the integrated operation of 220 kV and 380 kV. The German integrated association (DVG) was founded in 1948. Its main task is to create the technical, operational and legal conditions for the cooperation in the national and international integrated system. The inclusion of the new Federal States has been practiced for the first time with the 320 MW power station in Offleben. (DG) [de

  4. Darwin: German mystic or French rationalist?

    Science.gov (United States)

    Ghiselin, Michael T

    2015-01-01

    The notion that Charles Darwin embraced the German Romantic tradition seems plausible, given the early influence of Alexander von Humboldt. But this view fails to do justice to other scientific traditions. Darwin was a protégé of the Englishman John Stevens Henslow and was a follower of the Scott Charles Lyell. He had important debts to French scientists, notably Henri Milne-Edwards, Etienne and Isidore Geoffroy Saint-Hilaire, and Alphonse de Candolle. Many Germans were quite supportive of Darwin, but not all of these were encumbered by idealistic metaphysical baggage. Both Darwin and Anton Dohrn treated science as very much a cosmopolitan enterprise.

  5. German energy policy in deregulated Europe

    International Nuclear Information System (INIS)

    Kuhnt, D.

    2000-01-01

    The author argues in favor of a more fact-oriented German energy policy: Firstly, German energy policy must accept the new European framework of a market economy. This means that German utilities must no longer be burdened with the implementation of political objectives. The German power industry needs a level playing field for competition on a European scale. Consequently, also the European partner countries should not limit themselves to the minimum conditions of the Single Market Directive in opening their markets. Secondly, German energy policy must develop new forms of cooperation with the power industry so as to maintain domestic employment and the addition of value despite considerably stronger competitive pressure. Also the conflicting targets of sustainability, continuity of supply, and economic viability must not only be discussed, but must be turned into productive approaches. Thirdly, this means that there must be no inadmissible solution in matters nuclear. If the German power industry is to remain strong, in the interest of domestic jobs and opportunities for the future, it must not lose any more domestic market share to other European companies. Fourthly, we need a new energy policy which takes cognizance of the results of market development in a more rational, less emotional way. In this respect, it should be limited henceforth to supporting renewable energies and technologies so as to enhance energy efficiency in line with market requirements. Fifthly, German energy policy must not commit the mistake of enforcing deregulation and, at the same time, exempting large segments of the market from competition. Thus, the planned expansion of renewable energies, and the increase in cogeneration to more than thirty percent of the German electricty generation, by way of quotas and revenues for electricity from these sources fed into the public grid, are incompatible with competition in Europe. The electricity tax within the framework of the eco tax, the

  6. TANDEM - French-German cooperation for local energy transition

    International Nuclear Information System (INIS)

    Mouchard, Claire; Garreau, Enora; Maurer, Christiane; Schilken, Peter; Keilmann, Jenny-Claire; Janssen, Ulrike

    2014-01-01

    The simultaneous implementation of the German 'Energiewende' and the French 'Transition energetique' prompted both country's governments to sign various cooperation agreements. As both 'Energiewende' and 'Transition energetique' put a strong focus on decentralization of energy supply, establishing close inter-communal cooperation is particularly promising. The project TANDEM, which is jointly led by Klima-Buendnis and Energy Cities - both local authority networks - and co-funded by Germany's Federal Environment Agency (UBA) and the French Energy Agency ADEME provides French and German local authorities with a unique opportunity to exchange experiences and create partnerships for climate protection having the following objectives: - Creating broad mutual understanding for the respective situation, challenges and framework in energy and climate policy; - Encourage exchanges with regard to obstacles and success factors concerning the realization of ambitious energy- and climate-goals and promoting mutual transfer of know-how; - Stimulating close collaboration between local authorities from both countries while involving and supporting local stakeholders and citizens; - Implementing initial stages of cooperation projects during the lifetime of the TANDEM project and creating a foundation for long-term cooperation; - Raise awareness for demands, requirements and concerns of local authorities on a national and European level in order to strengthen their influence and enlarge their scope of action. In this document, the authors briefly present the French, German and European contexts and the organization of both countries regarding energy transition. Then, a parallel is made between the national energy-climate plans of both countries ('Klimaschutzkonzepte' and 'Plans Climat-Energie Territoriaux') to identify the similarities and differences in order to learn from each other and to be able to create

  7. The perception of the fehmarnbelt connection among german stakeholders

    DEFF Research Database (Denmark)

    Lohse, Sandrina; Jespersen, Per Homann

    This report gives an overview of the planned improvements of the German hinterland infrastructure connected to the fixed Fehmarn Belt Link (FBL), as well as the views of the key German stake holders towards the FBL....

  8. High-Speed Maglev Trains; German Safety Requirements

    Science.gov (United States)

    1991-12-31

    This document is a translation of technology-specific safety requirements developed : for the German Transrapid Maglev technology. These requirements were developed by a : working group composed of representatives of German Federal Railways (DB), Tes...

  9. Dietary choice for a balanced nutrient intake increases the mean and reduces the variance in the reproductive performance of male and female cockroaches.

    Science.gov (United States)

    Bunning, Harriet; Bassett, Lee; Clowser, Christina; Rapkin, James; Jensen, Kim; House, Clarissa M; Archer, Catharine R; Hunt, John

    2016-07-01

    Sexual selection may cause dietary requirements for reproduction to diverge across the sexes and promote the evolution of different foraging strategies in males and females. However, our understanding of how the sexes regulate their nutrition and the effects that this has on sex-specific fitness is limited. We quantified how protein (P) and carbohydrate (C) intakes affect reproductive traits in male (pheromone expression) and female (clutch size and gestation time) cockroaches (Nauphoeta cinerea). We then determined how the sexes regulate their intake of nutrients when restricted to a single diet and when given dietary choice and how this affected expression of these important reproductive traits. Pheromone levels that improve male attractiveness, female clutch size and gestation time all peaked at a high daily intake of P:C in a 1:8 ratio. This is surprising because female insects typically require more P than males to maximize reproduction. The relatively low P requirement of females may reflect the action of cockroach endosymbionts that help recycle stored nitrogen for protein synthesis. When constrained to a single diet, both sexes prioritized regulating their daily intake of P over C, although this prioritization was stronger in females than males. When given the choice between diets, both sexes actively regulated their intake of nutrients at a 1:4.8 P:C ratio. The P:C ratio did not overlap exactly with the intake of nutrients that optimized reproductive trait expression. Despite this, cockroaches of both sexes that were given dietary choice generally improved the mean and reduced the variance in all reproductive traits we measured relative to animals fed a single diet from the diet choice pair. This pattern was not as strong when compared to the single best diet in our geometric array, suggesting that the relationship between nutrient balancing and reproduction is complex in this species.

  10. One antenna, two antennae, big antennae, small: total antennae length, not bilateral symmetry, predicts odor-tracking performance in the American cockroach Periplaneta americana.

    Science.gov (United States)

    Lockey, Jacob K; Willis, Mark A

    2015-07-01

    Determining the location of a particular stimulus is often crucial to an animal's survival. One way to determine the local distribution of an odor is to make simultaneous comparisons across multiple sensors. If the sensors detect differences in the distribution of an odor in space, the animal can then steer toward the source. American cockroaches, Periplaneta americana, have 4 cm long antennae and are thought to track odor plumes using a spatial sampling strategy, comparing the amount of odor detected between these bilateral sensors. However, it is not uncommon for cockroaches to lose parts of their antennae and still track a wind-borne odor to its source. We examined whether bilateral odor input is necessary to locate an odor source in a wind-driven environment and how the loss of increasing lengths of the antennae affects odor tracking. The tracking performances of individuals with two bilaterally symmetrical antennae of decreasing length were compared with antennal length-matched individuals with one antenna. Cockroaches with one antenna were generally able to track an odor plume to its source. In fact, the performances of unilaterally antennectomized individuals were statistically identical to those of their bilaterally symmetrical counterparts when the combined length of both antennae equaled the length of the single antenna of the antennectomized individuals. This suggests that the total length of available antennae influences odor tracking performance more than any specific piece of antenna, and that they may be doing something more complex than a simple bilateral comparison between their antennae. The possibility of an antenna-topic map is discussed. © 2015. Published by The Company of Biologists Ltd.

  11. Attitudes of German Student Teachers on Inclusion

    Science.gov (United States)

    Baar, Robert

    2016-01-01

    The contribution discusses attitudes of German Teacher Training Students on Inclusion based on an empirical analysis containing three elements: Evaluation of students' written exams, results of a survey with closed as open questions and the interpretation of group discussions among students about inclusion. One can see that, though the found-out…

  12. Germans, History, and the Nazi Past.

    Science.gov (United States)

    Young, Anne P.

    1981-01-01

    Discusses opposite findings of researchers concerning the amount of time given to the study of Hitler and the Third Reich in German Secondary Schools. Considers the relationship among scholarly work on the Nazi era, influences of the work on secondary school teachers, impact of curriculum reform, and effects of government educational…

  13. German Unification: Security Implications for Europe

    Science.gov (United States)

    1990-07-01

    we are having problems.󈧟 49 Possible future options for NATO will be addressed in Chapter VII. Eurooe. after 40 years of stutter starts, has been...Jarvis. a Berliner. is a school teacher who has vivid childhood memories of tne World War II bombings of Berlin. -’Christoph Bertram. "The German

  14. German energy market 2016; Deutscher Energiemarkt 2016

    Energy Technology Data Exchange (ETDEWEB)

    Schiffer, Hans-Wilhelm [World Energy Council, London (United Kingdom). World Energy Resources; Weltenergierat, Berlin (Germany). Arbeitsgruppe Energie fuer Deutschland

    2017-03-15

    The basic orientation of the German energy supply to the increased use of renewable energies, while increasing energy efficiency, is prediscribed by the German government's energy concept and determines the market development. A current overview of the German energy market is given, which provides also this year a concentrated Compilation of the key data of the energy industry. As in the years before, the article not only summarizes general facts about the energy mix, but also goes into detail on the development of the individual energy sources, petroleum, natural gas, brown coal and hard coal, electricity as well as renewable energies. Furthermore, the price trends of international markets and in the domestic market are explained. A current overview of the development of greenhouse gas emissions concludes the contribution. [German] Die im Energiekonzept der Bundesregierung vorgegebene Grundausrichtung der deutschen Energieversorgung hin zur verstaerkten Nutzung erneuerbarer Energien bei gleichzeitiger Steigerung der Energieeffizienz bestimmt die Marktentwicklung. Vorliegend wird ein aktueller Ueberblick ueber den deutschen Energiemarkt gegeben, der auch in diesem Jahr eine konzentrierte Zusammenstellung der zentralen Eckdaten der Energiewirtschaft leistet. Wie in den Jahren zuvor fasst der Artikel nicht nur allgemeine Fakten zum Energiemix zusammen, sondern geht auch ausfuehrlich auf die Entwicklung der einzelnen Energietraeger Erdoel, Erdgas, Braun- und Steinkohle, Elektrizitaet sowie regenerative Energien ein. Ferner werden die Preistendenzen auf den internationalen Maerkten und im Inland erlaeutert. Eine aktuelle Uebersicht ueber die Entwicklung der Treibhausgas-Emissionen schliesst den Beitrag ab.

  15. The Eichmann Trial on East German Television

    NARCIS (Netherlands)

    Keilbach, Judith

    2014-01-01

    abstractThe trial against Adolf Eichmann was one of the first transnational media events on television. Its world-wide coverage required transnational cooperation. Using East German television reports about the trial this article argues that although the event transcended national borders it

  16. Qualification of ship doctors: a German approach.

    Science.gov (United States)

    Seidenstuecker, Klaus H; Neidhardt, Stefan

    2014-01-01

    While a steady growth of cruise tourism since the 1970s created an increasing demand for ship doctors medical postgraduate specialty training did not sufficiently reflect the scope of skills and knowledge required from a physician being left to himself at sea. The German Maritime Health Association therefore tasked a working group with analysing the situation and coming up with suggestions for an adequate postgraduate training for ship doctors. The working group consisted of 19 experts with various backgrounds in maritime medicine. A literature review was done on cruise ship epidemiology as well as an assessment of tasks and environmental factors influencing medical care on board of cruise ships. Necessary knowledge and skills were derived and compared with those imparted by standard German medical education. Mandatory knowledge and skills were identified as well as elements of standard medical education contributing to these goals. Those aspects that would or could not be adequately covered by German standard education were catalogued and summarised in a course curriculum. In 2013 after approval by its board of directors the German Maritime Health Association published a qualification and training recommendation addressing colleagues planning to muster as ship doctors.

  17. Dictionary of chemistry. English/German

    International Nuclear Information System (INIS)

    Wenske, G.

    1992-01-01

    This English/German dictionary covers more than 100.000 terms from chemistry, chemical engineering and related fields. It also contains molecular formulas, as well as numerous synonyms and areas of application. IUPAC terminology is emphasized, and outdated or rare terminology is indicated. (MM) [de

  18. The German Interlinguistics Society Gesellschaft fur Interlinguistik.

    Science.gov (United States)

    O Riain, Sean

    2003-01-01

    Describes the German interlinguistics society Gesellschaft fur Interlinguistik (GIL), which was founded to bring together interlinguistics and esperantology scholars. Highlights GIL's principal fields of activity and discusses its role in the fields of international linguistic communication, language planning, esperantolgy, and the teaching of…

  19. German and Russian Adolescents' Environmental Awareness.

    Science.gov (United States)

    Szagun, Gisela; Pavlov, Vladimir I.

    German (n=610) and Russian (n=610) adolescents in 3 age groups, 12, 15, and 18 years, were given a questionnaire assessing their feelings towards environmental destruction, their readiness for pro-environmental action, and their ethical attitude toward nature. In both nationalities anxiety, sadness, and anger about environmental destruction were…

  20. Vygotsky, Consciousness, and the German Psycholinguistic Tradition

    Science.gov (United States)

    Leitch, David G.

    2011-01-01

    This article argues that Vygotsky's choice of word meaning as the basic unit of analysis for cultural psychology connects him to a German psycholinguistic tradition--exemplified in the work of G. W. F. Hegel and J. G. Herder--distinct from the Marxist tradition. While later commentators criticize Vygotsky's reliance on word meaning, arguing that…

  1. Recent Developments in German Corporate Governance

    NARCIS (Netherlands)

    Goergen, M.; Manjon, M.C.; Renneboog, L.D.R.

    2004-01-01

    We contrast the features of the German corporate governance system with those of other systems and discuss the recent regulatory initiatives.For example, the rules on insider trading and anti-trust have been strengthened.The Restructuring Act has been revised to prevent minority shareholders from

  2. Suicidal ideation in German primary care

    NARCIS (Netherlands)

    Wiborg, J.F.; Gieseler, D.; Lowe, B.

    2013-01-01

    OBJECTIVE: To examine suicidal ideation in a sample of German primary care patients. METHODS: We conducted a cross-sectional study and included 1455 primary care patients who visited 1 of 41 general practitioners (GPs) working at 19 different sites. Suicidal ideation and psychopathology were

  3. Gifted Education in German-Speaking Europe

    Science.gov (United States)

    Ziegler, Albert; Stoeger, Heidrun; Harder, Bettina; Balestrini, Daniel Patrick

    2013-01-01

    The authors first briefly describe how the concepts of talents and giftedness found in German-speaking Europe have evolved in the school system and in general over the past two centuries, and how the variety of gifted-education efforts found within and beyond schools as well as counseling efforts attest to these changes. They then discuss four…

  4. Michael Sadler and the German Connection.

    Science.gov (United States)

    Higginson, J. H.

    1990-01-01

    Chronicles works of Michael Sadler who compared British and German educational systems, emphasizing Germany's contributions in technical education. Presents Sadler's 1912 recommendations--eight lessons premised upon powerful centralized government's ability to implement policy. Reflects on how World War I and Nazism influenced Sadler's thought and…

  5. Analysis of the first Romanian-German economic relations

    OpenAIRE

    Wiegand Helmut FLEISCHER

    2013-01-01

    The first Romanian-German economic relations were initiated by the German colonists who had settled on the territory of Transylvania since the 12th century. Over the centuries, the Romanian- German economic relations had some fluctuations, but the tradition of these relations is indisputable. The fluctuations in the Romanian-German economic relations were caused by the economic evolution in Romania and Germany, the politic relations between the two states as well as the European political and...

  6. The suspended sentence in German criminal law

    Directory of Open Access Journals (Sweden)

    Jovašević Dragan

    2017-01-01

    Full Text Available From the ancient times until today, criminal law in all countries has provided different criminal sanctions as social control measures. These are court-imposed coercive measures that take away or limit certain rights and freedoms of criminal offenders. Sanctions are applied to natural or legal persons who violate the norms of the legal order and cause damage or endanger other legal goods that enjoy legal protection. In order to effectively protect social values jeopardized by the commission of crime, state legislations prescribe several kinds of criminal sanctions: 1 penalties, 2 precautions, 3 safety measures, 4 penalties for juvenile offenders, and 5 sanctions for legal persons. Penalties are the basic, the oldest and the most important type of criminal sanctions. They are prescribed for the largest number of criminal offences. Imposed instead of or alongside with penalties, warning measures have particularly important role in jurisprudence. Since they were introduced in the system of criminal sanctions in the early 20th century, there has been a notable increase in the application of these measures, particularly in cases involving negligent and accidental offences, and minor offences that do not cause serious consequences, whose perpetrators are not persons with criminal characteristics. Warning measures (suspended sentence are envisaged in all contemporary criminal legislations, including the German legislation. Suspended sentence is a conditional stay of execution of the sentence of imprisonment for a specified time, provided that the convicted person fulfills the imposed obligations and does not commit another criminal offense. Two conditions must be fulfilled for the application of these sanctions: a the formal requirement, which is attached to the sentence of imprisonment; and b the substantive requirement, which implies the court assessment that the application of these sanctions is justified and necessary in a particular case. Many

  7. Imidacloprid and thiacloprid neonicotinoids bind more favourably to cockroach than to honeybee α6 nicotinic acetylcholine receptor: insights from computational studies.

    Science.gov (United States)

    Selvam, Balaji; Graton, Jérôme; Laurent, Adèle D; Alamiddine, Zakaria; Mathé-Allainmat, Monique; Lebreton, Jacques; Coqueret, Olivier; Olivier, Christophe; Thany, Steeve H; Le Questel, Jean-Yves

    2015-02-01

    The binding interactions of two neonicotinoids, imidacloprid (IMI) and thiacloprid (THI) with the extracellular domains of cockroach and honeybee α6 nicotinic acetylcholine receptor (nAChR) subunits in an homomeric receptor have been studied through docking and molecular dynamics (MD) simulations. The binding mode predicted for the two neonicotinoids is validated through the good agreement observed between the theoretical results with the crystal structures of the corresponding complexes with Ac-AChBP, the recognized structural surrogate for insects nAChR extracellular ligand binding domain. The binding site of the two insect α6 receptors differs by only one residue of loop D, a serine residue (Ser83) in cockroach being replaced by a lysine residue (Lys108) in honeybee. The docking results show very close interactions for the two neonicotinoids with both α6 nAChR models, in correspondence to the trends observed in the experimental neonicotinoid-Ac-AChBP complexes. However, the docking parameters (scores and energies) are not significantly different between the two insect α6 nAChRs to draw clear conclusions. The MD results bring distinct trends. The analysis of the average interaction energies in the two insects α6 nAChRs shows indeed better affinity of neonicotinoids bound to α6 cockroach compared to honeybee nAChR. This preference is explained by tighter contacts with aromatic residues (Trp and Tyr) of the binding pocket. Interestingly, the non-conserved residue Lys108 of loop D of α6 honeybee nAChR interacts through van der Waals contacts with neonicotinoids, which appear more favourable than the direct or water mediated hydrogen-bond interaction between the OH group of Ser83 of α6 cockroach nAChR and the electronegative terminal group of the two neonicotinoids (nitro in IMI and cyano in THI). Finally, in both insects nAChRs, THI is consistently found to bind more favourably than IMI. Copyright © 2014 Elsevier Inc. All rights reserved.

  8. Entangled Histories: German Veterinary Medicine, c.1770-1900.

    Science.gov (United States)

    Mitsuda, Tatsuya

    2017-01-01

    Medical historians have recently become interested in the veterinary past, investigating the development of animal health in countries such as France, the Netherlands, the United Kingdom and the United States. An appreciation of the German context, however, is still lacking - a gap in the knowledge that the present article seeks to fill. Providing a critical interpretation of the evolution of the veterinary profession, this investigation explains why veterinary and medical spheres intersected, drifted apart, then came back together; it also accounts for the stark differences in the position of veterinarians in Germany and Britain. Emphasis is placed on how diverse traditions, interests and conceptualisations of animal health shaped the German veterinary profession, conditioned its field of operation, influenced its choice of animals and diseases, and dictated the speed of reform. Due to a state-oriented model of professionalisation, veterinarians became more enthusiastic about public service than private practice, perceiving themselves to be alongside doctors and scientists in status, rather than next to animal healers or manual labourers. Building on their expertise in epizootics, veterinarians became involved in zoonoses, following outbreaks of trichinosis. They achieved a dominant position in meat hygiene by refashioning abattoirs into sites for the construction of veterinary knowledge. Later, bovine tuberculosis helped veterinarians cement this position, successfully showcasing their expertise and contribution to society by saving as much meat as possible from diseased livestock. Ultimately, this article shows how veterinarians were heavily 'entangled' with the fields of medicine, food, agriculture and the military.

  9. Underlying and derived glides in Middle High German

    Directory of Open Access Journals (Sweden)

    Tracy Alan Hall

    2017-05-01

    Full Text Available The present study investigates the phonology of glides in Middle High German. On the basis of surface contrasts between prevocalic nuclear glides in syllable-final position ([VG.V] and postvocalic glides in onset position ([V.GV], it is argued that the latter were underlying glides (e.g. the /w/ in [le.wə] ‘lion’ and that the former were glides derived from vowels (e.g. the offglide [o̯] in the diphthong [uo̯] from /uo/. Underlying glides are argued to be [+consonantal], while nuclear glides ‒ like the vowels from which they derive ‒ are [‒consonantal]. The analysis of Middle High German bears on several debates involving glides in the theoretical literature. First, a treatment with an underlying glide in /VGV/ cannot be reanalyzed by treating the vowels as peaks (e.g. Harris & Kaisse 1999 for Argentinian Spanish. Second, the treatment of underlying glides as [+consonantal] is to be preferred over alternatives which analyze those sounds as [‒vocalic] (e.g. Nevins & Chitoran 2008 for several languages. Third, an analysis of nuclear structure is adopted (from Harris & Kaisse 1999 which enables one to interpret which element in a complex nucleus is the peak and which is the nonpeak without stipulation. Fourth, the contrastive syllabification of surface glides (i.e. [VG.V] vs. [V.GV] is shown to be a diagnostic of underlying glide languages that has not been discussed in the literature to date.

  10. A Chatterbox is a Box: Morphology in German Word Production

    Science.gov (United States)

    Gumnior, Heidi; Bolte, Jens; Zwitserlood, Pienie

    2006-01-01

    Two experiments are reported in which university students translated visually presented English words into German, while German distractor words were simultaneously presented. Distractors were morphologically related, merely form-related or unrelated to the German translations (target words). The transparency of the semantic relation between…

  11. The Herero genocide : German unity, settlers, soldiers, and ideas

    NARCIS (Netherlands)

    Gewald, J.B.; Bechhaus-Gerst, M.; Klein-Arendt, R.

    2003-01-01

    Between 1904 and 1908 imperial German troops committed genocide in German South West Africa, present-day Namibia. African survivors of the war were cruelly treated, placed in camps and put to work as forced labourers. This paper addresses the question of why German soldiers and settlers committed

  12. 75 FR 62453 - German-American Day, 2010

    Science.gov (United States)

    2010-10-12

    ... shores in search of freedom, opportunity, and the chance at a better life. The German men and women who... ancestry who have been an integral part of our national life. On German-American Day, we pay tribute to the... lives on in the men, women, and families of German descent who enhance civic engagement, steer our...

  13. Christian mission agencies and the question of slavery in German ...

    African Journals Online (AJOL)

    ... to the imperial designs of their government, with little commitment to improving the wellbeing of Cameroonians. Little wonder colonial and missionization exploitation which is inseparable from the modern understanding of slavery was at its highest during the German era. Keywords: German Cameroon, German missions, ...

  14. The Lower Depths on the German Stage

    Directory of Open Access Journals (Sweden)

    Svetlana M. Demkina

    2018-03-01

    Full Text Available This article examines the stage history of M. Gorky’s play The Lower Depths in Germany. The author discusses German stage history of Gorky’s work against the social background and in the context of major artistic tendencies of the 20 th century. Steady interest in Gorky as a playwright in Germany is due to the acute social importance and universality of the problems reflected in his dramas. Bearing on the archive materials of the Gorky Museum, the essay explores interpretations of Gorky’s cult drama The Lower Depths in the work of European stage directors, acclaimed reformers of theatrical art. A significant part of the “Gorky and German Theater” section of the Gorky Museum (IWL RAS is devoted to The Lower Depths. Two series of photographs represent the first German staging of Nachtasyl (German translation of The Lower Depths. The performance of Max Reinhardt and Richard Vallentin in Berlin Kleines Theater on January 10–23, 1903, had great success and good takings. After the premiere, attention to the personality of Gorky in Europe increased; he became the most popular Sovietauthor. When Nazi came to power, they banned Gorky’s work in Germany: he reappeared on the German stage only after the World War II. In the late 1960s, on the wave of Gorky’s centenary (1968, world theatres ran a series of performances based on his plays. The 1970s were marked by a renewal of interest to Gorky the playwright. The Lower Depths was staged in Europe, the USA, and the UK. Both directors and critics perceived Gorky’s dramaturgy in the context of works of his contemporaries — Shaw, Ibsen, Hauptmann, Tolstoy, Chekhov.

  15. Mechanical properties of the cuticles of three cockroach species that differ in their wind-evoked escape behavior

    Directory of Open Access Journals (Sweden)

    Andrew J. Clark

    2014-07-01

    Full Text Available The structural and material properties of insect cuticle remain largely unexplored, even though they comprise the majority (approximately 80% of animals. Insect cuticle serves many functions, including protection against predatory attacks, which is especially beneficial to species failing to employ effective running escape responses. Despite recent advances in our understanding of insect escape behaviors and the biomechanics of insect cuticle, there are limited studies on the protective qualities of cuticle to extreme mechanical stresses and strains imposed by predatory attacks, and how these qualities vary between species employing different escape responses. Blattarians (cockroaches provide an appropriate model system for such studies. Wind-evoked running escape responses are strong in Periplaneta americana, weak in Blaberus craniifer and absent in Gromphodorhina portentosa, putting the latter two species at greater risk of being struck by a predator. We hypothesized that the exoskeletons in these two larger species could provide more protection from predatory strikes relative to the exoskeleton of P. americana. We quantified the protective qualities of the exoskeletons by measuring the puncture resistance, tensile strength, strain energy storage, and peak strain in fresh samples of thoracic and abdominal cuticles from these three species. We found a continuum in puncture resistance, tensile strength, and strain energy storage between the three species, which were greatest in G. portentosa, moderate in B. craniifer, and smallest in P. americana. Histological measurements of total cuticle thickness followed this same pattern. However, peak strain followed a different trend between species. The comparisons in the material properties drawn between the cuticles of G. portentosa, B. craniifer, and P. americana demonstrate parallels between cuticular biomechanics and predator running escape responses.

  16. Agonist actions of clothianidin on synaptic and extrasynaptic nicotinic acetylcholine receptors expressed on cockroach sixth abdominal ganglion.

    Science.gov (United States)

    Thany, Steeve H

    2009-11-01

    Clothianidin is new neonicotinoid insecticide acting selectively on insect nicotinic acetylcholine receptors (nAChRs). Its effects on nAChRs expressed on cercal afferent/giant interneuron synapses and DUM neurons have been studied using mannitol-gap and whole-cell patch-clamp techniques, respectively. Bath-application of clothianidin-induced dose-dependent depolarizations of cockroach cercal afferent/giant interneuron synapses which were not reversed after wash-out suggesting a strong desensitization of postsynaptic interneurons at the 6th abdominal ganglion (A6). Clothinidin activity on the nerve preparation was characterized by an increased firing rate of action potentials which then ceased when the depolarization reached a peak. Clothianidin responses were insensitive to all muscarinic antagonists tested but were blocked by co-application of specific nicotinic antagonists methyllicaconitine, alpha-bungarotoxin and d-tubocurarine. In a second round of experiment, clothianidin actions were tested on DUM neurons isolated from the A6. There was a strong desensitization of nAChRs which was not affected by muscarinic antagonists, pirenzepine and atropine, but was reduced with nicotinic antagonist alpha-bungarotoxin. In addition, clothianidin-induced currents were completely blocked by methyllicaconitine suggesting that (1) clothianidin acted as a specific agonist of nAChR subtypes and (2) a small proportion of receptors blocked by MLA was insensitive to alpha-bungarotoxin. Moreover, because clothianidin currents were blocked by d-tubocurarine and mecamylamine, we provided that clothianidin was an agonist of both nAChRs: imidacloprid-sensitive nAChR1 and -insensitive nAChR2 subtypes.

  17. Personality in the cockroach Diploptera punctata: Evidence for stability across developmental stages despite age effects on boldness.

    Science.gov (United States)

    Stanley, Christina R; Mettke-Hofmann, Claudia; Preziosi, Richard F

    2017-01-01

    Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes.

  18. Distribution of serotonergic and dopaminergic nerve fibers in the salivary gland complex of the cockroach Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Kühnel Dana

    2002-06-01

    Full Text Available Abstract Background The cockroach salivary gland consists of secretory acini with peripheral ion-transporting cells and central protein-producing cells, an extensive duct system, and a pair of reservoirs. Salivation is controled by serotonergic and dopaminergic innervation. Serotonin stimulates the secretion of a protein-rich saliva, dopamine causes the production of a saliva without proteins. These findings suggest a model in which serotonin acts on the central cells and possibly other cell types, and dopamine acts selectively on the ion-transporting cells. To examine this model, we have analyzed the spatial relationship of dopaminergic and serotonergic nerve fibers to the various cell types. Results The acinar tissue is entangled in a meshwork of serotonergic and dopaminergic varicose fibers. Dopaminergic fibers reside only at the surface of the acini next to the peripheral cells. Serotonergic fibers invade the acini and form a dense network between central cells. Salivary duct segments close to the acini are locally associated with dopaminergic and serotonergic fibers, whereas duct segments further downstream have only dopaminergic fibers on their surface and within the epithelium. In addition, the reservoirs have both a dopaminergic and a serotonergic innervation. Conclusion Our results suggest that dopamine is released on the acinar surface, close to peripheral cells, and along the entire duct system. Serotonin is probably released close to peripheral and central cells, and at initial segments of the duct system. Moreover, the presence of serotonergic and dopaminergic fiber terminals on the reservoir indicates that the functions of this structure are also regulated by dopamine and serotonin.

  19. The physiological role of fat body and muscle tissues in response to cold stress in the tropical cockroach Gromphadorhina coquereliana.

    Directory of Open Access Journals (Sweden)

    Szymon Chowański

    Full Text Available Protective mechanisms against cold stress are well studied in terrestrial and polar insects; however, little is known about these mechanisms in tropical insects. In our study, we tested if a tropical cockroach Gromphadorhina coquereliana, possesses any protective mechanisms against cold stress. Based on the results of earlier studies, we examined how short-term (3 h cold (4°C influences biochemical parameters, mitochondrial respiration activity, and the level of HSPs and aquaporins expression in the fat body and leg muscles of G. coquereliana. Following cold exposure, we found that the level of carbohydrates, lipids and proteins did not change significantly. Nevertheless, we observed significant changes in mitochondrial respiration activity. The oxygen consumption of resting (state 4 and phosphorylating (state 3 mitochondria was altered following cold exposure. The increase in respiratory rate in state 4 respiration was observed in both tissues. In state 3, oxygen consumption by mitochondria in fat body was significantly lower compared to control insects, whereas there were no changes observed for mitochondria in muscle tissue. Moreover, there were cold-induced changes in UCP protein activity, but the changes in activity differed in fat body and in muscles. Additionally, we detected changes in the level of HSP70 and aquaporins expression. Insects treated with cold had significantly higher levels of HSP70 in fat body and muscles. On the other hand, there were lower levels of aquaporins in both tissues following exposure to cold. These results suggest that fat body play an important role in protecting tropical insects from cold stress.

  20. Cockroach Oothecal Parasitoid, Evania appendigaster (Hymenoptera: Evaniidae) Exhibits Oviposition Preference Towards Oothecal Age Most Vulnerable to Host Cannibalism.

    Science.gov (United States)

    Tee, Hui-Siang; Lee, Chow-Yang

    2017-12-05

    Many female parasitoid wasps optimize host selection to balance the benefits of high-quality hosts and the costs of predator- or hyperparasitoid-induced mortality risks to maximize their fitness. Cannibalism exists in many insect species and affects survival of parasitoid larvae developing in or on parasitized hosts. However, little is known about how parasitoid wasps resolve the fitness consequence of host cannibalism-induced mortality risk during host selection. We examined the effect of oothecal age on cannibalism in the American cockroach Periplaneta americana (L.) (Dictyoptera: Blattidae) and its effect on host age selection and fitness of its oothecal parasitoid Evania appendigaster (L.) (Hymenoptera: Evaniidae). P. americana differentially cannibalized 1-d-old (30‒60%) versus 10- to 40-d-old oothecae (parasitoid females did not avoid but still preferred to parasitize 1-d-old (45%) over 10- to 40-d-old oothecae (1.6‒20%). The parasitism rate was greater and the handling time was shorter on 1-d-old compared to older oothecae. For parasitoid progeny emerging from different-aged oothecae, regression analysis showed that development time increased and body size (measured as hind tibia length) and longevity decreased with oothecal age. These results demonstrate that reduced parasitoid progeny survival due to host cannibalism did not change the parasitoid's oviposition preference for newly laid oothecae, and that E. appendigaster females traded progeny survival for fitness gains for themselves and their progeny. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  1. Personality in the cockroach Diploptera punctata: Evidence for stability across developmental stages despite age effects on boldness

    Science.gov (United States)

    Mettke-Hofmann, Claudia; Preziosi, Richard F.

    2017-01-01

    Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes. PMID:28489864

  2. Functions of corazonin and histamine in light entrainment of the circadian pacemaker in the Madeira cockroach, Rhyparobia maderae.

    Science.gov (United States)

    Arendt, Andreas; Baz, El-Sayed; Stengl, Monika

    2017-04-01

    The circadian pacemaker of the Madeira cockroach, Rhyparobia (Leucophaea) maderae, is located in the accessory medulla (AME). Ipsi- and contralateral histaminergic compound eyes are required for photic entrainment. Light pulses delay locomotor activity rhythm during the early night and advance it during the late night. Thus, different neuronal pathways might relay either light-dependent delays or advances to the clock. Injections of neuroactive substances combined with running-wheel assays suggested that GABA, pigment-dispersing factor, myoinhibitory peptides (MIPs), and orcokinins (ORCs) were part of both entrainment pathways, whereas allatotropin (AT) only delayed locomotor rhythms at the early night. To characterize photic entrainment further, histamine and corazonin were injected. Histamine injections resulted in light-like phase delays and advances, indicating that the neurotransmitter of the compound eyes participates in both entrainment pathways. Because injections of corazonin only advanced during the late subjective night, it was hypothesized that corazonin is only part of the advance pathway. Multiple-label immunocytochemistry in combination with neurobiotin backfills demonstrated that a single cell expressed corazonin in the optic lobes that belonged to the group of medial AME interneurons. It colocalized GABA and MIP but not AT or ORC immunoreactivity. Corazonin-immunoreactive (-ir) terminals overlapped with projections of putatively light-sensitive interneurons from the ipsi- and contralateral compound eye. Thus, we hypothesize that the corazonin-ir medial neuron integrates ipsi- and contralateral light information as part of the phase-advancing light entrainment pathway to the circadian clock. J. Comp. Neurol. 525:1250-1272, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  3. Ambiguous involvement

    DEFF Research Database (Denmark)

    Dannesboe, Karen Ida

    2016-01-01

    This edited collection shows that good parenthood is neither fixed nor stable. The contributors show how parenthood is equally done by men, women and children, in and through practices involving different normative guidelines. The book explores how normative layers of parenthood are constituted...... by notions such as good childhood, family ideals, national public health and educational strategies. The authors illustrate how different versions of parenthood coexist and how complex sets of actions are demanded to fulfil today’s expectations of parenthood in Western societies. This interdisciplinary book...

  4. Explanatory models of addictive behaviour among native German, Russian-German, and Turkish youth.

    Science.gov (United States)

    Penka, S; Heimann, H; Heinz, A; Schouler-Ocak, M

    2008-01-01

    In Germany, the public system of addiction treatment is used less by migrants with addictive disorders than by their non-migrant counterparts. To date, the literature has focused primarily on language, sociocultural factors, and residence status when discussing access barriers to this part of the health care system. However, little attention has been paid to cultural differences in explanatory models of addictive behaviour. This is surprising when we consider the important role played by popular knowledge in a population's perceptions of and responses to illnesses, including their causes, symptoms, and treatment. In the present study, we examined explanatory models of addictive behaviour and of mental disorders in 124 native German und Russian-German youth and compared these models to those observed in an earlier study of 144 German and Turkish youth. We employed the free listing technique German and to compile the terms that participating subjects used to describe addictive behaviour. Subsequently, we examined how a subset of our study population assigned these terms to the respective disorders by means of the pile sort method. Although the explanatory models used by the German and Russian-German youth in our study were surprisingly similar, those employed by Turkish youth did not make any fundamental distinction between illegal and legal drugs (e.g. alcohol and nicotine). German and Russian-German youth regarded eating disorders as "embarrassing" or "disgraceful", but Turkish youth did not. Unlike our German and Russian-German subjects, the Turkish youth did not classify eating disorders as being addictive in nature. Moreover, medical concepts crucial to a proper understanding of dependence disorders (e.g. the term "physical dependence") were characterised by almost half of our Turkish subjects as useless in describing addictions. These findings show that it is impossible to translate medical or everyday concepts of disease and treatment properly into a different

  5. On the phonetics of intensifying emphasis in German.

    Science.gov (United States)

    Niebuhr, Oliver

    2010-01-01

    This paper presents an exploratory study in the field of emphasis in German. It provides a comprehensive acoustic analysis for a type of emphasis that intensifies lexical meanings either positively or negatively. A speech corpus was recorded using an elicitation method adapted to yield natural-sounding, conversational, expressive speech under controlled conditions. Supporting the distinction between positive and negative intensification, two clearly different phonetic profiles emerged. These phonetic profiles of positive and negative intensification involve voice quality as well as the dynamics of the speech signal across its segmental and prosodic layers. By means of these profiles, the intensifying emphases were correctly classified by a discriminant analysis as positive or negative in around 90% of the cases. Moreover, indications were found for a third type of intensifying emphasis, which was called 'reinforcement'. Its multidimensional phonetic profile falls in between the ones of positive and negative intensification. Copyright © 2010 S. Karger AG, Basel.

  6. 16th French-German-Polish Conference on Optimization

    CERN Document Server

    Korytowski, Adam; Maurer, Helmut; Szymkat, Maciej

    2016-01-01

    This book contains extended, in-depth presentations of the plenary talks from the 16th French-German-Polish Conference on Optimization, held in Kraków, Poland in 2013. Each chapter in this book exhibits a comprehensive look at new theoretical and/or application-oriented results in mathematical modeling, optimization, and optimal control. Students and researchers involved in image processing, partial differential inclusions, shape optimization, or optimal control theory and its applications to medical and rehabilitation technology, will find this book valuable. The first chapter by Martin Burger provides an overview of recent developments related to Bregman distances, which is an important tool in inverse problems and image processing. The chapter by Piotr Kalita studies the operator version of a first order in time partial differential inclusion and its time discretization. In the chapter by Günter Leugering, Jan Sokołowski and Antoni Żochowski, nonsmooth shape optimization problems for variational inequa...

  7. Experience and results of MELCOR application for German PWRs

    International Nuclear Information System (INIS)

    Sonnenkalb, M.

    1999-01-01

    An introduction into severe accident research work performed at GRS with regard to the use of the MELCOR code is given in Chapter One of the paper. Experience in applying MELCOR 1.8.3 for German PWRs and results of MELCOR calculations done within the project 'Accident management - Mitigation' for German LWRs are presented in Chapter Two. This 3-year project was finished February 1998. It was funded by the German Ministry for Environment, Nature Conservation and Nuclear Safety - BMU. In Chapter Three, a short overview of a training course on 'Phenomenology of Severe Accidents in PWR-Plants' is given. Mainly due to the interest from German NPPs GRS developed this special training session in 1996. Since 1996 it has been held several times for operators, shift personnel and the management board of two different German NPPs and for lecture of the German NPP training centre in Essen. In Chapter Four, results of the application of MELCOR 1.8.4 for German PWRs are presented. This work is done within a new project on 'Accident Management - Mitigation' for German LWRs. It was started in March 1998 and is again funded by the German Federal Ministry BMU. An objective of this project is to perform further MELCOR calculations, to be used within a PSA level 2 study for a German PWR, which is done at GRS in parallel. The experience of using MELCOR for German PWRs are summarised in Chapter Five. (author)

  8. The American Cockroach Peptide Periplanetasin-2 BlocksClostridium DifficileToxin A-Induced Cell Damage and Inflammation in the Gut.

    Science.gov (United States)

    Hong, Ji; Zhang, Peng; Yoon, I Na; Hwang, Jae Sam; Kang, Jin Ku; Kim, Ho

    2017-04-28

    Clostridium difficile , which causes pseudomembranous colitis, releases toxin A and toxin B. These toxins are considered to be the main causative agents for the disease pathogenesis, and their expression is associated with a marked increase of apoptosis in mucosal epithelial cells. Colonic epithelial cells are believed to form a physical barrier between the lumen and the submucosa, and abnormally increased mucosal epithelial cell apoptosis is considered to be an initial step in gut inflammation responses. Therefore, one approach to treating pseudomembranous colitis would be to develop agents that block the mucosal epithelial cell apoptosis caused by toxin A, thus restoring barrier function and curing inflammatory responses in the gut. We recently isolated an antimicrobial peptide, Periplanetasin-2 (Peri-2, YPCKLNLKLGKVPFH) from the American cockroach, whose extracts have shown great potential for clinical use. Here, we assessed whether Peri-2 could inhibit the cell toxicity and inflammation caused by C. difficile toxin A. Indeed, in human colonocyte HT29 cells, Peri-2 inhibited the toxin A-induced decrease in cell proliferation and ameliorated the cell apoptosis induced by this toxin. Moreover, in the toxin A-induced mouse enteritis model, Peri-2 blocked the mucosal disruption and inflammatory response caused by toxin A. These results suggest that the American cockroach peptide Peri-2 could be a possible drug candidate for addressing the pseudomembranous colitis caused by C. difficile toxin A.

  9. Isolation and identification of two novel attractant compounds from Chinese cockroach (Eupolyphaga sinensis Walker) by combination of HSCCC, NMR and CD techniques.

    Science.gov (United States)

    Jiang, Wei; Wu, Xiaodan; Wu, Bin

    2013-09-13

    High-speed counter-current chromatography (HSCCC) with a two-phase solvent system composed of n-hextane-ethyl acetate-methanol-water (1.5:1:1.5:1, v/v/v/v) was applied to the isolation and purification of attractants from Chinese cockroach, Eupolyphaga sinensis Walker. Two new attractants with attractant activity towards the male insects were obtained from the extract sample in a one-step separation. Their purities were determined by HPLC. Subsequent MS, NMR and CD analyses have led to the characterization of (R)-3-ethyl-6,8-dihydroxy-7-methyl-3,4-dihydroisochromen-1-one (1) and (R)-6,8-dihydroxy-3,7-dimethyl-3,4-dihydroisochromen-1-one (2), two novel isocumarin type attractants. Based on these results, it is concluded that HSCCC is a viable separation method option for purifying insect attractants, while effectively maintaining the attracting activity of the isolates. This is the first attempt to apply counter-current chromatography technique to separate attractants from Chinese cockroach.

  10. Isolation and Identification of Two Novel Attractant Compounds from Chinese Cockroach (Eupolyphaga sinensis Walker by Combination of HSCCC, NMR and CD Techniques

    Directory of Open Access Journals (Sweden)

    Bin Wu

    2013-09-01

    Full Text Available High-speed counter-current chromatography (HSCCC with a two-phase solvent system composed of n-hextane-ethyl acetate-methanol-water (1.5:1:1.5:1, v/v/v/v was applied to the isolation and purification of attractants from Chinese cockroach, Eupolyphaga sinensis Walker. Two new attractants with attractant activity towards the male insects were obtained from the extract sample in a one-step separation. Their purities were determined by HPLC. Subsequent MS, NMR and CD analyses have led to the characterization of (R-3-ethyl-6,8-dihydroxy-7-methyl-3,4-dihydroisochromen-1-one (1 and (R-6,8-dihydroxy-3,7-dimethyl-3,4-dihydroisochromen-1-one (2, two novel isocumarin type attractants. Based on these results, it is concluded that HSCCC is a viable separation method option for purifying insect attractants, while effectively maintaining the attracting activity of the isolates. This is the first attempt to apply counter-current chromatography technique to separate attractants from Chinese cockroach.

  11. MICROBIAL LOAD AND MULTIPLE DRUG RESISTANCE OF PATHOGENIC BACTERIA ISOLATED FROM FEACES AND BODY SURFACES OF COCKROACHES IN AN URBAN AREA OF SOUTHWESTERN NIGERIA

    Directory of Open Access Journals (Sweden)

    Monsuru Adebayo Adeleke

    2012-06-01

    Full Text Available This study investigates the microbial load and antibiotic susceptibility pattern of pathogenic bacteria isolated from the faeces and body surfaces of cockroaches in Osogbo, Southwestern Nigeria. The cockroaches collected from residential areas and hospital vicinities were screened for microbial load and antibiotic susceptibility pattern using standard protocols. A total of twenty- three microorganisms namely Klebsiella aerogenes, Bacillius cereus, Proteus spp, Staphyloccocus aureus, S. saprophyticus, Enteroccocus faecalis, Staphylococus epididermis, E. coli, Listeria monoctogene, Proteus mirabilis, Citrobacter species, Pseudomonas aeruginosa, Psuedomonas species, Seretia mensence, Candida albicans, Candida spp., Aspergilius spp., A. flavus, A. fumigates, Mucor species and Penicilium species were isolated. The microbial load of the microorganisms was significantly higher in the isolates from hospital as compared with the residential area (p<0.05 with the exception of Canidida species, Mucor and Penicillium which had higher or equal microbial load at the residential areas. All the pathogenic bacteria isolated had multiple resistance to antibiotics most importantly, Ampicillin, Augumentin, Amoxicillin and Septrin (30μg. Efforts geared towards controlling the insects will be indispensable in curbing the wide spread of multi-drug resistant pathogens in the study area.

  12. Persistent Ambivalence: Theorizing Queer East German Studies.

    Science.gov (United States)

    Frackman, Kyle

    2018-01-16

    The German Democratic Republic (GDR, East Germany) had an ambivalent relationship with homosexuality. Under the principles of socialism, everyone was welcome to contribute to the greater good. The situation for queer people, here lesbians and gay men, was different: one of illegality and invisibility. A difficulty in analyzing these experiences is the theory and methodology necessary to find them and draw them together in an historical narrative. This essay offers a mode of analysis in which theories of affect illustrate long-term trends in East German conceptualizations of same-sex sexuality. By discussing a 1950 court ruling and a 1989 film, the essay demonstrates the persistence of homophobic prejudice and fear of homosexual seduction of young people and the links to historical and legal developments.

  13. West German Jewry: Guilt, Power and Pluralism

    Directory of Open Access Journals (Sweden)

    Anthony d. Kauders

    2010-04-01

    Full Text Available The essay will address the history of West German Jewry using the concept of guilt as its guiding theme. Jews in West Germany had a bad conscience on account of living in the “land of the murderers.” This bad conscience not only distinguished them from other Jewish communities, it also explains much of what characterized West German Jewry from 1945 to 1989: its particular economic structure; its especially close ties to Israel; its preoccupation with democratization; its power arrangements; and its communal life. The essay will address these issues, and trace a development that led from a close-knit, ideologically homogeneous group to one that became ever more pluralistic in the 1970s and 1980s.

  14. Franco-German cooperation in nuclear development

    International Nuclear Information System (INIS)

    Leny, J.C.

    1993-01-01

    In embarking on a joint approach in the supply of power, Framatome and Siemens agreed in 1989 to combine their future reactor development activities and, for this purpose, founded Nuclear Power International as a joint subsidiary. Their point project is called European Pressurized Water Reactor, and its conceptual design concept was defined in 1991. The 'harmonization phase' completed in 1992 adapted the concept to the national requirements in each of the two countries. At present, the budget is being drawn up, and the basic design is to be completed by 1995. The German and French safety organizations, GRS and IPSN, accompany the project; the German-French Directorate defines the safety standards. However, the scheme for bilatral cooperation can succeed only if Germany is able to achieve consensus on energy policy. (orig.) [de

  15. 14th German nuclear law symposium

    International Nuclear Information System (INIS)

    Burgi, Martin

    2013-01-01

    Nuclear law is still relevant and topical. The nuclear power phase-out in response to the nuclear accident of Fukushima and the turnaround in German energy policy raise new legal issues. In several lectures of practioners and scientists the 14th German Nuclear Law Symposium examined questions regarding the retrofitting of nuclear power plants, their decommissioning and disposal, the current developements in the European nuclear and radiation protection law and the search for a final nuclear waste repository. The nuclear law provides examples for central challenges of administrative law, such as the independence of authorities and the protection of third parties. The discussions between the almost 150 participants are documented in several reports.

  16. Childbirth in East and West German Stepfamilies

    Directory of Open Access Journals (Sweden)

    2002-08-01

    Full Text Available The present paper studies fertility rates in partnerships with and without children from previous partners in East and West Germany. Data from the German "Fertility and Family Survey" is used to estimate piecewise-linear hazard rate models for having another child. It turns out that a proportional-hazard model would give incorrect results because childbirth follows different time patterns for couples who have already a shared child and couples who do not. Therefore, a model with specific clocks for various experiences of parenthood is specified. Based on these model estimations the probability for having another child within a certain time is calculated. In West Germany the estimated likelihood of having another child within six years varies little by child composition. In contrast, East-German couples with no shared child have a higher likelihood than couples with a shared child to have a child within six years.

  17. Different zooplankton structures in the German Bight

    Science.gov (United States)

    Martens, P.; Brockmann, U.

    1993-06-01

    In August 1982, a net of 48 stations with altogether 208 samples was investigated in the eastern German Bight with respect to temperature, salinity, as well as the amount and species composition of the mesozooplankton (>80 μm). The data were arranged into different structures by means of a cluster analysis. Four different clusters were found: (a) a “Wadden sea water” with few holoplankton organisms but a higher amount of spionid larvae; (b) a “German Bight water” with a maximum occurrence of turbellaria ( Alaurina composita) and medium concentrations of copepods; (c) a mixing area between these two water masses with highest amounts of Oikopleura dioica, Temora longicornis, Acartia sp., mussel larvae and larvae of the spionid worms; (d) a “North Sea water” mass with highest concentrations of Pseudocalanus elongatus, Paracalanus parvus und Oithona similis. The differences in the concentrations of the species mentioned between the four clusters were significant on the 0.1%-level.

  18. Making sense of the German Wikipedia community

    Directory of Open Access Journals (Sweden)

    Rikke Frank Jørgensen

    2012-08-01

    Full Text Available This article presents the findings from a qualitative study of the German Wikipedia community, focusing on how people engaged with Wikipedia make sense of norms, collaborative practices and means of regulation within the community. The study highlights the strong focus on the quality of the end-product (the encyclopedia in the German community, stressing that article quality is seen as more important than the wiki-process as such. As the community has grown, an increasing number of rules and mechanisms have been deployed to resolve various issues and conflicts, however the interviewees do not perceive Wikipedia as being bureaucratic, but rather describe it as a “rule-governed anarchy”. The findings suggest that people contribute for a variety of reasons, yet point to reactions from and interactions with fellow Wikipedians as one of the strongest motivational drivers for participation.

  19. Enterobactérias isoladas de baratas (Periplaneta americana capturadas em um hospital brasileiro Enterobacteria isolated from cockroaches (Periplaneta americana captured in a Brazilian hospital

    Directory of Open Access Journals (Sweden)

    Marinésia A. Prado

    2002-02-01

    Full Text Available Objetivo. Isolar e identificar microrganismos em baratas capturadas em um hospital público e determinar o seu perfil de suscetibilidade antimicrobiana. Métodos. As baratas foram capturadas nos períodos matutino e noturno, colocadas em frascos desinfetados com álcool a 70%, transferidas para um frasco estéril e levadas ao laboratório. Consideraram-se as baratas íntegras e vivas, as quais foram colocadas em solução salina estéril (0,8% e homogeneizadas. Essa solução foi semeada nos meios de cultura ágar MacConkey, caldo nutriente, infusão de cérebro e coração (ágar BHI, ágar Sabouraud e ágar manitol. As culturas foram examinadas em um estereomicroscópio para a contagem das unidades formadoras de colônias. Para a determinação do perfil de suscetibilidade antimicrobiana utilizou-se o teste de difusão de disco. Resultados. Detectou-se prevalência de 56% de enterobactérias e de 18% de estafilococos coagulase negativos. Identificaram-se 15 espécies de enterobactérias. As mais freqüentes foram Klebsiella pneumoniae (17%; Enterobacter aerogenes (14%; Serratia marcescens (13%; Hafnia alvei (12%; Enterobacter gergoviae e Enterobacter cloacae (9%; e Serratia spp. (6%. Tanto as enterobactérias quanto os estafilococos coagulase negativos apresentaram uma resistência significativa aos antimicrobianos, inclusive à oxacilina. Conclusões. A prevalência de bactérias enteropatogênicas e de estafilococos coagulase negativos isolados de baratas Periplaneta americana no hospital estudado demonstra a fragilidade das condutas adotadas tanto para o controle de vetores quanto para o uso dos antimicrobianos. Os resultados demonstram a necessidade da implementação de um programa efetivo de saneamento ambiental e do uso racional dos antimicrobianos dentro das instituições de saúde.Objective. To isolate and identify microorganisms from cockroaches that were captured in a public hospital and to test the antimicrobial susceptibility of

  20. Control rooms in German nuclear power plants

    International Nuclear Information System (INIS)

    Hoffmann, E.

    1999-01-01

    The paper explains and illustrates the dissimilarity in design and equipment of control rooms in German NPPs, as well as a historical survey of the general principles and approaches applied in the evolution of control room technology, including backfitting activities. Experience obtained from daily operation as well training at the simulators is taken as a basis to formulate fundamental requirements for modification or novel design approaches. (orig./CB) [de

  1. [German nurses during the First World War].

    Science.gov (United States)

    Wagner, Franz

    2014-06-01

    Nurses from several German organisations participated in the First World War. For the most part, they did not work on the frontline but at the rear, in hospital trains, hospitals or refugee camps. They cared forwounded soldiers and faced epidemics of infectious diseases. The journal of the national association of nurses, which continued to be published during the war, provides a snapshot of their concerns and their questioning regarding the profession and its evolution.

  2. Remarks on the german regulation of crowdfunding

    OpenAIRE

    Tröger, Tobias

    2017-01-01

    Crowdfunding is a buzzword that signifies a sub-set in the new forms of finance facilitated by advances in information technology usually categorized as fintech. Concerns for financial stability, investor and consumer protection, or the prevention of money laundering or funding of terrorism hinge incrementally on including the new techniques to initiate financing relationships adequately in the regulatory framework. This paper analyzes the German regulation of crowdinvesting and finds that it...

  3. Ageing management in German nuclear power plants

    International Nuclear Information System (INIS)

    Wilke, Ulrich; Koring, Reinhard

    2005-01-01

    Ageing management (AM) programmes have been launched in many countries. In the USA ageing management activities were initiated to demonstrate the long term integrity of nuclear power plants for plant life extension purposes. Also in other countries e.g. Switzerland AM programmes became an important issue. In addition, the International Atomic Energy Agency (IAEA) has published recommendations concerning the physical ageing of safety relevant systems. As a consequence of these international developments, the ageing management aspect was introduced to Germany, too, although plant life extension is definitely not the key subject in the German nuclear industry, today. The situation in Germany concerning long term integrity of safety relevant NPP-systems and components is determined by the requirements stated in regulations and codes. They contain basic requirements for continuous precaution measures according to the current state-of-the-art starting already with the plant commissioning. This included demands for redundant safety and for surveillance measures. A continuous adjustment related to the requirements of the respective state-of-the-art is provided by the German utilities and submitted to the responsible safety authority to demonstrate an appropriate integrity status of the safety relevant systems. In Germany, no specific programme named ageing management exists. The measures concerning long term integrity of safety relevant components are performed under different names. Nevertheless, the German utilities understand that the subject 'Ageing Management' is comprehensively covered by the entirety of the different precaution and maintenance measures and regulations already established. This paper presents the existing German utility integrity concept and its sound application to ageing management issues. (authors)

  4. Right Face: Understanding German Political Developments

    Science.gov (United States)

    1994-06-16

    technology for printing an" aistr-buting informaticn and propaganda, including motion pictures , they Created a mass political awareness which broke past...1951 Lower Saxony Land.ag vote, the Party was banned by the Federal Constitutional Court in 1952,:for its direct link with the The German Rights...Westphalia NO National primarily in forbidden Offensive Bavaria & Saxony , December 1992 most members from FAP NB National Bloc neo-Nazi splinter forbidden

  5. Can German wine cooperatives compete on quality?

    Directory of Open Access Journals (Sweden)

    Schamel Guenter H.

    2015-01-01

    Full Text Available The paper analyzes how German cooperative wineries compete with private (i.e. non-cooperative wineries regarding reputation, quality categorization and varietal selection. Among the reasons why German cooperatives lag behind in terms of reputation for quality wine are organization principles of cooperatives and the difficulty to manage growers supplying grapes of different qualities. Cooperatives turn their supply of grapes into wine often classified as quality wine without much distinction. Conversely, privately owned wineries growing their own grapes may have more control over quality along their production chain and are able to produce more distinctive wines. In turn, they gain more reputation with final consumers with respect to quality. We analyze data for private and cooperative wineries from Germany. Our objective is to identify key differences in terms of reputation for quality wine production. Specifically, we look at interaction effects based on organizational form (cooperative vs. private and the German wine quality categorization (i.e. basic quality wine vs. Kabinett, Spätlese, or Auslese as well as varietal effects. We employ a hedonic pricing model to test the hypothesis that wines produced by private producers receive a reputation premium relative to cooperatives. Moreover, we hypothesize that private wineries receive a price premium relative to coopera- tives for other than basic quality wines and distinct varieties such as Riesling and Pinot Noir. The empirical analysis confirms both hypotheses. The estimated coefficients indicate that cooperatives are unable to gain quality premium for most quality cat- egories and gain price premiums only for non-distinct varieties such as Lemberger and Dornfelder. We can argue that German cooperatives are stuck in the low quality corner of the quality and variety spectrum and are currently not able to compete with private wineries in terms of quality. This result supports the observation

  6. Interaction of oxygen vacancies in yttrium germanates

    KAUST Repository

    Wang, Hao

    2012-01-01

    Forming a good Ge/dielectric interface is important to improve the electron mobility of a Ge metal oxide semiconductor field-effect transistor. A thin yttrium germanate capping layer can improve the properties of the Ge/GeO 2 system. We employ electronic structure calculations to investigate the effect of oxygen vacancies in yttrium-doped GeO 2 and the yttrium germanates Y 2Ge 2O 7 and Y 2GeO 5. The calculated densities of states indicate that dangling bonds from oxygen vacancies introduce in-gap states, but the system remains insulating. However, yttrium-doped GeO 2 becomes metallic under oxygen deficiency. Y-doped GeO 2, Y 2Ge 2O 7 and Y 2GeO 5 are calculated to be oxygen substoichiometric under low Fermi energy conditions. The use of yttrium germanates is proposed as a way to effectively passivate the Ge/dielectric interface. This journal is © 2012 the Owner Societies.

  7. German military neurosurgery at home and abroad.

    Science.gov (United States)

    Mauer, Uwe Max; Schulz, Chris; Rothe, Ronny; Kunz, Ulrich

    2010-05-01

    For many years, the experience of neurosurgeons from the German Armed Forces was limited to the peacetime care of patients in Germany. In 1995, German military neurosurgeons were deployed abroad for the first time. Since the beginning of the International Security Assistance Force mission, there has been a rapidly increasing number of opportunities for military neurosurgeons to broaden their experience during deployments abroad. Since the first deployment of a neurosurgeon to the German field hospital in Mazar-e-Sharif, Afghanistan, a total of 140 neurosurgical procedures have been performed there. Sixty-four surgeries were performed for cranial or spinal neurotrauma management. During the entire period, only 10 International Security Assistance Force members required acute or urgent neurosurgical interventions. The majority of neurosurgical procedures were performed in Afghan patients who received acute and elective treatment whenever the necessary infrastructure was available in the field hospital. Fifteen patients from the Afghan National Army and Police and 115 local patients underwent neurosurgery. Sixty-two procedures were carried out under acute or urgent conditions, and 78 operations were elective.

  8. The new German radiation protection ordinance

    International Nuclear Information System (INIS)

    Pfeffer, W.; Weimer, G.

    2003-01-01

    According to European law, the Basic Safety Standards (BSS) published by the European Council in 1996 and the Council Directive on health protection of individuals against dangers of ionising radiation in relation to medical exposure had to be transferred into national law within due time. In 2001 the new Ordinance for the Implementation of the Euratom Guidelines on Radiation Protection] was published, which replaces the old Radiation Protection Ordinance. The new German Ordinance adapts the European Directive to German law, covering the general principles but even giving more details in many fields of radiation protection. The BSS scope certainly is much broader than the prescriptions important for the field of radiation protection in nuclear power plants. According to the scope of this workshop on occupational exposure in nuclear power plants - and as the BSS most probably will be quite familiar to all of you - after a short general overview on relevant contents of the German Ordinance, this presentation will focus on the main issues important in the operation of NPP and especially on some areas which may give rise to necessary changes caused by the new Ordinance. (A.L.B.)

  9. The Litvinenko polonium-210 case - German experiences

    International Nuclear Information System (INIS)

    Kirchner, Gerald; Kroeger, Emily A.

    2008-01-01

    This paper brings together the measurement results taken and the lessons learned by the German Federal Office for Radiation Protection during the polonium-210 incident in Hamburg in late 2006. The incident was pivotal in confirming the importance of the defence against nuclear hazards in Germany and for highlighting the role of communication in the success of a deployment. The background of the case is reviewed and an overview of the German defence against nuclear hazards is given. The various measurement tasks, both at the scene and in the laboratory, and their results are summarized along with the communication challenges experienced. The main conclusions are that the traces of polonium-210 found at the sites were of little radiological consequence and the German defence against nuclear hazards in Germany delivered an excellent and measured response to the incident. However, communication challenges still exist and communication with the public and the emergency responders has to be given high priority during future deployments in order to ensure their success. (author)

  10. Learning from the Germans? History and Memory in German and European Discourses of Integration

    Directory of Open Access Journals (Sweden)

    Andrew Beattie

    2007-08-01

    Full Text Available History and memory appear to be increasingly important to discussions of European values and identity, as exemplified by references to ‘bitter experiences’ and ‘divided pasts’ in the draft EU constitution. The article takes recent suggestions that Europe could learn from German experiences of confronting multiple difficult pasts as its starting point, and considers critically what lessons those German experiences might in fact hold for ‘Europe’. It explores similarities and differences in the two integration contexts and their dominant approaches to, and assumptions about history and public memory. Specifically, it considers debates about the east-west division of the Cold War and about the place of communism and nazism in public memory. Contrary to common assumptions, the article argues that German experiences are not necessarily worth of European emulation.

  11. High alcohol consumption in Germany: results of the German National Health Interview and Examination Survey 1998.

    Science.gov (United States)

    Burger, Martina; Mensink, Gert B M

    2004-10-01

    To analyse the alcohol consumption behaviour of the German adult population, with a focus on the characteristics of persons drinking more than the tolerable upper alcohol intake level (TUAL) of 10-12 g day(-1) for healthy adult women and 20-24 g day(-1) for healthy adult men. For the German National Health Interview and Examination Survey 1998, a representative sample of free-living adults was drawn. A total of 7124 participants were interviewed comprehensively about their sociodemographic background, lifestyle and eating habits including alcohol consumption. A sub-sample of 4030 women and men, 18-79 years old, who were involved in the integrated German Nutrition Survey. About 16% of women and 31% of men had mean alcohol consumption above the TUAL. Among other factors, the inclination to exceed the TUAL was related to middle-age, high socio-economic status, smoking and use of soft drugs. Among both women and men, a high proportion of persons drinking above the TUAL was observed among those consuming low amounts of soft drinks, fruit, poultry, milk products, bread and cake/biscuits. Women preferred to drink wine, whereas men preferred to drink beer. Many Germans have an alcohol consumption level above the TUAL and thus are supposed to be at increased risk for alcohol-associated diseases.

  12. The Multi-Mission Operations Concept at the German Space Operations Center

    OpenAIRE

    Kuch, Thomas; Wickler, Martin

    2009-01-01

    The paper describes capabilities and activities of the German Space Operations Center (GSOC) which operates communication, navigation and earth observation satellites as well as Columbus, a human spaceflight mission. DLR offers its partners operations services for the different mission types on a modular basis. For many mission types DLR has the advantage to further offer the complete end-to-end services by additionally involving DLR’s Remote Sensing Data Center and several DLR research insti...

  13. Curriculum design and German student exchange for Sino-German Bachelor program majored in optoelectronics engineering

    Science.gov (United States)

    Zheng, Jihong; Fuhrmann, Thomas; Xu, Boqing; Schreiner, Rupert; Jia, Hongzhi; Zhang, Wei; Wang, Ning; Seebauer, Gudrun; Zhu, Jiyan

    2017-08-01

    Different higher education backgrounds in China and Germany led to challenges in the curriculum design at the beginning of our cooperative bachelor program in Optoelectronics Engineering. We see challenges in different subject requirements from both sides and in the German language requirements for Chinese students. The curriculum was optimized according to the ASIIN criteria, which makes it acceptable and understandable by both countries. German students are integrated into the Chinese class and get the same lectures like their Chinese colleagues. Intercultural and curriculum challenges are successfully solved. The results are summarized to provide an example for other similar international programs.

  14. Acquisition of German pluralization rules in monolingual and multilingual children

    Directory of Open Access Journals (Sweden)

    Eugen Zaretsky

    2013-10-01

    Full Text Available Existing studies on plural acquisition in German have relied on small samples and thus hardly deliver generalizable and differentiated results. Here, overgeneralizations of certain plural allomorphs and other tendencies in the acquisition of German plural markers are described on the basis of test data from 7,394 3- to 5-yearold monolingual German and bi/multilingual immigrant children tested with a modified, validated version of the Marburger Sprachscreening (MSS language test and 476 children tested with the SETK 3-5 language test. Classified correct and wrong answers to MSS and SETK 3-5 plural items were compared. The acquisition patterns of immigrants corresponded to those of younger German children. Both monolingual German and immigrant children demonstrated generally the same universal frequency and phonetically/phonologically based error patterns, irrespective of their linguistic background, but with different tendencies such as overgeneralization of -s by German children only.

  15. MACH MIT: Deutsches Wochenende am Karlsfluss (MACH MIT: a German Week-End on the Charles River).

    Science.gov (United States)

    Reizes, Sonia; Kramsch, Claire J.

    1980-01-01

    Describes a joint high school/college pilot program planned by Massachusetts foreign language teachers and hosted by M.I.T. The success of the program dubbed "MACH MIT Total Immersion German Weekend" is attributed to the concept of active involvement, which was implemented through games, seminars, shows, cooking and other activities.…

  16. Challenges of German Land Forces 2030 and Beyond

    Science.gov (United States)

    2011-03-24

    Alexander von Humboldt Foundation, the Institute for Foreign Cultural Relations, and the German Commission of the United Nations Educational, Scientific...only in war but also in full spectrum operations gives Carl von Clausewitz a timeless relevance. 15. SUBJECT TERMS German Strategy, Bundeswehr...Land Forces as an important means of German policy toward achieving political ends not only in war but also in full spectrum operations gives Carl von

  17. Optical Properties of Tm(3+) Ions in Alkali Germanate Glass

    Science.gov (United States)

    Walsh, Brian M.; Barnes, Norman P.; Reichle, Donald J.; Jiang, Shibin

    2006-01-01

    Tm-doped alkali germanate glass is investigated for use as a laser material. Spectroscopic investigations of bulk Tm-doped germanate glass are reported for the absorption, emission and luminescence decay. Tm:germanate shows promise as a fiber laser when pumped with 0.792 m diodes because of low phonon energies. Spectroscopic analysis indicates low nonradiative quenching and pulsed laser performance studies confirm this prediction by showing a quantum efficiency of 1.69.

  18. Short Takes: Intelligence-Service Psychology: A German Perspective

    Directory of Open Access Journals (Sweden)

    Dr. Helmut Müller-Enbergs

    2008-01-01

    Full Text Available To date, four German volumes in the series "Intelligence-Service Psychology" (Nachrichtendienstpsychologie have been published. These volumes generated interest in both the German and non-German speaking communities. It was therefore decided to translate some of the basic articles of the series into English (Litzcke, Müller-Enbergs & Ungerer, 2008, making them accessible to a wider range of readers. This article contains abbreviated versions of the articles in the book.

  19. Radiation exposure in German nuclear power plants

    International Nuclear Information System (INIS)

    Mueller, W.

    1981-01-01

    The individual and collective doses in German nuclear power stations have decreased remarkably since the beginning of the commercial nuclear power production. The paper discusses the influencing factors, that have caused this development and points out areas where improvements are possible in the future. Moreover the interaction between radiation protection practice and the relevant legal regulations is considered. Usually the recording of job related doses is regarded as the most direct access to possible improvements. Concluding, it is therefore demonstrated by some examples how the evaluation of such information has taken effect in practice. (orig.) [de

  20. Fifth French-German Conference on Optimization

    CERN Document Server

    1989-01-01

    The 2-yearly French-German Conferences on Optimization review the state-of-the-art and the trends in the field. The proceedings of the Fifth Conference include papers on projective methods in linear programming (special session at the conference), nonsmooth optimization, two-level optimization, multiobjective optimization, partial inverse method, variational convergence, Newton type algorithms and flows and on practical applications of optimization. A. Ioffe and J.-Ph. Vial have contributed survey papers on, respectively second order optimality conditions and projective methods in linear programming.

  1. The German energy landscape in 2015

    International Nuclear Information System (INIS)

    Lauer, Hartmut

    2016-01-01

    This article proposes a brief overview of the German energy sector: stagnation of primary energy consumption, shares of the different energy sources (renewable, coal, lignite, oil, gas, nuclear), shares of the different electric power production sources and their recent evolution. It evokes issues related to the objectives defined for energy transition, the high level of renewable energy production and the high level of power exports. It outlines that consumption must be reduced to reach the objectives defined for 2020. It notices a stagnation of the energy system de-carbonation, and comments the evolution of electricity prices

  2. Heisenberg and the German atomic project

    International Nuclear Information System (INIS)

    Hermann, A.

    1988-01-01

    The discovery of nuclear fusion 50 years ago, man's entry into the new atomic age, occurred in a fateful era, marked by the Munich Agreement shortly before and the outbreak of World War II shortly afterwards. Werner Heisenberg, Germany's Number One Physicist, was, on the one hand, respected as a competent and 'useful' theoretician, but on the other, was reviled as a 'white Jew, the spirit of Einstein's spirit'. He plays a key role in answering the question of whether research at that time could have resulted in a German atomic bomb. (orig.) [de

  3. Availability Improvement of German Nuclear Power Plants

    International Nuclear Information System (INIS)

    Wilhelm, Oliver

    2008-01-01

    High availability is important for the safety and economical performance of Nuclear Power Plants (NPP). The strategy for availability improvement in a typical German PWR shall be discussed here. Key parameters for strategy development are plant design, availability of safety systems, component reliability, preventive maintenance and outage organization. Plant design, availability of safety systems and component reliability are to a greater extent given parameters that can hardly be influenced after the construction of the plant. But they set the frame for maintenance and outage organisation which have shown to have a large influence on the availability of the plant. (author)

  4. German military medicine: missions and innovations.

    Science.gov (United States)

    Harms, D

    1999-05-01

    The German military medical service's foremost task in peacetime is to train and prepare medical personnel for their tasks in wartime. To this end, six medical subservices have been formed. They provide inpatient and outpatient care for the assigned military formations. Medical support for the reaction forces follows the principles of "operational medicine," which is provided in three qualitatively coordinated medical support levels. These support levels from the "lifesaving chain" for Bundeswehr soldiers deployed abroad, who are entitled to receive medical care that corresponds to the medical standard in Germany.

  5. The German Environmentalist Party - The Greens

    International Nuclear Information System (INIS)

    Mettke, J.R.

    1982-01-01

    The Greens are winning supporters throughout the FRG, quite a few of them are already members of the parliament of various lands. Will they cooperate with the established political parties in Bonn. Will they take over from the Free Democrats the role of holding the balance of power. In this book, Spiegel editors present their analyses of the changing concepts of the new political movement. The most outstanding members of the Environmentalist Party - the so-called Greens - define their position and state their opinions on the problems of coalition forming, and prominent members of the parties of the German Bundestag answer these statements. (orig.) [de

  6. [Poet-physicians in German literature].

    Science.gov (United States)

    Perels, C

    1991-12-17

    Starting with standards arising from the relationship between medicine and art in classical antiquity, biblical tradition and teutonic-pagan antiquity, this article roams through german literature from the Middle Ages up to the 20th century, from Hildegard of Bingen to Gottfried Benn and Alfred Döblin, guided by the question, how strongly medical knowledge and medical practise are reflected in the poetry of writing physicians. Individual dispositions and epoque-specific features are discussed. Special attention is given to Paul Fleming and Angelus Silesius, Albrecht von Haller and Friedrich Schiller, romanticism and Georg Büchner.

  7. Ageing management in German nuclear power plants

    International Nuclear Information System (INIS)

    Becker, D.E.; Reiner, M.

    1998-01-01

    In Germany, the term 'ageing management' comprises several aspects. A demand for a special ageing monitoring programme is not explicitly contained in the regulations. However, from the Atomic Energy Act and its regulations results the operator's obligation to perform extensive measures to maintain the quality of the plant and the operating personnel working in the plant. From this point of view, comprehensive ageing management in German nuclear power plants has taken place right from the start under the generic term of quality assurance. (author)

  8. German contributions to the CMS computing infrastructure

    International Nuclear Information System (INIS)

    Scheurer, A

    2010-01-01

    The CMS computing model anticipates various hierarchically linked tier centres to counter the challenges provided by the enormous amounts of data which will be collected by the CMS detector at the Large Hadron Collider, LHC, at CERN. During the past years, various computing exercises were performed to test the readiness of the computing infrastructure, the Grid middleware and the experiment's software for the startup of the LHC which took place in September 2008. In Germany, several tier sites are set up to allow for an efficient and reliable way to simulate possible physics processes as well as to reprocess, analyse and interpret the numerous stored collision events of the experiment. It will be shown that the German computing sites played an important role during the experiment's preparation phase and during data-taking of CMS and, therefore, scientific groups in Germany will be ready to compete for discoveries in this new era of particle physics. This presentation focuses on the German Tier-1 centre GridKa, located at Forschungszentrum Karlsruhe, the German CMS Tier-2 federation DESY/RWTH with installations at the University of Aachen and the research centre DESY. In addition, various local computing resources in Aachen, Hamburg and Karlsruhe are briefly introduced as well. It will be shown that an excellent cooperation between the different German institutions and physicists led to well established computing sites which cover all parts of the CMS computing model. Therefore, the following topics are discussed and the achieved goals and the gained knowledge are depicted: data management and distribution among the different tier sites, Grid-based Monte Carlo production at the Tier-2 as well as Grid-based and locally submitted inhomogeneous user analyses at the Tier-3s. Another important task is to ensure a proper and reliable operation 24 hours a day, especially during the time of data-taking. For this purpose, the meta-monitoring tool 'HappyFace', which was

  9. German-Egyptian seminar on environmental research

    International Nuclear Information System (INIS)

    Aly, H.F.; Nentwich, D.

    1994-01-01

    Industrial development and scientific advancement have opened new frontiers of interest and challenges. Anthropogenic activities are increasingly upsetting the natural environmental balance and are at the same time shifting from local impact to global importance. Science is confronted with the challenge to answer the question of what are the consequences of anthropogenic changes to the environment and to help politics formulate countermeasures for the sake of a sustainable future. Protect results achieved within the Egyptian-German cooperation were presented to the scientific community and to the interested public and discussions on future lines of actions took place. (orig./KW)

  10. German radionuclide exports and imports 1990

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    The statistics compiled by the German Federal Office for Trade and Industry (Bundesamt fuer Wirtschaft) for the Federal Ministry for the Environment, Conservation of Nature, and Reactor Protection of imports and exports of radionuclides, irradiation samples and sealed emitters above 1850 GBq show a slight decline by 11.8%, on the basis of activity, in imports and a somewhat higher rise by 21.6% in exports in 1990. Imports returned to the level of 1988 after having experienced an extraordinary rise in 1989. Exports were slightly better than in the previous year, but still considerably below the average of the past five years. (orig.) [de

  11. Germans or Jews? German-Speaking Jews in Post-War Europe: An Introduction

    Czech Academy of Sciences Publication Activity Database

    Čapková, Kateřina; Rechter, D.

    2017-01-01

    Roč. 62, November (2017), s. 69-74 ISSN 0075-8744 Institutional support: RVO:68378114 Keywords : Jews * Germans * post- war period Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) https://academic.oup.com/leobaeck/issue/volume/62?browseBy=volume

  12. Islamophobia? The German Discussion about Islamophobia

    Directory of Open Access Journals (Sweden)

    Astrid Bötticher

    2009-08-01

    Full Text Available Islamophobia is a term which is relatively new in the world of social science; it is a neologism. Kofi Annan has warned about it but there is not a clear, undoubted concept to it yet – and it is questionable if there ever will be, especially if one looks into the German controversy about the term. The German discussion is not unique though, and must fall into the pattern of wider, European discussion about the Islamic minority. Prominent figures of Islamic hatred in Europe are for instance Oriana Fallaci and Brigitte Bardot. Against them, there stands a more liberal community that does not want to follow the language of violence and hatred. Two different standpoints are the main poles of discussion. One group wants to use Islamophobia as a concept, the other group opposes the term. In between, there is the scientific concept of Islamophobia that is threatened to be pulverized before it is even fully conceptualized. In the middle position there are also intellectuals known as Islamic reformers who argue that Islamophobia should be replaced by the term Islam-critique.

  13. Limitation of medical research in German law.

    Science.gov (United States)

    Deutsch, Erwin

    2005-01-01

    In Germany, pharmaceutical trials and the testing of medical devices is regulated by statute. Any other kind of medical experimentation is handled according to the Declaration of Helsinki. Medical experimentation has to be reviewed by an ethics committee before the start and there has to be an elaborate research protocol, which provides for the protection of the experimental subject. In case of an accident, there is compulsory accident insurance as far as pharmaceutical trials and the testing of medical devices are concerned. The third party accident insurance just covers material loss, there is no provision paying and suffering. The sum paid by the insurance company is set off against damages for negligence. There is no strict liability for medical experimentation, but the German courts are expected to set very high standards for medical care in experimentation. The data protection and medical confidentiality have been lessened because of the European law that requires the experimental subject to give his consent to the inspection of the data or the file and if he takes part in the experimentation, that his data and some of his cells might be with the pharmaceutical company forever. In general, the German law seems to be adequate to the protection of experimental subjects.

  14. Evolution of the German energy policy

    International Nuclear Information System (INIS)

    Audigier, Pierre

    2013-01-01

    The author first recalls the main events and decisions regarding the German policy from 1998 to 2011, and notably the decisions related to nuclear energy. He gives the main data of the German energy system (production capacity, production of the different primary sources) and indicates the main characteristics and assumptions of the 2011 turnaround (decision of shutting down 17 nuclear plants by 2022, objectives in terms of renewable energy production and share, of electricity consumption, and of greenhouse gas emission). The author then presents how the law on renewable energies (EEG) operates, indicates energy prices in Germany for individuals and industries and CO 2 emissions per electric sector, and compares them with the French ones. He outlines the need of construction of new energy transport lines, and identifies and comments other implications of the intermittent character of renewable energies in terms of electricity market organisation, of construction of combustion-based thermal plants, and of flexibility requirements. He discusses successes and difficulties of this evolution of energy policy, and the implication of this new policy for the European Union and for border countries

  15. Apitherapy: Usage and Experience in German Beekeepers

    Directory of Open Access Journals (Sweden)

    Markus Hellner

    2008-01-01

    Full Text Available This study aimed to investigate the practice of apitherapy - using bee products such as honey, pollen, propolis, royal jelly and bee venom to prevent or treat illness and promote healing - among German beekeepers and to evaluate their experiences with these therapies. A questionnaire incorporating two instruments on beekeepers’ physical and mental health and working practice was included in three German beekeeping journals and readers were asked to complete it. The instrument included questions on the use of apitherapy. Simple descriptive methods, bivariate correlation, cross-tabulation and one-way ANOVA were used to analyze the data. Altogether 1059 completed questionnaires were received. The beekeepers reported the most effective and favorable therapeutic effects with honey, followed by propolis, pollen and royal jelly. The factors associated with successful experiences were: age, number of hives tended, health consciousness, positive experiences with one product and self-administration of treatment. Beekeepers were asked for which condition they would employ propolis and pollen. They reported that they used propolis most frequently to treat colds, wounds and burns, sore throats, gum disorders and also as a general prophylactic, while pollen was most commonly used as a general prophylactic and, less frequently, in treating prostate diseases. No adverse experiences were reported. The potential benefit of bee products is supported by the positive experiences of a large group of beekeepers who use some of these products to treat a wide range of conditions. The indications and treatments given here may be important in selecting bee products and designing future trials.

  16. An important role of a pyrethroid-sensing residue F1519 in the action of the N-alkylamide insecticide BTG 502 on the cockroach sodium channel.

    Science.gov (United States)

    Du, Yuzhe; Khambay, Bhupinder; Dong, Ke

    2011-07-01

    Deltamethrin, a pyrethroid insecticide, and BTG 502, an alkylamide insecticide, target voltage-gated sodium channels. Deltamethrin binds to a unique receptor site and causes prolonged opening of sodium channels by inhibiting deactivation and inactivation. Previous (22)Na(+) influx and receptor binding assays using mouse brain synaptoneurosomes showed that BTG 502 antagonized the binding and action of batrachotoxin (BTX), a site 2 sodium channel neurotoxin. However, the effect of BTG 502 has not been examined directly on sodium channels expressed in Xenopus oocytes. In this study, we examined the effect of BTG 502 on wild-type and mutant cockroach sodium channels expressed in Xenopus oocytes. Toxin competition experiments confirmed that BTG 502 antagonizes the action of BTX and possibly shares a common receptor site with BTX. However, unlike BTX which causes persistent activation of sodium channels, BTG 502 reduces the amplitude of peak sodium current. A previous study showed that BTG 502 was more toxic to pyrethroid-resistant house flies possessing a super-kdr (knockdown resistance) mechanism than to pyrethroid-susceptible house flies. However, we found that the cockroach sodium channels carrying the equivalent super-kdr mutations (M918T and L1014F) were not more sensitive to BTG 502 than the wild-type channel. Instead, a kdr mutation, F1519I, which reduces pyrethroid binding, abolished the action of BTG 502. These results provide evidence the actions of alkylamide and pyrethroid insecticides require a common sodium channel residue. Copyright © 2011 Elsevier Ltd. All rights reserved.

  17. Evaluation of Some Plant Essential Oils against the Brown-Banded Cockroach, Supella longipalpa (Blattaria: Ectobiidae): A Mechanical Vector of Human Pathogens

    Science.gov (United States)

    Sharififard, Mona; Safdari, Farhad; Siahpoush, Amir; Kassiri, Hamid

    2016-01-01

    Background: Essential oils, as secondary plant compounds, present a safer alternative to conventional insecticides in insect control programs. So five essential oils including eucalyptus, mint, yarrow, oregano and rosemary oils were evaluated against the brown-banded cockroach Supella longipalpa. Methods: Evaluation was done against the 3rd and 4th instar nymphs using three bioassay methods; continuous contact toxicity, fumigant toxicity and repellent activity. The study was done in the laboratory of medical entomology, during April 2012 to September 2013. Results: Mortality rates by the lowest concentration (2.5%) of rosemary, oregano, yarrow, eucalyptus and mint oils were 100%, 62.2%, 45 %, 36.2% and 5.2% at 24 h after exposure respectively. Rosemary oil was determined as the most toxic oil because of 100 % mortality rate at the concentration range of 2.5% to 30%. The lowest fumigation effect using 50 μl/L air was recorded from mint oil with 97.2 % mortality after 24 h, while the other oils caused 100% mortality. The most repel activity was related to oregano oil which showed 96.5–99.1% repellency at the concentration range of 2.5–30% with a residual effect lasting at least a week after treatment. Conclusion: Oregano oil could be used as a potential repellent against S. longipalpa. Also, all five essential oils could be used as the safe compounds for surface treating or fumigation in cockroach control programs while rosmary and oregano oils exhibited the most toxicity. PMID:28032105

  18. Evaluation of Some Plant Essential Oils against the Brown-banded Cock-roach, Supella longipalpa (Blattaria: Ectobiidae, A Mechanical Vector of Human Pathogens

    Directory of Open Access Journals (Sweden)

    Mona Sharififard

    2016-10-01

    Full Text Available Background: Essential oils, as secondary plant compounds, present a safer alternative to conventional insecticides in insect control programs. So five essential oils including eucalyptus, mint, yarrow, oregano and rosemary oils were evaluated against the brown-banded cockroach Supella longipalpa.Methods: Evaluation was done against the 3rd and 4th instar nymphs using three bioassay methods; continuous con­tact toxicity, fumigant toxicity and repellent activity. The study was done in the laboratory of medical entomology, during April 2012 to September 2013.Results: Mortality rates by the lowest concentration (2.5% of rosemary, oregano, yarrow, eucalyptus and mint oils were 100%, 62.2%, 45 %, 36.2% and 5.2% at 24 h after exposure respectively. Rosemary oil was determined as the most toxic oil because of 100 % mortality rate at the concentration range of 2.5% to 30%. The lowest fumigation effect using 50 µl /L air was recorded from mint oil with 97.2 % mortality after 24 h, while the other oils caused 100% mortality. The most repel activity was related to oregano oil which showed 96.5–99.1% repellency at the con­centration range of 2.5–30% with a residual effect lasting at least a week after treatment.Conclusion: Oregano oil could be used as a potential repellent against S. longipalpa. Also, all five essential oils could be used as the safe compounds for surface treating or fumigation in cockroach control programs while rosmary and oregano oils exhibited the most toxicity.

  19. Current status of the EPR (european pressurized reactor) program developed jointly by german and French nuclear industry

    International Nuclear Information System (INIS)

    Pouget-abadie, X.; Lallier, M.; Lauret, P.; Schneider, D.

    2000-01-01

    The Basic Design of the EPR is now completed and all the tasks, which were foreseen as part of this franco-german cooperation, came to a conclusion. At the origin of this project was the common decision in 1989 of Framatome and Siemens to cooperate through NPI, to design the Nuclear Island which meets the future needs of utilities. EDF and a group of the main German Utilities joined this cooperation in 1991 and since then have been totally involved to the progress of the the work. In addition, all the process was backed up to the end of 1998 by the strong cooperation between the French and the German Safety Authorities which have a long lasting cooperation to define common requirements which have to be applied to future Nuclear Power Plant. end of 2000, the French Safety Authorities are expected to issue their final recommendations

  20. American and German students' knowledge, perceptions, and behaviors with respect to over-the-counter pain relievers.

    Science.gov (United States)

    Hanoch, Yaniv; Katsikopoulos, Konstantinos V; Gummerum, Michaela; Brass, Eric P

    2007-11-01

    To better understand the knowledge base and perceptions involved in the decision to buy and use over-the-counter pain relievers (OTCPRs) by taking into account the environment in which these decisions are made. The authors expected that the differences in access and marketing would affect knowledge and decision making related to OTCPRs in the United States and Germany. A survey was given to 108 undergraduate university students in the United States and Germany (58 and 50 participants, respectively). The authors found that significantly more Americans than Germans take OTCPRs and that they also take significantly more OTCPRs. Americans exhibited less knowledge about side effects than their German counterparts. When asked when they consulted package labels, Americans reported they were more likely to do so before buying a product, whereas Germans reported consulting labels before taking OTCPRs for the first time. Package labels affected more Americans' decisions to purchase OTCPRs; Americans were also less likely to consult a doctor when feeling pain but more likely to take OTCPRs. Finally, Americans viewed OTCPRs as riskier after their status changed from prescription only to over the counter, whereas Germans believed they posed less risk. This study analyzed health-related behavior by looking at how environmental factors shape decision processes related to over-the-counter drug use. The results indicate that looking at environmental factors does help to explain differences in knowledge, perceptions, and behaviors among German and American students. (PsycINFO Database Record (c) 2007 APA, all rights reserved).

  1. Peer Effects and Academics’ Industry Involvement

    DEFF Research Database (Denmark)

    Aschhoff, Birgit; Grimpe, Christoph

    This study explores the interaction between professional imprinting and age in the context of industry-science collaboration. Specifically, we examine the impact of localized and personal peer effects on academics’ involvement with industry and how these effects are moderated by the career age...... of the scientist. We suggest that both localized and personal peer effects drive industry involvement but that the effects from such imprinting are more pronounced for younger researchers, suggesting that professional imprinting takes place in the early stages of a scientist’s academic career. Based on a sample...... of 330 German academics in the field of biotechnology and publication data from the Science Citation Index Expanded (SCIE), we find that scientists with industry-oriented co-authors are more likely to be involved with industry (personal peer effect). Moreover, we find that the scientist’s involvement...

  2. German-English-Speaking Children's Mixed NPs with "Correct" Agreement

    Science.gov (United States)

    Jorschick, Liane; Quick, Antje Endesfelder; Glasser, Dana; Lieven, Elena; Tomasello, Michael

    2011-01-01

    Previous research has reported that bilingual children sometimes produce mixed noun phrases with "correct" gender agreement--as in "der dog" ("der" being a masculine determiner in German and the German word for "dog", "hund", being masculine as well). However, these could obviously be due to chance or to the indiscriminate use of a default…

  3. Analysis of High School German Textbooks through Rasch Measurement Model

    Science.gov (United States)

    Batdi, Veli; Elaldi, Senel

    2016-01-01

    The purpose of the present study is to analyze German teacher trainers' views on high school German textbooks through the Rasch measurement model. A survey research design was employed and study group consisted of a total of 21 teacher trainers, three from each region and selected randomly from provinces which are located in seven regions and…

  4. Acquisition of German Pluralization Rules in Monolingual and Multilingual Children

    Science.gov (United States)

    Zaretsky, Eugen; Lange, Benjamin P.; Euler, Harald A.; Neumann, Katrin

    2013-01-01

    Existing studies on plural acquisition in German have relied on small samples and thus hardly deliver generalizable and differentiated results. Here, overgeneralizations of certain plural allomorphs and other tendencies in the acquisition of German plural markers are described on the basis of test data from 7,394 3- to 5-year-old monolingual…

  5. Generational Aspects of German National Socialism, 1919-33.

    Science.gov (United States)

    Madden, Paul

    1982-01-01

    Examines the theory that pre-Hitler Nazism was part of a generational revolt. Research shows that, among new recruits to the National Socialist German Workers Party in that period, there were more than twice as many who were under 30 years old. Socioeconomic and historical factors which made Nazism attractive to German youth are discussed. (AM)

  6. 'Good Hunting': German submarine offensives and South African ...

    African Journals Online (AJOL)

    By the latter half of 1942, the High Command of the German U-boats (BdU) realised that the 'sinking results' of the North Atlantic had decreased immensely. The successes of the Allied anti-submarine operations in the North Atlantic precluded the successful employment of the German submarines in said waters.

  7. Stuttering Characteristics of German-English Bilingual Speakers

    Science.gov (United States)

    Schafer, Martina; Robb, Michael P.

    2012-01-01

    The purpose of this study was to examine stuttering behavior in German-English bilingual people who stutter (PWS), with particular reference to the frequency of stuttering on content and function words. Fifteen bilingual PWS were sampled who spoke German as the first language (L1) and English as a second language (L2). Conversational speech was…

  8. German Television in the U.S. and Abroad

    Science.gov (United States)

    Ecke, Peter

    2008-01-01

    In this article, I review the options that teachers and students have to obtain German TV in the U.S.: through satellite and cable networks and by streaming, downloading, or recording TV programs through the internet. I also address how one can access TV programs over the air in the German-speaking countries by using a notebook PC and TV card.

  9. German Television in the United States and Abroad

    Science.gov (United States)

    Ecke, Peter

    2008-01-01

    In this article, I review the options that teachers and students have to obtain German TV in the U.S.: through satellite and cable networks and by streaming, downloading, or recording TV programs through the internet. I also address how one can access TV programs over the air in the German-speaking countries by using a notebook PC and TV card.

  10. On the contrast between Germanic and Romance negated quantifiers

    NARCIS (Netherlands)

    Cirillo, R.

    2009-01-01

    Universal quantifiers can be stranded in the manner described by Sportiche (1988), Giusti (1990) and Shlonsky (1991) in both the Romance and Germanic languages, but a negated universal quantifier can only be stranded in the Germanic languages. The goal of this paper is to show that this contrast

  11. Business Interests and the Development of the German Welfare State

    DEFF Research Database (Denmark)

    Paster, Thomas

    2016-01-01

    the core of the model of the ‘Bismarckian welfare state’, for which Germany became the prototype. After giving a brief overview of the main characteristics of the German welfare state and its historical origins, the chapter analyses the attitudes of German employers towards the adoption of these four...

  12. Russian regional elections from German mass media viewpoints

    OpenAIRE

    Krasilnikova, Oxana; Красильникова, Оксана

    2013-01-01

    The author provides a comparative analysis of the German media publications on the regional elections in 2012 and municipal elections of 2010 in Russia. Basing on the study material general conclusions are made on the development of electoral democracy in Russia from the German media point of view.

  13. The German contribution to South African librarianship | van der ...

    African Journals Online (AJOL)

    This article deals with the contribution of the German community in the Cape to the development of librarianship in South Africa during the eighteenth, nineteenth and twentieth centuries. The influence and important role of certain German nationals have their origins before the onset of the nineteenth century when they had ...

  14. The Germanic loanwords in Proto-Slavic : origin and accentuation

    NARCIS (Netherlands)

    Pronk-Tiethoff, Saskia Elisabeth

    2012-01-01

    This dissertation provides a thorough review of the words belonging to the oldest layer of Germanic loanwords in Proto-Slavic and answers the question of how these words were adapted to the Proto-Slavic accentual system. The dissertation contains a corpus of 78 words that can be regarded as Germanic

  15. An empirical analysis of the German interest rate

    NARCIS (Netherlands)

    den Butter, F.A.G.; Jansen, P.W.

    2004-01-01

    The short run and long run influences of the main determinants of the German long-term interest rate are estimated using quarterly data for the period 1982-2001. A major reason for the focus on the German interest rate is that this rate, and hence its determinants, will be dominant in explaining the

  16. Univariate characterization of the German business cycle 1955-1994

    OpenAIRE

    Weihs, Claus; Garczarek, Ursula

    2002-01-01

    We present a descriptive analysis of stylized facts for the German business cycle. We demonstrate that simple ad-hoc instructions for identifying univariate rules characterizing the German business cycle 1955-1994 lead to an error rate comparable to standard multivariate methods.

  17. German Machine Building: A New Benchmark before World War I

    NARCIS (Netherlands)

    Fremdling, Rainer

    2009-01-01

    The figure most commonly used as benchmark for the output of machinery before WW I is based on an estimate by the Association of German Machinery Producers (VDMA). It estimated that all German firms in total had sold machines worth 2800 million Marks in 1913.Using a recently detected detailed

  18. The Social Stratification of the German VET System

    Science.gov (United States)

    Protsch, Paula; Solga, Heike

    2016-01-01

    Germany is widely known for its vocational education and training (VET) system and its dual apprenticeship system in particular. What is often overlooked, however, is the vertical stratification within the German VET system. This is the focus of this study. Our analysis shows that the VET system, like the German school system, is highly…

  19. Creating a German–Basque Electronic Dictionary for German ...

    African Journals Online (AJOL)

    user

    lowing years, a series of studies about teaching German to Basque-L1 learners appeared (Braun 2010, Reuter 2010, Wolff 2010). German teachers in the Basque. Country have all made the same experience: Regardless of the teacher having recommended the use of monolingual dictionaries, learners stick to bilinguals,.

  20. German Libraries and Scientific and Technical Information in Nazi Germany.

    Science.gov (United States)

    Richards, Pamela Spence

    1985-01-01

    Review of development of German scientific and technical information network highlights scientific and technical libraries before World War I, the 1920s, effects of National Socialist rise to power, restriction of foreign acquisitions, technological university and wartime activities at Berlin-Charlottenburg, documentation movement, German Society…

  1. Russian-German research and academic cooperation in the Arctic

    Directory of Open Access Journals (Sweden)

    Dmitriyev Vasily

    2011-03-01

    Full Text Available This article is dedicated to the stages of development of international research cooperation in the framework of research and education projects focusing on the study of marine and polar territories of the Russian Federation and the Federative Republic of Germany. The largest and most stable projects are the establishment of the Russian-German laboratory of polar and marine research named after the Russian polar explorer of German origin, Otto Schmidt, — OSL — on the premises of AARI, the Russian-German education project — the Applied polar and marine studies master's programme (POMOR — implemented by the Russian and German partners at Saint Petersburg State University, and the Laptev Sea system research programme bringing together around 20 Russian and German organisations.

  2. Revitalization of ethnic identity among the Germans in Sremski Karlovci

    Directory of Open Access Journals (Sweden)

    Krel Aleksandar

    2009-01-01

    Full Text Available During the 1990's, many members of the German national minority have awaken from the several decades long sleep in 'ethnic hibernation'. Several associations have been founded at that time, with an aim to gather and encourage ethnic feelings of the Germans living in Vojvodina. These associations work toward revitalization and reconstruction of the German ethnic and cultural identity. There are quite a few of such institutions today, and one of them is German association promoting good neighbor relations Karlowitz, Sremski Karlovci. This paper will discuss transformation of an ethnic identity strategy among the Germans in Sremski Karlovci; in addition, I will analyze modus operandi by which this local association aims at keeping and encouraging certain elements of the ethnic and cultural particulars. The results of the research point out how a relatively small group, without social power, can define and redefine its own identity, in regards to historical, social and economic conditions.

  3. Dietary iron intake and iron status of German female vegans: results of the German vegan study.

    Science.gov (United States)

    Waldmann, Annika; Koschizke, Jochen W; Leitzmann, Claus; Hahn, Andreas

    2004-01-01

    As shown in previous studies vegetarians and especially vegans are at risk for iron deficiency. Our study evaluated the iron status of German female vegans. In this cross-sectional study, the dietary intakes of 75 vegan women were assessed by two 9-day food frequency questionnaires. The iron status was analyzed on the basis of blood parameters. Mean daily iron intake was higher than recommended by the German Nutrition Society. Still 42% of the female vegans or = 50 years (old women, OW). In all, 40% (tri-index model (TIM) 20%) of the YW and 12% (TIM 12%) of the OW were considered iron-deficient based on either serum ferritin levels of vegan diet should have their iron status monitored and should consider taking iron supplements in case of a marginal status. Copyright 2004 S. Karger AG, Basel

  4. German nuclear fuel exports and imports 1990

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    The statistics compiled by the German Federal Office for Trade and Industry (Bundesamt fuer Wirtschaft) for the Federal Ministry for the Environment, Conservation of Nature, and Reactor Safety of imports and exports of nuclear fuels and source materials in 1990 show a major rise by 46.3% in imports and a pronounced drop by 44.3% in exports, compared to the levels in the previous year. Source material for the purposes of the statistics refers only to uranium concentrate. Quantitatively, the biggest import items are source materials, depleted uranium, and uranium enriched 3% to 10%. Exports of unirradiated material quantitatively comprise mainly depleted uranium, source materials, and uranium enriched up to 10%. (orig.) [de

  5. German nuclear fuel exports and imports 1991

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    The statistics compiled by the German Federal Office for Trade and Industry (Bundesamt fuer Wirtschaft) for the Federal Ministry for the Environment, Conservation of Nature, and Reactor Safety of imports and exports of nuclear fuels and source materials in 1991 show a major drop by 33.8% in imports and a pronounced rise by 191.5% in exports, compared to the levels in the previous year. Source material for the purposes of these statistics refers only to uranium concentrate. Quantitatively, the biggest import items are source materials, depleted uranium, and uranium enriched up to 3%. Exports of unirradiated material quantitatively comprise mainly depleted uranium, source material, and uranium enriched up to 10%. (orig.) [de

  6. SPOKEN BAHASA INDONESIA BY GERMAN STUDENTS

    Directory of Open Access Journals (Sweden)

    I Nengah Sudipa

    2014-11-01

    Full Text Available This article investigates the spoken ability for German students using Bahasa Indonesia (BI. They have studied it for six weeks in IBSN Program at Udayana University, Bali-Indonesia. The data was collected at the time the students sat for the mid-term oral test and was further analyzed with reference to the standard usage of BI. The result suggests that most students managed to express several concepts related to (1 LOCATION; (2 TIME; (3 TRANSPORT; (4 PURPOSE; (5 TRANSACTION; (6 IMPRESSION; (7 REASON; (8 FOOD AND BEVERAGE, and (9 NUMBER AND PERSON. The only problem few students might encounter is due to the influence from their own language system called interference, especially in word order.

  7. Alexander Klein: German in the Makhnovist movement

    Directory of Open Access Journals (Sweden)

    Arkhireyskyi, D. V.

    2015-05-01

    Full Text Available Highlights the life of Alexander Klein, a descendant of German colonists, Makhno’s active insurgency. Analyzed the possible reasons for his joining the group of anarchists Huliaipole. Participating of O. Kleyn in detachments of the Black household troops in southern Ukraine on verge of 1917–1918 is examined. The battle way of insurgent in the soldiery formings of army of N. Makhno is traced. His participating in all the most important campaigns and battle of insurgent army inclusive to the day of death in August 1921 lights up. The most interesting events of revolutionary war, this insurgent commander took part in which, are considered. Confirmed A. Kleyn loyalty, in spite of his national belonging, and the ideals of the Makhnovist insurgency.

  8. Enteric methane emissions from German pigs

    DEFF Research Database (Denmark)

    Dämmgen, Ulrich; Schulz, Joachim; Klausing, Heinrich Kleine

    2012-01-01

    Methane emissions from enteric fermentation of pigs are object of emission reporting. Hitherto they were treated as part of the energy balance of pigs, in accordance with IPCC guidance documents. They were calculated from the gross energy intake rate and a constant methane conversion ratio....... Meanwhile numerous experimental data on methane emissions from enteric fermentation is available in Germany and abroad; the results are compiled in this work. These results also allow for a description of transformation processes in the hind gut and a subsequent establishment of models that relate emissions...... to feed and performance data. The model by Kirchgeßner et al. (1995) is based on German experimental data and reflects typical national diet compositions. It is used to quantify typical emissions and methane conversion ratios. The results agree with other experimental findings at home and abroad...

  9. A glance on the German energy policy

    International Nuclear Information System (INIS)

    Audigier, Pierre

    2012-01-01

    As Germany has decided to phase out nuclear by 2022 while aiming at ambitious objectives in terms of energy savings and reduction of greenhouse gas emissions, this report first highlights the interest of such an energy transition. It discusses the immediate consequences of the shutting down of the first eight reactors. It gives an overview of the German energy mix and discusses the objectives and challenges of the energy policy, and how this policy is implemented (by restructuring the electric grid, by building flame-based thermal power stations, by searching for a solution for electricity mass storage, by creating the conditions of an efficient energy saving policy). It discusses the consequences of this policy for the European and French energy policy

  10. German standard and German X-ray guide lines as a guide for quality assurance in X-ray diagnosis

    International Nuclear Information System (INIS)

    Pychlau, P.

    1985-01-01

    The German standard DIN 6868 (in preparation) and parts of the German X-ray Ordinance of 1973 deal with quality assurance in X-ray diagnosis. It is shown that both documents support each other and are a guidance for daily work. (author)

  11. Occurrence of hypercementosis in a German population.

    Science.gov (United States)

    Bürklein, Sebastian; Jansen, Sabine; Schäfer, Edgar

    2012-12-01

    The purpose of this study was to assess the occurrence of hypercementosis in a selected German dental school patient population. A total of 800 full-mouth periapical radiographic series were screened. The radiographs were evaluated under optimal conditions by using double magnifying glasses. A total of 18,589 teeth including third molars were evaluated. The relative incidence of hypercementosis and the correlation regarding the location (left-side versus right-side occurrence, maxillary versus mandibular, and anterior versus posterior teeth) and between men and women were recorded and analyzed by using the χ(2) test. Eleven patients were found to have hypercementosis, 10 women and 1 man (P hypercementosis, and 6 had more than 1 (54.54%). In total, 22 teeth associated with hypercementosis were found. Seven maxillary teeth were associated with hypercementosis (31.82%) and 15 mandibular teeth (68.18%) (P = .198). No significant differences were found regarding left-side and right-side occurrence of the affected teeth (P > .05). Hypercementosis was significantly more often associated with premolars and molars than with incisors (P Hypercementosis was found in 11 of 800 patients (1.33%). It was identified in 22 of the 18,589 teeth examined (0.12%). The occurrence of hypercementosis among this selected German population was rare. Female patients were approximately 10 times more often affected than male patients. Mandibular teeth were approximately twice as often associated with hypercementosis as maxillary teeth. Copyright © 2012 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  12. The Constitutional Deficiencies of the German 'Rechtsgutslehre'

    Directory of Open Access Journals (Sweden)

    Carl-Friedrich Stuckenberg

    2013-01-01

    Full Text Available This paper questions the theoretical merits and constitutional validity of the “Rechtsgutslehre” (doctrine of the protection of legal goods, a widely held doctrine about the limits of legitimate criminalization in Germany and some other jurisdictions. The immediate cause for this reassessment is a recent decision of the German constitutional court which upheld the German incest prohibition and simultaneously rejected the traditional “Rechtsgutslehre” as constitutionally irrelevant, thereby stirring up considerable controversy among academic criminal lawyers. The paper tries to show why the court’s view is correct by pointing out the main deficiencies of the doctrine and what criteria a better theory must fulfil. Este artículo cuestiona los méritos teóricos y la validez constitucional de la "Rechtsgutslehre" (doctrina de la protección de los bienes jurídicos, una doctrina muy extendida acerca de los límites de la criminalización legítima en Alemania y algunas otras jurisdicciones. La causa inmediata de esta nueva valoración es una decisión reciente del Tribunal Constitucional alemán que ratificó la prohibición del incesto en Alemania y al mismo tiempo rechazó el tradicional "Rechtsgutslehre" por ser constitucionalmente irrelevante, lo que provocó una considerable controversia entre la comunidad académica de abogados criminalistas. El artículo trata de mostrar por qué la decisión de la corte es correcta, señalando las deficiencias principales de la doctrina y los criterios que una teoría más adecuada debe cumplir. DOWNLOAD THIS PAPER FROM SSRN: http://ssrn.com/abstract=2200870

  13. Adaptation and initial validation of the german version of the Students’ Life Satisfaction Scale (German SLSS)

    OpenAIRE

    Weber, Marco; Ruch, Willibald; Huebner, E Scott

    2013-01-01

    The present research describes the adaptation and initial validation of a brief measure of global life satisfaction, the Students’ Life Satisfactions Scale (SLSS), for German-speaking children and adolescents aged 10–17 years. Study 1 investigated the responses of 286 Swiss students (aged 12–17 years) administered paper-pencil questionnaires (e.g., Junior Eysenck Personality Questionnaire) during class on two occasions (interval 4 months). Study 2 investigated the responses of a heterogeneous...

  14. German Foreign and Security Policy: Determinants of German Military Engagement in Africa Since 2011

    Science.gov (United States)

    2015-06-01

    niemand tobt [Peace Work 2.0: Gauck rocks German self-assurances— And nobody storms],” Die Zeit, February 6, 2014, http://pdf.zeit.de/2014/07/gauck- rede ...3 Ursula von der Leyen, Rede der Bundesministerin der Verteidigung anlässlich der 50. Münchner Sicherheitskonferenz [Speech by...auslandseinsaetze/9386838.html. 4 Frank Walter Steinmeier, Rede des Außenministers anlässlich der 50. Münchner Sicherheitskonferenz [Speech by federal

  15. Has the export pricing behaviour of German enterprises changed? Empirical evidence from German sectoral prices

    OpenAIRE

    Stahn, Kerstin

    2006-01-01

    The question as to whether the globalisation-related increase in competitive pressure may have caused the importance of exchange rate pass-through and pricing-to-market for export pricing in Germany to shift since the 1990s is addressed by testing the long-run export pricing behaviour of German enterprises for changes in the impact of its determinants. As globalisation may have affected competitive pressure in individual product markets differently, export pricing is analysed for 11 product c...

  16. Germans or Jews? German-Speaking Jews in Post-War Europe: An Introduction

    Czech Academy of Sciences Publication Activity Database

    Čapková, Kateřina; Rechter, D.

    2017-01-01

    Roč. 62, November (2017), s. 69-74 ISSN 0075-8744 Institutional support: RVO:68378114 Keywords : Jews * Germans * post-war period Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings) https://academic.oup.com/leobaeck/issue/volume/62?browseBy=volume

  17. German translation of the Alberta Context Tool and two measures of research use: methods, challenges and lessons learned.

    Science.gov (United States)

    Hoben, Matthias; Mahler, Cornelia; Bär, Marion; Berger, Sarah; Squires, Janet E; Estabrooks, Carole A; Behrens, Johann

    2013-11-16

    Understanding the relationship between organizational context and research utilization is key to reducing the research-practice gap in health care. This is particularly true in the residential long term care (LTC) setting where relatively little work has examined the influence of context on research implementation. Reliable, valid measures and tools are a prerequisite for studying organizational context and research utilization. Few such tools exist in German. We thus translated three such tools (the Alberta Context Tool and two measures of research use) into German for use in German residential LTC. We point out challenges and strategies for their solution unique to German residential LTC, and demonstrate how resolving specific challenges in the translation of the health care aide instrument version streamlined the translation process of versions for registered nurses, allied health providers, practice specialists, and managers. Our translation methods were based on best practices and included two independent forward translations, reconciliation of the forward translations, expert panel discussions, two independent back translations, reconciliation of the back translations, back translation review, and cognitive debriefing. We categorized the challenges in this translation process into seven categories: (1) differing professional education of Canadian and German care providers, (2) risk that German translations would become grammatically complex, (3) wordings at risk of being misunderstood, (4) phrases/idioms non-existent in German, (5) lack of corresponding German words, (6) limited comprehensibility of corresponding German words, and (7) target persons' unfamiliarity with activities detailed in survey items. Examples of each challenge are described with strategies that we used to manage the challenge. Translating an existing instrument is complex and time-consuming, but a rigorous approach is necessary to obtain instrument equivalence. Essential components were

  18. German translation of the Alberta context tool and two measures of research use: methods, challenges and lessons learned

    Science.gov (United States)

    2013-01-01

    Background Understanding the relationship between organizational context and research utilization is key to reducing the research-practice gap in health care. This is particularly true in the residential long term care (LTC) setting where relatively little work has examined the influence of context on research implementation. Reliable, valid measures and tools are a prerequisite for studying organizational context and research utilization. Few such tools exist in German. We thus translated three such tools (the Alberta Context Tool and two measures of research use) into German for use in German residential LTC. We point out challenges and strategies for their solution unique to German residential LTC, and demonstrate how resolving specific challenges in the translation of the health care aide instrument version streamlined the translation process of versions for registered nurses, allied health providers, practice specialists, and managers. Methods Our translation methods were based on best practices and included two independent forward translations, reconciliation of the forward translations, expert panel discussions, two independent back translations, reconciliation of the back translations, back translation review, and cognitive debriefing. Results We categorized the challenges in this translation process into seven categories: (1) differing professional education of Canadian and German care providers, (2) risk that German translations would become grammatically complex, (3) wordings at risk of being misunderstood, (4) phrases/idioms non-existent in German, (5) lack of corresponding German words, (6) limited comprehensibility of corresponding German words, and (7) target persons’ unfamiliarity with activities detailed in survey items. Examples of each challenge are described with strategies that we used to manage the challenge. Conclusion Translating an existing instrument is complex and time-consuming, but a rigorous approach is necessary to obtain instrument

  19. A cockroach for victory

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    From 1 – 5 July, CERN had the pleasure of welcoming Céline, Fanny and Ophélia, the three winners of the special EIROforum prize donated by CERN in the EU Competition for Young Scientists 2012 (EUCYS). Between visits to the installations and meetings, the young French women had a memorable week.   Fanny Risbourg, Ophélia Bolmin and Céline Lay (from left to right), alongside their CERN guide, Marc Goulette. The rules of EUCYS, organised by the EU since 1989, require all candidates to have first won a scientific prize in their own country. That’s easily said… and done for these young scientists, who have won two! After coming first in France’s Engineering Science Olympiad in 2011, they then took home the top prize in the C. Génial competition the following year. “It all started three years ago, with our travaux personnels encadrés (supervised project),” Fanny explained...

  20. The German version of the Perceived Stress Scale - psychometric characteristics in a representative German community sample.

    Science.gov (United States)

    Klein, Eva M; Brähler, Elmar; Dreier, Michael; Reinecke, Leonard; Müller, Kai W; Schmutzer, Gabriele; Wölfling, Klaus; Beutel, Manfred E

    2016-05-23

    The Perceived Stress Scale Cohen (J Health Soc Behav 24:385-96, 1983) is a widely and well-established self-report scale measuring perceived stress. However, the German version of the PSS-10 has not yet been validated. Thus, the purposes of this representative study were to psychometrically evaluate the PSS-10, and to provide norm values for the German population. The PSS-10 and standardized scales of depression, anxiety, fatigue, procrastination and life satisfaction were administered to a representative, randomly selected German community sample consisting of 1315 females and 1148 male participants in the age range from 14 to 90 years. The results demonstrated a good internal consistency and construct validity. Perceived stress was consistently associated with depression, anxiety, fatigue, procrastination and reduced life satisfaction. Confirmatory factor analysis revealed a bi-dimensional structure with two related latent factors. Regarding demographic variables, women reported a higher level of stress than men. Perceived stress decreased with higher education, income and employment status. Older and married participants felt less stressed than younger and unmarried participants. The PSS-10 is a reliable, valid and economic instrument for assessing perceived stress. As psychological stress is associated with an increased risk of diseases, identifying subpopulations with higher levels of stress is essential. Due to the dependency of the perceived stress level on demographic variables, particularly age and sex, differentiated norm values are needed, which are provided in this paper.