WorldWideScience

Sample records for generation sfg vibrational

  1. Vibrational Spectral Signatures of Crystalline Cellulose Using High Resolution Broadband Sum Frequency Generation Vibrational Spectroscopy (HR-BB-SFG-VS)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Libing; Lu, Zhou; Velarde Ruiz Esparza, Luis A.; Fu, Li; Pu, Yunqiao; Ding, Shi-You; Ragauskas, Art J.; Wang, Hongfei; Yang, Bin

    2015-03-03

    Here we reported the first sub-wavenumber high-resolution broadband sum frequency generation vibrational spectroscopy (HR-BB-SFG-VS) study on both the C-H and O-H region spectra of crystalline cellulose. HR-BB-SFG-VS has about 10 times better resolution than the conventional scanning SFG-VS and is known to be able to measure the intrinsic spectral lineshape and to resolve much more spectral details. With HR-BB-SFG-VS, we found that in cellulose from different sources, including Avicel and cellulose crystals isolated from algae Valonia (Iα) and tunicates (Iβ), the spectral signatures in the OH regions were unique for different allomorphs, i.e. Iα and Iβ, while the spectral signatures in the C-H regions varied in all samples examined. Even though the origin of the different behaviors of the crystalline cellulose in the O-H and C-H vibrational frequency regions is yet to be correlated to the structure of cellulose, these results provided new spectroscopic methods and opportunities to classify and understand the basic crystalline structure, as well as variations, in polymorphism of the crystalline cellulose structure.

  2. Nanoscale chemical and mechanical characterization of thin films:sum frequency generation (SFG) vibrational spectroscopy at buriedinterfaces

    Energy Technology Data Exchange (ETDEWEB)

    Kweskin, Sasha Joseph [Univ. of California, Berkeley, CA (United States)

    2006-01-01

    Sum frequency generation (SFG) surface vibrational spectroscopy was used to characterize interfaces pertinent to current surface engineering applications, such as thin film polymers and novel catalysts. An array of advanced surface science techniques like scanning probe microscopy (SPM), x-ray photoelectron spectroscopy (XPS), gas chromatography (GC) and electron microscopy were used to obtain experimental measurements complementary to SFG data elucidating polymer and catalyst surface composition, surface structure, and surface mechanical behavior. Experiments reported in this dissertation concentrate on three fundamental questions: (1) How does the interfacial molecular structure differ from that of the bulk in real world applications? (2) How do differences in chemical environment affect interface composition or conformation? (3) How do these changes correlate to properties such as mechanical or catalytic performance? The density, surface energy and bonding at a solid interface dramatically alter the polymer configuration, physics and mechanical properties such as surface glass transition, adhesion and hardness. The enhanced sensitivity of SFG at the buried interface is applied to three systems: a series of acrylates under compression, the compositions and segregation behavior of binary polymer polyolefin blends, and the changes in surface structure of a hydrogel as a function of hydration. In addition, a catalytically active thin film of polymer coated nanoparticles is investigated to evaluate the efficacy of SFG to provide in situ information for catalytic reactions involving small mass adsorption and/or product development. Through the use of SFG, in situ total internal reflection (TIR) was used to increase the sensitivity of SFG and provide the necessary specificity to investigate interfaces of thin polymer films and nanostructures previously considered unfeasible. The dynamic nature of thin film surfaces is examined and it is found that the non

  3. Sum frequency generation vibrational spectroscopy (SFG-VS) for complex molecular surfaces and interfaces: Spectral lineshape measurement and analysis plus some controversial issues

    Science.gov (United States)

    Wang, Hong-Fei

    2016-12-01

    Sum-frequency generation vibrational spectroscopy (SFG-VS) was first developed in the 1980s and it has been proven a uniquely sensitive and surface/interface selective spectroscopic probe for characterization of the structure, conformation and dynamics of molecular surfaces and interfaces. In recent years, there have been many progresses in the development of methodology and instrumentation in the SFG-VS toolbox that have significantly broadened the application to complex molecular surfaces and interfaces. In this review, after presenting a unified view on the theory and methodology focusing on the SFG-VS spectral lineshape, as well as the new opportunities in SFG-VS applications with such developments, some of the controversial issues that have been puzzling the community are discussed. The aim of this review is to present to the researchers and students interested in molecular surfaces and interfacial sciences up-to-date perspectives complementary to the existing textbooks and reviews on SFG-VS.

  4. Sum frequency generation vibrational spectroscopy (SFG-VS) for complex molecular surfaces and interfaces: Spectral lineshape measurement and analysis plus some controversial issues

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hong-Fei

    2016-12-01

    Sum-frequency generation vibrational spectroscopy (SFG-VS) was first developed in the 1980s and it has been proven a uniquely sensitive and surface/interface selective spectroscopic probe for characterization of the structure, conformation and dynamics of molecular surfaces and interfaces. In recent years, there has been significant progress in the development of methodology and instrumentation in the SFG-VS toolbox that has significantly broadened the application to complex molecular surfaces and interfaces. In this review, after presenting a unified view on the theory and methodology focusing on the SFG-VS spectral lineshape, as well as the new opportunities in SFG-VS applications with such developments, some of the controversial issues that have been puzzling the community are to be discussed. The aim of this review is to present to the researchers and students interested in molecular surfaces and interfacial sciences up-to-date perspectives complementary to the existing textbooks and reviews on SFG-VS.

  5. Novel SiO2-deposited CaF2 substrate for vibrational sum-frequency generation (SFG) measurements of chemisorbed monolayers in an aqueous environment.

    Science.gov (United States)

    Padermshoke, Adchara; Konishi, Shouta; Ara, Masato; Tada, Hirokazu; Ishibashi, Taka-Aki

    2012-06-01

    A novel SiO(2)-deposited CaF(2) (SiO(2)/CaF(2)) substrate for measuring vibrational sum-frequency generation (SFG) spectra of silane-based chemisorbed monolayers in aqueous media has been developed. The substrate is suitable for silanization and transparent over a broad range of the infrared (IR) probe. The present work demonstrates the practical application of the SiO(2)/CaF(2) substrate and, to our knowledge, the first SFG spectrum at the solid/water interface of a silanized monolayer observed over the IR fingerprint region (1780-1400 cm(-1)) using a back-side probing geometry. This new substrate can be very useful for SFG studies of various chemisorbed organic molecules, particularly biological compounds, in aqueous environments.

  6. Low energy electron diffraction (LEED) and sum frequency generation (SFG) vibrational spectroscopy studies of solid-vacuum, solid-air and solid-liquid interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Hoffer, Saskia [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    Electron based surface probing techniques can provide detailed information about surface structure or chemical composition in vacuum environments. The development of new surface techniques has made possible in situ molecular level studies of solid-gas interfaces and more recently, solid-liquid interfaces. The aim of this dissertation is two-fold. First, by using novel sample preparation, Low Energy Electron Diffraction (LEED) and other traditional ultra high vacuum (UHV) techniques are shown to provide new information on the insulator/vacuum interface. The surface structure of the classic insulator NaCl has been determined using these methods. Second, using sum frequency generation (SFG) surface specific vibrational spectroscopy studies were performed on both the biopolymer/air and electrode/electrolyte interfaces. The surface structure and composition of polyetherurethane-silicone copolymers were determined in air using SFG, atomic force microscopy (AFM), and X-ray photoelectron spectroscopy (XPS). SFG studies of the electrode (platinum, gold and copper)/electrolyte interface were performed as a function of applied potential in an electrochemical cell.

  7. Low energy electron diffraction (LEED) and sum frequency generation (SFG) vibrational spectroscopy studies of solid-vacuum, solid-air and solid-liquid interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Hoffer, Saskia

    2002-08-19

    Electron based surface probing techniques can provide detailed information about surface structure or chemical composition in vacuum environments. The development of new surface techniques has made possible in situ molecular level studies of solid-gas interfaces and more recently, solid-liquid interfaces. The aim of this dissertation is two-fold. First, by using novel sample preparation, Low Energy Electron Diffraction (LEED) and other traditional ultra high vacuum (UHV) techniques are shown to provide new information on the insulator/vacuum interface. The surface structure of the classic insulator NaCl has been determined using these methods. Second, using sum frequency generation (SFG) surface specific vibrational spectroscopy studies were performed on both the biopolymer/air and electrode/electrolyte interfaces. The surface structure and composition of polyetherurethane-silicone copolymers were determined in air using SFG, atomic force microscopy (AFM), and X-ray photoelectron spectroscopy (XPS). SFG studies of the electrode (platinum, gold and copper)/electrolyte interface were performed as a function of applied potential in an electrochemical cell.

  8. Phase transition behaviors of the supported DPPC bilayer investigated by sum frequency generation (SFG) vibrational spectroscopy and atomic force microscopy (AFM).

    Science.gov (United States)

    Wu, Heng-Liang; Tong, Yujin; Peng, Qiling; Li, Na; Ye, Shen

    2016-01-21

    The phase transition behaviors of a supported bilayer of dipalmitoylphosphatidyl-choline (DPPC) have been systematically evaluated by in situ sum frequency generation (SFG) vibrational spectroscopy and atomic force microscopy (AFM). By using an asymmetric bilayer composed of per-deuterated and per-protonated monolayers, i.e., DPPC-d75/DPPC and a symmetric bilayer of DPPC/DPPC, we were able to probe the molecular structural changes during the phase transition process of the lipid bilayer by SFG spectroscopy. It was found that the DPPC bilayer is sequentially melted from the top (adjacent to the solution) to bottom leaflet (adjacent to the substrate) over a wide temperature range. The conformational ordering of the supported bilayer does not decrease (even slightly increases) during the phase transition process. The conformational defects in the bilayer can be removed after the complete melting process. The phase transition enthalpy for the bottom leaflet was found to be approximately three times greater than that for the top leaflet, indicating a strong interaction of the lipids with the substrate. The present SFG and AFM observations revealed similar temperature dependent profiles. Based on these results, the temperature-induced structural changes in the supported lipid bilayer during its phase transition process are discussed in comparison with previous studies.

  9. Vibrational Dynamics of Interfacial Water by Free Induction Decay Sum Frequency Generation (FID-SFG) at the Al2O3(1120)/H2O Interface.

    Science.gov (United States)

    Boulesbaa, Abdelaziz; Borguet, Eric

    2014-02-06

    The dephasing dynamics of a vibrational coherence may reveal the interactions of chemical functional groups with their environment. To investigate this process at a surface, we employ free induction decay sum frequency generation (FID-SFG) to measure the time that it takes for free OH stretch oscillators at the charged (pH ≈ 13, KOH) interface of alumina/water (Al2O3/H2O) to lose their collective coherence. By employing noncollinear optical parametric amplification (NOPA) technology and nonlinear vibrational spectroscopy, we showed that the single free OH peak actually corresponds to two distinct oscillators oriented opposite to each other and measured the total dephasing time, T2, of the free OH stretch modes at the Al2O3/H2O interface with a sub-40 fs temporal resolution. Our results suggested that the free OH oscillators associated with interfacial water dephase on the time scale of 89.4 ± 6.9 fs, whereas the homogeneous dephasing of interfacial alumina hydroxyls is an order of magnitude slower.

  10. IR and SFG vibrational spectroscopy of the water bend in the bulk liquid and at the liquid-vapor interface, respectively.

    Science.gov (United States)

    Ni, Yicun; Skinner, J L

    2015-07-07

    Vibrational spectroscopy of the water bending mode has been investigated experimentally to study the structure of water in condensed phases. In the present work, we calculate the theoretical infrared (IR) and sum-frequency generation (SFG) spectra of the HOH bend in liquid water and at the water liquid/vapor interface using a mixed quantum/classical approach. Classical molecular dynamics simulation is performed by using a recently developed water model that explicitly includes three-body interactions and yields a better description of the water surface. Ab-initio-based transition frequency, dipole, polarizability, and intermolecular coupling maps are developed for the spectral calculations. The calculated IR and SFG spectra show good agreement with the experimental measurements. In the theoretical imaginary part of the SFG susceptibility for the water liquid/vapor interface, we find two features: a negative band centered at 1615 cm(-1) and a positive band centered at 1670 cm(-1). We analyze this spectrum in terms of the contributions from molecules in different hydrogen-bond classes to the SFG spectral density and also compare to SFG results for the OH stretch. SFG of the water bending mode provides a complementary picture of the heterogeneous hydrogen-bond configurations at the water surface.

  11. IR and SFG vibrational spectroscopy of the water bend in the bulk liquid and at the liquid-vapor interface, respectively

    Energy Technology Data Exchange (ETDEWEB)

    Ni, Yicun; Skinner, J. L. [Theoretical Chemistry Institute and Department of Chemistry, University of Wisconsin, Madison, Wisconsin 53706 (United States)

    2015-07-07

    Vibrational spectroscopy of the water bending mode has been investigated experimentally to study the structure of water in condensed phases. In the present work, we calculate the theoretical infrared (IR) and sum-frequency generation (SFG) spectra of the HOH bend in liquid water and at the water liquid/vapor interface using a mixed quantum/classical approach. Classical molecular dynamics simulation is performed by using a recently developed water model that explicitly includes three-body interactions and yields a better description of the water surface. Ab-initio-based transition frequency, dipole, polarizability, and intermolecular coupling maps are developed for the spectral calculations. The calculated IR and SFG spectra show good agreement with the experimental measurements. In the theoretical imaginary part of the SFG susceptibility for the water liquid/vapor interface, we find two features: a negative band centered at 1615 cm{sup −1} and a positive band centered at 1670 cm{sup −1}. We analyze this spectrum in terms of the contributions from molecules in different hydrogen-bond classes to the SFG spectral density and also compare to SFG results for the OH stretch. SFG of the water bending mode provides a complementary picture of the heterogeneous hydrogen-bond configurations at the water surface.

  12. Back-surface gold mirrors for vibrationally resonant sum-frequency (VR-SFG) spectroscopy using 3-mercaptopropyltrimethoxysilane as an adhesion promoter.

    Science.gov (United States)

    Quast, Arthur D; Zhang, Feng; Linford, Matthew R; Patterson, James E

    2011-06-01

    Back-surface mirrors are needed as reference materials for vibrationally resonant sum-frequency generation (VR-SFG) probing of liquid-solid interfaces. Conventional noble metal mirrors are not suitable for back-surface applications due to the presence of a metal adhesion layer (chromium or titanium) between the window substrate and the reflective metal surface. Using vapor deposited 3-mercaptopropyltrimethoxysilane (MPTMS) as a bi-functional adhesion promoter, gold mirrors were fabricated on fused silica substrates. These mirrors exhibit excellent gold adhesion as determined by the Scotch(®) tape test. They also produce minimal spectroscopic interference in the C-H stretching region (2800-3000 cm(-1)), as characterized by VR-SFG. These mirrors are thus robust and can be used as back-surface mirrors for a variety of applications, including reference mirrors for VR-SFG.

  13. Structure Sensitivity in Pt Nanoparticle Catalysts for Hydrogenation of 1,3-Butadiene: In Situ Study of Reaction Intermediates Using SFG Vibrational Spectroscopy

    KAUST Repository

    Michalak, William D.

    2013-01-31

    The product selectivity during 1,3-butadiene hydrogenation on monodisperse, colloidally synthesized, Pt nanoparticles was studied under reaction conditions with kinetic measurements and in situ sum frequency generation (SFG) vibrational spectroscopy. SFG was performed with the capping ligands intact in order to maintain nanoparticle size by reduced sintering. Four products are formed at 75 C: 1-butene, cis-2-butene, trans-2-butene, and n-butane. Ensembles of Pt nanoparticles with average diameters of 0.9 and 1.8 nm exhibit a ∼30% and ∼20% increase in the full hydrogenation products, respectively, as compared to Pt nanoparticles with average diameters of 4.6 and 6.7 nm. Methyl and methylene vibrational stretches of reaction intermediates observed under working conditions using SFG were used to correlate the stable reaction intermediates with the product distribution. Kinetic and SFG results correlate with previous DFT predictions for two parallel reaction pathways of 1,3-butadiene hydrogenation. Hydrogenation of 1,3-butadiene can initiate with H-addition at internal or terminal carbons leading to the formation of 1-buten-4-yl radical (metallocycle) and 2-buten-1-yl radical intermediates, respectively. Small (0.9 and 1.8 nm) nanoparticles exhibited vibrational resonances originating from both intermediates, while the large (4.6 and 6.7 nm) particles exhibited vibrational resonances originating predominately from the 2-buten-1-yl radical. This suggests each reaction pathway competes for partial and full hydrogenation and the nanoparticle size affects the kinetic preference for the two pathways. The reaction pathway through the metallocycle intermediate on the small nanoparticles is likely due to the presence of low-coordinated sites. © 2012 American Chemical Society.

  14. Chiral vibrational structures of proteins at interfaces probed by sum frequency generation spectroscopy.

    Science.gov (United States)

    Fu, Li; Wang, Zhuguang; Yan, Elsa C Y

    2011-01-01

    We review the recent development of chiral sum frequency generation (SFG) spectroscopy and its applications to study chiral vibrational structures at interfaces. This review summarizes observations of chiral SFG signals from various molecular systems and describes the molecular origins of chiral SFG response. It focuses on the chiral vibrational structures of proteins and presents the chiral SFG spectra of proteins at interfaces in the C-H stretch, amide I, and N-H stretch regions. In particular, a combination of chiral amide I and N-H stretches of the peptide backbone provides highly characteristic vibrational signatures, unique to various secondary structures, which demonstrate the capacity of chiral SFG spectroscopy to distinguish protein secondary structures at interfaces. On the basis of these recent developments, we further discuss the advantages of chiral SFG spectroscopy and its potential application in various fields of science and technology. We conclude that chiral SFG spectroscopy can be a new approach to probe chiral vibrational structures of protein at interfaces, providing structural and dynamic information to study in situ and in real time protein structures and dynamics at interfaces.

  15. Wavelength tunable CW red laser generated based on an intracavity-SFG composite cavity

    Science.gov (United States)

    Zhang, Z. N.; Bai, Y.; Lei, G. Z.; Bai, B.; Sun, Y. X.; Hu, M. X.; Wang, C.; Bai, J. T.

    2016-12-01

    We report a wavelength-tunable watt-level continuous wave (CW) red laser that uses a composite cavity based on an intracavity sum-frequency generation (SFG). The composite cavity is composed of a LD side-pumped Nd: GdVO4 p-polarized 1062.9 nm resonant cavity and a resonant optical parametric oscillator (SRO) of s-polarized signal light using a periodically poled crystal MgO: PPLN. Based on the temperature tuning from 30 °C to 200 °C, the CW red laser beams are obtained in a tunable waveband from 634.4 nm to 649.1 nm, corresponding to a tunable output waveband from 3278.0 nm to 2940.2 nm of the mid-infrared idler lights. The maximum CW output power of the red laser at 634.4 nm and the idler light at 3278.0 nm reach 3.03 W and 4.13 W under 30 °C, respectively.

  16. Sum Frequency Generation Vibrational Spectroscopy of Colloidal Platinum Nanoparticle Catalysts: Disordering versus Removal of Organic Capping

    KAUST Repository

    Krier, James M.

    2012-08-23

    Recent work with nanoparticle catalysts shows that size and shape control on the nanometer scale influences reaction rate and selectivity. Sum frequency generation (SFG) vibrational spectroscopy is a powerful tool for studying heterogeneous catalysis because it enables the observation of surface intermediates during catalytic reactions. To control the size and shape of catalytic nanoparticles, an organic ligand was used as a capping agent to stabilize nanoparticles during synthesis. However, the presence of an organic capping agent presents two major challenges in SFG and catalytic reaction studies: it blocks a significant fraction of active surface sites and produces a strong signal that prevents the detection of reaction intermediates with SFG. Two methods for cleaning Pt nanoparticles capped with poly (vinylpyrrolidone) (PVP) are examined in this study: solvent cleaning and UV cleaning. Solvent cleaning leaves more PVP intact and relies on disordering with hydrogen gas to reduce the SFG signal of PVP. In contrast, UV cleaning depends on nearly complete removal of PVP to reduce SFG signal. Both UV and solvent cleaning enable the detection of reaction intermediates by SFG. However, solvent cleaning also yields nanoparticles that are stable under reaction conditions, whereas UV cleaning results in aggregation during reaction. The results of this study indicate that solvent cleaning is more advantageous for studying the effects of nanoparticle size and shape on catalytic selectivity by SFG vibrational spectroscopy. © 2012 American Chemical Society.

  17. Interfacial structure of soft matter probed by SFG spectroscopy.

    Science.gov (United States)

    Ye, Shen; Tong, Yujin; Ge, Aimin; Qiao, Lin; Davies, Paul B

    2014-10-01

    Sum frequency generation (SFG) vibrational spectroscopy, an interface-specific technique in contrast to, for example, attenuated total reflectance spectroscopy, which is only interface sensitive, has been employed to investigate the surface and interface structure of soft matter on a molecular scale. The experimental arrangement required to carry out SFG spectroscopy, with particular reference to soft matter, and the analytical methods developed to interpret the spectra are described. The elucidation of the interfacial structure of soft matter systems is an essential prerequisite in order to understand and eventually control the surface properties of these important functional materials.

  18. Effects of Plant Cell Wall Matrix Polysaccharides on Bacterial Cellulose Structure Studied with Vibrational Sum Frequency Generation Spectroscopy and X-ray Diffraction

    Energy Technology Data Exchange (ETDEWEB)

    Park, Yong Bum; Lee, Christopher M; Kafle, Kabindra; Park, Sunkyu; Cosgrove, Daniel; Kim, Seong H

    2014-07-14

    The crystallinity, allomorph content, and mesoscale ordering of cellulose produced by Gluconacetobacter xylinus cultured with different plant cell wall matrix polysaccharides were studied with vibrational sum frequency generation (SFG) spectroscopy and X-ray diffraction (XRD).

  19. In Situ Molecular Level Studies on Membrane Related Peptides and Proteins in Real Time Using Sum Frequency Generation Vibrational Spectroscopy

    Science.gov (United States)

    Ye, Shuji; Nguyen, Khoi Tan; Le Clair, Stéphanie V.; Chen, Zhan

    2009-01-01

    Sum frequency generation (SFG) vibrational spectroscopy has been demonstrated to be a powerful technique to study the molecular structures of surfaces and interfaces in different chemical environments. This review summarizes recent SFG studies on hybrid bilayer membranes and substrate-supported lipid monolayers and bilayers, the interaction between peptides/proteins and lipid monolayers/bilayers, and bilayer perturbation induced by peptides/proteins. To demonstrate the ability of SFG to determine the orientations of various secondary structures, studies on the interaction between different peptides/proteins (melittin, G proteins, almethicin, and tachyplesin I) and lipid bilayers are discussed. Molecular level details revealed by SFG in these studies show that SFG can provide a unique understanding on the interactions between a lipid monolayer/bilayer and peptides/proteins in real time, in situ and without any exogenous labeling. PMID:19306928

  20. Proteins at interfaces probed by chiral vibrational sum frequency generation spectroscopy.

    Science.gov (United States)

    Yan, Elsa C Y; Wang, Zhuguang; Fu, Li

    2015-02-19

    Characterizations of protein structures at interfaces are important in solving an array of fundamental and engineering problems, including understanding transmembrane signal transduction and molecular transport processes and development of biomaterials to meet the needs of biomedical and energy research. However, in situ and real-time characterization of protein secondary structures is challenging because it requires physical methods that are selective to both interface and secondary structures. Here, we summarize recent experimental developments in our laboratory of chiral vibrational sum frequency generation spectroscopy (SFG) for analyzing protein structures at interfaces. We showed that chiral SFG provides vibrational optical signatures of the peptide N-H stretch and amide I modes that can distinguish various protein secondary structures. Using these signatures, we further applied chiral SFG to probe orientations and folding kinetics of proteins at interfaces. Our results show that chiral SFG is a background-free, label-free, in situ, and real-time vibrational method for studying proteins at interfaces. This recent progress demonstrates the potential of chiral SFG in solving problems related to proteins and other chiral biopolymers at interfaces.

  1. Comparative study of direct and phase-specific vibrational sum-frequency generation spectroscopy: advantages and limitations.

    Science.gov (United States)

    Pool, Ruben E; Versluis, Jan; Backus, Ellen H G; Bonn, Mischa

    2011-12-29

    As a surface-specific technique, vibrational sum-frequency generation (SFG) is used in a wide range of applications where soft matter or solid interfaces are to be probed on a molecular level through their vibrational modes. In recent years, phase-specific sum-frequency generation (PS-SFG, also known as heterodyne-detected SFG) spectroscopy has been increasingly replacing its predecessor (direct SFG, also known as homodyne SFG) as the experimental technique of choice for characterizing interfacial structure. The technique enables phase sensitive measurements, allowing for the determination of the real and imaginary parts of the interfacial vibrational response function and thereby the unambiguous identification of molecular orientation. This phase-sensitivity requires, however, a complete understanding of the complex optical properties of the sample and of their effect on the signal. These optical properties significantly influence the raw spectral data from which the real and imaginary parts of the second-order susceptibility are retrieved. We show that it is essential to correct the data appropriately to infer the true molecular response. The current study presents a detailed description of the physical contributions to the phase-resolved spectrum, allowing a direct comparison between the phase-resolved spectrum and that obtained using the well-understood direct detection method in a step-by-step data analysis process. In addition to phase sensitivity, PS-SFG has been shown to increase the sensitivity compared to traditional (direct) SFG spectroscopy. We present a quantitative comparison between theoretical limits of the signal-to-noise ratio of both techniques, which shows that for many systems the signal-to-noise ratio is very similar for direct- and phase-specific SFG signals. © 2011 American Chemical Society

  2. Sum Frequency Generation Vibrational Spectroscopy of Adsorbed Amino Acids, Peptides and Proteins of Hydrophilic and Hydrophobic Solid-Water Interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Holinga IV, George Joseph [Univ. of California, Berkeley, CA (United States)

    2010-09-01

    Sum frequency generation (SFG) vibrational spectroscopy was used to investigate the interfacial properties of several amino acids, peptides, and proteins adsorbed at the hydrophilic polystyrene solid-liquid and the hydrophobic silica solid-liquid interfaces. The influence of experimental geometry on the sensitivity and resolution of the SFG vibrational spectroscopy technique was investigated both theoretically and experimentally. SFG was implemented to investigate the adsorption and organization of eight individual amino acids at model hydrophilic and hydrophobic surfaces under physiological conditions. Biointerface studies were conducted using a combination of SFG and quartz crystal microbalance (QCM) comparing the interfacial structure and concentration of two amino acids and their corresponding homopeptides at two model liquid-solid interfaces as a function of their concentration in aqueous solutions. The influence of temperature, concentration, equilibration time, and electrical bias on the extent of adsorption and interfacial structure of biomolecules were explored at the liquid-solid interface via QCM and SFG. QCM was utilized to quantify the biological activity of heparin functionalized surfaces. A novel optical parametric amplifier was developed and utilized in SFG experiments to investigate the secondary structure of an adsorbed model peptide at the solid-liquid interface.

  3. Structure and orientation of interfacial proteins determined by sum frequency generation vibrational spectroscopy: method and application.

    Science.gov (United States)

    Ye, Shuji; Wei, Feng; Li, Hongchun; Tian, Kangzhen; Luo, Yi

    2013-01-01

    In situ and real-time characterization of molecular structures and orientation of proteins at interfaces is essential to understand the nature of interfacial protein interaction. Such work will undoubtedly provide important clues to control biointerface in a desired manner. Sum frequency generation vibrational spectroscopy (SFG-VS) has been demonstrated to be a powerful technique to study the interfacial structures and interactions at the molecular level. This paper first systematically introduced the methods for the calculation of the Raman polarizability tensor, infrared transition dipole moment, and SFG molecular hyperpolarizability tensor elements of proteins/peptides with the secondary structures of α-helix, 310-helix, antiparallel β-sheet, and parallel β-sheet, as well as the methodology to determine the orientation of interfacial protein secondary structures using SFG amide I spectra. After that, recent progresses on the determination of protein structure and orientation at different interfaces by SFG-VS were then reviewed, which provides a molecular-level understanding of the structures and interactions of interfacial proteins, specially understanding the nature of driving force behind such interactions. Although this review has focused on analysis of amide I spectra, it will be expected to offer a basic idea for the spectral analysis of amide III SFG signals and other complicated molecular systems such as RNA and DNA. Copyright © 2013 Elsevier Inc. All rights reserved.

  4. Molecular order at polymer interfaces measured by broad-bandwidth vibrationally-resolved sum frequency generation spectroscopy.

    Science.gov (United States)

    Wilson, Philip T.; Briggman, Kimberly A.; Stephenson, John C.; Wallace, William E.; Richter, Lee J.

    2001-03-01

    Broad-bandwidth vibrationally-resolved sum frequency generation (VR-SFG)spectroscopy has been used to measure the molecular orientation distribution at polymer/dielectric interfaces. A novel three layer microcavity structure of polystyrene (i.e.,PS)/spin-on hydrogen silsesquioxane dielectric (i.e.,spin-on glass)/Au has been developed in which manipulation of Fresnel factors through the variation of dielectric thickness allows unique spectroscopic study of either the free or buried polymer interface. Chemically specific VR-SFG spectroscopy of the phenyl groups of PS reveals opposite absolute orientations of these groups for the two interfaces, each directed away from the bulk of the PS film.

  5. A trough for improved SFG spectroscopy of lipid monolayers

    Science.gov (United States)

    Franz, Johannes; van Zadel, Marc-Jan; Weidner, Tobias

    2017-05-01

    Lipid monolayers are indispensable model systems for biological membranes. The main advantage over bilayer model systems is that the surface pressure within the layer can be directly and reliably controlled. The sensitive interplay between surface pressure and temperature determines the molecular order within a model membrane and consequently determines the membrane phase behavior. The lipid phase is of crucial importance for a range of membrane functions such as protein interactions and membrane permeability. A very reliable method to probe the structure of lipid monolayers is sum frequency generation (SFG) vibrational spectroscopy. Not only is SFG extremely surface sensitive but it can also directly access critical parameters such as lipid order and orientation, and it can provide valuable information about protein interactions along with interfacial hydration. However, recent studies have shown that temperature gradients caused by high power laser beams perturb the lipid layers and potentially obscure the spectroscopic results. Here we demonstrate how the local heating problem can be effectively reduced by spatially distributing the laser pulses on the sample surface using a translating Langmuir trough for SFG experiments at lipid monolayers. The efficiency of the trough is illustrated by the detection of enhanced molecular order due to reduced heat load.

  6. Hydrogenation of the alpha,beta-Unsaturated Aldehydes Acrolein, Crotonaldehyde, and Prenal over Pt Single Crystals: A Kinetic and Sum-Frequency Generation Vibrational Spectroscopy Study

    Energy Technology Data Exchange (ETDEWEB)

    Kliewer, C.J.; Somorjai, G.A.

    2008-11-26

    Sum-frequency generation vibrational spectroscopy (SFG-VS) and kinetic measurements using gas chromatography have been used to study the surface reaction intermediates during the hydrogenation of three {alpha},{beta}-unsaturated aldehydes, acrolein, crotonaldehyde, and prenal, over Pt(111) at Torr pressures (1 Torr aldehyde, 100 Torr hydrogen) in the temperature range of 295K to 415K. SFG-VS data showed that acrolein has mixed adsorption species of {eta}{sub 2}-di-{sigma}(CC)-trans, {eta}{sub 2}-di-{sigma}(CC)-cis as well as highly coordinated {eta}{sub 3} or {eta}{sub 4} species. Crotonaldehyde adsorbed to Pt(111) as {eta}{sub 2} surface intermediates. SFG-VS during prenal hydrogenation also suggested the presence of the {eta}{sub 2} adsorption species, and became more highly coordinated as the temperature was raised to 415K, in agreement with its enhanced C=O hydrogenation. The effect of catalyst surface structure was clarified by carrying out the hydrogenation of crotonaldehyde over both Pt(111) and Pt(100) single crystals while acquiring the SFG-VS spectra in situ. Both the kinetics and SFG-VS showed little structure sensitivity. Pt(100) generated more decarbonylation 'cracking' product while Pt(111) had a higher selectivity for the formation of the desired unsaturated alcohol, crotylalcohol.

  7. Hydrogenation of the alpha,beta-unsaturated aldehydes acrolein, crotonaldehyde, and prenal over Pt single crystals: a kinetic and sum-frequency generation vibrational spectroscopy study.

    Science.gov (United States)

    Kliewer, Christopher J; Bieri, Marco; Somorjai, Gabor A

    2009-07-29

    Sum-frequency generation vibrational spectroscopy (SFG-VS) and kinetic measurements using gas chromatography have been used to study the surface reaction intermediates during the hydrogenation of three alpha,beta-unsaturated aldehydes, acrolein, crotonaldehyde, and prenal, over Pt(111) at Torr pressures (1 Torr of aldehyde, 100 Torr of hydrogen) in the temperature range of 295-415 K. SFG-VS data showed that acrolein has mixed adsorption species of eta(2)-di-sigma(CC)-trans, eta(2)-di-sigma(CC)-cis as well as highly coordinated eta(3) or eta(4) species. Crotonaldehyde adsorbed to Pt(111) as eta(2) surface intermediates. SFG-VS during prenal hydrogenation also suggested the presence of the eta(2) adsorption species and became more highly coordinated as the temperature was raised to 415 K, in agreement with its enhanced C=O hydrogenation. The effect of catalyst surface structure was clarified by carrying out the hydrogenation of crotonaldehyde over both Pt(111) and Pt(100) single crystals while acquiring the SFG-VS spectra in situ. Both the kinetics and SFG-VS showed little structure sensitivity. Pt(100) generated more decarbonylation "cracking" product while Pt(111) had a higher selectivity for the formation of the desired unsaturated alcohol, crotyl alcohol.

  8. 5.5 W of Diffraction-Limited Green Light Generated by SFG of Tapered Diode Lasers in a Cascade of Nonlinear Crystals

    DEFF Research Database (Denmark)

    Hansen, Anders Kragh; Jensen, Ole Bjarlin; Andersen, Peter Eskil

    2015-01-01

    Diode-based high power visible lasers are perfect pump sources for, e.g., titaniumsapphire lasers. The combination of favorable scaling laws in both SFG and cascading of nonlinear crystals allows access to unprecedented powers in diode-based systems....

  9. Dicty_cDB: SFG267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFG267 (Link to dictyBase) - - - Contig-U16276-1 SFG267P (Link to Original site) SF...G267F 513 SFG267Z 695 SFG267P 1198 - - Show SFG267 Library SF (Link to library) Clone ID SF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFG2-C/SFG267Q.Seq.d/ Representative seq. ID SF...G267P (Link to Original site) Representative DNA sequence >SFG267 (SFG267Q) /CSM/SF/SFG2-C/SFG... CTYQYNHELGPVFKTCNLVGGFFQRLETLHKYAFASMIIFGEEQGGAVKDQTVSGLWVFR GQDLPADMKDCDDSLVYDWKKLDVAADKAIIESFLAWEDKNGVSX*

  10. Dicty_cDB: SFG824 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFG824 (Link to dictyBase) - - - Contig-U10808-1 SFG824P (Link to Original site) SF...G824F 540 SFG824Z 777 SFG824P 1317 - - Show SFG824 Library SF (Link to library) Clone ID SF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFG8-A/SFG824Q.Seq.d/ Representative seq. ID SF...G824P (Link to Original site) Representative DNA sequence >SFG824 (SFG824Q) /CSM/SF/SFG8-A/SFG...o Acid sequence i*fis*kfifiksivtliynnqivvlf*yff**IKMMKPDLNSPLPQSPQLQSFGSRSSD LATE

  11. Physiologically-Relevant Modes of Membrane Interactions by the Human Antimicrobial Peptide, LL-37, Revealed by SFG Experiments

    Science.gov (United States)

    Ding, Bei; Soblosky, Lauren; Nguyen, Khoi; Geng, Junqing; Yu, Xinglong; Ramamoorthy, Ayyalusamy; Chen, Zhan

    2013-05-01

    Antimicrobial peptides (AMPs) could become the next generation antibiotic compounds which can overcome bacterial resistance by disrupting cell membranes and it is essential to determine the factors underlying its mechanism of action. Although high-resolution NMR and other biological studies have provided valuable insights, it has been a major challenge to follow the AMP-membrane interactions at physiologically-relevant low peptide concentrations. In this study, we demonstrate a novel approach to overcome this major limitation by performing Sum Frequency Generation (SFG) vibrational spectroscopic experiments on lipid bilayers containing an AMP, LL-37. Our results demonstrate the power of SFG to study non-linear helical peptides and also infer that lipid-peptide interaction and the peptide orientation depend on the lipid membrane composition. The observed SFG signal changes capture the aggregating process of LL-37 on membrane. In addition, our SFG results on cholesterol-containing lipid bilayers indicate the inhibition effect of cholesterol on peptide-induced membrane permeation process.

  12. N-H stretching modes around 3300 wavenumber from peptide backbones observed by chiral sum frequency generation vibrational spectroscopy.

    Science.gov (United States)

    Fu, Li; Wang, Zhuguang; Yan, Elsa C Y

    2014-09-01

    We present a detailed analysis of the molecular origin of the chiral sum frequency generation (SFG) signals of proteins and peptides at interfaces in the N-H stretching vibrational region. The N-H stretching can be a probe for investigating structural and functional properties of proteins, but remains technically difficult to analyze due to the overlapping with the O-H stretching of water molecules. Chiral SFG spectroscopy offers unique tools to study the N-H stretching from proteins at interfaces without interference from the water background. However, the molecular origin of the N-H stretching signals of proteins is still unclear. This work provides a justification of the origin of chiral N-H signals by analyzing the vibrational frequencies, examining chiral SFG theory, studying proton (hydrogen/deuterium) exchange kinetics, and performing optical control experiments. The results demonstrate that the chiral N-H stretching signals at ~3300 cm(-1) originate from the amide group of the protein backbones. This chiral N-H stretching signal offers an in situ, real-time, and background-free probe for interrogating the protein structures and dynamics at interfaces at the molecular level. © 2014 Wiley Periodicals, Inc.

  13. Dicty_cDB: SFG464 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFG464 (Link to dictyBase) - - - Contig-U15632-1 SFG464Z (Link... to Original site) - - SFG464Z 677 - - - - Show SFG464 Library SF (Link to library) Clone ID SFG464 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFG4-C/SFG464Q.Seq.d/ Representative seq. ID SFG46...4Z (Link to Original site) Representative DNA sequence >SFG464 (SFG464Q) /CSM/SF/SFG4-C/SFG464Q.Seq.d/ XXXXX...TPSNLWIPTFLRLAFFPLFALCIKPLVFNNNAWYFVFMFIFSI SNGYCGTLAMIFGPTKAEEHEKEYAGITYVILFKFWYLGINSFAFLL Translated Amino

  14. Pyrrole Hydrogenation over Rh(111) and Pt(111) Single-Crystal Surfaces and Hydrogenation Promotion Mediated by 1-Methylpyrrole: A Kinetic and Sum-Frequency Generation Vibrational Spectroscopy Study

    Energy Technology Data Exchange (ETDEWEB)

    Kliewer, Christopher J.; Bieri, Marco; Somorjai, Gabor A.

    2008-03-04

    Sum-frequency generation (SFG) surface vibrational spectroscopy and kinetic measurements using gas chromatography have been used to study the adsorption and hydrogenation of pyrrole over both Pt(111) and Rh(111) single-crystal surfaces at Torr pressures (3 Torr pyrrole, 30 Torr H{sub 2}) to form pyrrolidine and the minor product butylamine. Over Pt(111) at 298 K it was found that pyrrole adsorbs in an upright geometry cleaving the N-H bond to bind through the nitrogen evidenced by SFG data. Over Rh(111) at 298 K pyrrole adsorbs in a tilted geometry relative to the surface through the p-aromatic system. A pyrroline surface reaction intermediate, which was not detected in the gas phase, was seen by SFG during the hydrogenation over both surfaces. Significant enhancement of the reaction rate was achieved over both metal surfaces by adsorbing 1-methylpyrrole before reaction. SFG vibrational spectroscopic results indicate that reaction promotion is achieved by weakening the bonding between the N-containing products and the metal surface because of lateral interactions on the surface between 1-methylpyrrole and the reaction species, reducing the desorption energy of the products. It was found that the ring-opening product butylamine was a reaction poison over both surfaces, but this effect can be minimized by treating the catalyst surfaces with 1-methylpyrrole before reaction. The reaction rate was not enhanced with elevated temperatures, and SFG suggests desorption of pyrrole at elevated temperatures.

  15. Theoretical Investigation of C-H Vibrational Spectroscopy. 2. Unified Assignment Method of IR, Raman, and Sum Frequency Generation Spectra of Ethanol.

    Science.gov (United States)

    Wang, Lin; Ishiyama, Tatsuya; Morita, Akihiro

    2017-09-14

    Using the flexible and polarizable model in the preceding paper, we performed comprehensive analysis of C-H stretching vibrations of ethanol and partially deuterated ones by molecular dynamics (MD) simulation. The overlapping band structures of the C-H stretching region including (i) methyl and methylene, (ii) the number of modes with Fermi resonances, and (iii) different trans/gauche conformers are disentangled by various analysis methods, such as isotope exchange, empirical potential parameter shift analysis, and separate calculations of conformers. The present analysis with MD simulation revealed unified assignment of infrared, Raman, and sum frequency generation (SFG) spectra. The analysis confirmed that the different conformers have significant influence on the assignment of CH2 vibrations. Band components and their signs in the imaginary χ((2)) spectra of SFG under various polarizations are also understood from the common assignment with the infrared and Raman spectra.

  16. Dicty_cDB: SFG280 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFG280 (Link to dictyBase) - - - Contig-U16321-1 SFG280Z (Link... to Original site) - - SFG280Z 634 - - - - Show SFG280 Library SF (Link to library) Clone ID SFG280 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFG2-D/SFG280Q.Seq.d/ Representative seq. ID SFG280...Z (Link to Original site) Representative DNA sequence >SFG280 (SFG280Q) /CSM/SF/SFG2-D/SFG280Q.Seq.d/ XXXXX...nificant alignments: (bits) Value SFG280 (SFG280Q) /CSM/SF/SFG2-D/SFG280Q.Seq.d/ 1245 0.0 CFB686 (CFB686Q) /

  17. New Insights from Sum Frequency Generation Vibrational Spectroscopy into the Interactions of Islet Amyloid Polypeptides with Lipid Membranes

    Directory of Open Access Journals (Sweden)

    Li Fu

    2016-01-01

    Full Text Available Studies of amyloid polypeptides on membrane surfaces have gained increasing attention in recent years. Several studies have revealed that membranes can catalyze protein aggregation and that the early products of amyloid aggregation can disrupt membrane integrity, increasing water permeability and inducing ion cytotoxicity. Nonetheless, probing aggregation of amyloid proteins on membrane surfaces is challenging. Surface-specific methods are required to discriminate contributions of aggregates at the membrane interface from those in the bulk phase and to characterize protein secondary structures in situ and in real time without the use of perturbing spectroscopic labels. Here, we review the most recent applications of sum frequency generation (SFG vibrational spectroscopy applied in conjunction with computational modeling techniques, a joint experimental and computational methodology that has provided valuable insights into the aggregation of islet amyloid polypeptide (IAPP on membrane surfaces. These applications show that SFG can provide detailed information about structures, kinetics, and orientation of IAPP during interfacial aggregation, relevant to the molecular mechanisms of type II diabetes. These recent advances demonstrate the promise of SFG as a new approach for studying amyloid diseases at the molecular level and for the rational drug design targeting early aggregation products on membrane surfaces.

  18. Studies of Heterogeneously Catalyzed Liquid-Phase Alcohol Oxidation on Platinum bySum-frequency Generation Vibrational Spectroscopy and Reaction Rate Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, Christopher [Univ. of California, Berkeley, CA (United States)

    2014-05-15

    Compared to many branches of chemistry, the molecular level study of catalytically active surfaces is young. Only with the invention of ultrahigh vacuum technology in the past half century has it been possible to carry out experiments that yield useful molecular information about the reactive occurrences at a surface. The reason is two-fold: low pressure is necessary to keep a surface clean for an amount of time long enough to perform an experiment, and most atomic scale techniques that are surface speci c (x-ray photoelectron spectroscopy, electron energy loss spectroscopy, Auger electron spectroscopy, etc.) cannot be used at ambient pressures, because electrons, which act as chemical probes in these techniques, are easily scattered by molecules. Sum-frequency generation (SFG) vibrational spectroscopy is one technique that can provide molecular level information from the surface without the necessity for high vacuum. Since the advent of SFG as a surface spectroscopic tool it has proved its worth in the studies of surface catalyzed reactions in the gas phase, with numerous reactions in the gas phase having been investigated on a multitude of surfaces. However, in situ SFG characterization of catalysis at the solid-liquid interface has yet to be thoroughly pursued despite the broad interest in the use of heterogeneous catalysts in the liquid phase as replacements for homogeneous counterparts. This work describes an attempt to move in that direction, applying SFG to study the solid-liquid interface under conditions of catalytic alcohol oxidation on platinum.

  19. Sum Frequency Generation Vibrational Spectroscopy of 1,3-Butadiene Hydrogenation on 4 nm Pt@SiO 2 , Pd@SiO 2 , and Rh@SiO 2 Core–Shell Catalysts

    KAUST Repository

    Krier, James M.

    2015-01-14

    © 2014 American Chemical Society. 1,3-Butadiene (1,3-BD) hydrogenation was performed on 4 nm Pt, Pd, and Rh nanoparticles (NPs) encapsulated in SiO2 shells at 20, 60, and 100 °C. The core-shells were grown around polyvinylpyrrolidone (PVP) coated NPs (Stöber encapsulation) prepared by colloidal synthesis. Sum frequency generation (SFG) vibrational spectroscopy was performed to correlate surface intermediates observed in situ with reaction selectivity. It is shown that calcination is effective in removing PVP, and the SFG signal can be generated from the metal surface. Using SFG, it is possible to compare the surface vibrational spectrum of Pt@SiO2 (1,3-BD is hydrogenated through multiple paths and produces butane, 1-butene, and cis/trans-2-butene) to Pd@SiO2 (1,3-BD favors one path and produces 1-butene and cis/trans-2-butene). In contrast to Pt@SiO2 and Pd@SiO2, SFG and kinetic experiments of Rh@SiO2 show a permanent accumulation of organic material.

  20. Intrinsic chirality and prochirality at Air/R-(+)- and S-(-)-limonene interfaces: spectral signatures with interference chiral sum-frequency generation vibrational spectroscopy.

    Science.gov (United States)

    Fu, Li; Zhang, Yun; Wei, Zhe-Hao; Wang, Hong-Fei

    2014-09-01

    We report in this work detailed measurements of the chiral and achiral sum-frequency vibrational spectra in the C-H stretching vibration region (2800-3050 cm(-1)) of the air/liquid interfaces of R-(+)-limonene and S-(-)-limonene, using the recently developed high-resolution broadband sum-frequency generation vibrational spectroscopy (HR-BB-SFG-VS). The achiral SFG spectra of R-limonene and S-limonene, as well as the RS racemic mixture (50/50 equal amount mixture), show that the corresponding molecular groups of the R and S enantiomers are with the same interfacial orientations. The interference chiral SFG spectra of the limonene enantiomers exhibit a spectral signature from the chiral response of the Cα-H stretching mode, and a spectral signature from the prochiral response of the CH(2) asymmetric stretching mode, respectively. The chiral spectral feature of the Cα-H stretching mode changes sign from R-(+)-limonene to S-(-)-limonene surfaces, and disappears for the RS racemic mixture surface. While the prochiral spectral feature of the CH(2) asymmetric stretching mode is the same for R-(+)-limonene and S-(-)-limonene surfaces, and also surprisingly remains the same for the RS racemic mixture surface. Therefore, the structures of the R-(+)-limonene and the S-(-)-limonene at the liquid interfaces are nevertheless not mirror images to each other, even though the corresponding groups have the same tilt angle from the interfacial normal, i.e., the R-(+)-limonene and the S-(-)-limonene at the surface are diastereomeric instead of enantiomeric. These results provide detailed information in understanding the structure and chirality of molecular interfaces and demonstrate the sensitivity and potential of SFG-VS as a unique spectroscopic tool for chirality characterization and chiral recognition at the molecular interface.

  1. Catalyzed hydrogenation of nitrogen and ethylene on metal (Fe, Pt) single crystal surfaces and effects of coadsorption: A sum frequency generation vibrational spectroscopy study

    Energy Technology Data Exchange (ETDEWEB)

    Westerberg, Staffan Per Gustav [Univ. of California, Berkeley, CA (United States)

    2004-01-01

    High-pressure catalytic reactions and associated processes, such as adsorption have been studied on a molecular level on single crystal surfaces. Sum Frequency Generation (SFG) vibrational spectroscopy together with Auger Electron Spectroscopy (AES), Temperature Programmed Desorption (TPD) and Gas Chromatography (GC) were used to investigate the nature of species on catalytic surfaces and to measure the catalytic reaction rates. Special attention has been directed at studying high-pressure reactions and in particular, ammonia synthesis in order to identify reaction intermediates and the influence of adsorbates on the surface during reaction conditions. The adsorption of gases N2, H2, O2 and NH3 that play a role in ammonia synthesis have been studied on the Fe(111) crystal surface by sum frequency generation vibrational spectroscopy using an integrated Ultra-High Vacuum (UHV)/high-pressure system. SFG spectra are presented for the dissociation intermediates, NH2 (~3325 cm-1) and NH (~3235 cm-1) under high pressure of ammonia (200 Torr) on the clean Fe(111) surface. Addition of 0.5 Torr of oxygen to 200 Torr of ammonia does not significantly change the bonding of dissociation intermediates to the surface. However, it leads to a phase change of nearly 180° between the resonant and non-resonant second order non-linear susceptibility of the surface, demonstrated by the reversal of the SFG spectral features. Heating the surface in the presence of 200 Torr ammonia and 0.5 Torr oxygen reduces the oxygen coverage, which can be seen from the SFG spectra as another relative phase change of 180°. The reduction of the oxide is also supported by Auger electron spectroscopy. The result suggests that the phase change of the spectral features could serve as a sensitive indicator of the chemical environment of the adsorbates.

  2. Catalyzed hydrogenation of nitrogen and ethylene on metal (Fe, Pt) single crystal surfaces and effects of coadsorption: A sum frequency generation vibrational spectroscopy study

    Energy Technology Data Exchange (ETDEWEB)

    Westerberg, Staffan Per Gustav

    2004-12-15

    High-pressure catalytic reactions and associated processes, such as adsorption have been studied on a molecular level on single crystal surfaces. Sum Frequency Generation (SFG) vibrational spectroscopy together with Auger Electron Spectroscopy (AES), Temperature Programmed Desorption (TPD) and Gas Chromatography (GC) were used to investigate the nature of species on catalytic surfaces and to measure the catalytic reaction rates. Special attention has been directed at studying high-pressure reactions and in particular, ammonia synthesis in order to identify reaction intermediates and the influence of adsorbates on the surface during reaction conditions. The adsorption of gases N{sub 2}, H{sub 2}, O{sub 2} and NH{sub 3} that play a role in ammonia synthesis have been studied on the Fe(111) crystal surface by sum frequency generation vibrational spectroscopy using an integrated Ultra-High Vacuum (UHV)/high-pressure system. SFG spectra are presented for the dissociation intermediates, NH{sub 2} ({approx}3325 cm{sup -1}) and NH ({approx}3235 cm{sup -1}) under high pressure of ammonia (200 Torr) on the clean Fe(111) surface. Addition of 0.5 Torr of oxygen to 200 Torr of ammonia does not significantly change the bonding of dissociation intermediates to the surface. However, it leads to a phase change of nearly 180{sup o} between the resonant and non-resonant second order non-linear susceptibility of the surface, demonstrated by the reversal of the SFG spectral features. Heating the surface in the presence of 200 Torr ammonia and 0.5 Torr oxygen reduces the oxygen coverage, which can be seen from the SFG spectra as another relative phase change of 180{sup o}. The reduction of the oxide is also supported by Auger electron spectroscopy. The result suggests that the phase change of the spectral features could serve as a sensitive indicator of the chemical environment of the adsorbates.

  3. Extracting structural information from the polarization dependence of one- and two-dimensional sum frequency generation spectra.

    Science.gov (United States)

    Laaser, Jennifer E; Zanni, Martin T

    2013-07-25

    We present ways in which pulse sequences and polarizations can be used to extract structural information from one- and two-dimensional vibrational sum frequency generation (2D SFG) spectra. We derive analytic expressions for the polarization dependence of systems containing coupled vibrational modes, and we present simulated spectra to identify the features of different molecular geometries. We discuss several useful polarization combinations for suppressing strong diagonal peaks and emphasizing weaker cross-peaks. We investigate unique capabilities of 2D SFG spectra for obtaining structural information about SFG-inactive modes and for identifying coupled achiral chromophores. This work builds on techniques that have been developed for extracting structural information from 2D IR spectra. This paper discusses how to utilize these concepts in 2D SFG experiments to probe multioscillator systems at interfaces. The sample code for calculating polarization dependence of 1D and 2D SFG spectra is provided in the Supporting Information .

  4. Sum Frequency Generation Studies of Hydrogenation Reactions on Platinum Nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Krier, James M. [Univ. of California, Berkeley, CA (United States)

    2013-08-31

    Sum Frequency Generation (SFG) vibrational spectroscopy is used to characterize intermediate species of hydrogenation reactions on the surface of platinum nanoparticle catalysts. In contrast to other spectroscopy techniques which operate in ultra-high vacuum or probe surface species after reaction, SFG collects information under normal conditions as the reaction is taking place. Several systems have been studied previously using SFG on single crystals, notably alkene hydrogenation on Pt(111). In this thesis, many aspects of SFG experiments on colloidal nanoparticles are explored for the first time. To address spectral interference by the capping agent (PVP), three procedures are proposed: UV cleaning, H2 induced disordering and calcination (core-shell nanoparticles). UV cleaning and calcination physically destroy organic capping while disordering reduces SFG signal through a reversible structural change by PVP.

  5. In Situ Adsorption Studies at the Solid/Liquid Interface:Characterization of Biological Surfaces and Interfaces Using SumFrequency Generation Vibrational Spectroscopy, Atomic Force Microscopy,and Quartz Crystal Microbalance

    Energy Technology Data Exchange (ETDEWEB)

    Phillips, Diana Christine [Univ. of California, Berkeley, CA (United States)

    2006-01-01

    Sum frequency generation (SFG) vibrational spectroscopy, atomic force microscopy (AFM), and quartz crystal microbalance (QCM) have been used to study the molecular surface structure, surface topography and mechanical properties, and quantitative adsorbed amount of biological molecules at the solid-liquid interface. The molecular-level behavior of designed peptides adsorbed on hydrophobic polystyrene and hydrophilic silica substrates has been examined as a model of protein adsorption on polymeric biomaterial surfaces. Proteins are such large and complex molecules that it is difficult to identify the features in their structure that lead to adsorption and interaction with solid surfaces. Designed peptides which possess secondary structure provide simple model systems for understanding protein adsorption. Depending on the amino acid sequence of a peptide, different secondary structures (α-helix and β-sheet) can be induced at apolar (air/liquid or air/solid) interfaces. Having a well-defined secondary structure allows experiments to be carried out under controlled conditions, where it is possible to investigate the affects of peptide amino acid sequence and chain length, concentration, buffering effects, etc. on adsorbed peptide structure. The experiments presented in this dissertation demonstrate that SFG vibrational spectroscopy can be used to directly probe the interaction of adsorbing biomolecules with a surface or interface. The use of well designed model systems aided in isolation of the SFG signal of the adsorbing species, and showed that surface functional groups of the substrate are sensitive to surface adsorbates. The complementary techniques of AFM and QCM allowed for deconvolution of the effects of surface topography and coverage from the observed SFG spectra. Initial studies of biologically relevant surfaces are also presented: SFG spectroscopy was used to study the surface composition of common soil bacteria for use in bioremediation of nuclear waste.

  6. Sum-Frequency Generation from Chiral Media and Interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Ji, Na [Univ. of California, Berkeley, CA (United States)

    2006-02-13

    Sum frequency generation (SFG), a second-order nonlinear optical process, is electric-dipole forbidden in systems with inversion symmetry. As a result, it has been used to study chiral media and interfaces, systems intrinsically lacking inversion symmetry. This thesis describes recent progresses in the applications of and new insights into SFG from chiral media and interfaces. SFG from solutions of chiral amino acids is investigated, and a theoretical model explaining the origin and the strength of the chiral signal in electronic-resonance SFG spectroscopy is discussed. An interference scheme that allows us to distinguish enantiomers by measuring both the magnitude and the phase of the chiral SFG response is described, as well as a chiral SFG microscope producing chirality-sensitive images with sub-micron resolution. Exploiting atomic and molecular parity nonconservation, the SFG process is also used to solve the Ozma problems. Sum frequency vibrational spectroscopy is used to obtain the adsorption behavior of leucine molecules at air-water interfaces. With poly(tetrafluoroethylene) as a model system, we extend the application of this surface-sensitive vibrational spectroscopy to fluorine-containing polymers.

  7. Resonance Photon Generation in a Vibrating Cavity

    CERN Document Server

    Dodonov, V V

    1998-01-01

    The problem of photon creation from vacuum due to the nonstationary Casimir effect in an ideal one-dimensional Fabry--Perot cavity with vibrating walls is solved in the resonance case, when the frequency of vibrations is close to the frequency of some unperturbed electromagnetic mode: $\\omega_w=p(\\pi c/L_0)(1+\\delta)$, $|\\delta|\\ll 1$, (p=1,2,...). An explicit analytical expression for the total energy in all the modes shows an exponential growth if $|\\delta|$ is less than the dimensionless amplitude of vibrations $\\epsilon\\ll 1$, the increment being proportional to $p\\sqrt{\\epsilon^2-\\delta^2}$. The rate of photon generation from vacuum in the (j+ps)th mode goes asymptotically to a constant value $cp^2\\sin^2(\\pi j/p)\\sqrt{\\epsilon^2-\\delta^2}/[\\pi L_0 (j+ps)]$, the numbers of photons in the modes with indices p,2p,3p,... being the integrals of motion. The total number of photons in all the modes is proportional to $p^3(\\epsilon^2-\\delta^2) t^2$ in the short-time and in the long-time limits. In the case of st...

  8. Molecular interactions of proteins and peptides at interfaces studied by sum frequency generation vibrational spectroscopy.

    Science.gov (United States)

    Liu, Yuwei; Jasensky, Joshua; Chen, Zhan

    2012-01-31

    Interfacial peptides and proteins are critical in many biological processes and thus are of interest to various research fields. To study these processes, surface sensitive techniques are required to completely describe different interfacial interactions intrinsic to many complicated processes. Sum frequency generation (SFG) spectroscopy has been developed into a powerful tool to investigate these interactions and mechanisms of a variety of interfacial peptides and proteins. It has been shown that SFG has intrinsic surface sensitivity and the ability to acquire conformation, orientation, and ordering information about these systems. This paper reviews recent studies on peptide/protein-substrate interactions, peptide/protein-membrane interactions, and protein complexes at interfaces and demonstrates the ability of SFG on unveiling the molecular pictures of complicated interfacial biological processes. © 2011 American Chemical Society

  9. Orientations of nonlocal vibrational modes from combined experimental and theoretical sum frequency spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Chase, Hilary M.; Chen, Shunli; Fu, Li; Upshur, Mary Alice; Rudshteyn, Benjamin; Thomson, Regan J.; Wang, Hong-Fei; Batista, Victor S.; Geiger, Franz M.

    2017-09-01

    Inferring molecular orientations from vibrational sum frequency generation (SFG) spectra is challenging in polarization combinations that result in low signal intensities, or when the local point group symmetry approximation fails. While combining experiments with density functional theory (DFT) could overcome this problem, the scope of the combined method has yet to be established. Here, we assess its feasibility of determining the distributions of molecular orientations for one monobasic ester, two epoxides and three alcohols at the vapor/fused silica interface. We find that molecular orientations of nonlocal vibrational modes cannot be determined using polarization-resolved SFG measurements alone.

  10. Statistical mechanics of sum frequency generation spectroscopy for the liquid-vapor interface of dilute aqueous salt solutions

    Energy Technology Data Exchange (ETDEWEB)

    Noah-Vanhoucke, Joyce; Smith, Jared D.; Geissler, Phillip L.

    2009-01-02

    We demonstrate a theoretical description of vibrational sum frequency generation (SFG) at the boundary of aqueous electrolyte solutions. This approach identifies and exploits a simple relationship between SFG lineshapes and the statistics of molecular orientation and electric field. Our computer simulations indicate that orientational averages governing SFG susceptibility do not manifest ion-specific shifts in local electric field, but instead, ion-induced polarization of subsurface layers. Counterbalancing effects are obtained for monovalent anions and cations at the same depth. Ions held at different depths induce an imbalanced polarization, suggesting that ion-specific effects can arise from weak, long ranged influence on solvent organization.

  11. Statistical mechanics of sum frequency generation spectroscopy for the liquid-vapor interface of dilute aqueous salt solutions

    Science.gov (United States)

    Noah-Vanhoucke, Joyce; Smith, Jared D.; Geissler, Phillip L.

    2009-02-01

    We demonstrate a theoretical description of vibrational sum frequency generation (SFG) at the boundary of aqueous electrolyte solutions. This approach identifies and exploits a simple relationship between SFG lineshapes and the statistics of molecular orientation and electric field. Our computer simulations indicate that orientational averages governing SFG susceptibility do not manifest ion-specific shifts in local electric field, but instead, ion-induced polarization of subsurface layers. Counterbalancing effects are obtained for monovalent anions and cations at the same depth. Ions held at different depths induce an imbalanced polarization, suggesting that ion-specific effects can arise from weak, long-ranged influence on solvent organization.

  12. Vibrational Mode Assignment of α-Pinene by Isotope Editing: One Down, Seventy-One To Go

    Energy Technology Data Exchange (ETDEWEB)

    Upshur, Mary Alice; Chase, Hilary M.; Strick, Benjamin F.; Ebben, Carlena J.; Fu, Li; Wang, Hongfei; Thomson, Regan J.; Geiger, Franz M.

    2016-05-05

    This study aims to reliably assign the vibrational sum frequency generation (SFG) spectrum of α-pinene at the vapor/solid interface using a method involving deuteration of various methyl groups. The synthesis of five different deuterated isotopologues of α-pinene is presented in order to determine the impact that removing contributions from methyl group C$-$H oscillators has on its SFG response. 0.6 cm-1 Resolution SFG spectra of these isotopologues show varying degrees of differences in the C–H stretching region when compared to the SFG response of unlabeled α-pinene. The largest spectral changes were observed for the isotopologue containing a fully deuterated vinyl methyl group. Noticeable losses in signal intensities allow us to reliably assign the 2860 cm-1 peak to the vinyl methyl symmetric stretch. Furthermore, upon removing the vinyl methyl group entirely by synthesizing apopinene, the steric influence of the unlabeled C9H14 fragment on the SFG response of α-pinene SFG can be readily observed. The work presented here brings us one step closer to understanding the vibrational spectroscopy of α-pinene.

  13. Non-invasive SFG spectroscopy: a tool to reveal the conformational change of grafted chains due to bacterial adhesion

    Science.gov (United States)

    Bulard, Emilie; Dubost, Henri; Fontaine-Aupart, Marie-Pierre; Zheng, Wanquan; Herry, Jean-Marie; Bellon-Fontaine, Marie-No"lle; Briandet, Romain; Bourguignon, Bernard

    2011-07-01

    In many fields such as biomedical or food industry, surface colonization by micro-organisms leads to biofilms formation that are tridimentional biostructures highly resistant to the action of antimicrobials, by mechanisms still unclear. In order to deepen our understanding of the initial interaction of bacteria cells with a solid surface, we analyze by in situ vibrational Sum Frequency Generation (SFG) spectroscopy the effect of the adhesion of hydrophilic Lactoccocus lactis bacteria and its hydrophobic mutants in distilled water on a self-assembled monolayer (SAM) of octadecanethiol (ODT) on a gold film. When a homogeneous bacterial monolayer is deposited on this ordered surface, SFG spectrum of the ODT SAM shows significant intensity changes from that in air or in water. Its modelling as a function of conformation allows to distinguish optical effects due to the water solution surrounding bacteria from conformational changes of the ODT SAM due to the presence of the bacteria cells. Futhermore, bacterial adhesion induces different measurable effects on the ODT SAM conformation, depending on the hydrophobic / hydrophilic character of the bacterial surface. Such a result deserves to be taken into account for the design of new materials with improved properties or to control biofilm formation.

  14. Vibration analysis of a hydro generator for different operating regimes

    Science.gov (United States)

    Haţiegan, C.; Pădureanu, I.; Jurcu, M.; Nedeloni, M. D.; Hamat, C. O.; Chioncel, C. P.; Trocaru, S.; Vasile, O.; Bădescu, O.; Micliuc, D.; (Filip Nedeloni, L.; Băra, A.; (Barboni Haţiegan, L.

    2017-01-01

    Based on experimental measurements, this paper presents the vibration analysis of a hydro generator that equips a Kaplan hydraulic turbine of a Hydropower plant in Romania. This analysis means vibrations measurement to different operating regimes of the hydro generator respectively before installing it and into operation, namely putting off load mode (unexcited and excited) respectively putting on load mode. By comparing, through the experimental results obtained before and after the operation of hydro aggregates are observed vibrations improvements.

  15. Surface and buried interfacial structures of epoxy resins used as underfills studied by sum frequency generation vibrational spectroscopy.

    Science.gov (United States)

    Vázquez, Anne V; Holden, Brad; Kristalyn, Cornelius; Fuller, Mike; Wilkerson, Brett; Chen, Zhan

    2011-05-01

    Flip chip technology has greatly improved the performance of semiconductor devices, but relies heavily on the performance of epoxy underfill adhesives. Because epoxy underfills are cured in situ in flip chip semiconductor devices, understanding their surface and interfacial structures is critical for understanding their adhesion to various substrates. Here, sum frequency generation (SFG) vibrational spectroscopy was used to study surface and buried interfacial structures of two model epoxy resins used as underfills in flip chip devices, bisphenol A digylcidyl ether (BADGE) and 1,4-butanediol diglycidyl ether (BDDGE). The surface structures of these epoxies were compared before and after cure, and the orientations of their surface functional groups were deduced to understand how surface structural changes during cure may affect adhesion properties. Further, the effect of moisture exposure, a known cause of adhesion failure, on surface structures was studied. It was found that the BADGE surface significantly restructured upon moisture exposure while the BDDGE surface did not, showing that BADGE adhesives may be more prone to moisture-induced delamination. Lastly, although surface structure can give some insight into adhesion, buried interfacial structures more directly correspond to adhesion properties of polymers. SFG was used to study buried interfaces between deuterated polystyrene (d-PS) and the epoxies before and after moisture exposure. It was shown that moisture exposure acted to disorder the buried interfaces, most likely due to swelling. These results correlated with lap shear adhesion testing showing a decrease in adhesion strength after moisture exposure. The presented work showed that surface and interfacial structures can be correlated to adhesive strength and may be helpful in understanding and designing optimized epoxy underfill adhesives.

  16. In-situ Studies of the Reactions of Bifunctional and Heterocyclic Molecules over Noble Metal Single Crystal and Nanoparticle Catalysts Studied with Kinetics and Sum-Frequency Generation Vibrational Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Kliewer, Christopher J. [Univ. of California, Berkeley, CA (United States)

    2009-06-30

    Sum frequency generation surface vibrational spectroscopy (SFG-VS) in combination with gas chromatography (GC) was used in-situ to monitor surface bound reaction intermediates and reaction selectivities for the hydrogenation reactions of pyrrole, furan, pyridine, acrolein, crotonaldehyde, and prenal over Pt(111), Pt(100), Rh(111), and platinum nanoparticles under Torr reactant pressures and temperatures of 300K to 450K. The focus of this work is the correlation between the SFG-VS observed surface bound reaction intermediates and adsorption modes with the reaction selectivity, and how this is affected by catalyst structure and temperature. Pyrrole hydrogenation was investigated over Pt(111) and Rh(111) single crystals at Torr pressures. It was found that pyrrole adsorbs to Pt(111) perpendicularly by cleaving the N-H bond and binding through the nitrogen. However, over Rh(111) pyrrole adsorbs in a tilted geometry binding through the {pi}-aromatic orbitals. A surface-bound pyrroline reaction intermediate was detected over both surfaces with SFG-VS. It was found that the ring-cracking product butylamine is a reaction poison over both surfaces studied. Furan hydrogenation was studied over Pt(111), Pt(100), 10 nm cubic platinum nanoparticles and 1 nm platinum nanoparticles. The product distribution was observed to be highly structure sensitive and the acquired SFG-VS spectra reflected this sensitivity. Pt(100) exhibited more ring-cracking to form butanol than Pt(111), while the nanoparticles yielded higher selectivities for the partially saturated ring dihydrofuran. Pyridine hydrogenation was investigated over Pt(111) and Pt(100). The α-pyridyl surface adsorption mode was observed with SFG-VS over both surfaces. 1,4-dihydropyridine was seen as a surface intermediate over Pt(100) but not Pt(111). Upon heating the surfaces to 350K, the adsorbed pyridine changes to a flat-lying adsorption mode. No evidence was found for the pyridinium cation. The hydrogenation of the

  17. Retrieval of complex χ((2)) parts for quantitative analysis of sum-frequency generation intensity spectra.

    Science.gov (United States)

    Hofmann, Matthias J; Koelsch, Patrick

    2015-10-07

    Vibrational sum-frequency generation (SFG) spectroscopy has become an established technique for in situ surface analysis. While spectral recording procedures and hardware have been optimized, unique data analysis routines have yet to be established. The SFG intensity is related to probing geometries and properties of the system under investigation such as the absolute square of the second-order susceptibility χ((2)) (2). A conventional SFG intensity measurement does not grant access to the complex parts of χ((2)) unless further assumptions have been made. It is therefore difficult, sometimes impossible, to establish a unique fitting solution for SFG intensity spectra. Recently, interferometric phase-sensitive SFG or heterodyne detection methods have been introduced to measure real and imaginary parts of χ((2)) experimentally. Here, we demonstrate that iterative phase-matching between complex spectra retrieved from maximum entropy method analysis and fitting of intensity SFG spectra (iMEMfit) leads to a unique solution for the complex parts of χ((2)) and enables quantitative analysis of SFG intensity spectra. A comparison between complex parts retrieved by iMEMfit applied to intensity spectra and phase sensitive experimental data shows excellent agreement between the two methods.

  18. Model Catalysis of Ammonia Synthesis ad Iron-Water Interfaces - ASum Frequency Generation Vibrational Spectroscopic Study of Solid-GasInterfaces and Anion Photoelectron Spectroscopic Study of Selected Anionclusters

    Energy Technology Data Exchange (ETDEWEB)

    Ferguson, Michael James [Univ. of California, Berkeley, CA (United States)

    2005-01-01

    The ammonia synthesis reaction has been studied using single crystal model catalysis combined with sum frequency generation (SFG) vibrational spectroscopy. The adsorption of gases N2, H2, O2 and NH3 that play a role in ammonia synthesis have been studied on the Fe(111) crystal surface by sum frequency generation vibrational spectroscopy using an integrated Ultra-High Vacuum (UHV)/high-pressure system. SFG spectra are presented for the dissociation intermediates, NH2 (~3325 cm-1) and NH (~3235 cm-1) under high pressure of ammonia or equilibrium concentrations of reactants and products on Fe(111) surfaces. Special attention was paid to understand how potassium promotion of the iron catalyst affects the intermediates of ammonia synthesis. An Fe(111) surface promoted with 0.2 monolayers of potassium red shifts the vibrational frequencies of the reactive surface intermediates, NH and NH2, providing evidence for weakened the nitrogen-hydrogen bonds relative to clean Fe(111). Spectral features of these surface intermediates persisted to higher temperatures for promoted iron surfaces than for clean Fe(111) surfaces implying that nitrogen-iron bonds are stronger for the promoted surface. The ratio of the NH to NH2 signal changed for promoted surfaces in the presence of equilibrium concentrations of reactants and products. The order of adding oxygen and potassium to promoted surfaces does not alter the spectra indicating that ammonia induces surface reconstruction of the catalyst to produce the same surface morphology. When oxygen is co-adsorbed with nitrogen, hydrogen, ammonia or potassium on Fe(111), a relative phase shift of the spectra occurs as compared to the presence of adsorbates on clean iron surfaces. Water adsorption on iron was also probed using SFG vibrational spectroscopy. For both H2O and D2O, the only spectral feature was in the range of

  19. Toward a simple molecular understanding of sum frequency generation at air-water interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Noah-Vanhoucke, Joyce; Smith, Jared D.; Geissler, Phillip L.

    2009-01-13

    Second-order vibrational spectroscopies successfully isolate signals from interfaces, but they report on intermolecular structure in a complicated and indirect way. Here we adapt a perspective on vibrational response developed for bulk spectroscopies to explore the microscopic fluctuations to which sum frequency generation (SFG), a popular surface-specific measurement, is most sensitive. We focus exclusively on inhomogeneous broadening of spectral susceptibilities for OH stretching of HOD as a dilute solute in D{sub 2}O. Exploiting a simple connection between vibrational frequency shifts and an electric field variable, we identify several functions of molecular orientation whose averages govern SFG. The frequency-dependence of these quantities is well captured by a pair of averages, involving alignment of OH and OD bonds with the surface normal at corresponding values of the electric field. The approximate form we obtain for SFG susceptibility highlights a dramatic sensitivity to the way a simulated liquid slab is partitioned for calculating second-order response.

  20. Capacitance-Based Frequency Adjustment of Micro Piezoelectric Vibration Generator

    Directory of Open Access Journals (Sweden)

    Xinhua Mao

    2014-01-01

    Full Text Available Micro piezoelectric vibration generator has a wide application in the field of microelectronics. Its natural frequency is unchanged after being manufactured. However, resonance cannot occur when the natural frequencies of a piezoelectric generator and the source of vibration frequency are not consistent. Output voltage of the piezoelectric generator will sharply decline. It cannot normally supply power for electronic devices. In order to make the natural frequency of the generator approach the frequency of vibration source, the capacitance FM technology is adopted in this paper. Different capacitance FM schemes are designed by different locations of the adjustment layer. The corresponding capacitance FM models have been established. Characteristic and effect of the capacitance FM have been simulated by the FM model. Experimental results show that the natural frequency of the generator could vary from 46.5 Hz to 42.4 Hz when the bypass capacitance value increases from 0 nF to 30 nF. The natural frequency of a piezoelectric vibration generator could be continuously adjusted by this method.

  1. Orientation determination of protein helical secondary structures using linear and nonlinear vibrational spectroscopy.

    Science.gov (United States)

    Nguyen, Khoi Tan; Le Clair, Stéphanie V; Ye, Shuji; Chen, Zhan

    2009-09-10

    In this paper, we systematically presented the orientation determination of protein helical secondary structures using vibrational spectroscopic methods, particularly, nonlinear sum frequency generation (SFG) vibrational spectroscopy, along with linear vibrational spectroscopic techniques such as infrared spectroscopy and Raman scattering. SFG amide I signals can be collected using different polarization combinations of the input laser beams and output signal beam to measure the second-order nonlinear optical susceptibility components of the helical amide I modes, which are related to their molecular hyperpolarizability elements through the orientation distribution of these helices. The molecular hyperpolarizability elements of amide I modes of a helix can be calculated based on the infrared transition dipole moment and Raman polarizability tensor of the helix; these quantities are determined by using the bond additivity model to sum over the individual infrared transition dipole moments and Raman polarizability tensors, respectively, of the peptide units (or the amino acid residues). The computed overall infrared transition dipole moment and Raman polarizability tensor of a helix can be validated by experimental data using polarized infrared and polarized Raman spectroscopy on samples with well-aligned helical structures. From the deduced SFG hyperpolarizability elements and measured SFG second-order nonlinear susceptibility components, orientation information regarding helical structures can be determined. Even though such orientation information can also be measured using polarized infrared or polarized Raman amide I signals, SFG has a much lower detection limit, which can be used to study the orientation of a helix when its surface coverage is much lower than a monolayer. In addition, the combination of different vibrational spectroscopic techniques, for example, SFG and attenuated total reflectance Fourier transform infrared spectroscopy, provides more

  2. Characterization of the molecular structure and mechanical properties of polymer surfaces and protein/polymer interfaces by sum frequency generation vibrational spectroscopy and atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Koffas, Telly Stelianos [Univ. of California, Berkeley, CA (United States)

    2004-01-01

    Sum frequency generation (SFG) vibrational spectroscopy, atomic force microscopy (AFM), and other complementary surface-sensitive techniques have been used to study the surface molecular structure and surface mechanical behavior of biologically-relevant polymer systems. SFG and AFM have emerged as powerful analytical tools to deduce structure/property relationships, in situ, for polymers at air, liquid and solid interfaces. The experiments described in this dissertation have been performed to understand how polymer surface properties are linked to polymer bulk composition, substrate hydrophobicity, changes in the ambient environment (e.g., humidity and temperature), or the adsorption of macromolecules. The correlation of spectroscopic and mechanical data by SFG and AFM can become a powerful methodology to study and engineer materials with tailored surface properties. The overarching theme of this research is the interrogation of systems of increasing structural complexity, which allows us to extend conclusions made on simpler model systems. We begin by systematically describing the surface molecular composition and mechanical properties of polymers, copolymers, and blends having simple linear architectures. Subsequent chapters focus on networked hydrogel materials used as soft contact lenses and the adsorption of protein and surfactant at the polymer/liquid interface. The power of SFG is immediately demonstrated in experiments which identify the chemical parameters that influence the molecular composition and ordering of a polymer chain's side groups at the polymer/air and polymer/liquid interfaces. In general, side groups with increasingly greater hydrophobic character will be more surface active in air. Larger side groups impose steric restrictions, thus they will tend to be more randomly ordered than smaller hydrophobic groups. If exposed to a hydrophilic environment, such as water, the polymer chain will attempt to orient more of its hydrophilic groups to

  3. Characterization of the molecular structure and mechanical properties of polymer surfaces and protein/polymer interfaces by sum frequency generation vibrational spectroscopy and atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Koffas, Telly Stelianos

    2004-05-15

    Sum frequency generation (SFG) vibrational spectroscopy, atomic force microscopy (AFM), and other complementary surface-sensitive techniques have been used to study the surface molecular structure and surface mechanical behavior of biologically-relevant polymer systems. SFG and AFM have emerged as powerful analytical tools to deduce structure/property relationships, in situ, for polymers at air, liquid and solid interfaces. The experiments described in this dissertation have been performed to understand how polymer surface properties are linked to polymer bulk composition, substrate hydrophobicity, changes in the ambient environment (e.g., humidity and temperature), or the adsorption of macromolecules. The correlation of spectroscopic and mechanical data by SFG and AFM can become a powerful methodology to study and engineer materials with tailored surface properties. The overarching theme of this research is the interrogation of systems of increasing structural complexity, which allows us to extend conclusions made on simpler model systems. We begin by systematically describing the surface molecular composition and mechanical properties of polymers, copolymers, and blends having simple linear architectures. Subsequent chapters focus on networked hydrogel materials used as soft contact lenses and the adsorption of protein and surfactant at the polymer/liquid interface. The power of SFG is immediately demonstrated in experiments which identify the chemical parameters that influence the molecular composition and ordering of a polymer chain's side groups at the polymer/air and polymer/liquid interfaces. In general, side groups with increasingly greater hydrophobic character will be more surface active in air. Larger side groups impose steric restrictions, thus they will tend to be more randomly ordered than smaller hydrophobic groups. If exposed to a hydrophilic environment, such as water, the polymer chain will attempt to orient more of its hydrophilic groups to

  4. Broad-Bandwidth Chiral Sum Frequency Generation Spectroscopy for Probing the Kinetics of Proteins at Interfaces.

    Science.gov (United States)

    Wang, Zhuguang; Fu, Li; Ma, Gang; Yan, Elsa C Y

    2015-10-27

    The kinetics of proteins at interfaces plays an important role in biological functions and inspires solutions to fundamental problems in biomedical sciences and engineering. Nonetheless, due to the lack of surface-specific and structural-sensitive biophysical techniques, it still remains challenging to probe protein kinetics in situ and in real time without the use of spectroscopic labels at interfaces. Broad-bandwidth chiral sum frequency generation (SFG) spectroscopy has been recently developed for protein kinetic studies at interfaces by tracking the chiral vibrational signals of proteins. In this article, we review our recent progress in kinetic studies of proteins at interfaces using broad-bandwidth chiral SFG spectroscopy. We illustrate the use of chiral SFG signals of protein side chains in the C-H stretch region to monitor self-assembly processes of proteins at interfaces. We also present the use of chiral SFG signals from the protein backbone in the N-H stretch region to probe the real-time kinetics of proton exchange between protein and water at interfaces. In addition, we demonstrate the applications of spectral features of chiral SFG that are typical of protein secondary structures in both the amide I and the N-H stretch regions for monitoring the kinetics of aggregation of amyloid proteins at membrane surfaces. These studies exhibit the power of broad-bandwidth chiral SFG to study protein kinetics at interfaces and the promise of this technique in research areas of surface science to address fundamental problems in biomedical and material sciences.

  5. Interferometric vibration sensor using phase-generated carrier method.

    Science.gov (United States)

    Li, Yang; Liu, Zhibo; Liu, Yan; Ma, Lin; Tan, Zhongwei; Jian, Shuisheng

    2013-09-01

    An interferometric fiber-optic vibration sensing system using the phase-generated carrier (PGC) method is proposed and experimentally demonstrated. The sensing section consists of a Sagnac interferometer combined with a Mach-Zehnder interferometer, a length of sensing fiber is shared between the two interferometers. The PGC demodulation scheme is used to demodulate the time-varying phase shifts induced by vibrations. Spatial information can be extracted from the demodulated results. A prototype sensing system with a 628 m long sensing fiber has been tested and a spatial resolution better than 12 m is successfully achieved.

  6. Study of micro piezoelectric vibration generator with added mass and capacitance suitable for broadband vibration

    Directory of Open Access Journals (Sweden)

    Qing He

    2015-07-01

    Full Text Available This study proposes an optimized frequency adjustment method that uses a micro-cantilever beam-based piezoelectric vibration generator based on a combination of added mass and capacitance. The most important concept of the proposed method is that the frequency adjustment process is divided into two steps: the first is a rough adjustment step that changes the size of the mass added at the end of cantilever to adjust the frequency in a large-scale and discontinuous manner; the second step is a continuous but short-range frequency adjustment via the adjustable added capacitance. Experimental results show that when the initial natural frequency of a micro piezoelectric vibration generator is 69.8 Hz, then this natural frequency can be adjusted to any value in the range from 54.2 Hz to 42.1 Hz using the combination of the added mass and the capacitance. This method simply and effectively matches a piezoelectric vibration generator’s natural frequency to the vibration source frequency.

  7. Study of micro piezoelectric vibration generator with added mass and capacitance suitable for broadband vibration

    Energy Technology Data Exchange (ETDEWEB)

    He, Qing, E-mail: hqng@163.com; Mao, Xinhua, E-mail: 30400414@qq.com; Chu, Dongliang, E-mail: 569256386@qq.com [School of Energy, Power and Mechanical Engineering, North China Electric Power University, Beijing 102206 (China)

    2015-07-15

    This study proposes an optimized frequency adjustment method that uses a micro-cantilever beam-based piezoelectric vibration generator based on a combination of added mass and capacitance. The most important concept of the proposed method is that the frequency adjustment process is divided into two steps: the first is a rough adjustment step that changes the size of the mass added at the end of cantilever to adjust the frequency in a large-scale and discontinuous manner; the second step is a continuous but short-range frequency adjustment via the adjustable added capacitance. Experimental results show that when the initial natural frequency of a micro piezoelectric vibration generator is 69.8 Hz, then this natural frequency can be adjusted to any value in the range from 54.2 Hz to 42.1 Hz using the combination of the added mass and the capacitance. This method simply and effectively matches a piezoelectric vibration generator’s natural frequency to the vibration source frequency.

  8. Interfacial Water Structure in Langmuir Monolayer and Gibbs Layer Probed by Sum Frequency Generation Vibrational Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    张贞; 郭源

    2012-01-01

    Langmuir monolayer and Gibbs layer exhibit surface-active properties and it can be used as simple model systems to investigate the physicochemical properties of biological membranes. In this report, we presented the OH stretching vibration of H2O in the 4"-n-pentyl-4-cyano-p-terphenyl (5CT), nonadecanenitrile (C18CN) Langmuir monolayer and compared them with CH3CN Gibbs layer at the air/water interface with polarization SFG-VS. This study demonstrated that the hydrogen bond network is different in the Langmuir monolayer of 5CT, C18CN from CH3CN Gibbs layer at the air/water interface which showed two different water structures on the different surface layer. The results provided a deeper insight into understanding the hydrogen bond on the interfaces.

  9. INFLUENCE OF VIBRATIONS AND DYNAMIC CHARACTERIZATION OF THE HUMAN BODY GENERATED BY CARS

    Directory of Open Access Journals (Sweden)

    Bogdan Andrei BARBU

    2011-05-01

    Full Text Available Vibrations influence the human body in many different ways. The response to a vibration exposure is primarily dependent on the frequency, amplitude, and duration of exposure. This paper studies the influence of vibrations generated by automobiles on the human body, taking into account both amplitude and especially the frequency of these vibrations. Measurement of these vibrations was made through the acquisition of latest equipment by acquiring tridimensional signals.

  10. Vibrational spectroscopy of water interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Du, Quan [Univ. of California, Berkeley, CA (United States)

    1994-12-01

    The second order nonlinear optical processes of second harmonic generation and sum frequency generation are powerful and versatile tools for studying all kinds of surfaces. They possess unusual surface sensitivity due to the symmetry properties of the second order nonlinear susceptibility. The technique of infrared-visible sum frequency generation (SFG) is particularly attractive because it offers a viable way to do vibrational spectroscopy on any surfaces accessible to light with submonolayer sensitivity. In this thesis, the author applies SFG to study a number of important water interfaces. At the air/water interface, hydrophobic solid/water and liquid/water interfaces, it was found that approximately 25% of surface water molecules have one of their hydrogen pointing away from the liquid water. The large number of unsatisfied hydrogen bonds contributes significantly to the large interfacial energy of the hydrophobic surfaces. At the hydrophilic fused quartz/water interface and a fatty acid monolayer covered water surface, the structure and orientation of surface water molecules are controlled by the hydrogen bonding of water molecules with the surface OH groups and the electrostatic interaction with the surface field from the ionization of surface groups. A change of pH value in the bulk water can significantly change the relative importance of the two interactions and cause a drastic change in orientation of the surface water molecules. SFG has also been applied to study the tribological response of some model lubricant films. Monolayers of Langmuir-Blodgett films were found to disorder orientationaly under mildly high pressure and recover promptly upon removal of the applied pressure.

  11. Local Environment and Interactions of Liquid and Solid Interfaces Revealed by Spectral Line Shape of Surface Selective Nonlinear Vibrational Probe

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Shun-Li; Fu, Li; Chase, Zizwe A.; Gan, Wei; Wang, Hong-Fei

    2016-11-10

    Vibrational spectral lineshape contains important detailed information of molecular vibration and reports its specific interactions and couplings to its local environment. In this work, recently developed sub-1 cm-1 high-resolution broadband sum frequency generation vibrational spectroscopy (HR-BB-SFG-VS) was used to measure the -C≡N stretch vibration in the 4-n-octyl-4’-cyanobiphenyl (8CB) Langmuir or Langmuir-Blodgett (LB) monolayer as a unique vibrational probe, and the spectral lineshape analysis revealed the local environment and interactions at the air/water, air/glass, air/calcium fluoride and air/-quartz interfaces for the first time. The 8CB Langmuir or LB film is uniform and the vibrational spectral lineshape of its -C≡N group has been well characterized, making it a good choice as the surface vibrational probe. Lineshape analysis of the 8CB -C≡N stretch SFG vibrational spectra suggests the coherent vibrational dynamics and the structural and dynamic inhomogeneity of the -C≡N group at each interface are uniquely different. In addition, it is also found that there are significantly different roles for water molecules in the LB films on different substrate surfaces. These results demonstrated the novel capabilities of the surface nonlinear spectroscopy in characterization and in understanding the specific structures and chemical interactions at the liquid and solid interfaces in general.

  12. GENERATOR VIBRATION FAULT DIAGNOSIS METHOD BASED ON ROTOR VIBRATION AND STATOR WINDING PARALLEL BRANCHES CIRCULATING CURRENT CHARACTERISTICS

    Institute of Scientific and Technical Information of China (English)

    Wan Shuting; Li Heming; Li Yonggang; Tang Guiji

    2005-01-01

    Rotor vibration characteristics are first analyzed, which are that the rotor vibration of fundamental frequency will increase due to rotor winding inter-turn short circuit fault, air-gap dynamic eccentricity fault, or imbalance fault, and the vibration of the second frequency will increase when the air-gap static eccentricity fault occurs. Next, the characteristics of the stator winding parallel branches circulating current are analyzed, which are that the second harmonics circulating current will increase when the rotor winding inter-turn short circuit fault occurs, and the fundamental circulating current will increase when the air-gap eccentricity fault occurs, neither being strongly affected by the imbalance fault. Considering the differences of the rotor vibration and circulating current characteristics caused by different rotor faults, a method of generator vibration fault diagnosis, based on rotor vibration and circulating current characteristics, is developed. Finally, the rotor vibration and circulating current of a type SDF-9 generator is measured in the laboratory to verify the theoretical analysis presented above.

  13. The Optimum Vibration Generator for the Technological Process in Casting Bays

    Directory of Open Access Journals (Sweden)

    Codruţa-Oana Hamat

    2008-01-01

    Full Text Available The performing of some experimental investigations caucering theapplication of vibrations to the technological processes in foundries has required in the first place a vibration generator. By an analysis of the existent generator types it has been established that the optimum generator for these processes is the pneumatic ball-generator. In the work the principle of functioning of this kind of generator is treated and the dimensional and functional characteristics for two realized prototypes are given.

  14. Piezoelectric generator based on torsional modes for power harvesting from angular vibrations

    Institute of Scientific and Technical Information of China (English)

    CHEN Zi-guang; HU Yuan-tai; YANG Jia-shi

    2007-01-01

    Torsional vibration of a circular piezoelectric shell of polarized ceramics mounted on a rotationally vibrating base is analyzed. The shell is properly electroded and connected to a circuit such that an electric output is generated. The structure analyzed represents a piezoelectric generator for converting mechanical energy from angular vibrations to electrical energy. Analytical expressions and numerical results for the output voltage, current, power, efficiency and power density are given.

  15. Absolute Orientation of Molecules with Competing Hydrophilic Head Groups at the Air/Water Interface Probed with Sum Frequency Generation Vibrational Spectroscopy

    Institute of Scientific and Technical Information of China (English)

    Feng Wang; Zhi Huang; Zhifeng Cui; Hongfei Wang

    2009-01-01

    The constructive or destructive spectral interference between the molecular groups oriented up and down at the interface in the sum-frequency generation (SFG) spectra provides a direct measurement of the absolute orientation of these molecular groups. This simple approach can be employed to interrogate absolute molecular orientations other than using the complex absolute phase measurement in the SFG studies. We used the -CN group in the p-cyanophenol (PCP) molecule as the internal phase standard, and we measured the phases of the SFG fields of the -CN groups in the 3,5-dimethyl-4-hydroxy-benzonitrile (35DMHBN)and 2,6-dimethyl-4-hydroxy-benzonitrile (26DMHBN) at the air/water interface by measuring the SFG spectra of the aqueous surfaces of the mixtures of the PCP, 35DMHBN, and 26DMHBN solutions. The results showed that the 35DMHBN had its -CN group pointing into the aqueous phase; while the 26DMHBN, similar to the PCP, had its -CN group pointing away from the aqueous phase. The tilt angles of the -CN group for both the 35DMHBN and 26DMHBN molecules at the air/water interface were around 25°-45° from the interface normal. These results provided insights on the understanding of the detailed balance of the competing factors, such as solvation of the polar head groups, hydrogen bonding and hydrophobic effects, etc., on influencing the absolute molecular orientation at the air/water interface.

  16. Sum frequency generation spectroscopy study of hydrogenated stepped Si(111) surfaces made by molecular hydrogen exposure

    Science.gov (United States)

    Hien, K. T. T.; Sattar, M. A.; Miyauchi, Y.; Mizutani, G.; Rutt, H. N.

    2017-09-01

    Hydrogen adsorption on stepped Si(111) surfaces 9.5° miscut in the [ 1 ̅ 1 ̅ 2 ] direction has been investigated in situ in a UHV chamber with a base pressure of 10-8 Pa. The H-Si(111)1×1 surface was prepared by exposing the wafer to ultra-pure hydrogen gas at a pressure of 470 Pa. Termination of hydrogen on terraces and steps was observed by sum frequency generation (SFG) with several polarization combinations such as ppp, ssp, pps, spp, psp, sps, pss and sss. Here the 1st, 2nd and 3rd symbols indicate SFG, visible and IR polarizations, respectively. ppp and ssp-SFG clearly showed only two modes: the Si-H stretching vibration terrace mode at 2082 cm-1 (A) and the vertical step dihydride vibration mode at 2094 cm-1 (C1). Interesting points are the appearance of the C1 mode in contrast to the previous SFG spectrum of the H-Si(111)1×1 surface with the same miscut surface angle prepared by wet chemical etching. We suggest that the formation of step dihydride and its orientation on the Si(111) stepped surfaces depend strongly on the preparation method.

  17. ACO-Initialized Wavelet Neural Network for Vibration Fault Diagnosis of Hydroturbine Generating Unit

    Directory of Open Access Journals (Sweden)

    Zhihuai Xiao

    2015-01-01

    Full Text Available Considering the drawbacks of traditional wavelet neural network, such as low convergence speed and high sensitivity to initial parameters, an ant colony optimization- (ACO- initialized wavelet neural network is proposed in this paper for vibration fault diagnosis of a hydroturbine generating unit. In this method, parameters of the wavelet neural network are initialized by the ACO algorithm, and then the wavelet neural network is trained by the gradient descent algorithm. Amplitudes of the frequency components of the hydroturbine generating unit vibration signals are used as feature vectors for wavelet neural network training to realize mapping relationship from vibration features to fault types. A real vibration fault diagnosis case result of a hydroturbine generating unit shows that the proposed method has faster convergence speed and stronger generalization ability than the traditional wavelet neural network and ACO wavelet neural network. Thus it can provide an effective solution for online vibration fault diagnosis of a hydroturbine generating unit.

  18. A MEMS-Based Piezoelectric Power Generator for Low Frequency Vibration Energy Harvesting

    Institute of Scientific and Technical Information of China (English)

    FANG Hua-Bin; LIU Jing-Quan; XU Zheng-Yi; DONG Lu; CHEN Di; CAI Bing-Chu; LIU Yue

    2006-01-01

    @@ A novel power generator has been achieved to convert vibration to electrical energy via the piezoelectric effect. The generator obtained by micro fabrication process mainly consists of silicon based frame and composite cantilever.The prototype tested at resonant vibration generates 1.15 μ W of effective power to a 20.4-kΩ resistance load. The potential of this work is to offer miniaturization solutions for power generators, and with the proposed method the ambient ubiquitous vibration can be harvested effectively as endless energy source to form an integrated self-powering system.

  19. Automatic Generation of Analytic Equations for Vibrational and Rovibrational Constants from Fourth-Order Vibrational Perturbation Theory

    Science.gov (United States)

    Matthews, Devin A.; Gong, Justin Z.; Stanton, John F.

    2014-06-01

    The derivation of analytic expressions for vibrational and rovibrational constants, for example the anharmonicity constants χij and the vibration-rotation interaction constants α^B_r, from second-order vibrational perturbation theory (VPT2) can be accomplished with pen and paper and some practice. However, the corresponding quantities from fourth-order perturbation theory (VPT4) are considerably more complex, with the only known derivations by hand extensively using many layers of complicated intermediates and for rotational quantities requiring specialization to orthorhombic cases or the form of Watson's reduced Hamiltonian. We present an automatic computer program for generating these expressions with full generality based on the adaptation of an existing numerical program based on the sum-over-states representation of the energy to a computer algebra context. The measures taken to produce well-simplified and factored expressions in an efficient manner are discussed, as well as the framework for automatically checking the correctness of the generated equations.

  20. Energy harvesting from wood floor vibration using a piezoelectric generator

    Science.gov (United States)

    Jiangming Kan; Robert J. Ross; Xiping Wang; Wenbin Li

    2017-01-01

    Vibration can occur in wood floor systems as a consequence of a variety of human activities, ranging from common daily movements associated with individuals living in homes to high-intensity activities associated with sporting events that are held in large sports arenas. For example, the potential for harvesting energy from a wooden floor system in public buildings...

  1. U-shape magnetostrictive vibration based power generator for universal use

    Science.gov (United States)

    Ueno, T.

    2016-04-01

    Vibrational power generator extracts electrical energy from ambient vibration. Author invented novel configuration using magnetostrictive material. The device is based on parallel beams of iron-gallium alloy and magnetic material, and features high efficiency, high robustness, and low electrical impedance. In this paper, author proposes U-shape generator for universal use. It consists of the parallel beams and fixed and free end beams forming U-shape frame flexibly modified for variety of mechanical input. Miniature U-shape prototype using Fe-Ga rod 6 by 0.5 by 13 mm3 exhibited average power of 3.7 mW under vibration of 166 Hz and 2.5 G. L-shape type was demonstrated to generate electromotive force by two directional vibrations. In switch type, maximum energy of 0.7 mJ was retrieved by one pushing force. The performances are sufficient to drive wireless module for heath monitoring and remote control.

  2. Theoretical Investigation of C-H Vibrational Spectroscopy. 1. Modeling of Methyl and Methylene Groups of Ethanol with Different Conformers.

    Science.gov (United States)

    Wang, Lin; Ishiyama, Tatsuya; Morita, Akihiro

    2017-09-14

    A flexible and polarizable molecular model of ethanol is developed to extend our investigation of thermodynamic, structural, and vibrational properties of the liquid and interface. A molecular dynamics (MD) simulation with the present model confirmed that this model well reproduces a number of properties of liquid ethanol, including density, heat of vaporization, surface tension, molecular dipole moment, and trans/gauche ratio. In particular, the present model can describe vibrational IR, Raman, and sum frequency generation (SFG) spectra of ethanol and partially deuterated analogues with reliable accuracy. The improved accuracy is largely attributed to proper modeling of the conformational dependence and the intramolecular couplings including Fermi resonance in C-H vibrations. Precise dependence of torsional motions is found to be critical in representing vibrational spectra of the C-H bending. This model allows for further vibrational analysis of complicated alkyl groups widely observed in various organic molecules with MD simulation.

  3. Detection of generator bearing inner race creep by means of vibration and temperature analysis

    DEFF Research Database (Denmark)

    Skrimpas, Georgios Alexandros; Dragiev, Ivaylo G.; Hilmisson, Reynir

    2015-01-01

    damages and development. Detection of bearing creep can be achieved reliably based on continuous trending of the amplitude of vibration running speed harmonic and temperature absolute values. In order to decrease the number of condition indicators which need to be assessed, it is proposed to exploit......Vibration and temperature analysis are the two dominating condition monitoring techniques applied to fault detection of bearing failures in wind turbine generators. Relative movement between the bearing inner ring and generator axle is one of the most severe failure modes in terms of secondary...... a weighted average descriptor calculated based on the 3rd up to 6th harmonic orders. Two cases of different bearing creep severity are presented, showing the consistency of the combined vibration and temperature data utilization. In general, vibration monitoring reveals early signs of abnormality several...

  4. Role of structural noise in aircraft pressure cockpit from vibration action of new-generation engines

    Science.gov (United States)

    Baklanov, V. S.

    2016-07-01

    The evolution of new-generation aircraft engines is transitioning from a bypass ratio of 4-6 to an increased ratio of 8-12. This is leading to substantial broadening of the vibration spectrum of engines with a shift to the low-frequency range due to decreased rotation speed of the fan rotor, in turn requiring new solutions to decrease structural noise from engine vibrations to ensure comfort in the cockpits and cabins of aircraft.

  5. Pattern Matching of Harmonic Vibrations in Nonlinearly Generated Acoustic Modes in Bovine Bone Samples

    Science.gov (United States)

    Alippi, A.; Biagioni, A.; Germano, M.; Passeri, D.

    2008-06-01

    Local probing of nonlinear generation of harmonic vibrations has been done on bone plate samples and the evaluation of the nonlinear term is derived from a limited number of cases of bovine thigh bones, that shows that a low level of nonlinearity is present in bone structures. This is consistent with the assumption that in low level nonlinear samples the distribution of harmonic vibrations matches the corresponding power distribution of the fundamental mode.

  6. Analysis of generator bearing vibration data for diagnosing rotor circuit malfunction in DFIGs

    DEFF Research Database (Denmark)

    Skrimpas, Georgios Alexandros; Sweeney, Christian W.; Jensen, Bogi Bech

    2014-01-01

    . In this paper generator bearing vibration signature for a DFIG under operation with one rotor phase coil open is analysed and presented. Further this failure mode is compared to rotor dynamics fault, such as rotational looseness, and the difference in signature is discussed. Vibration data from a multi......Doubly fed induction generators (DFIGs) are the most popular configuration met in the wind energy sector occu- pying approximately 65 % of the total market share. Condition monitoring of wind turbine generators is performed based on vibration data collected from accelerometers mounted on the drive...... end and non-drive end bearings, meeting the requirements of numerous turbine operators for condition based maintenance. In a DFIG the voltage applied to the rotor is controlled by a converter, where electric connection between the two is accom- plished by using slip rings. Improper connection between...

  7. Yield stress, volume change, and shear strength behaviour of unsaturated soils: validation of the SFG model

    National Research Council Canada - National Science Library

    Zhou, Annan; Sheng, Daichao

    2009-01-01

    The model recently presented by Sheng, Fredlund, and Gens, known as the SFG model, provides a consistent explanation of yield stress, shear strength, and volume change behaviour of unsaturated soils...

  8. Analysis of Vibrations Generated by the Presence of Corrugation in a Modeled Tram Track

    Directory of Open Access Journals (Sweden)

    Julia I. Real Herráiz

    2015-01-01

    Full Text Available In recent years, there has been a significant increase in the development of the railway system. Despite the huge benefits of railways, one of the main drawbacks of this mode of transport is vibrations caused by vehicles in service, especially in the case of trams circulating in urban areas. Moreover, this undesirable phenomenon may be exacerbated by the presence of irregularities in the rail-wheel contact. Thus, an analytical model able to reproduce the vibrational behavior of a real stretch of tram track was implemented. Besides, a simulation of different types of corrugation was carried out by calculating in an auxiliary model the dynamic overloads generated by corrugation. These dynamic overloads fed the main model to obtain the vibrations generated and then transmitted to the track.

  9. Identification of vibration loads on hydro generator by using hybrid genetic algorithm

    Institute of Scientific and Technical Information of China (English)

    Shouju Li; Yingxi Liu

    2006-01-01

    Vibration dynamic characteristics have been a major issue in the modeling and mechanical analysis of large hydro generators.An algorithm is developed for identifying vibration dynamic characteristics by means of hybrid genetic algorithm.From the measured dynamic responses of a hydro generator,an appropriate estimation algorithm is needed to identify the loading parameters,including the main frequencies and amplitudes of vibrating forces.In order to identify parameters in an efficient and robust manner,an optimization method is proposed that combines genetic algorithm with simulated annealing and elitist strategy.The hybrid genetic algorithm is then used to tackle an ill-posed problem of parameter identification.In which the effectiveness of the proposed optimization method is confirmed by its comparison with actual observation data.

  10. Performance of improved magnetostrictive vibrational power generator, simple and high power output for practical applications

    Energy Technology Data Exchange (ETDEWEB)

    Ueno, Toshiyuki, E-mail: ueno@ec.t.kanazawa-u.ac.jp [Kanazawa University, Kakuma-machi, Kanazawa-city, Ishikawa 920-1192 (Japan)

    2015-05-07

    Vibration based power generation technology is utilized effectively in various fields. Author has invented novel vibrational power generation device using magnetostrictive material. The device is based on parallel beam structure consisting of a rod of iron-gallium alloy wound with coil and yoke accompanied with permanent magnet. When bending force is applied on the tip of the device, the magnetization inside the rod varies with induced stress due to the inverse magnetostrictive effect. In vibration, the time variation of the magnetization generates voltage on the wound coil. The magnetostrictive type is advantageous over conventional such using piezoelectric or moving magnet types in high efficiency and high robustness, and low electrical impedance. Here, author has established device configuration, simple, rigid, and high power output endurable for practical applications. In addition, the improved device is lower cost using less volume of Fe-Ga and permanent magnet compared to our conventional, and its assembly by soldering is easy and fast suitable for mass production. Average power of 3 mW/cm{sup 3} under resonant vibration of 212 Hz and 1.2 G was obtained in miniature prototype using Fe-Ga rod of 2 × 0.5× 7 mm{sup 3}. Furthermore, the damping effect was observed, which demonstrates high energy conversion of the generator.

  11. Wide operation frequency band magnetostrictive vibration power generator using nonlinear spring constant by permanent magnet

    Science.gov (United States)

    Furumachi, S.; Ueno, T.

    2016-04-01

    We study magnetostrictive vibration based power generator using iron-gallium alloy (Galfenol). The generator is advantages over conventional, such as piezoelectric material in the point of high efficiency highly robust and low electrical impedance. Generally, the generator exhibits maximum power when its resonant frequency matches the frequency of ambient vibration. In other words, the mismatch of these frequencies results in significant decrease of the output. One solution is making the spring characteristics nonlinear using magnetic force, which distorts the resonant peak toward higher or lower frequency side. In this paper, vibrational generator consisting of Galfenol plate of 6 by 0.5 by 13 mm wound with coil and U shape-frame accompanied with plates and pair of permanent magnets was investigated. The experimental results show that lean of resonant peak appears attributed on the non-linear spring characteristics, and half bandwidth with magnets is 1.2 times larger than that without. It was also demonstrated that the addition of proof mass is effective to increase the sensitivity but also the bandwidth. The generator with generating power of sub mW order is useful for power source of wireless heath monitoring for bridge and factory machine.

  12. Normalization of vibration signals generated under highly varying speed and load with application to signal separation

    Science.gov (United States)

    Urbanek, Jacek; Barszcz, Tomasz; Strączkiewicz, Marcin; Jablonski, Adam

    2017-01-01

    The paper presents a normalization dedicated to transform non-stationary vibration signals into signals characterized by purely stationary properties. For this purpose, a novel class of generalized periodic signals is defined followed by a proposition of a normalization technique, which takes advantage of available, instantaneous values of operational parameters. Within the paper, a well-known discrete-random separation (DRS) technique is recalled as an exemplary technique, which has been restricted to stationary signals so far. The authors present a step-by-step adoption of the DRS to non-stationary signals. The method is applied to simulated signal, test rig signal, and a vibration signal from industrial object. Additionally, for the purpose of synthesis of simulated signal, a new model of multi-component vibrations generated under varying regime is proposed. The presented method aims to expand existing solutions dealing with varying frequency to a more general solution dealing with independent, simultaneous varying frequency and amplitude of signal components.

  13. Improvement of force factor of magnetostrictive vibration power generator for high efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Kita, Shota, E-mail: happiest3.7@gmail.com; Ueno, Toshiyuki; Yamada, Sotoshi [Kanazawa University, Kakuma-machi, Kanazawa-city, Ishikawa 920-1164 (Japan)

    2015-05-07

    We develop high power magnetostrictive vibration power generator for battery-free wireless electronics. The generator is based on a cantilever of parallel beam structure consisting of coil-wound Galfenol and stainless plates with permanent magnet for bias. Oscillating force exerted on the tip bends the cantilever in vibration yields stress variation of Galfenol plate, which causes flux variation and generates voltage on coil due to the law of induction. This generator has advantages over conventional, such as piezoelectric or moving magnet types, in the point of high efficiency, highly robust, and low electrical impedance. Our concern is the improvement of energy conversion efficiency dependent on the dimension. Especially, force factor, the conversion ratio of the electromotive force (voltage) on the tip velocity in vibration, has an important role in energy conversion process. First, the theoretical value of the force factor is formulated and then the validity was verified by experiments, where we compare four types of prototype with parameters of the dimension using 7.0 × 1.5 × 50 mm beams of Galfenol with 1606-turn wound coil. In addition, the energy conversion efficiency of the prototypes depending on load resistance was measured. The most efficient prototype exhibits the maximum instantaneous power of 0.73 W and energy of 4.7 mJ at a free vibration of frequency of 202 Hz in the case of applied force is 25 N. Further, it was found that energy conversion efficiency depends not only on the force factor but also on the damping (mechanical loss) of the vibration.

  14. Two methods for damping torsional vibrations in DFIG-based wind generators using power converters

    Science.gov (United States)

    Zhao, Zuyi; Lu, Yupu; Xie, Da; Yu, Songtao; Wu, Wangping

    2017-01-01

    This paper proposes novel damping control algorithms by using static synchronous compensator (STATCOM) and energy storage system (ESS) to damp torsional vibrations in doubly fed induction generator (DFIG) based wind turbine systems. It first analyses the operating characteristics of STATCOM and ESS for regulating power variations to increase grid voltage stability. Then, new control strategies for STATCOM and ESS are introduced to damp the vibrations. It is followed by illustration of their effectiveness to damp the drive train torsional vibrations of wind turbines, which can be caused by grid disturbances, such as voltage sags and frequency fluctuations. Results suggest that STATCOM is a promising technology to mitigate the torsional vibrations caused by grid voltage sags. By contrast, the ESS connected to the point of common coupling (PCC) of wind turbine systems shows even obvious advantages because of its capability of absorbing/releasing both active and reactive power. It can thus be concluded that STATCOM is useful for stabilizing power system voltage fluctuations, and ESS is more effective both in regulating PCC voltage fluctuations and damping torsional vibrations caused by grid voltage frequency fluctuations.

  15. Experimental characterization of cantilever-type piezoelectric generator operating at resonance for vibration energy harvesting

    Science.gov (United States)

    Montanini, Roberto; Quattrocchi, Antonino

    2016-06-01

    A cantilever-type resonant piezoelectric generator (RPG) has been designed by gluing a PZT patch working in d31 mode onto a glass fibre reinforced composite cantilever beam with a discrete mass applied on its free end. The electrical and dynamic behaviour of the RPG prototype has been investigated by carrying out laboratory tests aimed to assess the effect of definite design parameters, specifically the electric resistance load and the excitation frequency. Results showed that an optimum resistance load exists, at which power generation is maximized. Moreover, it has been showed that power generation is strongly influenced by the vibration frequency highlighting that, at resonance, output power can be increased by more than one order of magnitude. Possible applications include inertial resonant harvester for energy recovery from vibrating machines, sea waves or wind flux and self-powering of wireless sensor nodes.

  16. Experimental characterization of cantilever-type piezoelectric generator operating at resonance for vibration energy harvesting

    Energy Technology Data Exchange (ETDEWEB)

    Montanini, Roberto, E-mail: rmontanini@unime.it; Quattrocchi, Antonino, E-mail: aquattrocchi@unime.it [University of Messina, Dept. of Engineering, Contrada di Dio, Messina (Italy)

    2016-06-28

    A cantilever-type resonant piezoelectric generator (RPG) has been designed by gluing a PZT patch working in d{sub 31} mode onto a glass fibre reinforced composite cantilever beam with a discrete mass applied on its free end. The electrical and dynamic behaviour of the RPG prototype has been investigated by carrying out laboratory tests aimed to assess the effect of definite design parameters, specifically the electric resistance load and the excitation frequency. Results showed that an optimum resistance load exists, at which power generation is maximized. Moreover, it has been showed that power generation is strongly influenced by the vibration frequency highlighting that, at resonance, output power can be increased by more than one order of magnitude. Possible applications include inertial resonant harvester for energy recovery from vibrating machines, sea waves or wind flux and self-powering of wireless sensor nodes.

  17. Broadband and three-dimensional vibration energy harvesting by a non-linear magnetoelectric generator

    Science.gov (United States)

    Lin, Zhiming; Chen, Jun; Li, Xiaoshi; Li, Jun; Liu, Jun; Awais, Qasim; Yang, Jin

    2016-12-01

    Vibration, widely existing in an ambient environment with a variety of forms and wide-range of scales, recently becomes an attractive target for energy harvesting. However, its time-varying directions and frequencies render a lack of effective energy technology to scavenge it. Here, we report a rationally designed nonlinear magnetoelectric generator for broadband and multi-directional vibration energy harvesting. By using a stabilized three-dimensional (3D) magnetic interaction and spring force, the device working bandwidth was largely broadened, which was demonstrated both experimentally and theoretically. The multidirectional vibration energy harvesting was enabled by three identical suspended springs with equal intersection angles, which are all connected to a cylindrical magnet. Numerical simulations and experimental results show that the nonlinear harvester can sustain large-amplitude oscillations over a wide frequency range, and it can generate power efficiently in an arbitrary direction. Moreover, the experimental data suggest that the proposed nonlinear energy harvester has the potential to scavenge vibrational energy over a broad range of ambient frequencies in 3D space.

  18. Interference effects in the sum frequency generation spectra of thin organic films. II: Applications to different thin-film systems.

    Science.gov (United States)

    Tong, Yujin; Zhao, Yanbao; Li, Na; Ma, Yunsheng; Osawa, Masatoshi; Davies, Paul B; Ye, Shen

    2010-07-21

    In this paper, the results of the modeling calculations carried out for predicting the interference effects expected in the sum frequency generation (SFG) spectra of a specific thin-layer system, described in the accompanying paper, are tested by comparing them with the experimental spectra obtained for a real thin-layer film comprising an organic monolayer/variable thickness dielectric layer/gold substrate. In this system, two contributions to the SFG spectra arise, a resonant contribution from the organic film and a nonresonant contribution from the gold substrate. The modeling calculations are in excellent agreement with the experimental spectra over a wide range of thicknesses and for different polarization combinations. The introduction of another resonant monolayer adjacent to the gold substrate and with the molecules having a reverse orientation has a significant affect on the spectral shapes which is predicted. If a dielectric substrate such as CaF(2) is used instead of a gold substrate, only the spectral intensities vary with the film thickness but not the spectral shapes. The counterpropagating beam geometry will change both the thickness dependent spectral shapes and the intensity of different vibrational modes in comparison with a copropagating geometry. The influences of these experimental factors, i.e., the molecular orientational structure in the thin film, the nature of the substrate, and the selected incident beam geometry, on the experimental SFG spectra are quantitatively predicted by the calculations. The thickness effects on the signals from a SFG active monolayer contained in a thin liquid-layer cell of the type frequently used for in situ electrochemical measurements is also discussed. The modeling calculation is also valid for application to other thin-film systems comprising more than two resonant SFG active interfaces by appropriate choice of optical geometries and relevant optical properties.

  19. A piezoelectric pulse generator for low frequency non-harmonic vibration

    Science.gov (United States)

    Jiang, Hao; Yeatman, Eric M.

    2013-12-01

    This paper reports a new piezoelectric prototype for pulse generation by energy harvesting from low frequency non-harmonic vibration. The pulse generator presented here consists of two parts: the electromechanical part and the load circuit. A metal rolling rod is used as the proof mass, moving along the substrate to achieve both actuating of the piezoelectric cantilever by magnetic coupling and self-synchronous switching of the circuit. By using this new approach, the energy from the piezoelectric transduction mechanism is regulated simultaneously when it is extracted. This allows a series of tuneable pulses to be generated, which can be applied to self-powered RF wireless sensor network (WSN) nodes.

  20. Forces exciting generation roll at rotor vibrations when rotor-to-stator rubbing

    Science.gov (United States)

    Shatokhin, V. F.

    2017-07-01

    The consequences of emergencies of turbosets for different application are revealed, the cause of forced shutdown and even catastrophic destructions of which many researchers consider the rotor-to-stator rubbing and development—to a greater or lesser extent—of the phenomena of the rotor generation roll over the stator. The synchronous or asynchronous generation roll is determined by the rotor precession direction, coinciding or not coinciding with the self-rotation direction of the rotor. Asynchronous generation roll is the most dangerous form of the rotor-stator contact interaction with the vibrations with rubbing. The basic equations of rotor vibrations are presented: symmetric rotor fixed on two supports and that fixed on several supports after abrupt imbalance with and without rotor coming in contact with a flexible stator. The vibration process is considered as the rotor motion in a backlash with subsequent contact with the stator, loss of contact, or development of generation roll. The latter essentially depends on the properties of the "rotor-support-stator" dynamic system. The stator stiffness characteristic is specified in "force-deformation" coordinates that make it possible to take into account damping in the supports and power loss in the stator. The diagram of elastic-damping device was presented, which makes it possible to ensure a certain level of power loss at the stator displacements. The exciting forces promoting development of self-exciting vibrations of the rotor in the form of asynchronous generation roll were compared with the exciting forces of oil film of sliding bearings and forces of aerodynamic excitation in the turbine flow path and sealings. For the rotor systems of high and medium pressure of a 300 MW capacity turboset, the simulation results of the process of development of asynchronous generation roll at the vibrations with rubbing were revealed, and the basic characteristics of development of generation roll in a span between

  1. Engineering and Characterization of Peptides and Proteins at Surfaces and Interfaces: A Case Study in Surface-Sensitive Vibrational Spectroscopy.

    Science.gov (United States)

    Ding, Bei; Jasensky, Joshua; Li, Yaoxin; Chen, Zhan

    2016-06-21

    Understanding molecular structures of interfacial peptides and proteins impacts many research fields by guiding the advancement of biocompatible materials, new and improved marine antifouling coatings, ultrasensitive and highly specific biosensors and biochips, therapies for diseases related to protein amyloid formation, and knowledge on mechanisms for various membrane proteins and their interactions with ligands. Developing methods for measuring such unique systems, as well as elucidating the structure and function relationship of such biomolecules, has been the goal of our lab at the University of Michigan. We have made substantial progress to develop sum frequency generation (SFG) vibrational spectroscopy into a powerful technique to study interfacial peptides and proteins, which lays a foundation to obtain unique and valuable insights when using SFG to probe various biologically relevant systems at the solid/liquid interface in situ in real time. One highlighting feature of this Account is the demonstration of the power of combining SFG with other techniques and methods such as ATR-FTIR, surface engineering, MD simulation, liquid crystal sensing, and isotope labeling in order to study peptides and proteins at interfaces. It is necessary to emphasize that SFG plays a major role in these studies, while other techniques and methods are supplemental. The central role of SFG is to provide critical information on interfacial peptide and protein structure (e.g., conformation and orientation) in order to elucidate how surface engineering (e.g., to vary the structure) can ultimately affect surface function (e.g., to optimize the activity). This Account focuses on the most significant recent progress in research on interfacial peptides and proteins carried out by our group including (1) the development of SFG analysis methods to determine orientations of regular as well as disrupted secondary structures, and the successful demonstration and application of an isotope

  2. Generation of higher harmonics in longitudinal vibration of beams with breathing cracks

    Science.gov (United States)

    Broda, D.; Pieczonka, L.; Hiwarkar, V.; Staszewski, W. J.; Silberschmidt, V. V.

    2016-10-01

    Classical nonlinear vibration methods used for structural damage detection are often based on higher- and sub-harmonic generation. However, nonlinearities arising from sources other than damage - e.g. boundary conditions or a measurement chain - are a primary concern in these methods. This paper focuses on localisation of damage-related nonlinearities based on higher harmonic generation. Numerical and experimental investigations in longitudinal vibration of beams with breathing cracks are presented. Numerical modelling is performed using a two-dimensional finite element approach. Different crack depths, locations and boundary conditions are investigated. The results demonstrate that nonlinearities in cracked beams are particularly strong in the vicinity of damage, allowing not only for damage localisation but also for separation of crack induced nonlinearity from other sources of nonlinearities.

  3. Vibration Energy Harvesting on Vehicle Suspension Using Rotary and Linear Electromagnetic Generator

    Directory of Open Access Journals (Sweden)

    Arif Indro Sultoni

    2013-04-01

    Full Text Available In this paper, we discuss comparation of vehicle vibration energy harvesting between rotary and linear electromagnetic generator. We construct the two model of energy harvester mechanism and then analyze both of energy absorbtion and vehicle comfortability. Furthermore, we analyze both of energy absorbtion and vehicle comfortability. Vehicle is modeled as quarter car. Rotarty generator harvests 2.5 x 10-4 Watt. The other hand, linear generator has viscous characteristic and capable to generates 90 Watts with 12 Volt power supply for 0.03 m amplitude of bumpy road input. Linear generator reduces oscillation with 1.2 sec settling time. It is more comfort than the angular which has 3 sec in settling time. With unnevenees road input, mean power of this generator is 64 Watt.

  4. Experimental investigation of a vibrating axial turbine cascade in presence of upstream generated aerodynamic gusts

    OpenAIRE

    Rottmeier, Fabrice; Bölcs, Albin

    2005-01-01

    An experimental investigation has been conducted in the non-rotating annular test facility of the "Laboratoire de Thermique Appliquée et de Turbomachines" (LTT), "École Polytechnique Fédérale de Lausanne" (EPFL). During this investigation, the unsteady aerodynamic response of a turbine cascade was investigated for three different cases: (1) the clamped blades subjected to periodic, upstream generated aerodynamic gusts, (2) the cascade forced to vibrate in the travelling wave mode in a uniform...

  5. Experimental investigation of a vibrating axial turbine cascade in presence of upstream generated aerodynamic gusts

    OpenAIRE

    Rottmeier, Fabrice

    2003-01-01

    An experimental investigation has been conducted in the non-rotating annular test facility of the "Laboratoire de Thermique Appliquée et de Turbomachines" (LTT), "École Polytechnique Fédérale de Lausanne" (EPFL). During this investigation, the unsteady aerodynamic response of a turbine cascade was investigated for three different cases: (1) the clamped blades subjected to periodic, upstream generated aerodynamic gusts, (2) the cascade forced to vibrate in the travelling wave mode in a uniform...

  6. Vibration Testing of the Pluto/New Horizons Radioisotope Thermoelectric Generator

    Energy Technology Data Exchange (ETDEWEB)

    Charles D. Griffin

    2006-06-01

    The Radioisotopic Thermal Generator (RTG) for the Pluto/New Horizons spacecraft was subjected to a flight dynamic acceptance test to demonstrate that it would perform successfully following launch. Seven RTGs of this type had been assembled and tested at Mound, Ohio from 1984 to 1997. This paper chronicles major events in establishing a new vibration test laboratory at the Idaho National Laboratory and the nineteen days of dynamic testing.

  7. Application of cyclic coherence function to bearing fault detection in a wind turbine generator under electromagnetic vibration

    Science.gov (United States)

    Teng, Wei; Ding, Xian; Zhang, Yangyang; Liu, Yibing; Ma, Zhiyong; Kusiak, Andrew

    2017-03-01

    In a wind turbine generator, there is an intrinsic electromagnetic vibration originated from an alternating magnetic field acting on a low stiffness stator, which modulates vibration signals of the generator and impedes fault feature extraction of bearings. When defects arise in a bearing, the statistics of the vibration signal are periodic and this phenomenon is described as cyclostationarity. Correspondingly, cyclostationary analysis enables finding the degree of cyclostationarity representing potential fault modulation information. In this paper, the electromagnetic vibration acting as a disturbance source for fault feature extraction is deduced. Additionally, the spectral correlation density and cyclic coherence function used for vibration analysis are estimated. A real 2 MW wind turbine generator with a faulty bearing was tested and the vibration signals were analyzed separately using conventional demodulation analysis, cyclic coherence function, complex wavelet transform and spectral kurtosis. The analysis results have demonstrated that the cyclic coherence function can detect the fault feature of inner race successfully, while the feature is concealed by intensive electromagnetic vibration in the other three methods. The disassembled bearing of the wind turbine generator illustrates the effectiveness of the analysis result, and precautionary measures for protecting bearings in generators are suggested.

  8. A novel SFG structure for C-T high-pass filters

    DEFF Research Database (Denmark)

    Nielsen, Ivan Riis

    1993-01-01

    A signal flow graph (SFG) structure for simulating passive high-pass ladder filters, called the incremental integration structure, is proposed. The structure requires the use of integrators with nonintegrating inputs, and an implementation based on the MOSFET-C technique is discussed. The increme......A signal flow graph (SFG) structure for simulating passive high-pass ladder filters, called the incremental integration structure, is proposed. The structure requires the use of integrators with nonintegrating inputs, and an implementation based on the MOSFET-C technique is discussed...

  9. Hair cell force generation does not amplify or tune vibrations within the chicken basilar papilla.

    Science.gov (United States)

    Xia, Anping; Liu, Xiaofang; Raphael, Patrick D; Applegate, Brian E; Oghalai, John S

    2016-10-31

    Frequency tuning within the auditory papilla of most non-mammalian species is electrical, deriving from ion-channel resonance within their sensory hair cells. In contrast, tuning within the mammalian cochlea is mechanical, stemming from active mechanisms within outer hair cells that amplify the basilar membrane travelling wave. Interestingly, hair cells in the avian basilar papilla demonstrate both electrical resonance and force-generation, making it unclear which mechanism creates sharp frequency tuning. Here, we measured sound-induced vibrations within the apical half of the chicken basilar papilla in vivo and found broadly-tuned travelling waves that were not amplified. However, distortion products were found in live but not dead chickens. These findings support the idea that avian hair cells do produce force, but that their effects on vibration are small and do not sharpen tuning. Therefore, frequency tuning within the apical avian basilar papilla is not mechanical, and likely derives from hair cell electrical resonance.

  10. The influence of vibrations on time reference signals generated using quartz crystals

    Science.gov (United States)

    Drumea, Andrei; Marcu, Alina; Plotog, Ioan

    2016-12-01

    32.768 kHz low frequency crystals are found in a large part of today's embedded systems that use microcontrollers especially in battery supplied applications which need low power consumption1]. Their main role is to offer a stable time reference. There are situations in which time measurement is needed when the system works in a mechanically unstable environment (cars, industrial equipment). The paper presents the studies done on the behavior of 32.768 kHz quartz crystals that are part of embedded systems which operate in a vibrating environment, in terms of period and long-time jitter of the generated time reference signal. The investigations of this effect were done using a test bench especially designed for this purpose which can measure the presented parameters determined by controlled mechanical stimulus (waveform, amplitude and frequency of the vibrations).

  11. Automatic generation of force fields and property surfaces for use in variational vibrational calculations of anharmonic vibrational energies and zero-point vibrational averaged properties.

    Science.gov (United States)

    Kongsted, Jacob; Christiansen, Ove

    2006-09-28

    An automatic and general procedure for the calculation of geometrical derivatives of the energy and general property surfaces for molecular systems is developed and implemented. General expressions for an n-mode representation are derived, where the n-mode representation includes only the couplings between n or less degrees of freedom. The general expressions are specialized to derivative force fields and property surfaces, and a scheme for calculation of the numerical derivatives is implemented. The implementation is interfaced to electronic structure programs and may be used for both ground and excited electronic states. The implementation is done in the context of a vibrational structure program and can be used in combination with vibrational self-consistent field (VSCF), vibrational configuration interaction (VCI), vibrational Moller-Plesset, and vibrational coupled cluster calculations of anharmonic wave functions and calculation of vibrational averaged properties at the VSCF and VCI levels. Sample calculations are presented for fundamental vibrational energies and vibrationally averaged dipole moments and frequency dependent polarizabilities and hyperpolarizabilities of water and formaldehyde.

  12. Dynamics and Control of Lateral Tower Vibrations in Offshore Wind Turbines by Means of Active Generator Torque

    Directory of Open Access Journals (Sweden)

    Zili Zhang

    2014-11-01

    Full Text Available Lateral tower vibrations of offshore wind turbines are normally lightly damped, and large amplitude vibrations induced by wind and wave loads in this direction may significantly shorten the fatigue life of the tower. This paper proposes the modeling and control of lateral tower vibrations in offshore wind turbines using active generator torque. To implement the active control algorithm, both the mechanical and power electronic aspects have been taken into consideration. A 13-degrees-of-freedom aeroelastic wind turbine model with generator and pitch controllers is derived using the Euler–Lagrangian approach. The model displays important features of wind turbines, such as mixed moving frame and fixed frame-defined degrees-of-freedom, couplings of the tower-blade-drivetrain vibrations, as well as aerodynamic damping present in different modes of motions. The load transfer mechanisms from the drivetrain and the generator to the nacelle are derived, and the interaction between the generator torque and the lateral tower vibration are presented in a generalized manner. A three-dimensional rotational sampled turbulence field is generated and applied to the rotor, and the tower is excited by a first order wave load in the lateral direction. Next, a simple active control algorithm is proposed based on active generator torques with feedback from the measured lateral tower vibrations. A full-scale power converter configuration with a cascaded loop control structure is also introduced to produce the feedback control torque in real time. Numerical simulations have been carried out using data calibrated to the referential 5-MW NREL (National Renewable Energy Laboratory offshore wind turbine. Cases of drivetrains with a gearbox and direct drive to the generator are considered using the same time series for the wave and turbulence loadings. Results show that by using active generator torque control, lateral tower vibrations can be significantly mitigated for

  13. Development of Design Criteria for Fluid Induced Structural Vibration in Steam Generators and Heat Exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Catton, Ivan; Dhir, Vijay K.; Alquaddoomi, O.S.; Mitra, Deepanjan; Adinolfi, Pierangelo

    2004-03-26

    OAK-B135 Flow-induced vibration in heat exchangers has been a major cause of concern in the nuclear industry for several decades. Many incidents of failure of heat exchangers due to apparent flow-induced vibration have been reported through the USNRC incident reporting system. Almost all heat exchangers have to deal with this problem during their operation. The phenomenon has been studied since the 1970s and the database of experimental studies on flow-induced vibration is constantly updated with new findings and improved design criteria for heat exchangers. In the nuclear industry, steam generators are often affected by this problem. However, flow-induced vibration is not limited to nuclear power plants, but to any type of heat exchanger used in many industrial applications such as chemical processing, refrigeration and air conditioning. Specifically, shell and tube type heat exchangers experience flow-induced vibration due to the high velocity flow over the tube banks. Flow-induced vibration in these heat exchangers leads to equipment breakdown and hence expensive repair and process shutdown. The goal of this research is to provide accurate measurements that can help modelers to validate their models using the measured experimental parameters and thereby develop better design criteria for avoiding fluid-elastic instability in heat exchangers. The research is divided between two primary experimental efforts, the first conducted using water alone (single phase) and the second using a mixture of air or steam and water as the working fluid (two phase). The outline of this report is as follows: After the introduction to fluid-elastic instability, the experimental apparatus constructed to conduct the experiments is described in Chapter 2 along with the measurement procedures. Chapter 3 presents results obtained on the tube array and the flow loop, as well as techniques used in data processing. The project performance is described and evaluated in Chapter 4 followed by

  14. Nonlinear vibrational spectroscopy of surfactants at liquid interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Miranda, Paulo B. [Univ. of California, Berkeley, CA (United States)

    1998-12-14

    Surfactants are widely used to modify physical and chemical properties of interfaces. They play an important role in many technological problems. Surfactant monolayer are also of great scientific interest because they are two-dimensional systems that may exhibit a very rich phase transition behavior and can also be considered as a model system for biological interfaces. In this Thesis, we use a second-order nonlinear optical technique (Sum-Frequency Generation - SFG) to obtain vibrational spectra of surfactant monolayer at Iiquidhapor and solid/liquid interfaces. The technique has several advantages: it is intrinsically surface-specific, can be applied to buried interfaces, has submonolayer sensitivity and is remarkably sensitive to the confirmational order of surfactant monolayers.

  15. Vibration characteristics of a hydraulic generator unit rotor system with parallel misalignment and rub-impact

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Zhiwei; Zhou, Jianzhong; Yang, Mengqi; Zhang, Yongchuan [Huazhong University of Science and Technology, College of Hydraulic and Digitalization Engineering, Wuhan, Hubei Province (China)

    2011-07-15

    The object of this research aims at the hydraulic generator unit rotor system. According to fault problems of the generator rotor local rubbing caused by the parallel misalignment and mass eccentricity, a dynamic model for the rotor system coupled with misalignment and rub-impact is established. The dynamic behaviors of this system are investigated using numerical integral method, as the parallel misalignment, mass eccentricity and bearing stiffness vary. The nonlinear dynamic responses of the generator rotor and turbine rotor with coupling faults are analyzed by means of bifurcation diagrams, Poincare maps, axis orbits, time histories and amplitude spectrum diagrams. Various nonlinear phenomena in the system, such as periodic, three-periodic and quasi-periodic motions, are studied with the change of the parallel misalignment. The results reveal that vibration characteristics of the rotor system with coupling faults are extremely complex and there are some low frequencies with large amplitude in the 0.3-0.4 x components. As the increase in mass eccentricity, the interval of nonperiodic motions will be continuously moved forward. It suggests that the reduction in mass eccentricity or increase in bearing stiffness could preclude nonlinear vibration. These might provide some important theory references for safety operating and exact identification of the faults in rotating machinery. (orig.)

  16. Liquid/liquid interface layering of 1-butanol and [bmim]PF6 ionic liquid: a nonlinear vibrational spectroscopy and molecular dynamics simulation study.

    Science.gov (United States)

    Iwahashi, Takashi; Ishiyama, Tatsuya; Sakai, Yasunari; Morita, Akihiro; Kim, Doseok; Ouchi, Yukio

    2015-10-14

    IR-visible sum-frequency generation (IV-SFG) vibrational spectroscopy and a molecular dynamics (MD) simulation were used to study the local layering order at the interface of 1-butanol-d9 and 1-butyl-3-methylimidazolium hexafluorophosphate ([bmim]PF6), a room-temperature ionic liquid (RTIL). The presence of a local non-polar layer at the interface of the two polar liquids was successfully demonstrated. In the SFG spectra of 1-butanol-d9, we observed significant reduction and enhancement in the strength of the CD3 symmetric stretching (r(+)) mode and the antisymmetric stretching (r(-)) mode peaks, respectively. The results can be well explained by the presence of an oppositely oriented quasi-bilayer structure of butanol molecules, where the bottom layer is strongly bound by hydrogen-bonding with the PF6(-) anion. MD simulations reveal that the hydrogen-bonding of butanol with the PF6(-) anion causes the preferential orientation of the butanols; the restriction on the rotational distribution of the terminal methyl group along their C3 axis enhances the r(-) mode. As for the [bmim](+) cations, the SFG spectra taken within the CH stretch region indicate that the butyl chain of [bmim](+) points away from the bulk RTIL phase to the butanol phase at the interface. Combining the SFG spectroscopy and MD simulation results, we propose an interfacial model structure of layering, in which the butyl chains of the butanol molecules form a non-polar interfacial layer with the butyl chains of the [bmim](+) cations at the interface.

  17. FFT Analysis on Coupling Effect of Axial and Torsional Vibrations in Circular Cross Section Beam of Steam Turbine Generators

    Directory of Open Access Journals (Sweden)

    Xiang Xu

    2013-09-01

    Full Text Available This paper presents a novel method to nonlinearly investigate the dynamics of the coupled axial and torsional vibrations in the circular cross section beam of the steam turbine generator using the FFT analysis. Firstly, the coupled axial and torsional vibrations of a beam are proved by equivalent law of shearing stress and different boundary conditions. Then, a nonlinear mathematical model of the coupled axial and torsional vibrations is established by the Galerkin method. Lastly, the fast Fourier transform (FFT is employed to investigate the coupled effect of the beam vibration. A practical calculation example is calculated numerically and the coupled mechanism of the beam’s axial and torsional vibrations is analyzed in detail. The analysis results show that the frequencies of the coupled response would be existed in some special orders and the coupled response frequencies are smaller than the single vibration. Since for the first time the coupled mechanism of the beam’s axial and torsional vibrations is theoretically analyzed, the findings in this work may provide directive reference for practical engineering problems in design of steam turbine generators.

  18. Generation of highly vibrationally excited H2 and detection by 2+1 resonantly enhanced multiphoton ionization

    Science.gov (United States)

    Robie, Daniel C.; Jusinski, Leonard E.; Bischel, William K.

    1990-02-01

    We report the first detection by optical means of highly vibrationally excited H2 X1Σ+g(vx=6-11). Vibrationally excited H2 was generated using a recently discovered hot-wire effect in H2 gas, and was detected in 40 bands with 2+1 resonantly enhanced multiphoton ionization via the EF state (vEF=0-14). Rotational temperatures are in the range 200-650 K, well below that required for thermal excitation of the observed vibrational levels.

  19. Optimal linear generator with Halbach array for harvesting of vibration energy during human walking

    Directory of Open Access Journals (Sweden)

    Joonsoo Jun

    2016-05-01

    Full Text Available In IT business, the capacity of the battery in smartphone was drastically improved to digest various functions such as communication, Internet, e-banking, and entertainment. Although the capacity of the battery is improved, it still needs to be upgraded due to customer’s demands. In this article, we optimize the design of the linear generator with the Halbach array to improve the efficiency of harvesting vibration energy during human walking for the battery capacitance. We propose the optimal design of the tubular permanent magnet with the linear generator that uses a Halbach array. The approximate model is established using generic algorithm. Furthermore, we performed electromagnetic finite element analysis to predict the induced voltage.

  20. Surface characterization of imidazolium-based ionic liquids with cyano-functionalized anions at the gas-liquid interface using sum frequency generation spectroscopy.

    Science.gov (United States)

    Peñalber, Chariz Y; Grenoble, Zlata; Baker, Gary A; Baldelli, Steven

    2012-04-21

    Advancement in the field of ionic liquid technology requires a comprehensive understanding of their surface properties, as a wide range of chemical reactions occur mainly at interfaces. As essential media currently used in several technological applications, their accurate molecular level description at the gas-liquid interface is of utmost importance. Due to the high degree of chemical information provided in the vibrational spectrum, vibrational spectroscopy gives the most detailed model for molecular structure. The inherently surface-sensitive technique, sum frequency generation (SFG) spectroscopy, in combination with bulk-sensitive vibrational spectroscopic techniques such as FTIR and Raman, has been used in this report to characterize the surface of cyano-containing ionic liquids, such as [BMIM][SCN], [BMIM][DCA], [BMIM][TCM] and [EMIM][TCB] at the gas-liquid interface. By structural variation of the anion while keeping the cation constant, emphasis on the molecular arrangement of the anion at the gas-liquid interface is reported, and its subsequent role (if any) in determining the surface molecular orientation of the cation. Vibrational modes seen in the C-H stretching region revealed the presence of the cation at the gas-liquid interface. The cation orientation is independent of the type of cyano-containing anion, however, a similar arrangement at the surface as reported in previous studies was found, with the imidazolium ring lying flat at the surface, and the alkyl chains pointing towards the gas phase. SFG results show that all three anions of varying symmetry, namely, [DCA](-) (C(2v)), [TCM](-)(D(3h)) and [TCB](-) (T(d)) in ionic liquids [BMIM]DCA], [BMIM][TCM] and [EMIM][TCB] are significantly tilted from the surface plane, while the linear [SCN](-) in [BMIM][SCN] exhibited poor ordering, as seen in the absence of its C-N stretching mode in the SFG vibrational spectra.

  1. A Novel (DDCC-SFG-Based Systematic Design Technique of Active Filters

    Directory of Open Access Journals (Sweden)

    M. Fakhfakh

    2013-09-01

    Full Text Available This paper proposes a novel idea for the synthesis of active filters that is based on the use of signal-flow graph (SFG stamps of differential difference current conveyors (DDCCs. On the basis of an RLC passive network or a filter symbolic transfer function, an equivalent SFG is constructed. DDCCs’ SFGs are identified inside the constructed ‘active’ graph, and thus the equivalent circuit can be easily synthesized. We show that the DDCC and its ‘derivatives’, i.e. differential voltage current conveyors and the conventional current conveyors, are the main basic building blocks in such design. The practicability of the proposed technique is showcased via three application examples. Spice simulations are given to show the viability of the proposed technique.

  2. Highly vibrationally excited CO generated in a low-temperature chemical reaction between carbon vapor and molecular oxygen

    Science.gov (United States)

    Jans, E.; Frederickson, K.; Yurkovich, M.; Musci, B.; Rich, J. W.; Adamovich, I. V.

    2016-08-01

    A chemical flow reactor is used to study the vibrational population distribution of CO produced by a reaction between carbon vapor generated in an arc discharge and molecular oxygen. The results demonstrate formation of highly vibrationally excited CO, up to vibrational level v = 14, at low temperatures, T = 400-450 K, with population inversion at v = 4-7, in a collision-dominated environment, 15-20 Torr. The average vibrational energy per CO molecule formed by the reaction is 0.6-1.2 eV/molecule, which corresponds to 10-20% of reaction enthalpy. The results show feasibility of development of a new CO chemical laser using carbon vapor and oxygen as reactants.

  3. Blasting Vibration Generated by Breaking-Blasting Large Barriers with EBBLB

    OpenAIRE

    Wang Zhen-xiong; Gu Wen-bin; Liang Ting; Liu Jian-qing; Xu Jing-lin; Liu Xin

    2016-01-01

    Equipment for breaking and blasting large barriers (EBBLB) is new break-blast equipment, which inevitably induces ground vibration and may cause substantial damage to rock mass and nearby structures as well as human beings. The ground vibration induced by break-blast is one of the inevitable outcomes. By monitoring vibration at measuring points at different distances from blasting center, time history curve of vibrating velocity can be obtained; it can be drawn that blasting seismic waves are...

  4. Modeling And Analysis of a Piezoelectric Vibration-Induced Micro Power Generator

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Joon Hong; Park, Moon Soo; Lee, Sang Ho [Korea Institute of Industrial Technology, Cheonan (Korea, Republic of)

    2007-07-01

    Supplying power to microsystems that have no physical connection to the outside is difficult, and using batteries is not always appropriate. This paper discuss how to generates electricity from mechanical energy when vibrated in a cantilever beam and a model for the system is derived that predicts that the output power of the system is maximized when the mechanical damping in the system is minimized. Furthermore, to cover a wide frequency range and to be useful in a number of applications, a system of three beams with three different resonant frequencies were designed and optimized. This information makes it possible to determine what design alternatives are feasible for the creation of a micro power supply for any specific application of MEMS.

  5. Focusing of Rayleigh waves generated by high-speed trains under the condition of ground vibration boom

    CERN Document Server

    Krylov, Victor V

    2015-01-01

    In the present paper, the effects of focusing of Rayleigh waves generated by high speed trains in the supporting ground under the condition of ground vibration boom are considered theoretically. These effects are similar to the effects of focusing of sound waves radiated by aircraft under the condition of sonic boom. In particular, if a railway track has a bend to provide the possibility of changing direction of train movement, the Rayleigh surface waves generated by high-speed trains under the condition of ground vibration boom may become focused. This results in concentration of their energy along a simple caustic line at one side of the track and in the corresponding increase in ground vibration amplitudes. The effect of focusing of Rayleigh waves may occur also if a train moves along a straight line with acceleration and its current speed is higher than Rayleigh wave velocity in the ground. The obtained results are illustrated by numerical calculations.

  6. Numerical Research on Hydraulically Generated Vibration and Noise of a Centrifugal Pump Volute with Impeller Outlet Width Variation

    Directory of Open Access Journals (Sweden)

    Houlin Liu

    2014-01-01

    Full Text Available The impeller outlet width of centrifugal pumps is of significant importance for numbers of effects. In the paper, these effects including the performance, pressure pulsations, hydraulically generated vibration, and noise level are investigated. For the purpose, two approaches were used to predict the vibration and sound radiation of the volute under fluid excitation force. One approach is the combined CFD/FEM analysis for structure vibration, and then the structure response obtained from the FEM analysis is treated as the boundary condition for BEM analysis for sound radiation. The other is the combined CFD/FEM/BEM coupling method. Before the numerical methods were used, the simulation results were validated by the vibration acceleration of the monitoring points on the volute. The vibration and noise were analyzed and compared at three flow conditions. The analysis of the results shows that the influences of the sound pressure of centrifugal pumps on the structure appear insignificant. The relative outlet width b2* at nq(SI = 26.7 in this paper should be less than 0.06, based on an overall consideration of the pump characteristics, pressure pulsations, vibration and noise level.

  7. Structural changes in a polyelectrolyte multilayer assembly investigated by reflection absorption infrared spectroscopy and sum frequency generation spectroscopy.

    Science.gov (United States)

    Kett, Peter J N; Casford, Michael T L; Yang, Amanda Y; Lane, Thomas J; Johal, Malkiat S; Davies, Paul B

    2009-02-12

    The structure of polyelectrolyte multilayer films adsorbed onto either a per-protonated or per-deuterated 11-mercaptoundecanoic acid (h-MUA/d-MUA) self assembled monolayer (SAM) on gold was investigated in air using two surface vibrational spectroscopy techniques, namely, reflection absorption infrared spectroscopy (RAIRS) and sum frequency generation (SFG) spectroscopy. Determination of film masses and dissipation values were made using a quartz crystal microbalance with dissipation monitoring (QCM-D). The films, containing alternating layers of the polyanion poly[1-[4-(3-carboxy-4-hydroxyphenylazo) benzenesulfonamido]-1,2-ethanediyl, sodium salt] (PAZO) and the polycation poly(ethylenimine) (PEI) built on the MUA SAM, were formed using the layer-by-layer electrostatic self-assembly method. The SFG spectrum of the SAM itself comprised strong methylene resonances, indicating the presence of gauche defects in the alkyl chains of the acid. The RAIRS spectrum of the SAM also contained strong methylene bands, indicating a degree of orientation of the methylene groups parallel to the surface normal. Changes in the SFG and RAIRS spectra when a PEI layer was adsorbed on the MUA monolayer showed that the expected electrostatic interaction between the polymer and the SAM, probably involving interpenetration of the PEI into the MUA monolayer, caused a straightening of the alkyl chains of the MUA and, consequently, a decrease in the number of gauche defects. When a layer of PAZO was subsequently deposited on the MUA/PEI film, further spectral changes occurred that can be explained by the formation of a complex PEI/PAZO interpenetrated layer. A per-deuterated MUA SAM was used to determine the relative contributions from the adsorbed polyelectrolytes and the MUA monolayer to the RAIRS and SFG spectra. Spectroscopic and adsorbed mass measurements combined showed that as further bilayers were constructed the interpenetration of PAZO into preadsorbed PEI layers was repeated, up to

  8. Solvation Reaction Field at the Interface Measured by Vibrational Sum Frequency Generation Spectroscopy.

    Science.gov (United States)

    Sorenson, Shayne A; Patrow, Joel G; Dawlaty, Jahan M

    2017-02-15

    Interfacial electric fields are important in several areas of chemistry, materials sciences, and device physics. However, they are poorly understood, partly because they are difficult to measure directly and model accurately. We present both a spectroscopic experimental investigation and a theoretical model for the interfacial field at the junction of a conductor and a dielectric. First, we present vibrational sum frequency generation (VSFG) results of the nitrile (CN) stretch of 4-mercaptobenzonitrile (4-MBN) covalently attached to a gold surface and in contact with a variety of liquid dielectrics. It is found that the CN stretch frequency red-shifts with increasing dielectric constant. Second, we build a model in direct analogy to the well-known Onsager reaction field theory, which has been successful in predicting vibrational frequency shifts in bulk dielectric media. Clearly, due to the asymmetric environment, with metal on one side and a dielectric on the other, the bulk Onsager model is not applicable at the interface. To address this, we apply the Onsager model to the interface accounting for the asymmetry. The model successfully explains the red-shift of the CN stretch as a function of the dielectric constant and is used to estimate the reaction field near the interface. We show the similarities and differences between the conventional bulk Onsager model and the interfacial reaction field model. In particular, the model emphasizes the importance of the metal as part of the solvation environment of the tethered molecules. We anticipate that our work will be of fundamental value to understand the crucial and often elusive electric fields at interfaces.

  9. ZERO MODE NATURAL FREQUENCY AND NONLINEAR VIBRATION OF COUPLED LATERAL AND TORSION OF A LARGE TURBINE GENERATOR

    Institute of Scientific and Technical Information of China (English)

    Ta Na; Qiu Jiajun; Cai Ganhua

    2005-01-01

    Zero mode natural frequency (ZMNF) is found during experiments. The ZMNF and vibrations resulted by it are studied. First, calculating method of the ZMNF excited by electromagnetic in vibrational system of coupled mechanics and electrics are given from the view of magnetic energy.Laws that the ZMNF varies with active power and exciting current are obtained and are verified by experiments. Then, coupled lateral and torsional vibration of rotor shaft system is studied by considering rest eccentricity, rotating eccentricity and swing eccentricity. Using Largrange-Maxwell equation when three phases are asymmetric derives differential equation of the coupled vibration. With energy method of nonlinear vibration, amplitude-frequency characteristics of resonance are studied when rotating speed of rotor equals to ZMNF. The results show that ZMNF will occur in turbine generators by the action of electromagnetic. Because ZMNF varies with electromagnetic parameters,resonance can occur when exciting frequency of the rotor speed is fixed whereas exciting current change. And also find that a generator is in the state of large amplitude in rated exciting current.

  10. Design and Modeling of a Novel Micro-Power Generator based on Harvesting Omni-Directional Vibration Energy

    Directory of Open Access Journals (Sweden)

    E. Elsherbiny1

    2015-08-01

    Full Text Available : In This paper reports on the integration of several technologies to realize, by modeling and design the first twodimensional (2D micro power generator which harvesting multi-directional vibration energy from surrounding environmental, which consists of composite cylindrical system with fixed coil and two rounded axial Neodymium permanent magnets.

  11. Early-Stage Aggregation of Islet Amyloid Polypeptide on Membrane Surfaces Probed by Label-Free Chiral Sum Frequency Generation Spectroscopy

    Science.gov (United States)

    Wang, Zhuguang; Fu, Li; Yan, Elsa

    2013-03-01

    The aggregation of human islet amyloid polypeptide (hIAPP) into fibrils is associated with type II diabetes. It can be catalyzed by interactions with membranes. Recent studies have shown that cytotoxicity arises from the intermediates of aggregation instead of mature fibrils. However, the pathogenic mechanism is still unknown and it remains challenging to probe structures of the intermediates on membrane surfaces due to a lack of biophysical methods that are sensitive to both protein secondary structures and interfaces. Here, we used label-free chiral sum frequency generation spectroscopy (cSFG) to probe the intermediates. Recently, we have discovered cSFG provides highly specific peptide vibrational signatures that can distinguish protein secondary structures at interfaces. Using cSFG, we observed in situ and in real time the aggregation of hIAPP from disordered structures to α-helices and then β-sheets on membrane surfaces. We also obtained the orientation of the β-sheet aggregates inserted into the membranes. We further studied the S20G mutant, which is linked to the early onset of type II diabetes among Asian populations. We compared the mutant with the wild-type hIAPP to evaluate the effect of S20G in the early-stage aggregation on membrane surfaces.

  12. Simple evaluations of fluid-induced vibrations for steam generator tube arrays in advanced marine reactors (MRX, DRX)

    Energy Technology Data Exchange (ETDEWEB)

    Saito, Kazuo [Ishikawajima-Harima Heavy Industries Co., Ltd., Tokyo (Japan); Ishida, Toshihisa [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2001-06-01

    Advanced Marine Reactor (MRX) and Deep Sea Research Reactor (DRX) are the integral-type PWR, and the steam generators are installed in the reactor vessels. Steam generators are of the once-through, helical-coil tube types. Heat transfer tubes surround inner shroud in annular space of the reactor vessel. Flow-induced vibrations are calculated by simple methods, and the arrangement of tube support structures are evaluated. (author)

  13. Broadband sum frequency generation via chirped quasi-phase-matching

    CERN Document Server

    Rangelov, A A

    2011-01-01

    An efficient broadband sum frequency generation (SFG) technique using the two collinear optical parametric processes \\omega 3=\\omega 1+\\omega 2 and \\omega 4=\\omega 1+\\omega 3 is proposed. The technique uses chirped quasi-phase-matched gratings, which, in the undepleted pump approximation, make SFG analogous to adiabatic population transfer in three-state systems with crossing energies in quantum physics. If the local modulation period %for aperiodically poled quasi-phase-matching first makes the phase match occur for \\omega 3 and then for \\omega 4 SFG processes then the energy is converted adiabatically to the \\omega 4 field. Efficient SFG of the \\omega 4 field is also possible by the opposite direction of the local modulation sweep; then transient SFG of the \\omega 3 field is strongly reduced. Most of these features remain valid in the nonlinear regime of depleted pump.

  14. Influence of water depth on the sound generated by air-bubble vibration in the water musical instrument

    Science.gov (United States)

    Ohuchi, Yoshito; Nakazono, Yoichi

    2014-06-01

    We have developed a water musical instrument that generates sound by the falling of water drops within resonance tubes. The instrument can give people who hear it the healing effect inherent in the sound of water. The sound produced by falling water drops arises from air- bubble vibrations. To investigate the impact of water depth on the air-bubble vibrations, we conducted experiments at varying values of water pressure and nozzle shape. We found that air-bubble vibration frequency does not change at a water depth of 50 mm or greater. Between 35 and 40 mm, however, the frequency decreases. At water depths of 30 mm or below, the air-bubble vibration frequency increases. In our tests, we varied the nozzle diameter from 2 to 4 mm. In addition, we discovered that the time taken for air-bubble vibration to start after the water drops start falling is constant at water depths of 40 mm or greater, but slower at depths below 40 mm.

  15. Next-Generation Modeling, Analysis, and Testing of the Vibration of Mistuned Bladed Disks

    Science.gov (United States)

    2007-12-21

    August 2007. [22] Whitehead, D. S., "Effect of Mistuning on the Vibration of Turbomachine Blades Induced by Wakes," Journal of Mechanical Engineering...14-17. [27] Wagner, J. T., "Coupling of Turbomachine Blade Vibrations Through the Rotor," Journal of Engineering for Power, Vol. 89, No. 3, 1967, pp

  16. Operational Safety Assessment of Turbo Generators with Wavelet Rényi Entropy from Sensor-Dependent Vibration Signals

    Science.gov (United States)

    Zhang, Xiaoli; Wang, Baojian; Chen, Xuefeng

    2015-01-01

    With the rapid development of sensor technology, various professional sensors are installed on modern machinery to monitor operational processes and assure operational safety, which play an important role in industry and society. In this work a new operational safety assessment approach with wavelet Rényi entropy utilizing sensor-dependent vibration signals is proposed. On the basis of a professional sensor and the corresponding system, sensor-dependent vibration signals are acquired and analyzed by a second generation wavelet package, which reflects time-varying operational characteristic of individual machinery. Derived from the sensor-dependent signals’ wavelet energy distribution over the observed signal frequency range, wavelet Rényi entropy is defined to compute the operational uncertainty of a turbo generator, which is then associated with its operational safety degree. The proposed method is applied in a 50 MW turbo generator, whereupon it is proved to be reasonable and effective for operation and maintenance. PMID:25894934

  17. Operational Safety Assessment of Turbo Generators with Wavelet Rényi Entropy from Sensor-Dependent Vibration Signals

    Directory of Open Access Journals (Sweden)

    Xiaoli Zhang

    2015-04-01

    Full Text Available With the rapid development of sensor technology, various professional sensors are installed on modern machinery to monitor operational processes and assure operational safety, which play an important role in industry and society. In this work a new operational safety assessment approach with wavelet Rényi entropy utilizing sensor-dependent vibration signals is proposed. On the basis of a professional sensor and the corresponding system, sensor-dependent vibration signals are acquired and analyzed by a second generation wavelet package, which reflects time-varying operational characteristic of individual machinery. Derived from the sensor-dependent signals’ wavelet energy distribution over the observed signal frequency range, wavelet Rényi entropy is defined to compute the operational uncertainty of a turbo generator, which is then associated with its operational safety degree. The proposed method is applied in a 50 MW turbo generator, whereupon it is proved to be reasonable and effective for operation and maintenance.

  18. Operational safety assessment of turbo generators with wavelet Rényi entropy from sensor-dependent vibration signals.

    Science.gov (United States)

    Zhang, Xiaoli; Wang, Baojian; Chen, Xuefeng

    2015-04-16

    With the rapid development of sensor technology, various professional sensors are installed on modern machinery to monitor operational processes and assure operational safety, which play an important role in industry and society. In this work a new operational safety assessment approach with wavelet Rényi entropy utilizing sensor-dependent vibration signals is proposed. On the basis of a professional sensor and the corresponding system, sensor-dependent vibration signals are acquired and analyzed by a second generation wavelet package, which reflects time-varying operational characteristic of individual machinery. Derived from the sensor-dependent signals' wavelet energy distribution over the observed signal frequency range, wavelet Rényi entropy is defined to compute the operational uncertainty of a turbo generator, which is then associated with its operational safety degree. The proposed method is applied in a 50 MW turbo generator, whereupon it is proved to be reasonable and effective for operation and maintenance.

  19. Quantification of multiple fault parameters in flexible turbo-generator systems with incomplete rundown vibration data

    Science.gov (United States)

    Lal, Mohit; Tiwari, Rajiv

    2013-12-01

    A turbo-generator system of the modern rotating machinery consists of the driver and driven shafts, which are coupled through flexible couplings and mounted on flexible bearings. Dynamic characterisation of vital machine elements of such rotating machinery is a challenging problem for reliable and accurate response predictions. In this paper, a key intention is to estimate the bearing and coupling dynamic parameters along with residual unbalances at predefined planes, and the misalignment forces and moments at the coupling based on the rundown vibration data. To tackle a practical difficulty of limited measurements and a numerical difficulty of the conventional dynamic condensation in the development of identification algorithm, a novel condensation technique has been implemented especially to overcome measurement of transverse rotational DOFs. Numerical examples are also presented to show the effectiveness of the proposed method. The measurement noise has been added in numerically simulated responses that are used in the present algorithm to identify the parameters and it is found to be robust. Modelling errors of few physical parameters are also considered and estimates are found to be very good.

  20. Ground vibrations and airborne sounds generated by motion of rock in a river bed

    Directory of Open Access Journals (Sweden)

    C.-J. Huang

    2008-10-01

    Full Text Available This study investigates how ground vibrations (underground sounds and airborne sounds that are produced by rocks in a river bed differ from each other. Airborne and underground sounds were simultaneously received at three microphones and three geophones, respectively. These sound signals were then analyzed using both the Fast Fourier Transform and the Gabor Transform to represent them in both the frequency and time-frequency domains. Experimental data indicate that the frequency of both airborne and underground sounds produced by the impact of rocks against the river bed is in the range 10–150 Hz. Furthermore, the high-frequency band of underground sounds decays much more rapidly than that of airborne sounds. The spatial decay rate of airborne sounds was also determined and compared with theoretical values. The lower spatial decay rate of airborne sounds than that of underground sounds suggests that monitoring of airborne sounds may be more efficient in the detection of debris flows or other natural hazards that generate both airborne and underground sounds.

  1. Theoretical vibrational sum-frequency generation spectroscopy of water near lipid and surfactant monolayer interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Roy, S.; Gruenbaum, S. M.; Skinner, J. L. [Theoretical Chemistry Institute and Department of Chemistry, 1101 University Ave., University of Wisconsin-Madison, Madison, Wisconsin 53706 (United States)

    2014-11-14

    Understanding the structure of water near cell membranes is crucial for characterizing water-mediated events such as molecular transport. To obtain structural information of water near a membrane, it is useful to have a surface-selective technique that can probe only interfacial water molecules. One such technique is vibrational sum-frequency generation (VSFG) spectroscopy. As model systems for studying membrane headgroup/water interactions, in this paper we consider lipid and surfactant monolayers on water. We adopt a theoretical approach combining molecular dynamics simulations and phase-sensitive VSFG to investigate water structure near these interfaces. Our simulated spectra are in qualitative agreement with experiments and reveal orientational ordering of interfacial water molecules near cationic, anionic, and zwitterionic interfaces. OH bonds of water molecules point toward an anionic interface leading to a positive VSFG peak, whereas the water hydrogen atoms point away from a cationic interface leading to a negative VSFG peak. Coexistence of these two interfacial water species is observed near interfaces between water and mixtures of cationic and anionic lipids, as indicated by the presence of both negative and positive peaks in their VSFG spectra. In the case of a zwitterionic interface, OH orientation is toward the interface on the average, resulting in a positive VSFG peak.

  2. Flow patterns generated by vibrations in weightlessness in binary mixture with Soret effect.

    Science.gov (United States)

    Shevtsova, Valentina; Melnikov, Denis; Gaponenko, Yuri; Lyubimova, Tatyana; Mialdun, Aliaksandr; Sechenyh, Vitaliy

    2012-07-01

    Vibrational convection refers to the specific flows that appear when a fluid with density gradient is subjected to external vibration. The density gradient may result from the inhomogeneity of temperature or composition. The study of vibrational impact on fluids has fundamental and applied importance. In weightlessness, vibrational convection is an additional way of transporting heat and matter similar to thermo- and solutocapillary convection. The response of the fluid to external forcing depends on the frequency of vibration. The case of small amplitude and high frequency vibration (when the period is much smaller than the characteristic viscous and heat (mass) diffusion times) is of special interest. In this case, the mean flow can be observed in the system, which describes the non-linear response of the fluid to a periodic excitation. The mean flow is most pronounced in the absence of other external forces (in particular, absence of static gravity). The experiment IVIDIL (Influence of Vibration on Diffusion in Liquids) has been conducted on the ISS during more than 3 months in 2009-2010. In the experimental liquids the density changes due to both the temperature and composition. 55 experimental runs of IVIDIL provided rich variety of valuable information about behavior of the liquid in weightlessness which is released with time, [1-3]. The current results provide experimental and numerical evidence of richness of flow patterns and their classification. References: 1. Shevtsova V., Mialdun A., Melnikov D., Ryzhkov I., Gaponenko Y., Saghir Z., Lyubimova T., Legros J.C., IVIDIL experiment onboard ISS: thermodiffusion in presence of controlled vibrations, Comptes Rendus Mecanique, 2011, 339, 310-317 2. Shevtsova V., Lyubimova T., Saghir Z. , Melnikov D., Gaponenko Y. , Sechenyh V. , Legros J.C. , Mialdun A., IVIDIL: on-board g-jitters and diffusion controlled phenomena; Journal of Physics: Conference Series, 2011, 327, 012031 3. Mazzoni S., Shevtsova V., Mialdun A

  3. A comprehensive flow-induced vibration model to predict crack growth and leakage potential in steam generator tubes

    Energy Technology Data Exchange (ETDEWEB)

    El Bouzidi, Salim [School of Engineering, University of Guelph, Guelph, Ontario N1G 2W1 (Canada); Hassan, Marwan, E-mail: mahassan@uoguelph.ca [School of Engineering, University of Guelph, Guelph, Ontario N1G 2W1 (Canada); Riznic, Jovica [Operational Engineering Assessment Division, Canadian Nuclear Safety Commission, Ottawa, Ontario K1P 5S9 (Canada)

    2015-10-15

    Highlights: • Comprehensive flow induced vibrations time domain model was developed. • Simulations of fluidelastic instability and turbulence were conducted. • Nonlinear effect due to the clearances at the supports was studied. • Prediction of stresses due to fluid excitation was obtained. • Deterministic and stochastic analyses for crack and leakage rate were conducted. - Abstract: Flow-induced vibrations (FIVs) are a major threat to the operation of nuclear steam generators. Turbulence and fluidelastic instability are the two main excitation mechanisms leading to tube vibrations. The consequences to the operation of steam generators are premature wear of the tubes, as well as development of cracks that may leak hazardous fluids. This paper investigates the effect of tube support clearance on the integrity of tube bundles within steam generators. Special emphasis will be placed on crack propagation and leakage rates. A crack growth model is used to simulate the growth of surface flaws and through-wall cracks of various initial sizes due to a wide range of support clearances. Leakage rates are predicted using a two-phase flow leakage model. Nonlinear finite element analysis is used to simulate a full U-bend subjected to fluidelastic and turbulence forces. Monte Carlo simulations are then used to conduct a probabilistic assessment of steam generator life due to crack development.

  4. Insight from Laboratory Experiments on the Generation of Granular Flows on the Flanks of Vibrated Pyroclastic Cones

    Science.gov (United States)

    Cagnoli, B.; Romano, G. P.; Ventura, G.

    2015-12-01

    We have carried out laboratory experiments to study the generation of granular flows on the slopes of pyroclastic cones that are experiencing volcanic tremor or tectonic earthquakes. These experiments are inspired by the occurrence of granular flows on the flanks of Mount Vesuvius during its 1944 eruption. Our laboratory model consists of sand cones built around a vibrating tube which represents a volcanic conduit with erupting magma inside. A video camera allows the study of the granular flow inception, movement and deposition. Although the collapse of the entire cone is obtained at a specific resonance frequency, individual granular flows can be generated by all the vibration frequencies and all the vibration amplitudes that our experimental apparatus has allowed us to adopt. We believe that this is due to the fact that the energy threshold to generate the flows is small in value. Therefore, if this is true in nature as well, shaken pyroclastic cones are always potentially dangerous because they can easily generate flows that can strike the surrounding areas.

  5. Development of Design Criteria for Fluid Induced Structural Vibrations in Steam Generators and Heat Exchangers

    Energy Technology Data Exchange (ETDEWEB)

    Uvan Catton; Vijay K. Dhir; Deepanjan Mitra; Omar Alquaddoomi; Pierangelo Adinolfi

    2004-04-06

    Flow-induced vibration in heat exchangers has been a major cause of concern in the nuclear industry for several decades. Many incidents of failure of heat exchangers due to apparent flow-induced vibration have been reported through the USNRC incident reporting system. Almost all heat exchangers have to deal with this problem during their operation. The phenomenon has been studied since the 1970s and the database of experimental studies on flow-induced vibration is constantly updated with new findings and improved design criteria for heat exchangers.

  6. Design and optimization of a bi-axial vibration-driven electromagnetic generator

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jin, E-mail: yangjin@cqu.edu.cn; Yu, Qiangmo; Zhao, Jiangxin; Zhao, Nian; Wen, Yumei; Li, Ping; Qiu, Jing [Department of Optoelectronic Engineering, Research Center of Sensors and Instruments, Chongqing University, Chongqing 400044 (China)

    2014-09-21

    To scavenge energy from ambient vibrations with arbitrary in-plane motion directions and over a wide frequency range, a novel electromagnetic vibration energy harvester is designed and optimized. In the harvester, a circular cross-section elastic rod, not a traditional thin cantilever beam, is used to extract ambient vibration energy because of its capability to collect vibration from arbitrary in-plane motion directions. The magnetic interaction between magnets and the iron core contributes to a nonlinear oscillation of the rod with increased frequency bandwidth. The influences of the structure configurations on the electrical output and the working bandwidth of the harvester are investigated using Ansoft's Maxwell 3D to achieve optimal performance. The experimental results show that the harvester is sensitive to vibrations from arbitrary in-plane directions and it exhibits a bandwidth of 5.7 Hz and a maximum power of 13.4 mW at an acceleration of 0.6 g (with g=9.8 ms⁻²).

  7. A 2.5D finite element approach for predicting ground vibrations generated by vertical track irregularities

    Institute of Scientific and Technical Information of China (English)

    Xue-cheng BIAN; Chang CHAO; Wan-feng JIN; Yun-min CHEN

    2011-01-01

    Dynamic responses of track structure and wave propagation in nearby ground vibration become significant when train operates on high speeds.A train-track-ground dynamic interaction analysis model based on the 2.5D finite element method is developed for the prediction of ground vibrations due to vertical track irregularities.The one-quarter car model is used to represent the train as lumped masses connected by springs.The embankment and the underlying ground are modeled by the 2.5D finite element approach to improve the computation efficiency.The Fourier transform is applied in the direction of train's movement to express the wave motion with a wave-number.The one-quarter car model is coupled into the global stiffness matrix describing the track-ground dynamic system with the displacement compatibility condition at the wheel-rail interface,including the irregularities on the track surface.Dynamic responses of the track and ground due to train's moving loads are obtained in the wave-number domain by solving the governing equation,using a conventional finite element procedure.The amplitude and wavelength are identified as two major parameters describing track irregularities.The irregularity amplitude has a direct impact on the vertical response for low-speed trains,both for short wavelength and long wavelength irregularities.Track irregularity with shorter wavelength can generate stronger track vibration both for low-speed and high-speed cases.For low-speed case,vibrations induced by track irregularities dominate far field responses.For high-speed case,the wavelength of track irregularities has very little effect on ground vibration at distances far from track center,and train's wheel axle weights becomes dominant.

  8. ENIDINE: Vibration and seismic isolation technologies for power generation station applications

    Energy Technology Data Exchange (ETDEWEB)

    Zemanek, T.A.

    1994-12-31

    ENIDINE Inc. is a world leader in the design and manufacture of shock and vibration mounts. Founded in 1966, the company has two manufacturing facilities, employs over 300 people and supports a worldwide network of distributors and representatives. ENIDINE Inc. is part of the ENIDINE Corporate Group which owns a number of companies that design and manufacture Hydraulic/Pneumatic cylinders, Electromechanical devices, Hydraulic Control Valves and a number of Industrial Distribution companies throughout Europe. In total, the ENIDINE Corporate Group has over 900 employees with annual sales of over $100 million. ENIDINE shock and vibration mounts are used to isolate the vibration of missiles from their guidance systems, pumps from hospital operating equipment and off shore oil rigs, from the shock energy of waves in the North Sea. ENIDINE products can be found on all Boeing and McDonnell Douglas aircraft, as well as many electronic and weapons systems on board Navy ships.

  9. Fabrication and performance evaluation of a metal-based bimorph piezoelectric MEMS generator for vibration energy harvesting

    Science.gov (United States)

    Kuo, Chun-Liang; Lin, Shun-Chiu; Wu, Wen-Jong

    2016-10-01

    This paper presents the development of a bimorph microelectromechanical system (MEMS) generator for vibration energy harvesting. The bimorph generator is in cantilever beam structure formed by laminating two lead zirconate titanate thick-film layers on both sides of a stainless steel substrate. Aiming to scavenge vibration energy efficiently from the environment and transform into useful electrical energy, the two piezoelectric layers on the device can be poled for serial and parallel connections to enhance the output voltage or output current respectively. In addition, a tungsten proof mass is bonded at the tip of the device to adjust the resonance frequency. The experimental result shows superior performance the generator. At the 0.5 g base excitation acceleration level, the devices pooled for serial connection and the device poled for parallel connection possess an open-circuit output voltage of 11.6 VP-P and 20.1 VP-P, respectively. The device poled for parallel connection reaches a maximum power output of 423 μW and an output voltage of 15.2 VP-P at an excitation frequency of 143.4 Hz and an externally applied based excitation acceleration of 1.5 g, whereas the device poled serial connection achieves a maximum power output of 413 μW and an output voltage of 33.0 VP-P at an excitation frequency of 140.8 Hz and an externally applied base excitation acceleration of 1.5 g. To demonstrate the feasibility of the MEMS generator for real applications, we finished the demonstration of a self-powered Bluetooth low energy wireless temperature sensor sending readings to a smartphone with only the power from the MEMS generator harvesting from vibration.

  10. Somatic growth of mussels Mytilus edulis in field studies compared to predictions using BEG, DEB, and SFG models

    Science.gov (United States)

    Larsen, Poul S.; Filgueira, Ramón; Riisgård, Hans Ulrik

    2014-04-01

    Prediction of somatic growth of blue mussels, Mytilus edulis, based on the data from 2 field-growth studies of mussels in suspended net-bags in Danish waters was made by 3 models: the bioenergetic growth (BEG), the dynamic energy budget (DEB), and the scope for growth (SFG). Here, the standard BEG model has been expanded to include the temperature dependence of filtration rate and respiration and an ad hoc modification to ensure a smooth transition to zero ingestion as chlorophyll a (chl a) concentration approaches zero, both guided by published data. The first 21-day field study was conducted at nearly constant environmental conditions with a mean chl a concentration of C = 2.7 μg L- 1, and the observed monotonous growth in the dry weight of soft parts was best predicted by DEB while BEG and SFG models produced lower growth. The second 165-day field study was affected by large variations in chl a and temperature, and the observed growth varied accordingly, but nevertheless, DEB and SFG predicted monotonous growth in good agreement with the mean pattern while BEG mimicked the field data in response to observed changes in chl a concentration and temperature. The general features of the models were that DEB produced the best average predictions, SFG mostly underestimated growth, whereas only BEG was sensitive to variations in chl a concentration and temperature. DEB and SFG models rely on the calibration of the half-saturation coefficient to optimize the food ingestion function term to that of observed growth, and BEG is independent of observed actual growth as its predictions solely rely on the time history of the local chl a concentration and temperature.

  11. Binding of Na+ and K+ to the Headgroup of Palmitic Acid Monolayers Studied by Vibrational Sum Frequency Generation Spectroscopy

    Science.gov (United States)

    Huang, Zishuai; Allen, Heather C.

    2012-06-01

    Alkali cations are critical in biological systems due to their electrical interaction with cell membranes. While Na+ and K+ share similar chemical and physical properties, they can exhibit differences when interacting with biological membranes. These phenomena may be modeled using a Langmuir monolayer of surfactant on alkali chloride solutions. Vibrational sum frequency generation (VSFG) spectroscopy is an interface specific technique that is widely employed to study molecular organization at surfaces and interfaces. VSFG spectroscopy was used to probe the CO2- vibrational mode for the carboxylic acid headgroup of palmitic acid (PA) spread on the surface of NaCl and KCl solutions in the vibrational region between 1400 and 1500 cm-1. The ability of Na+ and K+ to bind with the carboxylic headgroup of PA is revealed by observing peak positions (˜1410 cm-1 and ˜1470 cm-1) and relative intensity for the CO2- peaks. These results are compared and discussed with perspective toward elucidating interfacial PA headgroup organization. The time evolution for the PA CO2- peaks is also monitored after monolayer spreading via VSFG and these results are presented as well.

  12. Elucidating low-frequency vibrational dynamics in calcite and water with time-resolved third-harmonic generation spectroscopy.

    Science.gov (United States)

    Wang, Liang; Liu, Weimin; Fang, Chong

    2015-07-14

    Low-frequency vibrations are foundational for material properties including thermal conductivity and chemical reactivity. To resolve the intrinsic molecular conformational dynamics in condensed phase, we implement time-resolved third-harmonic generation (TRTHG) spectroscopy to unravel collective skeletal motions in calcite, water, and aqueous salt solution in situ. The lifetime of three Raman-active modes in polycrystalline calcite at 155, 282 and 703 cm(-1) is found to be ca. 1.6 ps, 1.3 ps and 250 fs, respectively. The lifetime difference is due to crystallographic defects and anharmonic effects. By incorporating a home-built wire-guided liquid jet, we apply TRTHG to investigate pure water and ZnCl2 aqueous solution, revealing ultrafast dynamics of water intermolecular stretching and librational bands below 500 cm(-1) and a characteristic 280 cm(-1) vibrational mode in the ZnCl4(H2O)2(2-) complex. TRTHG proves to be a compact and versatile technique that directly uses the 800 nm fundamental laser pulse output to capture ultrafast low-frequency vibrational motion snapshots in condensed-phase materials including the omnipresent water, which provides the important time dimension to spectral characterization of molecular structure-function relationships.

  13. Sensitivity analysis of torsional vibration behavior of the shafting of a turbo generator set to changes of its mechanical parameters

    Institute of Scientific and Technical Information of China (English)

    XIE Danmei; LIU Zhanhui; ZHANG Hengliang; YANG Changzhu; DONG Chuan

    2007-01-01

    Aiming at a 300 MW turbo-generator model,the sensitivity of natural torsional frequencies and modes of torsional vibration (TV) to the rotational inertia and stiffness of the turbo-generator were analyzed.Calculation results show that the variation of the rotational inertia or stiffness either of the rotor system as a whole (namely shafting) or only locally may both remarkably influence the TV characteristics of the rotor.The influence of localized variation is still notable although it is not as great as that of the rotor as a whole.The segments on the shafting,which contribute more to a certain mode of vibration,have a greater influence on the pertaining order of TV.Compared with the modal shape,a larger slope can be observed at these sections of the rotor for the particular mode.Thus,frequencies can be modulated by modifying the local construction of the rotor to make the natural TV frequency of a certain order avoid some specific value,herewith arriving at the objective of tuning.Therefore,it is very important,in the course of modeling for the purpose of studying the TV of the shafting of a turbo-set,to accurately determine the structural parameters of parts that have a relatively sensitive effect on the TV behavior.

  14. Somatic growth of mussels Mytilus edulis in field studies compared to predictions using BEG, DEB, and SFG models

    DEFF Research Database (Denmark)

    Larsen, Poul Scheel; Filgueira, Ramón; Riisgård, Hans Ulrik

    2014-01-01

    model has been expanded to include the temperature dependence of filtration rate and respiration and an ad hoc modification to ensure a smooth transition to zero ingestion as chlorophyll a (chl a) concentration approaches zero, both guided by published data. The first 21-day field study was conducted......Prediction of somatic growth of blue mussels, Mytilus edulis, based on the data from 2 field-growth studies of mussels in suspended net-bags in Danish waters was made by 3 models: the bioenergetic growth (BEG), the dynamic energy budget (DEB), and the scope for growth (SFG). Here, the standard BEG...... at nearly constant environmental conditions with a mean chl a concentration of C=2.7μgL−1, and the observed monotonous growth in the dry weight of soft parts was best predicted by DEB while BEG and SFG models produced lower growth. The second 165-day field study was affected by large variations in chl...

  15. Probing the structure and nano-scale mechanical properties of polymer surfaces with scanning force microscopy and sum frequency vibrational spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Gracias, David Hugo [Univ. of California, Berkeley, CA (United States)

    1999-05-01

    Scanning Force Microscopy (SFM) has been used to quantitatively measure the elastic modulus, friction and hardness of polymer surfaces with special emphasis on polyethylene and polypropylene. In the experiments, tips of different radii of curvature ranging from 20 nm to 1000 nm have been used and the high pressure applied by the SFM have been observed to affect the values obtained in the measurements. The contact of the SFM tip with the polymer surface is explained by fitting the experimental curves to theoretical predictions of contact mechanics. Sum Frequency Generation (SFG) Vibrational Spectroscopy has been used to measure vibrational spectra of polymer surfaces in the vibrational range of 2700 to 3100 cm-1. Strong correlations are established between surface chemistry and surface structure as probed by SFG and mechanical properties measured by SFM on the surfaces. In these studies segregation of low surface energy moieties, from the bulk of the polymer to the surface have been studied. It was found that surface segregation occurs in miscible polymer blends and a small concentration of surface active polymer can be used to totally modify the surface properties of the blend. A novel high vacuum SFM was built to do temperature dependent measurements of mechanical changes occurring at the surface of polypropylene during the glass transition of the polymer. Using this instrument the modulus and friction of polypropylene was measured in the range of room temperature to ˜-60°C. An increase in the ordering of the backbone of the polymer chains below the glass transition measured by SFG correlates well with the increase in modulus measured on the same surface with SFM. Friction measurements have been done on polyethylene with three different instruments by applying loads ranging from nN to sub newton i.e. over eight orders of magnitude. Pressure and contact area effects were observed to play a significant role in determining the frictional response of the polymer

  16. Sum-Frequency-Generation-Based Laser Sidebands for Tunable Femtosecond Raman Spectroscopy in the Ultraviolet

    Directory of Open Access Journals (Sweden)

    Liangdong Zhu

    2015-04-01

    Full Text Available Femtosecond stimulated Raman spectroscopy (FSRS is an emerging molecular structural dynamics technique for functional materials characterization typically in the visible to near-IR range. To expand its applications we have developed a versatile FSRS setup in the ultraviolet region. We use the combination of a narrowband, ~400 nm Raman pump from a home-built second harmonic bandwidth compressor and a tunable broadband probe pulse from sum-frequency-generation-based cascaded four-wave mixing (SFG-CFWM laser sidebands in a thin BBO crystal. The ground state Raman spectrum of a laser dye Quinolon 390 in methanol that strongly absorbs at ~355 nm is systematically studied as a standard sample to provide previously unavailable spectroscopic characterization in the vibrational domain. Both the Stokes and anti-Stokes Raman spectra can be collected by selecting different orders of SFG-CFWM sidebands as the probe pulse. The stimulated Raman gain with the 402 nm Raman pump is >21 times larger than that with the 550 nm Raman pump when measured at the 1317 cm−1 peak for the aromatic ring deformation and ring-H rocking mode of the dye molecule, demonstrating that pre-resonance enhancement is effectively achieved in the unique UV-FSRS setup. This added tunability in the versatile and compact optical setup enables FSRS to better capture transient conformational snapshots of photosensitive molecules that absorb in the UV range.

  17. Observation of Charge Inversion of an Ionic Liquid at the Solid Salt-Liquid Interface by Sum Frequency Generation Spectroscopy.

    Science.gov (United States)

    Peñalber, Chariz Y; Baldelli, Steven

    2012-04-05

    Sum frequency generation (SFG) vibrational spectroscopy of the ionic liquid, 1-butyl-3-methylimidazolium dicyanamide [BMIM][DCA], in contact with two different solid salt surfaces, BaF2(111) single crystal and solid NaCl{100}, are discussed in this Letter. This investigation describes the nature of an ionic liquid-(solid) salt interface using SFG, contributing a new understanding to the molecular-level interactions involved in salts, which are conceptually similar compounds (of purely ionic character) but of different physical properties (liquid versus solid at room temperature). Results show the presence of [BMIM](+) at the NaCl{100} surface and [DCA](-) at the BaF2(111) surface. [BMIM](+) cations adhere closely via Coulombic interactions to the negatively charged NaCl{100} surface, while [DCA](-) anions subsequently have a strong electrostatic affinity to the positively charged BaF2(111) surface. Ions of the ionic liquid adsorb to the solid salt surface to form a Helmholtz-like electric double layer.

  18. A narrow amide I vibrational band observed by sum frequency generation spectroscopy reveals highly ordered structures of a biofilm protein at the air/water interface.

    Science.gov (United States)

    Wang, Zhuguang; Morales-Acosta, M Daniela; Li, Shanghao; Liu, Wei; Kanai, Tapan; Liu, Yuting; Chen, Ya-Na; Walker, Frederick J; Ahn, Charles H; Leblanc, Roger M; Yan, Elsa C Y

    2016-02-18

    We characterized BslA, a bacterial biofilm protein, at the air/water interface using vibrational sum frequency generation spectroscopy and observed one of the sharpest amide I bands ever reported. Combining methods of surface pressure measurements, thin film X-ray reflectivity, and atomic force microscopy, we showed extremely ordered BslA at the interface.

  19. Atomization off thin water films generated by high-frequency substrate wave vibrations.

    Science.gov (United States)

    Collins, David J; Manor, Ofer; Winkler, Andreas; Schmidt, Hagen; Friend, James R; Yeo, Leslie Y

    2012-11-01

    Generating aerosol droplets via the atomization of thin aqueous films with high frequency surface acoustic waves (SAWs) offers several advantages over existing nebulization methods, particularly for pulmonary drug delivery, offering droplet sizes in the 1-5-μm range ideal for effective pulmonary therapy. Nevertheless, the physics underlying SAW atomization is not well understood, especially in the context of thin liquid film formation and spreading and how this affects the aerosol production. Here, we demonstrate that the film geometry, governed primarily by the applied power and frequency of the SAW, indeed plays a crucial role in the atomization process and, in particular, the size of the atomized droplets. In contrast to the continuous spreading of low surface energy liquids atop similar platforms, high surface energy liquids such as water, in the present case, are found to undergo transient spreading due to the SAW to form a quasisteady film whose height is determined by self-selection of the energy minimum state associated with the acoustic resonance in the film and whose length arises from a competition between acoustic streaming and capillary effects. This is elucidated from a fundamental model for the thin film spreading behavior under SAW excitation, from which we show good agreement between the experimentally measured and theoretically predicted droplet dimension, both of which consistently indicate a linear relationship between the droplet diameter and the mechanical power coupled into the liquid by the SAW (the latter captured by an acoustic Weber number to the two thirds power, and the reciprocal of the SAW frequency).

  20. Photocatalytic oxidation of the organic monolayers on TiO{sub 2} surface investigated by in-situ sum frequency generation spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Tong, Yujin; Peng, Qiling; Ma, Tongsen; Nishida, Takuma; Ye, Shen, E-mail: ye@cat.hokudai.ac.jp [Catalysis Research Center, Hokkaido University, Sapporo 060-0811 (Japan)

    2015-10-01

    In-situ vibrational sum frequency generation (SFG) spectroscopy has been employed to investigate the photocatalytic oxidation of two types of well-ordered organic monolayers, namely, an arachidic acid (AA) monolayer prepared by the Langmuir-Blodgett method and an octadecyltrichlorosilane (OTS) monolayer prepared by the self-assembling method, on a TiO{sub 2} surface under ultraviolet (UV) irradiation. The extremely high sensitivity and unique selectivity of the SFG spectroscopy enabled us to directly probe the structural changes in these monolayers during the surface photocatalytic oxidation and further elucidate their reaction mechanisms at a molecular level. It was revealed that the ordering of the monolayers during the photocatalytic reaction is strongly dependent on their interaction with the substrate; the AA monolayer maintains its ordered conformation until the final oxidation stage, while the OTS monolayer shows a large increase in disordering during the initial oxidation stage, indicating a different photocatalytic reaction mechanism of the two monolayers on the TiO{sub 2} surface.

  1. Photocatalytic oxidation of the organic monolayers on TiO2 surface investigated by in-situ sum frequency generation spectroscopy

    Directory of Open Access Journals (Sweden)

    Yujin Tong

    2015-10-01

    Full Text Available In-situ vibrational sum frequency generation (SFG spectroscopy has been employed to investigate the photocatalytic oxidation of two types of well-ordered organic monolayers, namely, an arachidic acid (AA monolayer prepared by the Langmuir-Blodgett method and an octadecyltrichlorosilane (OTS monolayer prepared by the self-assembling method, on a TiO2 surface under ultraviolet (UV irradiation. The extremely high sensitivity and unique selectivity of the SFG spectroscopy enabled us to directly probe the structural changes in these monolayers during the surface photocatalytic oxidation and further elucidate their reaction mechanisms at a molecular level. It was revealed that the ordering of the monolayers during the photocatalytic reaction is strongly dependent on their interaction with the substrate; the AA monolayer maintains its ordered conformation until the final oxidation stage, while the OTS monolayer shows a large increase in disordering during the initial oxidation stage, indicating a different photocatalytic reaction mechanism of the two monolayers on the TiO2 surface.

  2. High resolution time-to-space conversion of sub-picosecond pulses at 1.55µm by non-degenerate SFG in PPLN crystal.

    Science.gov (United States)

    Shayovitz, Dror; Herrmann, Harald; Sohler, Wolfgang; Ricken, Raimund; Silberhorn, Christine; Marom, Dan M

    2012-11-19

    We demonstrate high resolution and increased efficiency background-free time-to-space conversion using spectrally resolved non-degenerate and collinear SFG in a bulk PPLN crystal. A serial-to-parallel resolution factor of 95 and a time window of 42 ps were achieved. A 60-fold increase in conversion efficiency slope compared with our previous work using a BBO crystal [D. Shayovitz and D. M. Marom, Opt. Lett. 36, 1957 (2011)] was recorded. Finally the measured 40 GHz narrow linewidth of the output SFG signal implies the possibility to extract phase information by employing coherent detection techniques.

  3. Identification of a wagging vibrational mode of water molecules at the water/vapor interface.

    Science.gov (United States)

    Perry, Angela; Neipert, Christine; Ridley, Christina; Space, Brian; Moore, Preston B

    2005-05-01

    An improved time correlation function description of sum frequency generation (SFG) spectroscopy was applied to theoretically describe the water/vapor interface. The resulting spectra compare favorably in shape and relative magnitude to extant experimental results in the O-H stretching region of water. Further, the SFG spectra show a well-defined intermolecular mode at 875 cm(-1) that has significant intensity. The resonance is due to a wagging mode localized on a single water molecule. It represents a well-defined population of water molecules at the interface that, along with the free O-H modes, represent the dominant interfacial species.

  4. Modeling and application of piezoelectric vibration-based power generator%压电式振动发电机的建模及应用

    Institute of Scientific and Technical Information of China (English)

    贺学锋; 温志渝; 温中泉

    2009-01-01

    振动式压电发电机是一种可为旋转机械故障诊断中的无线传感节点供电的微能源.本文设计了由压电悬臂梁、质量块和固定装置组成的振动式压电发电机,并建立了安装在恒速旋转机械上的悬臂梁式发电机的数学模型.分析了轴向分力对悬臂梁刚度和发电机频率的影响,在考虑悬臂梁受到轴向力影响的基础上,给出了发电机固有频率、输出电压和输出功率的公式.对一个安装于转动框架上的振动式压电发电机进行了测量,结果表明,当框架转动频率为14.25 Hz时,发电机的输出功率约为35 μW,随着旋转机械转动频率偏离发电机固有频率,发电机的输出功率很快降低.%The piezoelectric vibration-based power generator is apromising MEMS electricity source to power wireless sensing nodes for the fault diagnosis of rotary machines. In this paper,a piezoelectric vibration-based power generator is designed and the mathematical model of the cantilever piezoelectric generator used in rotary mechines is established.Then,the effects of the axial extension force on the stiffness of the beam and the frequency of the generator are analyzed,and the formulas of the frequency, output voltage and output power of the cantilever piezoelectric generator are derived. The output property of the piezoelectric vibration-based generator fixed on a rotary frame is measured.Obtained results show that the maximum output power of the generator is about 35 μW at the rotation frequency about 14.25 Hz. The output power decreases quickly when the rotation frequency deviates from the frequency of the generator.

  5. Power spectral density function and spatial autocorrelation of the ambient vibration full-wavefield generated by a distribution of spatially correlated surface sources

    Science.gov (United States)

    Lunedei, Enrico; Albarello, Dario

    2016-03-01

    Synthetic dispersion curves are here computed in the frame of an ambient-vibration full-wavefield model, which relies on the description of both ambient-vibration ground displacement and its sources as stochastic fields defined on the Earth's surface, stationary in time and homogeneous in space. In this model, previously developed for computing synthetic Horizontal-to-Vertical Spectral Ratio curves, the power spectral density function and the spatial autocorrelation of the displacement are naturally described as functions of the power spectral density function of the generating forces and of the subsoil properties (via the relevant Green's function), by also accounting for spatial correlation of these forces. Dispersion curves are computed from the displacement power spectral density function and from the spatial autocorrelation according with the well-known f-k and SPAC techniques, respectively. Two examples illustrate the way this new ambient-vibration model works, showing its possible use in better understanding the role of the surface waves in forming the dispersion curves, as well as its capability to capture some remarkable experimental findings.

  6. 立车变速箱振动噪声产生的机理及测试%Vibration noise generation mechanism and test of vertical lathe gearbox

    Institute of Scientific and Technical Information of China (English)

    王世杰; 焦卫兵

    2014-01-01

    Noise is the most important factor in measuring the quality level of vertical lathe gearbox. The noise generation mechanism of vertical lathe gearbox was analyzed during the transmission. And then the noise measuring system was determined. Finally, the vibration testing system was designed.%对立车变速箱传动过程中的噪声产生机理进行了分析,确定了箱体噪声测量系统,最后对振动测试系统进行了设计。

  7. Sum Frequency Generation Spectroscopy and Molecular Dynamics Simulations Reveal a Rotationally Fluid Adsorption State of α-Pinene on Silica

    Energy Technology Data Exchange (ETDEWEB)

    Ho, Junming; Psciuk, Brian T.; Chase, Hilary M.; Rudshteyn, Benjamin; Upshur, Mary Alice; Fu, Li; Thomson, Regan J.; Wang, Hong-Fei; Geiger, Franz M.; Batista, Victor S.

    2016-06-16

    A rotationally fluid state of α-pinene at fused silica/vapor interfaces is revealed by computational and experimental vibrational sum frequency generation (SFG) studies. We report the first assignment of the vibrational modes in the notoriously congested C-H stretching region of α-pinene and identify its bridge methylene group on the four-membered ring ("βCH2") as the origin of its dominant spectral feature. We find that the spectra are perfused with Fermi resonances that need to be accounted for explicitly in the computation of vibrational spectra of strained hydrocarbons such α-pinene. The preferred orientations of α-pinene are consistent with optimization of van der Waals contacts with the silica surface that results in a bimodal distribution of highly fluxional orientations in which the βCH2 group points "towards" or "away from” the surface. The reported findings are particularly relevant to the exposure of α-pinene to primary oxidants in heterogeneous catalytic pathways that exploit α-pinene as a sustainable feedstock for fine chemicals and polymers.

  8. 多悬臂梁式压电振动发电机的多方向发电性能%Multi-direction Generation Performance for Multi-cantilever-beam-type Piezoelectric Vibration Generator

    Institute of Scientific and Technical Information of China (English)

    刘祥建; 陈仁文; 侯志伟

    2016-01-01

    为提高压电振动发电机对多方向振动环境的适应能力,研究了一种多悬臂梁式压电振动发电机的多方向发电性能问题。基于机械振动学理论和压电学理论,建立了多悬臂梁式压电振动发电机的发电模型,研究结果表明,在不同方向外界激励下,发电机都能产生一定的电能,且产生的最大电能达到128μJ,产生的最小电能约为38μJ,说明多悬臂梁式压电振动发电机在多方向振动环境中具有较强的适应能力,更容易获得较好的发电效果。%With the aim to enhance the energy conversion efficiency in the multi-direction vibra-tion environment,the problem of multi-direction generation performance for multi-cantilever-beam-type piezoelectric vibration generator (PVG)is studied.The generation model of the multi-cantilever-beam-type PVG is established on the basis of the mechanical vibration theory and the piezoelectricity theory.The results show that the multi-cantilever-beam-type PVG can generate more electricity as the excitation direction changing,and the maximum electric energy of the generator can reach 128μJ,the minimum electric energy is about 38μJ.It shows that the multi-cantilever-beam-type PVG has strong adaptability in the multi-direction vibration envi-ronment,and it is easier to obtain a better generation effect.

  9. Power-Generation Characteristics After Vibration and Thermal Stresses of Thermoelectric Unicouples with CoSb3/Ti/Mo(Cu) Interfaces

    Science.gov (United States)

    Bae, Kwang Ho; Choi, Soon-Mok; Kim, Kyung-Hun; Choi, Hyoung-Seuk; Seo, Won-Seon; Kim, Il-Ho; Lee, Soonil; Hwang, Hae Jin

    2015-06-01

    Reliability tests for thermoelectric unicouples were carried out to investigate the adhesion properties of CoSb3/Ti/Mo(Cu) interfaces. The n-type In0.25 Co3.95Ni0.05Sb12 and p-type In0.25Co3FeSb12 bulks were prepared for fabricating a thermoelectric unicouple (one p- n couple) by an induction melting and a spark plasma sintering process. Mo-Cu alloy was selected as an electrode for the unicouples due to its high melting temperature and proper work function value. Many thermoelectric unicouples with the CoSb3/Ti/Mo(Cu) interfaces were fabricated with the proper brazing materials by means of a repeated firing process. Reliability of the unicouples with the interfaces was evaluated by a vibration test and a thermal cycling test. After the thermal cycling and vibration tests, the power-generation characteristics of the unicouples were compared with the unicouples before the tests. Even after the vibration test, electrical power with a power density of 0.5 W/cm2 was generated. The Ti-interlayer is considered as a possible candidate for making a reliable unicouple with high adhesion strength. With the thermal cycling test, the resistance of the unicouple increased and the electrical power from the unicouple decreased. A failure mode by the thermal cycling test was ascribed to a complex effect of micro-cracks originated from the thermal stress and oxidation problem of the thermoelectric materials; that is, a thick oxide layer more than 300 μm was detected after a high-temperature durability test of n-type In0.25Co3.95Ni0.05Sb12 material at 773 K in air for 7 days.

  10. 200 MW Turbo-generator Set Start Process of Vibration Fault Diagnosis and Processing%200 MW 汽轮发电机组启动过程振动故障诊断及处理

    Institute of Scientific and Technical Information of China (English)

    崔英龙; 王凤良

    2015-01-01

    阐述了某电厂2号汽轮发电机组在大修后启动过程中发电机转子存在的振动超标问题,通过对机组各测点振动值的获取,综合分析了引起该机组发电机转子振动超标故障的原因,经过对发电机转子进行现场动平衡,消除了由发电机转子一阶不平衡引起的振动超标故障,机组各测点的振动水平达到优良水平,保障了机组运行的安全稳定。%This paper expounds the no .2 in one power plant steam turbine generator set start after overhaul process the problem of excessive vibration of the rotor of the generator based on the unit of each measuring point vibration acquisition , analyzed the causes of excess the generator rotor vibration fault , after the scene of the generator rotor dynamic balance , eliminate the vibration caused by unbalanced generator rotor first-order exceeds bid failure , unit of each measuring point vibration level to good level , to ensure the safety of the unit operation stability .

  11. The steady state of a particle in a vibrating box and possible application in short pulse generation of charged particles

    Indian Academy of Sciences (India)

    Nandan Jha; Sudhir R Jain

    2013-09-01

    In this paper the classical evolution of a particle is studied which bounces back and forth in a 1D vibrating cavity such that the reflection from the wall does not change the speed of the particle. A peculiar behaviour of the particle motion can be seen where the time evolution of the motion shows superposition of linear and oscillatory behaviour. In particular, the parameter range is found in which the particle oscillates between the walls in steady state as if the wall was static and it is showed that for these parameter ranges the particle settles to this steady state for all initial conditions. It is proposed that this phenomenon can be used to bunch charged particles in short pulses where the synchronization proposed in our model should work against the space charge effect in the charged particle bunch.

  12. Influence of treatment by vibration in residual stress generated in the laser welding of HSLA and IF steels; Influencia do tratamento de vibracao nas tensoes residuais geradas na soldagem a laser de acos ARBL e IF

    Energy Technology Data Exchange (ETDEWEB)

    Chuvas, T.C.; Fonseca, M.P. Cindra, E-mail: chuvas@vm.uff.b [Universidade Federal Fluminense (PGMEC/UFF), Niteroi, RJ (Brazil). Programa de Pos-graduacao em Engenharia Mecanica; Castello, D.A. [Universidade Federal do Rio de Janeiro (DEM/UFRJ), RJ (Brazil). Dept. de Engenharia Mecanica

    2010-07-01

    The stress relieving treatment by vibration is a new technology under development, which has many advantages over thermal methods. In this work was analyzed the surface residual stress generated in the laser welding of biphasic HSLA and IF steels, both used in the automotive industry. Residual stresses were measured by X-ray diffraction, by the sen{sup 2} {Psi} method. Residual stresses generated in the welding of the samples were tensile at all points measured. After welding, the samples were submitted to the mechanical vibration treatment. Some samples presented a significant reduction in the stress values. The welded joints were also characterized by optical microscopy. (author)

  13. Sum Frequency Generation Vibrational Spectroscopy and Kinetic Study of 2-Methylfuran and 2,5-Dimethylfuran Hydrogenation over 7 nm Platinum Cubic Nanoparticles

    KAUST Repository

    Aliaga, Cesar

    2011-04-28

    Sum frequency generation vibrational spectroscopy and kinetic measurements obtained from gas chromatography were used to study the adsorption and hydrogenation of 2-methylfuran (MF) and 2,5-dimethylfuran (DMF) over cubic Pt nanoparticles of 7 nm average size, synthesized by colloidal methods and cleaned by ultraviolet light and ozone treatment. Reactions carried out at atmospheric pressure in the temperature range of 20-120 °C produced dihydro and tetrahydro species, as well as ring-opening products (alcohols) and ring-cracking products, showing high selectivity toward ring opening throughout the entire temperature range. The aromatic rings (MF and DMF) adsorbed parallel to the nanoparticle surface. Results yield insight into various surface reaction intermediates and the reason for the significantly lower selectivity for ring cracking in DMF hydrogenation compared to MF hydrogenation. © 2011 American Chemical Society.

  14. Coherent vibrational dynamics

    CERN Document Server

    Lanzani, Guglielmo; De Silvestri, Sandro

    2007-01-01

    Vibrational spectroscopy is a powerful investigation tool for a wide class of materials covering diverse areas in physics, chemistry and biology. The continuous development in the laser field regarding ultrashort pulse generation has led to the possibility of producing light pulses that can follow vibrational motion coupled to the electronic transitions in molecules and solids in real time. Aimed at researchers and graduate students using vibrational spectroscopy, this book provides both introductory chapters as well as more advanced contents reporting on recent progress. It also provides a good starting point for scientists seeking a sound introduction to ultrafast optics and spectroscopic techniques.

  15. Design of a generator of harmonic vibrations for rotary unbalance; Diseno de un generador de vibraciones armonicas por desbalance rotatorio

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Vazquez, Ely Edmundo [Grupo de Investigacion Aplicada, Queretaro, Queretaro (Mexico); Silva Navarro, Gerardo [Cinvestav, IPN, Mexico, D.F. (Mexico); Zuniga Osorio, Helen Janeth [CIATEQ, Queretaro, Queretaro (Mexico)

    2007-11-15

    In this paper is presented the experimental development of an integral system for the monitoring and acquisition of involved physical variables in the performance analysis of the turbo-machinery. The integral system has been denominated SMD Turbo (System of Monitoring and Diagnosis for turbo-machinery) and has as fundamental intention to realize the analysis and diagnosis (on the basis of mathematical and graphical tools) of the performance of a machine through the physical measurement of physical variables such as pressure, temperature and vibration. The system is able to realize the analysis of the information in real time and to store it for its later processing of diagnosis by means of specialized software with which the calculations of the performance will be able to be realized. Preliminary results of the proposal are presented that confirm the viability of the proposal. [Spanish] En este trabajo se presenta el desarrollo experimental de un sistema integral para el monitoreo y adquisicion de variables fisicas involucradas en el analisis del rendimiento de la turbomaquinaria. El sistema integral se ha denominado SMD Turbo (Sistema de Monitoreo y Diagnostico para trubomaquinaria) y tiene como proposito fundamental realizar el analisis y diagnostico (en base a herramientas matematicas y graficas) del rendimiento de la turbo maquina a traves de la medicion de variable fisicas como por ejemplo, presion, temperatura y vibracion. El sistema es capaz de realizar el analisis de la informacion en tiempo real y almacenarla para su posterior proceso de diagnostico mediante un software especializado con el cual se podran realizar los calculos del rendimiento. Se presentan resultados preliminares de la propuesta que confirman la viabilidad de la propuesta.

  16. High force vibration testing with wide frequency range

    Energy Technology Data Exchange (ETDEWEB)

    Romero, Edward F.; Jepsen, Richard A.; Gregory, Danny Lynn

    2013-04-02

    A shaker assembly for vibration testing includes first and second shakers, where the first shaker includes a piezo-electric material for generating vibration. A support structure permits a test object to be supported for vibration of the test object by both shakers. An input permits an external vibration controller to control vibration of the shakers.

  17. Direct comparison of phase-sensitive vibrational sum frequency generation with maximum entropy method: case study of water.

    Science.gov (United States)

    de Beer, Alex G F; Samson, Jean-Sebastièn; Hua, Wei; Huang, Zishuai; Chen, Xiangke; Allen, Heather C; Roke, Sylvie

    2011-12-14

    We present a direct comparison of phase sensitive sum-frequency generation experiments with phase reconstruction obtained by the maximum entropy method. We show that both methods lead to the same complex spectrum. Furthermore, we discuss the strengths and weaknesses of each of these methods, analyzing possible sources of experimental and analytical errors. A simulation program for maximum entropy phase reconstruction is available at: http://lbp.epfl.ch/.

  18. Anomalous effective polarity of an air/liquid-mixture interface: a heterodyne-detected electronic and vibrational sum frequency generation study.

    Science.gov (United States)

    Mondal, Sudip Kumar; Inoue, Ken-ichi; Yamaguchi, Shoichi; Tahara, Tahei

    2015-10-07

    We study the effective polarity of an air/liquid-mixture interface by using interface-selective heterodyne-detected electronic sum frequency generation (HD-ESFG) and vibrational sum frequency generation (HD-VSFG) spectroscopies. With water and N,N-dimethylformamide (DMF) chosen as two components of the liquid mixture, the bulk polarity of the mixture is controlled nearly arbitrarily by the mixing ratio. The effective polarity of the air/mixture interface is evaluated by HD-ESFG with a surface-active solvatochromic molecule used as a polarity indicator. Surprisingly, the interfacial effective polarity of the air/mixture interface increases significantly, when the bulk polarity of the mixture decreases (i.e. when the fraction of DMF increases). Judging from the hydrogen-bond structure at the air/mixture interface clarified by HD-VSFG, this anomalous change of the interfacial effective polarity is attributed to the interface-specific solvation structure around the indicator molecule at the air/mixture interface.

  19. Waves & vibrations

    OpenAIRE

    Nicolas, Maxime

    2016-01-01

    Engineering school; This course is designed for students of Polytech Marseille, engineering school. It covers first the physics of vibration of the harmonic oscillator with damping and forcing, coupled oscillators. After a presentation of the wave equation, the vibration of strings, beams and membranes are studied.

  20. Research on Character of Generator Stator Core Vibration Modal Test%发电机定子铁芯模态振动特性试验研究

    Institute of Scientific and Technical Information of China (English)

    杨骏; 马斌; 吴鸿韬

    2013-01-01

    To prevent the resonance between the elliptic modal frequency of stator core and the twice fre-quency of the radial electromagnetic force in the turbo-generators operation , the modal test of the stator core of turbo-generators is necessary .A few factories of generator do some numerical simulations and sta-tor core modal test before the core leaving the factory , stator cores are little tested in the site of power plant .In this paper , through a number of examples of typical turbine power plant unit , some methods and characteristics of the modal test are introduced , and the key points in the process of field test are put forward .It is pointed out that the test of generator core vibration modal is a good method of safety supervi-sory technology of turbine-generators.%对发电机定子铁芯进行模态振动试验是为了防止汽轮发电机组在运行过程中定子铁芯椭圆形模态振动频率与双倍的发电机的径向电磁力频率产生共振。目前只有各个发电机制造厂进行数值模拟和出厂前进行模态振动测试,几乎没有在电厂生产现场进行该项测试。文章通过几个典型汽轮发电机测试实例详细介绍了对于电厂停机检修机组进行发电机定子铁芯模态试验的方法及特性,提出了现场试验过程中的要点。指出发电机铁芯模态振动测试是目前发电机安全监测工作中很好的补充技术手段。

  1. The crystal structure, vibrational spectra, thermal behaviour and second harmonic generation of aminoguanidinium(1+) hydrogen L-tartrate monohydrate

    Science.gov (United States)

    Macháčková, Zorka; Němec, Ivan; Teubner, Karel; Němec, Petr; Vaněk, Přemysl; Mička, Zdeněk

    2007-04-01

    Aminoguanidinium(1+) hydrogen L-tartrate monohydrate was prepared by crystallisation from aqueous solution and X-ray structural analysis was carried out. The substance crystallises in the orthorhombic system in space group P2 12 12 1, a = 7.1380(2) Å, b = 9.9700(4) Å, c = 14.0790(6) Å, V = 1001.94(7) Å 3, Z = 4, R = 0.0271 for 2272 observed reflections. The crystal structure consists of a 3D framework formed by hydrogen tartrate anions and water molecules with incorporated aminoguanidinium(1+) cations connected by a system of hydrogen bonds. The FTIR and FT Raman spectra of natural and N,O-deuterated compounds were measured and discussed at laboratory temperature. DSC measurements were carried out in the temperature range from 95 to 380 K. A weak anomaly was observed at a temperature of 268 K. Quantitative measurements of second harmonic generation of powdered aminoguanidinium(1+) hydrogen tartrate monohydrate at 800 nm were performed relative to KDP and a relative efficiency of 14% was observed.

  2. Structure of butanol and hexanol at aqueous, ammonium bisulfate, and sulfuric acid solution surfaces investigated by vibrational sum frequency generation spectroscopy.

    Science.gov (United States)

    Van Loon, Lisa L; Minor, Rena N; Allen, Heather C

    2007-08-09

    The organization of 1-butanol and 1-hexanol at the air-liquid interface of aqueous, aqueous ammonium bisulfate, and sulfuric acid solutions was investigated using vibrational broad bandwidth sum frequency generation spectroscopy. There is spectroscopic evidence supporting the formation of centrosymmetric structures at the surface of pure butanol and pure hexanol. At aqueous, ammonium bisulfate, and at most sulfuric acid solution surfaces, butanol molecules organize in all-trans conformations. This suggests that butanol self-aggregates. The spectrum for the 0.052 M butanol in 59.5 wt % sulfuric acid solution is different from the other butanol solution spectra, that is, the surface butanol molecules are observed to possess a significant number of gauche defects. Relative to surface butanol, surface hexanol chains are more disordered at the surface of their respective solutions. Statistically, an increase in the number of gauche defects is expected for hexanol relative to butanol, a six carbon chain vs a four carbon chain. Yet, self-aggregation of hexanol at its aqueous solution surfaces is not ruled out because the methylene spectral contribution is relatively small. The surface spectra for butanol and hexanol also show evidence for salting out from the ammonium bisulfate solutions.

  3. Experimental evidence for an optical interference model for vibrational sum frequency generation on multilayer organic thin film systems. II. Consideration for higher order terms.

    Science.gov (United States)

    O'Brien, Daniel B; Massari, Aaron M

    2015-01-14

    The generalized optical interference model for interfacial contributions to vibrational sum frequency generation (VSFG) spectroscopic signals from organic thin film systems is extended to include a description of optical interferences contained in the thin film bulk response. This is based on electric quadrupolar interactions with the input fields and includes a discussion on possible contribution from the electric quadrupolar polarization. VSFG data from the first of this two part report are analyzed and include effects from higher order responses, for both bulk and higher order interfacial terms. The results indicate that although it is capable of capturing many of the data features, the electric dipole treatment is likely not a complete description of the VSFG intensity data from this system. An analysis based on the signs of the resulting response amplitudes is used to deduce the relative magnitude of the electric dipole and higher order interfacial terms. It is found that the buried interface is closer to satisfying the electric dipole approximation, consistent with smaller field gradients due to closer index matching between the organic thin film and substrate relative to air. The procedure outlined in this work allows for the difficult task of deducing a physical picture of average molecular orientation at the buried interface of a multilayer organic thin film system while including higher order effects.

  4. Water Orientation at Ceramide/Water Interfaces Studied by Heterodyne-Detected Vibrational Sum Frequency Generation Spectroscopy and Molecular Dynamics Simulation

    KAUST Repository

    Adhikari, Aniruddha

    2016-10-10

    Lipid/water interaction is essential for many biological processes. The water structure at the nonionic lipid interface remains little known, and there is no scope of a priori prediction of water orientation at nonionic interfaces, either. Here, we report our study combining advanced nonlinear spectroscopy and molecular dynamics simulation on the water orientation at the ceramide/water interface. We measured χ spectrum in the OH stretch region of ceramide/isotopically diluted water interface using heterodyne-detected vibrational sum-frequency generation spectroscopy and found that the interfacial water prefers an overall hydrogen-up orientation. Molecular dynamics simulation indicates that this preferred hydrogen-up orientation of water is determined by a delicate balance between hydrogen-up and hydrogen-down orientation induced by lipid-water and intralipid hydrogen bonds. This mechanism also suggests that water orientation at neutral lipid interfaces depends highly on the chemical structure of the lipid headgroup, in contrast to the charged lipid interfaces where the net water orientation is determined solely by the charge of the lipid headgroup.

  5. Vibrational sum-frequency generation spectroscopy of ionic liquid 1-butyl-3-methylimidazolium tris(pentafluoroethyl)trifluorophosphate at the air-water interface

    Science.gov (United States)

    Saha, Ankur; SenGupta, Sumana; Kumar, Awadhesh; Choudhury, Sipra; Naik, Prakash D.

    2016-08-01

    The structure and orientation of room temperature ionic liquid (RTIL) 1-butyl-3-methylimidazolium tris(pentafluoroethyl)trifluorophosphate [PF3(C2F5)3], commonly known as [bmim][fap], have been investigated at the air-[bmim][fap] and air-water interfaces, employing vibrational sum-frequency generation (VSFG) spectroscopy. The VSFG spectra in the CH stretch region suggest presence of the [bmim] cation at the interfaces. Studies reveal that the butyl chain protrudes out into air, and the imidazolium ring lies almost planar to the interface. The CH stretch intensities get enhanced at the air-water interface, mainly because of polar orientation of imidazolium cation induced by interfacial water molecules. The OH stretch intensities are also enhanced at the air-water interface due to polar orientation of interfacial water molecules induced by [bmim][fap]. The Brewster angle microscopy suggests self aggregation of [bmim][fap] in the presence of water, and the aggregation becomes extensive showing dense surface domains with time. However, the surface pressure is almost unaffected due to aggregation.

  6. Research on cylindrical shell vibration reduction systems

    Institute of Scientific and Technical Information of China (English)

    XING Xiao-liang; WANG Min-qing

    2008-01-01

    Longitudinal and horizontal vibration must both be reduced in an effective vibration isolation system. We present a cylindrical shell vibration isolator as a dynamic system composed of four springs and dampers. Vibration is directly produced by the motion of machinery, and more is subsequently generated by harmonic frequencies within their structure. To test the effectiveness of our isolator, we first determined equations for the transmission of vibration from the machine to its cylindrical shell. Damping effects produced by the vibration parameters of our system are then analyzed.

  7. Generation of femtosecond laser pulses tunable from 380 nm to 465 nm via cascaded nonlinear optical mixing in a noncollinear optical parametric amplifier with a type-I phase matched BBO crystal.

    Science.gov (United States)

    Lee, Chao-Kuei; Zhang, Jing-Yuan; Huang, J; Pan, Ci-Ling

    2003-07-14

    We report the generation of tunable femtosecond pulses from 380nm to 465nm near the degenerate point of a 405-nm pumped type-I BBO noncollinearly phase-matched optical parametric amplifier (NOPA). The tunable UV/blue radiation is obtained from sum frequency generation (SFG) between the OPA output and the residual fundamental beam at 810-nm and cascaded second harmonic generation (SHG) of OPA. With a fixed seeding angle, the generated SFG and SHG covers from 385 nm to 465-nm. With a pumping energy of 75 J at 405 nm, the optical conversion efficiency from the pump to the tunable SFG is more than 5% and the efficiency of SHG of the OPA is about 2%.

  8. Broadband sum-frequency generation using d33 in periodically poled LiNbO3 thin film in the telecommunications band.

    Science.gov (United States)

    Li, Guangzhen; Chen, Yuping; Jiang, Haowei; Chen, Xianfeng

    2017-03-01

    We demonstrate the first, to the best of our knowledge, type-0 broadband sum-frequency generation (SFG) based on single-crystal periodically poled LiNbO3 (PPLN) thin film. The broad bandwidth property was largely tuned from mid-infrared region to the telecommunications band by engineering the thickness of PPLN from bulk crystal to nanoscale. It provides SFG a solution with both broadband and high efficiency by using the highest nonlinear coefficient d33 instead of d31 in type-I broadband SFG or second-harmonic generation. The measured 3 dB upconversion bandwidth is about 15.5 nm for a 4 cm long single crystal at 1530 nm wavelength. It can find applications in chip-scale spectroscopy, quantum information processing, LiNbO3-thin-film-based microresonator and optical nonreciprocity devices, etc.

  9. Approaches to the quantification and investigation of interfacial systems and their materials properties using sum frequency generation spectroscopy

    Science.gov (United States)

    Hurrey, Michael Laird

    The focus of this thesis is the use and methods development of sum frequency generation (SFG) spectroscopy as an analytical tool for studying surfaces of CO2-philic molecules. The specific set of molecules used for analysis in this project was peracetylated carbohydrates due to their inherent solubility in liquid and supercritical CO2. The goal of the project was to investigate the specific interactions present at the surface of these materials in contact with CO2 under varying conditions. To accomplish this task however, it was necessary to study the materials properties of these compounds using a variety of techniques and relate the SFG data collected under ambient conditions to changes in the long range order. During the analysis of the materials properties the sensitivity of diffuse reflectance sum frequency generation (DR-SFG) spectroscopy to changes in crystallinity was elucidated. In addition, a method was developed and validated for quantitative analysis of changes in concentration of bulk mixtures. Specifically, mixtures of materials differing only in crystal structure were studied and linear calibration plots were created allowing the determination of an unknown samples mole fraction. The last set of control experiments included study of the CO2 adsorption of peracetylated carbohydrates using a high pressure quartz crystal microbalance (QCM) to understand how these surface interactions occur below each material's deliquescence point. By understanding the molecular interactions of this class of CO2-philes in terms of the adsorption thermodynamics and the importance of long range order, deconvolution of subsequent SFG experiments involving changes in CO2 pressure can be accomplished. Finally, the first pressurized SFG experiment was performed on thin films to see how changes in the viscosity and density of CO2 effect the specific interactions at the surface. By relating information collected previously with SFG data collected under varying CO2 environments

  10. Performance comparison of two different filter design approaches for torsional vibration damping in a doubly fed induction generator-based wind turbine

    Directory of Open Access Journals (Sweden)

    Libo Liu

    2015-06-01

    Full Text Available Conventional band-pass filter (BPF-based damper is commonly employed to damp the vibrations in the drive train caused by turbulent winds. However, for the case of grid disturbances or faults resultant torsional vibrations, the performance of the BPF-based damper can be compromised because of the potential low-frequency vibration modes from grid side. To overcome this shortcoming, low-pass filter (LPF-based torsional damper was proposed in this study. The theoretical analysis of the two torsional damper was assessed in frequency domain. Performance comparison of the two dampers was conducted through simulations and the proposed LPF-based torsional damper outperformed the conventional one in the presence of unexpected low-frequency vibrations. Results also showed that retuning the BPF by decreasing the quality factor can restore the intended performance of torsional damper.

  11. Good Vibrations

    OpenAIRE

    Panesar, Lucy

    2007-01-01

    Good Vibrations was a market research exercise conducted by Felicity (my alter-ego) and assistants to help develop marketing and packaging for an electro-therapeutic device (vibrator) used to treat hysteria and other female stress related disorders. It was a live art work commissioned by The Live Art Development Agency for East End Collaborations on 6th May 2007 and the South London Gallery for Bonkersfest on 2nd June 2007.

  12. Vibration sensors

    Science.gov (United States)

    Gupta, Amita; Singh, Ranvir; Ahmad, Amir; Kumar, Mahesh

    2003-10-01

    Today, vibration sensors with low and medium sensitivities are in great demand. Their applications include robotics, navigation, machine vibration monitoring, isolation of precision equipment & activation of safety systems e.g. airbags in automobiles. Vibration sensors have been developed at SSPL, using silicon micromachining to sense vibrations in a system in the 30 - 200 Hz frequency band. The sensing element in the silicon vibration sensor is a seismic mass suspended by thin silicon hinges mounted on a metallized glass plate forming a parallel plate capacitor. The movement of the seismic mass along the vertical axis is monitored to sense vibrations. This is obtained by measuring the change in capacitance. The movable plate of the parallel plate capacitor is formed by a block connected to a surrounding frame by four cantilever beams located on sides or corners of the seismic mass. This element is fabricated by silicon micromachining. Several sensors in the chip sizes 1.6 cm x 1.6 cm, 1 cm x 1 cm and 0.7 cm x 0.7 cm have been fabricated. Work done on these sensors, techniques used in processing and silicon to glass bonding are presented in the paper. Performance evaluation of these sensors is also discussed.

  13. Generación de Spray por Vibración de un Fluido Viscoelastico Spray Generation by Vibration of a Viscoelastic Fluid

    Directory of Open Access Journals (Sweden)

    Gabriel Ferreyra

    2009-01-01

    Full Text Available En este trabajo se estudia la emisión de spray de liquidos viscoelasticos generada mediante vibración, asi como la influencia de sus propiedades físicas en el tamaño de las gotas. El recipiente conteniendo el fluido es sometido a un campo de fuerzas vertical periódico, del cual se controlan la amplitud de la excitación y la frecuencia del mismo. Se utilizaron diferentes mezclas de queroseno con agregado de polímero viscoelástico, resultando validos los modelos aplicados a fluidos Newtonianos dentro de las condiciones de trabajo. Tambien se obtuvo la dependencia del tamaño de gota con la cantidad de polimero agregado, la aceleracion y la frecuencia aplicadas. Se concluye que los modelos desarrollados para fluidos Newtonianos pueden ser aplicados a liquidos de características similares a los utilizados en estas experiencias.In this paper, viscoelastic liquids spray emission generated by vibration and the influence of their physical properties are studied. The fluid contained in a cell is subjected to a field of periodic vertical forces, for which the excitation amplitude and frequency are controlled. Different mixtures of kerosene with viscoelastic polymer were used and results were modelled using equations applicable to Newtonian fluids with acceptable results within the values of the operating conditions considered. Also, the dependence of drop size with the quantity of polymer added, the acceleration and the frequency applied was determined. It is concluded that Newtonian fluids models can be applied to liquids with characteristics similar to those studied in this work.

  14. Structural Reorganization and Fibrinogen Adsorption Behaviors on the Polyrotaxane Surfaces Investigated by Sum Frequency Generation Spectroscopy.

    Science.gov (United States)

    Ge, Aimin; Seo, Ji-Hun; Qiao, Lin; Yui, Nobuhiko; Ye, Shen

    2015-10-14

    Polyrotaxanes, such as supramolecular assemblies with methylated α-cyclodextrins (α-CDs) as host molecules noncovalently threaded on the linear polymer backbone, are promising materials for biomedical applications because they allow adsorbed proteins possessing a high surface flexibility as well as control of the cellular morphology and adhesion. To provide a general design principle for biomedical materials, we examined the surface reorganization behaviors and adsorption conformations of fibrinogen on the polyrotaxane surfaces with comparison to several random copolymers by sum frequency generation (SFG) vibrational spectroscopy. We showed that the polyrotaxane (OMe-PRX-PMB) with methylated α-CDs as the host molecule exhibited unique surface structures in an aqueous environment. The hydrophobic interaction between the methoxy groups of the methylated α-CD molecules and methyl groups of the n-butyl methacrylate (BMA) side chains may dominate the surface restructuring behavior of the OMe-PRX-PMB. The orientation analysis revealed that the orientation of the fibrinogen adsorbed on the OMe-PRX-PMB surface is close to a single distribution, which is different from the adsorption behaviors of fibrinogen on other polyrotaxane or random copolymer surfaces.

  15. In Situ Electrochemical SFG/DFG Study of CN and Nitrile Adsorption at Au from 1-Butyl-1-methyl-pyrrolidinium Bis(trifluoromethylsulfonyl Amide Ionic Liquid ([BMP][TFSA] Containing 4-{2-[1-(2-Cyanoethyl-1,2,3,4-tetrahydroquinolin-6-yl]diazenyl} Benzonitrile (CTDB and K[Au(CN2

    Directory of Open Access Journals (Sweden)

    Benedetto Bozzini

    2012-06-01

    Full Text Available In this paper we report an in situ electrochemical Sum-/Difference Frequency Generation (SFG/DFG spectroscopy investigation of the adsorption of nitrile and CN from the ionic liquid 1-butyl-1-methyl-pyrrolidinium bis(trifluoromethylsulfonyl amide ([BMP][TFSA] containing 4-{2-[1-(2-cyanoethyl-1,2,3,4-tetrahydroquinolin-6-yl]- diazenyl}benzonitrile (CTDB at Au electrodes in the absence and in the presence of the Au-electrodeposition process from K[Au(CN2]. The adsorption of nitrile and its coadsorption with CN resulting either from the cathodic decomposition of the dye or from ligand release from the Au(I cyanocomplex yield potential-dependent single or double SFG bands in the range 2,125–2,140 cm1, exhibiting Stark tuning values of ca. 3 and 1 cm1 V1 in the absence and presence of electrodeposition, respectively. The low Stark tuning found during electrodeposition correlates with the cathodic inhibiting effect of CTDB, giving rise to its levelling properties. The essential insensitivity of the other DFG parameters to the electrodeposition process is due to the growth of smooth Au.

  16. Quadrupole second harmonic generation and sum-frequency generation in ZnO quantum dots

    Energy Technology Data Exchange (ETDEWEB)

    Maikhuri, Deepti; Purohit, S. P., E-mail: sppurohitjiit@gmail.com; Mathur, K. C. [Department of Physics and Materials Science and Engineering, Jaypee Institute of Information Technology, A-10, Sector-62, Noida, U.P. 201307 (India)

    2015-04-15

    The second harmonic generation (SHG) and the sum frequency generation (SFG) processes are investigated in the conduction band states of the singly charged ZnO quantum dot (QD) embedded in the HfO{sub 2}, and the AlN matrices. With two optical fields of frequency ω{sub p} and ω{sub q} incident on the dot, we study the variation with frequency of the second order nonlinear polarization resulting in SHG and SFG, through the electric dipole and the electric quadrupole interactions of the pump fields with the electron in the dot. We obtain enhanced value of the second order nonlinear susceptibility in the dot compared to the bulk. The effective mass approximation with the finite confining barrier is used for obtaining the energy and wavefunctions of the quantized confined states of the electron in the conduction band of the dot. Our results show that both the SHG and SFG processes depend on the dot size, the surrounding matrix and the polarization states of the pump beams.

  17. Urban vibrations

    DEFF Research Database (Denmark)

    Morrison, Ann; Knudsen, L.; Andersen, Hans Jørgen

    2012-01-01

    In   this   paper   we   describe   a   field   study   conducted   with   a   wearable   vibration   belt   where   we   test   to   determine   the   vibration   intensity   sensitivity   ranges   on   a   large   diverse   group   of   participants   with   evenly   distributed  ages  and......   lab   studies   in   that   we   found   a   decreased   detection   rate   in   busy   environments.   Here   we   test   with   a   much   larger   sample   and   age   range,   and   contribute   with   the   first   vibration  sensitivity  testing  outside  the  lab  in  an  urban   public...

  18. Influence of Light Polarization States on Sum-Frequency Generation in a Chiral Medium with a Two-Coupled-Oscillator Model

    Institute of Scientific and Technical Information of China (English)

    郑仰东; 李俊庆; 李淳飞

    2002-01-01

    Sum-frequency generation (SFG) is investigated using the two-coupled-oscillator molecular model. The influence of the polarization states and angles of two incident beams on reflected and transmitted sum-frequency lights is discussed by considering the circular birefringence in a chiral medium. The different response of media with two kinds of enantiomers to polarization states of incident beams is also discussed. Furthermore, the relations between the SFG spectrum and the polarization states are studied. The theoretical result is consistent with a known experimental fact.

  19. Vibrational spectroscopy

    Science.gov (United States)

    Umesh P. Agarwal; Rajai Atalla

    2010-01-01

    Vibrational spectroscopy is an important tool in modern chemistry. In the past two decades, thanks to significant improvements in instrumentation and the development of new interpretive tools, it has become increasingly important for studies of lignin. This chapter presents the three important instrumental methods-Raman spectroscopy, infrared (IR) spectroscopy, and...

  20. Vibrating minds

    CERN Document Server

    2009-01-01

    Ed Witten is one of the leading scientists in the field of string theory, the theory that describes elementary particles as vibrating strings. This week he leaves CERN after having spent a few months here on sabbatical. His wish is that the LHC will unveil supersymmetry.

  1. Membrane orientation and binding determinants of G protein-coupled receptor kinase 5 as assessed by combined vibrational spectroscopic studies.

    Directory of Open Access Journals (Sweden)

    Pei Yang

    Full Text Available G-protein coupled receptors (GPCRs are integral membrane proteins involved in a wide variety of biological processes in eukaryotic cells, and are targeted by a large fraction of marketed drugs. GPCR kinases (GRKs play important roles in feedback regulation of GPCRs, such as of β-adrenergic receptors in the heart, where GRK2 and GRK5 are the major isoforms expressed. Membrane targeting is essential for GRK function in cells. Whereas GRK2 is recruited to the membrane by heterotrimeric Gβγ subunits, the mechanism of membrane binding by GRK5 is not fully understood. It has been proposed that GRK5 is constitutively associated with membranes through elements located at its N-terminus, its C-terminus, or both. The membrane orientation of GRK5 is also a matter of speculation. In this work, we combined sum frequency generation (SFG vibrational spectroscopy and attenuated total reflectance-Fourier transform infrared spectroscopy (ATR-FTIR to help determine the membrane orientation of GRK5 and a C-terminally truncated mutant (GRK51-531 on membrane lipid bilayers. It was found that GRK5 and GRK51-531 adopt a similar orientation on model cell membranes in the presence of PIP2 that is similar to that predicted for GRK2 in prior studies. Mutation of the N-terminal membrane binding site of GRK5 did not eliminate membrane binding, but prevented observation of this discrete orientation. The C-terminus of GRK5 does not have substantial impact on either membrane binding or orientation in this model system. Thus, the C-terminus of GRK5 may drive membrane binding in cells via interactions with other proteins at the plasma membrane or bind in an unstructured manner to negatively charged membranes.

  2. Generations.

    Science.gov (United States)

    Chambers, David W

    2005-01-01

    Groups naturally promote their strengths and prefer values and rules that give them an identity and an advantage. This shows up as generational tensions across cohorts who share common experiences, including common elders. Dramatic cultural events in America since 1925 can help create an understanding of the differing value structures of the Silents, the Boomers, Gen Xers, and the Millennials. Differences in how these generations see motivation and values, fundamental reality, relations with others, and work are presented, as are some applications of these differences to the dental profession.

  3. Study of the vibrations induced by two-phase flow in steam generator: measurement of void fraction in a two-phase flow; Etude des vibrations induites dans les tubes de generateurs de vapeur: mesure du taux de vide dans un ecoulement diphasique

    Energy Technology Data Exchange (ETDEWEB)

    Sivault, S

    1998-07-01

    Two-phase flow can trigger vibration phenomena that are not well predicted by models like the homogeneous model. Concerning the steam generator of a Candu type reactor, these vibrations may lead to the failure of tubes. The coupling between thermo-hydraulic and vibration phenomena requires models that treat sliding between liquid and vapor phases. The purpose of this work is to study a series of experiments performed in a freon loop. These experiments simulate a two-phase flow through a bundle of tubes. Most estimations of vibratory parameters are based on the assumption of a uniform distribution of the void fraction. An optic probe has been used to measure the void fraction. The first part of this study is devoted to the processing of the response spectra given by the probe. The second part presents an estimation of the void fraction given by different models, a comparison between experimental and theoretical results allows to discuss their validity range. (A.C.) 6 refs.

  4. Effect of vibration modes on positions of piezoelectric ceramic patches for cantilever generators%振动模态对压电发电机陶瓷片粘贴位置的影响

    Institute of Scientific and Technical Information of China (English)

    刘树林; 许小勇; 翟宇毅; 刘彦峰; 李余珍

    2011-01-01

    By modeling and calculating the piezoelectric ceramic patches of cantilever generators, the effects of different positions of the piezoelectoic patches on the generation ability of the generators were analyzed and the optimum positions of the piezoelectric ceramic patches under the first and second vibration modes were obtained with Euler-Bernoulli model and by testing the open circuit voltages, short-circuit currents of generators and the performance of LED lighting. Experiments indicate that the generators show the optimum performance under the first vibration mode when the piezoelectric ceramic patches locate at the root of the cantilever. Its opening voltage and short current are 4 times and LED power is 10 times of experimental data of other three generators. Moreover,the generation ability is investigated under the second vibration mode. When the ceramic patch respectively locates at the middle and the root of cantilever, the generation ability of the former is superior to that of the latter,and the opening voltage and short current of the former are 1. 2 and 1. 9 times those of lat-ters respectively through six generator experiments. In addition, LED power of the former is 1. 4 times those of the others. It points out that the piezoelectric ceramic patches should be located at the root of beam under the first vibration mode and at the middle of beam under the second mode to improve the generation efficiency.%通过对压电单晶悬臂梁振动发电机陶瓷片建模及理论计算,分析了一阶振型与二阶振型状态下陶瓷片不同贴片位置与振动发电机发电能力的关系,利用欧拉伯努利梁模型并通过电机开路电压、短路电流及LED照明试验,得到了最佳贴片位置.试验表明在一阶模态时,陶瓷片贴于悬臂梁根部的电机能够获得最大的发电量,对4种不同贴片位置电机的发电试验显示,陶瓷片贴于根部的电机其开路电压及短路电流分别是其他电机的4倍以上,驱

  5. 某电厂发电机振动故障诊断及处理%Vibration Diagnosis and Disposal for Generator of 600MW Ultra-Supercritical Unit of a Centain Power Plant

    Institute of Scientific and Technical Information of China (English)

    刘树鹏; 葛祥

    2016-01-01

    The generator rotor vibrations of a power plant No.4 unit have been in state of gradually climbing and then reached the tripping value during loading, resulting in the commissioning procedure could not be successfully completed. Through detailed and comprehensive field test, it is found that the cause of the malfunction is that the rotor coils occur dynamic intertern short circuit at hot state. It causes the rotor been partially heated and then occurs transient thermal bending. This diagnostic conclusion has been verified by the dynamic interturn short circuit test. The phenomenon of the rotor vibrations climbing has been completely eliminated after replacing the generator rotor. During the unit stable operation with load, the rotor vibrations have been controlled to the excellent level.%某电厂4号汽轮发电机组带负荷时发电机转子振动不断爬升幵达到跳机值,导致调试进程无法顺利完成。通过现场详细、全面的测试,诊断其故障原因为:热态下转子线圈出现动态匝间短路现象,导致转子局部受热而发生暂态弯曲。这一诊断结论得到了电气专业动态匝间短路试验结果的验证。更换发电机转子后,振动爬升现象彻底消除。机组带负荷稳定运行时,轴系振动达到优良水平。

  6. Attaining 186-nm light generation in cooled beta-BaB(2)O(4) crystal.

    Science.gov (United States)

    Kouta, H; Kuwano, Y

    1999-09-01

    The transparency range of beta-BaB(2)O(4) (BBO) was expanded by means of cooling, and the resulting absorption coefficient at 193.4 nm was reduced to 0.29cm(-1) at 91 K from 1.39cm(-1) at 295 K. Further, generation of light at 186.0 nm (the measurement limit in air) by type I sum-frequency generation (SFG) based on fundamental (744-nm) and third-harmonic (248-nm) light from a Ti:sapphire laser was confirmed for cooled BBO. Calculations based on observed data for SFG wavelengths and phase-matching angles indicate a potential for cooled BBO to generate wavelengths as low as 181.7 nm.

  7. Ultrasonic vibrating system design and tool analysis

    Institute of Scientific and Technical Information of China (English)

    Kei-Lin KUO

    2009-01-01

    The applications of ultrasonic vibrations for material removal processes exist predominantly in the area of vertical processing of hard and brittle materials. This is because the power generated by vertical vibrating oscillators generates the greatest direct penetration, in order to conduct material removal on workpieces by grains. However, for milling processes, vertical vibrating power has to be transformed into lateral (horizontal) vibration to produce the required horizontal cutting force. The objective of this study is to make use of ultrasonic lateral transformation theory to optimize processing efficiency, through the use of the finite element method for design and analysis of the milling tool. In addition, changes can be made to the existing vibrating system to generate best performance under consistent conditions, namely, using the same piezoelectric ceramics.

  8. 汽轮发电机组轴系扭振多指标非线性协调控制%Multi-index nonlinear coordination control design for steam-turbine generator shafting torsional vibration

    Institute of Scientific and Technical Information of China (English)

    李啸骢; 鹿建成; 韦善革; 梁志坚; 徐俊华

    2014-01-01

    为减少机电扰动对汽轮发电机组轴系扭振的影响,在单机无穷大系统中,建立了汽轮发电机组轴系、励磁和调速的六阶非线性状态空间数学模型。基于反馈精确线性化理论,设计了发电机组励磁和调速的多指标非线性协调控制(MINC)策略。同时与线性最优控制(LOC)方法做对比,仿真表明:采用MINC方法,当系统受到短路故障,调功和调压扰动时,不仅能更好地抑制汽轮机和发电机之间功角位移偏差的振荡,减少轴系扭振事故的发生,还可以兼顾各状态量的动、静态性能,提高电力系统稳定运行水平。%To reduce the effect of mechanical and electrical disturbance on torsional vibration of steam-turbine generator shafting, in a single machine infinite system, a six order nonlinear state space model is set up for steam turbine generator shafting based on the generator excitation and speed-regulation system. According to the accurate feedback linearization theory, the multi-index nonlinear coordination (MINC) control strategy is designed for suppressing the torsional vibration of shafting. The strategy is compared with linear optimal control (LOC) method. The simulation results show that when the short-circuit fault occurs and the regulating power and voltage are disturbed, the MINC method can restrain oscillation of the angular displacement deviation between turbine and generator, reduce the risk of shaft torsional vibration, give better consideration of both dynamic and static performance of each state quantity, and stabilize the operation of power system.

  9. Vibration Induced Microfluidic Atomization

    Science.gov (United States)

    Yeo, Leslie; Qi, Aisha; Friend, James

    2008-11-01

    We demonstrate rapid generation of micron aerosol droplets in a microfluidic device in which a fluid drop is exposed to surface vibration as it sits atop a piezoelectric substrate. Little, however, is understood about the processes by which these droplets form due to the complex hydrodynamic processes that occur across widely varying length and time scales. Through experiments, scaling theory and numerical modelling, we elucidate the interfacial destabilization mechanisms that lead to droplet formation. Droplets form due to the axisymmetric break-up of cylindrical liquid jets ejected as a consequence of interfacial destabilization. Their 10 μm size correlates with the jet radius and the instability wavelength, both determined from a viscous-capillary dominant force balance and confirmed through a numerical solution. With the exception of drops that spread into thin films with thicknesses on the order of the boundary layer dimension, the free surface is always observed to vibrate at the capillary-viscous resonance frequency despite the surface vibration frequency being several orders larger. This is contrary to common assumptions used in deriving subharmonic models resulting in a Mathieu equation, which has commonly led to spurious predictions in the droplet size.

  10. Pickin’ up good vibrations

    CERN Multimedia

    Katarina Anthony

    2015-01-01

    In preparation for the civil engineering work on the HL-LHC, vibration measurements were carried out at the LHC’s Point 1 last month. These measurements will help evaluate how civil engineering work could impact the beam, and will provide crucial details about the site’s geological make-up before construction begins.   A seismic truck at Point 1 generated wave-like vibrations measured by EN/MME. From carrying out R&D to produce state-of-the-art magnets to developing innovative, robust materials capable of withstanding beam impact, the HL-LHC is a multi-faceted project involving many groups and teams across CERN’s departments. It was in this framework that the project management mandated CERN's Mechanical and Materials Engineering (EN/MME) group to measure the propagation of vibrations around Point 1. Their question: can civil engineering work for the HL-LHC – the bulk of which is scheduled for LS2 – begin while the LHC is running? Alth...

  11. Adaptive Piezoelectric Absorber for Active Vibration Control

    Directory of Open Access Journals (Sweden)

    Sven Herold

    2016-02-01

    Full Text Available Passive vibration control solutions are often limited to working reliably at one design point. Especially applied to lightweight structures, which tend to have unwanted vibration, active vibration control approaches can outperform passive solutions. To generate dynamic forces in a narrow frequency band, passive single-degree-of-freedom oscillators are frequently used as vibration absorbers and neutralizers. In order to respond to changes in system properties and/or the frequency of excitation forces, in this work, adaptive vibration compensation by a tunable piezoelectric vibration absorber is investigated. A special design containing piezoelectric stack actuators is used to cover a large tuning range for the natural frequency of the adaptive vibration absorber, while also the utilization as an active dynamic inertial mass actuator for active control concepts is possible, which can help to implement a broadband vibration control system. An analytical model is set up to derive general design rules for the system. An absorber prototype is set up and validated experimentally for both use cases of an adaptive vibration absorber and inertial mass actuator. Finally, the adaptive vibration control system is installed and tested with a basic truss structure in the laboratory, using both the possibility to adjust the properties of the absorber and active control.

  12. Theory of vibration protection

    CERN Document Server

    Karnovsky, Igor A

    2016-01-01

    This text is an advancement of the theory of vibration protection of mechanical systems with lumped and distributed parameters. The book offers various concepts and methods of solving vibration protection problems, discusses the advantages and disadvantages of different methods, and the fields of their effective applications. Fundamental approaches of vibration protection, which are considered in this book, are the passive, parametric and optimal active vibration protection. The passive vibration protection is based on vibration isolation, vibration damping and dynamic absorbers. Parametric vibration protection theory is based on the Shchipanov-Luzin invariance principle. Optimal active vibration protection theory is based on the Pontryagin principle and the Krein moment method. The book also contains special topics such as suppression of vibrations at the source of their occurrence and the harmful influence of vibrations on humans. Numerous examples, which illustrate the theoretical ideas of each chapter, ar...

  13. VibroCav: Hydrodynamic Vibration and Cavitation Technology

    NARCIS (Netherlands)

    Bakker, T.W.

    2012-01-01

    Vibration and cavitation can be generated in many ways and serve many useful purposes. This study describes physical aspects of useful vibration and cavitation for a broad spectrum of applications at atmospheric or elevated pressures. After a review of available devices, hydrodynamic vibrating-body

  14. VibroCav: Hydrodynamic Vibration and Cavitation Technology

    NARCIS (Netherlands)

    Bakker, T.W.

    2012-01-01

    Vibration and cavitation can be generated in many ways and serve many useful purposes. This study describes physical aspects of useful vibration and cavitation for a broad spectrum of applications at atmospheric or elevated pressures. After a review of available devices, hydrodynamic vibrating-body

  15. Mechanism of bubble detachment from vibrating walls

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dongjun; Park, Jun Kwon, E-mail: junkeun@postech.ac.kr; Kang, Kwan Hyoung [Department of Mechanical Engineering, Pohang University of Science and Technology (POSTECH), San 31, Hyoja-dong, Pohang 790-784 (Korea, Republic of); Kang, In Seok [Department of Chemical Engineering, Pohang University of Science and Technology (POSTECH), San 31, Hyoja-dong, Pohang 790-784 (Korea, Republic of)

    2013-11-15

    We discovered a previously unobserved mechanism by which air bubbles detach from vibrating walls in glasses containing water. Chaotic oscillation and subsequent water jets appeared when a wall vibrated at greater than a critical level. Wave forms were developed at water-air interface of the bubble by the wall vibration, and water jets were formed when sufficiently grown wave-curvatures were collapsing. Droplets were pinched off from the tip of jets and fell to the surface of the glass. When the solid-air interface at the bubble-wall attachment point was completely covered with water, the bubble detached from the wall. The water jets were mainly generated by subharmonic waves and were generated most vigorously when the wall vibrated at the volume resonant frequency of the bubble. Bubbles of specific size can be removed by adjusting the frequency of the wall's vibration.

  16. Active vibration control by means of concurrent implementation techniques

    OpenAIRE

    2015-01-01

    M.Ing. The central theme of this dissertation is vibration reduction. The aims of this dissertation are, firstly, to provide a practical, cost effective, experimental system on which a given vibration control algorithm can be tested and experimented on, since there is a need to further optimize the performance of the given vibration control algorithm. Secondly, a solution to the problem of excessive time consumption of the given vibration control algorithm on current generation computers i...

  17. Data Management Techniques for Blade Vibration Analysis

    Directory of Open Access Journals (Sweden)

    Przysowa Radosław

    2016-07-01

    Full Text Available Well-designed procedures are required to handle large amounts of data, generated by complex measurement systems used in engine tests. The paper presents selected methodologies and software tools for characterisation and monitoring of blade vibration. Common file formats and data structures as well as methods to process and visualise tip-timing data are discussed. Report Generation Framework (RGF developed in Python is demonstrated as a flexible tool for processing and publishing blade vibration results.

  18. Research on Third Order Vibration Treatment Method of 660 MW Generator Rotors%660 MW发电机转子三阶振动处理方法研究

    Institute of Scientific and Technical Information of China (English)

    王广庭

    2015-01-01

    本文介绍了双平面不平衡影响系数算法的基本原理和发电机等柔性转子的振型分解基本方法,结合发电机三阶不平衡处理的现场实践经验,可知在低发对轮和励磁机上加重可以很好地平衡发电机的三阶不平衡。本文将双平面影响系数法应用于发电机的三阶不平衡振动处理,简化了计算模型,减少了计算量,并且成功处理了印度某厂660 MW发电机的三阶不平衡故障。%This paper introduces the basic principles of the double plane unbalance influence coeffi-cient algorithm and the basic modal decomposition method of the generator and other flexible rotor. Combined with the practical field of unbalanced generator of third order processing experience,the generator third order unbalance was balanced nicely under low on the wheel and increase on excitation system This paper presented example for a double plane influence coefficient method applied to the generator of third order imbalance vibration processing,it simplified the calculation model,reduced the calculation load and successfully dealt with third order unbalance fault of India 660 MW generator rotor.

  19. 基于QPSO-BP和改进D-S的水电机组振动故障诊断%Vibration fault diagnosis for hydroelectric generating unit based on QPSO-BP and modified D-S theory

    Institute of Scientific and Technical Information of China (English)

    程加堂; 段志梅; 艾莉; 熊燕

    2015-01-01

    In order to improve the accuracy of vibration fault diagnosis for hydroelectric generating unit, a method is proposed based on quantum particle swarm optimized BP neural network (QPSO-BP) which is fused by modified D-S evidence theory. According to the common vibration fault types, three QPSO-BP networks with inertia weight being adjusted randomly are used as its primary diagnosis models, then the independent bodies of evidence are applied to the synthesis of D-S theory, and the basic probability assignment is realized objectively. In view of the defects that standard D-S can not synthesize high conflict evidence, the weight matrix is calculated to improve it. Example analysis shows that the proposed method can effectively identify vibration fault of the unit, and has a high diagnostic accuracy compared with three primary diagnostic model and standard D-S theory.%为提高水电机组振动故障诊断的准确性,提出了一种基于改进D-S证据理论融合量子粒子群优化BP神经网络(QPSO-BP)的诊断方法.根据水电机组常见的振动故障类型,采用3个惯性权值随机调整的QPSO-BP网络分别对其进行初级诊断,并作为独立证据体应用于D-S理论的合成之中,实现了基本概率赋值的客观化.针对标准D-S无法合成高度冲突证据的缺陷,通过计算权值矩阵对其进行修正.实例分析表明,和3个初级诊断模型及标准D-S合成法相比,所提方法可以有效识别机组的振动故障,具有较高的诊断准确率.

  20. EMBEDDED COMPUTER BASED ACTIVE VIBRATION CONTROL SYSTEM FOR VIBRATION REDUCTION OF FLEXIBLE STRUCTURES

    Directory of Open Access Journals (Sweden)

    Venkata Ratnam Tatavolu

    2013-01-01

    Full Text Available Research on Active Vibration Control System (AVCS is being carried out to reduce structural vibrations caused by unwanted vibrations in many application areas such as in space, aircraft structures, satellites, automobiles and civil structures (bridges, particularly at low frequencies. The unwanted vibration may cause damage to the structure or degradation to the structure’s performance. The AVCS comprises physical plant, a sensor to detect the source vibration, a DSP based electronic controller using an actuator connected to the structure generates a counter force that is appropriately out of phase but equal in amplitude to the source vibration. As a result two equal and opposite forces cancel each other by the principle of super position and structure stops vibrating. The main objective of this research work is to develop an embedded computer based real time AVCS for reducing low frequency tonal vibration response of a vibrating flexible cantilever beam by automatic modification of the vibrating beam’s structural response and to verify the performance of the developed system experimentally. The developed AVCS is a generic design platform that can be applied for designing adaptive feed forward AVC and feedback AVC. This study presents the vibration control methodology adapted for reducing tonal vibration generated by a sine generator connected to the primary source actuator attached to one end of the cantilever beam. The secondary actuator is attached to the beam on the other end through the AVCS to reduce primary vibration by destructive interference with the original response of the system, caused by the primary source of vibration. Adaptive feed forward Active Vibration Control (AVC technique is used with Filtered-X Least Mean Square (FxLMS algorithm using FIR digital filter. A cantilever beam was considered as plant and embedded computer based AVCS was tested and evaluated using an experimental setup. The experimental results are

  1. Portable vibration exciter

    Science.gov (United States)

    Beecher, L. C.; Williams, F. T.

    1970-01-01

    Gas-driven vibration exciter produces a sinusoidal excitation function controllable in frequency and in amplitude. It allows direct vibration testing of components under normal loads, removing the possibility of component damage due to high static pressure.

  2. Control System Damps Vibrations

    Science.gov (United States)

    Kopf, E. H., Jr.; Brown, T. K.; Marsh, E. L.

    1983-01-01

    New control system damps vibrations in rotating equipment with help of phase-locked-loop techniques. Vibrational modes are controlled by applying suitable currents to drive motor. Control signals are derived from sensors mounted on equipment.

  3. Acid-Base Interaction Induced Stability of Self-assembled Monolayer at Solid Interface Characterized by Sum Frequency Generation Spectroscopy

    Science.gov (United States)

    Zhu, He; Dhinojwala, Ali

    2014-03-01

    Long chain alcohols have been known to form hydrogen bonding with the hydroxyl groups on aluminum oxide surface. We used the interface sensitive technique, sum frequency generation (SFG) spectroscopy, to study the molecular structure of hexadecanol at liquid/sapphire interface and air/sapphire interface. We characterized the hydrocarbon chain conformation and the hydrogen bonding at different temperatures. Peak intensity changes were used to determine order-disorder transition of interfacial molecules. The transition hysteresis will also be discussed.

  4. Vibration energy harvester optimization using artificial intelligence

    Science.gov (United States)

    Hadas, Z.; Ondrusek, C.; Kurfurst, J.; Singule, V.

    2011-06-01

    This paper deals with an optimization study of a vibration energy harvester. This harvester can be used as autonomous source of electrical energy for remote or wireless applications, which are placed in environment excited by ambient mechanical vibrations. The ambient energy of vibrations is usually on very low level but the harvester can be used as alternative source of energy for electronic devices with an expected low level of power consumption of several mW. The optimized design of the vibration energy harvester was based on previous development and the sensitivity of harvester design was improved for effective harvesting from mechanical vibrations in aeronautic applications. The vibration energy harvester is a mechatronic system which generates electrical energy from ambient vibrations due to precision tuning up generator parameters. The optimization study for maximization of harvested power or minimization of volume and weight are the main goals of our development. The optimization study of such complex device is complicated therefore artificial intelligence methods can be used for tuning up optimal harvester parameters.

  5. Design for Vibrator Field Experiment Based- on Vibrator- earth System

    Institute of Scientific and Technical Information of China (English)

    Chen Zubin; Lin Jun; Liang Tiecheng; Zhang Linhang

    2000-01-01

    Source- generated energy in seismic vibrator records high frequency harmonic behavior. Conventional vibratorearth coupling model was set up on the linear system. Some assumptions in the application of linear theory to the vibrator problem play an insignificant role in the overall coupling structure. Obviously, non- linear behaviors can be modeled using a "hard - spring" form of the Duffing equation. Model dedicates that a qualitatively similar harmonic component is present for a broad range of possible mathematical descriptions. After some qualitative analysis about the non- linear system, some conclusion can be drawn. Firstly, The design of the vibrator weight should be abided by two points as followed: In order to avoid decoupling for the vibrator to the earth, the weight should be greater than the peak of the driving force amplitude as to keep the resultant force pointing to the earth's core. On the other hand, for the limited energy output, the vibrator overweight may damage the system high - frequency ability. Secondly, as the driving force frequency approaching to the ground hard- spring inherent frequency, the energy transmission was found to climb its peak from the system energy absorbed curve. At last, due to the non- linear coupling model system, its load curve would come into unstable frequency range,which might limit the application of the Vibroseis conventional sweeping pattern - linear sweep. A new sweeping pattern was listed: the driving signal was the pseudo- random sequence modulated by a fixed frequency cosine signal satisfying with the exploration precision and absorbing efficiency. The synthesized signal was ready to be realized by the electromagnetic driven system. Even the side- lobes noise of its auto- correlation function was restrained well. The theory coming from the Vibrator- earth coupling model was applied to the design of the Portable High- frequency Vibrator System (PHVS), and the good result was obtained. By the analysis of the

  6. Vibration Measurement with PULSE and DSPACE Equipment

    Directory of Open Access Journals (Sweden)

    Radim KLEČKA

    2009-06-01

    Full Text Available This contribution describes techniques and results of measurement with TIRA vibration generator. A method of experimental modal analysis allows next restore of vibration data. The goal is check validity of head expanders and screw connection. This process is based to using ME’scope environment. Another goal is check possibilities of dSPACE platform to vibration measurement. This task includes design of connection between dSPACE system and power amplifier, creating of graphical user interface and analyzing main configuration parameters to improve quality of drive signal.

  7. What is limiting low-temperature atomic layer deposition of Al{sub 2}O{sub 3}? A vibrational sum-frequency generation study

    Energy Technology Data Exchange (ETDEWEB)

    Vandalon, V., E-mail: v.vandalon@tue.nl, E-mail: w.m.m.kessels@tue.nl; Kessels, W. M. M., E-mail: v.vandalon@tue.nl, E-mail: w.m.m.kessels@tue.nl [Department of Applied Physics, Eindhoven University of Technology, P.O. Box 513, 5600 MB Eindhoven (Netherlands)

    2016-01-04

    The surface reactions during atomic layer deposition (ALD) of Al{sub 2}O{sub 3} from Al(CH{sub 3}){sub 3} and H{sub 2}O have been studied with broadband sum-frequency generation to reveal what is limiting the growth at low temperatures. The –CH{sub 3} surface coverage was measured for temperatures between 100 and 300 °C and the absolute reaction cross sections, describing the reaction kinetics, were determined for both half-cycles. It was found that –CH{sub 3} groups persisted on the surface after saturation of the H{sub 2}O half-cycle. From a direct correlation with the growth per cycle, it was established that the reduced reactivity of H{sub 2}O towards –CH{sub 3} is the dominant factor limiting the ALD process at low temperatures.

  8. The speed of propagation of small vibrations in hydraulic systems with a boiling transfer agent

    Energy Technology Data Exchange (ETDEWEB)

    Proskuryakov, K.N.

    1981-01-01

    Vibration resonance in a steam generation channel is studied. A formula is derived for the calculation of the speed of dispersion of acoustical vibrations in a singular steam generation pipe. Methods are indicated for changing the resonance frequency in the vibrations of the heat transfer agent.

  9. Optimizing Vibrational Coordinates To Modulate Intermode Coupling.

    Science.gov (United States)

    Zimmerman, Paul M; Smereka, Peter

    2016-04-12

    The choice of coordinate system strongly affects the convergence properties of vibrational structure computations. Two methods for efficient generation of improved vibrational coordinates are presented and justified by analysis of a model anharmonic two-mode Hessian and numerical computations on polyatomic molecules. To produce optimal coordinates, metrics which quantify off-diagonal couplings over a grid of Hessian matrices are minimized through unitary rotations of the vibrational basis. The first proposed metric minimizes the total squared off-diagonal coupling, and the second minimizes the total squared change in off-diagonal coupling. In this procedure certain anharmonic modes tend to localize, for example X-H stretches. The proposed methods do not rely on prior fitting of the potential energy, vibrational structure computations, or localization metrics, so they are unique from previous vibrational coordinate generation algorithms and are generally applicable to polyatomic molecules. Fitting the potential to the approximate n-mode representation in the optimized bases for all-trans polyenes shows that off-diagonal anharmonic couplings are substantially reduced by the new choices of coordinate system. Convergence of vibrational energies is examined in detail for ethylene, and it is shown that coupling-optimized modes converge in vibrational configuration interaction computations to within 1 cm(-1) using only 3-mode couplings, where normal modes require 4-mode couplings for convergence. Comparison of the vibrational configuration interaction convergence with respect to excitation level for the two proposed metrics shows that minimization of the total off-diagonal coupling is most effective for low-cost vibrational structure computations.

  10. Vibration of hydraulic machinery

    CERN Document Server

    Wu, Yulin; Liu, Shuhong; Dou, Hua-Shu; Qian, Zhongdong

    2013-01-01

    Vibration of Hydraulic Machinery deals with the vibration problem which has significant influence on the safety and reliable operation of hydraulic machinery. It provides new achievements and the latest developments in these areas, even in the basic areas of this subject. The present book covers the fundamentals of mechanical vibration and rotordynamics as well as their main numerical models and analysis methods for the vibration prediction. The mechanical and hydraulic excitations to the vibration are analyzed, and the pressure fluctuations induced by the unsteady turbulent flow is predicted in order to obtain the unsteady loads. This book also discusses the loads, constraint conditions and the elastic and damping characters of the mechanical system, the structure dynamic analysis, the rotor dynamic analysis and the system instability of hydraulic machines, including the illustration of monitoring system for the instability and the vibration in hydraulic units. All the problems are necessary for vibration pr...

  11. Statistical quality control through overall vibration analysis

    Science.gov (United States)

    Carnero, M. a. Carmen; González-Palma, Rafael; Almorza, David; Mayorga, Pedro; López-Escobar, Carlos

    2010-05-01

    The present study introduces the concept of statistical quality control in automotive wheel bearings manufacturing processes. Defects on products under analysis can have a direct influence on passengers' safety and comfort. At present, the use of vibration analysis on machine tools for quality control purposes is not very extensive in manufacturing facilities. Noise and vibration are common quality problems in bearings. These failure modes likely occur under certain operating conditions and do not require high vibration amplitudes but relate to certain vibration frequencies. The vibration frequencies are affected by the type of surface problems (chattering) of ball races that are generated through grinding processes. The purpose of this paper is to identify grinding process variables that affect the quality of bearings by using statistical principles in the field of machine tools. In addition, an evaluation of the quality results of the finished parts under different combinations of process variables is assessed. This paper intends to establish the foundations to predict the quality of the products through the analysis of self-induced vibrations during the contact between the grinding wheel and the parts. To achieve this goal, the overall self-induced vibration readings under different combinations of process variables are analysed using statistical tools. The analysis of data and design of experiments follows a classical approach, considering all potential interactions between variables. The analysis of data is conducted through analysis of variance (ANOVA) for data sets that meet normality and homoscedasticity criteria. This paper utilizes different statistical tools to support the conclusions such as chi squared, Shapiro-Wilks, symmetry, Kurtosis, Cochran, Hartlett, and Hartley and Krushal-Wallis. The analysis presented is the starting point to extend the use of predictive techniques (vibration analysis) for quality control. This paper demonstrates the existence

  12. Energy scavenging from environmental vibration.

    Energy Technology Data Exchange (ETDEWEB)

    Galchev, Tzeno (University of Michigan); Apblett, Christopher Alan; Najafi, Khalil (University of Michigan)

    2009-10-01

    The goal of this project is to develop an efficient energy scavenger for converting ambient low-frequency vibrations into electrical power. In order to achieve this a novel inertial micro power generator architecture has been developed that utilizes the bi-stable motion of a mechanical mass to convert a broad range of low-frequency (< 30Hz), and large-deflection (>250 {micro}m) ambient vibrations into high-frequency electrical output energy. The generator incorporates a bi-stable mechanical structure to initiate high-frequency mechanical oscillations in an electromagnetic scavenger. This frequency up-conversion technique enhances the electromechanical coupling and increases the generated power. This architecture is called the Parametric Frequency Increased Generator (PFIG). Three generations of the device have been fabricated. It was first demonstrated using a larger bench-top prototype that had a functional volume of 3.7cm3. It generated a peak power of 558{micro}W and an average power of 39.5{micro}W at an input acceleration of 1g applied at 10 Hz. The performance of this device has still not been matched by any other reported work. It yielded the best power density and efficiency for any scavenger operating from low-frequency (<10Hz) vibrations. A second-generation device was then fabricated. It generated a peak power of 288{micro}W and an average power of 5.8{micro}W from an input acceleration of 9.8m/s{sup 2} at 10Hz. The device operates over a frequency range of 20Hz. The internal volume of the generator is 2.1cm{sup 3} (3.7cm{sup 3} including casing), half of a standard AA battery. Lastly, a piezoelectric version of the PFIG is currently being developed. This device clearly demonstrates one of the key features of the PFIG architecture, namely that it is suitable for MEMS integration, more so than resonant generators, by incorporating a brittle bulk piezoelectric ceramic. This is the first micro-scale piezoelectric generator capable of <10Hz operation. The

  13. Hybrid isolation of micro vibrations induced by reaction wheels

    Science.gov (United States)

    Lee, Dae-Oen; Park, Geeyong; Han, Jae-Hung

    2016-02-01

    As the technology for precision satellite payloads continues to advance, the requirements for the pointing stability of the satellites are becoming extremely high. In many situations, even small amplitude disturbances generated by the onboard components may cause serious degradation in the performance of high precision payloads. In such situations, vibration isolators can be installed to reduce the vibration transmission. In this work, a hybrid vibration isolator comprising passive and active components is proposed to provide an effective solution to the vibration problems caused by the reaction wheel disturbances. Firstly, mathematical modeling and experimental study of a single axis vibration isolator having high damping and high roll-off rate for the high frequency region and active components that enhance isolation performance for narrow frequency bands are presented. This concept is then extended to multi-axis by forming Stewart platform and the performance is experimentally verified. The tests on a flexible testbed show effective vibration isolation by the proposed vibration isolator.

  14. Damage monitoring and impact detection using optical fiber vibration sensors

    Science.gov (United States)

    Yang, Y. C.; Han, K. S.

    2002-06-01

    Intensity-based optical fiber vibrations sensors (OFVSs) are used in damage monitoring of fiber-reinforced plastics, in vibration sensing, and location of impacts. OFVSs were constructed by placing two cleaved fiber ends in a capillary tube. This sensor is able to monitor structural vibrations. For vibration sensing, the optical fiber sensor was mounted on the carbon fiber reinforced composite beam, and its response was investigated for free and forced vibration. For locating impact points, four OFVSs were placed at chosen positions and the different arrival times of impact-generated vibration signals were recorded. The impact location can be determined from these time delays. Indentation and tensile tests were performed with the measurement of the optical signal and acoustic emission (AE). The OFVSs accurately detected both free and forced vibration signals. Accurate locations of impact were determined on an acrylate plate. It was found that damage information, comparable in quality to AE data, could be obtained from the OFVS signals.

  15. Vibration and noise analysis of a gear transmission system

    Science.gov (United States)

    Choy, F. K.; Qian, W.; Zakrajsek, J. J.; Oswald, F. B.

    1993-01-01

    This paper presents a comprehensive procedure to predict both the vibration and noise generated by a gear transmission system under normal operating conditions. The gearbox vibrations were obtained from both numerical simulation and experimental studies using a gear noise test rig. In addition, the noise generated by the gearbox vibrations was recorded during the experimental testing. A numerical method was used to develop linear relationships between the gearbox vibration and the generated noise. The hypercoherence function is introduced to correlate the nonlinear relationship between the fundamental noise frequency and its harmonics. A numerical procedure was developed using both the linear and nonlinear relationships generated from the experimental data to predict noise resulting from the gearbox vibrations. The application of this methodology is demonstrated by comparing the numerical and experimental results from the gear noise test rig.

  16. Bevel Gearbox Fault Diagnosis using Vibration Measurements

    Directory of Open Access Journals (Sweden)

    Hartono Dennis

    2016-01-01

    Full Text Available The use of vibration measurementanalysis has been proven to be effective for gearbox fault diagnosis. However, the complexity of vibration signals observed from a gearbox makes it difficult to accurately detectfaults in the gearbox. This work is based on a comparative studyof several time-frequency signal processing methods that can be used to extract information from transient vibration signals containing useful diagnostic information. Experiments were performed on a bevel gearbox test rig using vibration measurements obtained from accelerometers. Initially, thediscrete wavelet transform was implementedfor vibration signal analysis to extract the frequency content of signal from the relevant frequency region. Several time-frequency signal processing methods werethen incorporated to extract the fault features of vibration signals and their diagnostic performances were compared. It was shown thatthe Short Time Fourier Transform (STFT could not offer a good time resolution to detect the periodicity of the faulty gear tooth due the difficulty in choosing an appropriate window length to capture the impulse signal. The Continuous Wavelet Transform (CWT, on the other hand, was suitable to detection of vibration transients generated by localized fault from a gearbox due to its multi-scale property. However, both methods still require a thorough visual inspection. In contrast, it was shown from the experiments that the diagnostic method using the Cepstrumanalysis could provide a direct indication of the faulty tooth without the need of a thorough visual inspection as required by CWT and STFT.

  17. Review of Energy Harvesters Utilizing Bridge Vibrations

    Directory of Open Access Journals (Sweden)

    Farid Ullah Khan

    2016-01-01

    Full Text Available For health monitoring of bridges, wireless acceleration sensor nodes (WASNs are normally used. In bridge environment, several forms of energy are available for operating WASNs that include wind, solar, acoustic, and vibration energy. However, only bridge vibration has the tendency to be utilized for embedded WASNs application in bridge structures. This paper reports on the recent advancements in the area of vibration energy harvesters (VEHs utilizing bridge oscillations. The bridge vibration is narrowband (1 to 40 Hz with low acceleration levels (0.01 to 3.8 g. For utilization of bridge vibration, electromagnetic based vibration energy harvesters (EM-VEHs and piezoelectric based vibration energy harvesters (PE-VEHs have been developed. The power generation of the reported EM-VEHs is in the range from 0.7 to 1450000 μW. However, the power production by the developed PE-VEHs ranges from 0.6 to 7700 μW. The overall size of most of the bridge VEHs is quite comparable and is in mesoscale. The resonant frequencies of EM-VEHs are on the lower side (0.13 to 27 Hz in comparison to PE-VEHs (1 to 120 Hz. The power densities reported for these bridge VEHs range from 0.01 to 9539.5 μW/cm3 and are quite enough to operate most of the commercial WASNs.

  18. Thermal Vibrational Convection

    Science.gov (United States)

    Gershuni, G. Z.; Lyubimov, D. V.

    1998-08-01

    Recent increasing awareness of the ways in which vibrational effects can affect low-gravity experiments have renewed interest in the study of thermal vibrational convection across a wide range of fields. For example, in applications where vibrational effects are used to provide active control of heat and mass transfer, such as in heat exchangers, stirrers, mineral separators and crystal growth, a sound understanding of the fundamental theory is required. In Thermal Vibrational Convection, the authors present the theory of vibrational effects caused by a static gravity field, and of fluid flows which appear under vibration in fluid-filled cavities. The first part of the book discusses fluid-filled cavities where the fluid motion only appears in the presence of temperature non-uniformities, while the second considers those situations where the vibrational effects are caused by a non-uniform field. Throughout, the authors concentrate on consideration of high frequency vibrations, where averaging methods can be successfully applied in the study of the phenomena. Written by two of the pioneers in this field, Thermal Vibrational Convection will be of great interest to scientists and engineers working in the many areas that are concerned with vibration, and its effect on heat and mass transfer. These include hydrodynamics, hydro-mechanics, low gravity physics and mechanics, and geophysics. The rigorous approach adopted in presenting the theory of this fascinating and highly topical area will facilitate a greater understanding of the phenomena involved, and will lead to the development of more and better-designed experiments.

  19. Substrate vibrations during courtship in three Drosophila species.

    Directory of Open Access Journals (Sweden)

    Valerio Mazzoni

    Full Text Available While a plethora of studies have focused on the role of visual, chemical and near-field airborne signals in courtship of Drosophila fruit flies, the existence of substrate-borne vibrational signals has been almost completely overlooked. Here we describe substrate vibrations generated during courtship in three species of the D. melanogaster group, from the allegedly mute species D. suzukii, its sister species D. biarmipes, and from D. melanogaster. In all species, we recorded several types of substrate vibrations which were generated by locomotion, abdominal vibrations and most likely through the activity of thoracic wing muscles. In D. melanogaster and D. suzukii, all substrate vibrations described in intact males were also recorded in males with amputated wings. Evidence suggests that vibrational signalling may be widespread among Drosophila species, and fruit flies may provide an ideal model to study various aspects of this widespread form of animal communication.

  20. Prediction of Ground Vibration from Freight Trains

    Science.gov (United States)

    Jones, C. J. C.; Block, J. R.

    1996-05-01

    Heavy freight trains emit ground vibration with predominant frequency components in the range 4-30 Hz. If the amplitude is sufficient, this may be felt by lineside residents, giving rise to disturbance and concern over possible damage to their property. In order to establish the influence of parameters of the track and rolling stock and thereby enable the design of a low vibration railway, a theoretical model of both the generation and propagation of vibration is required. The vibration is generated as a combination of the effects of dynamic forces, due to the unevenness of the track, and the effects of the track deformation under successive axle loads. A prediction scheme, which combines these effects, has been produced. A vehicle model is used to predict the dynamic forces at the wheels. This includes the non-linear effects of friction damped suspensions. The loaded track profile is measured by using a track recording coach. The dynamic loading and the effects of the moving axles are combined in a track response model. The predicted track vibration is compared to measurements. The transfer functions from the track to a point in the ground can be calculated by using a coupled track and a three-dimensional layered ground model. The propagation effects of the ground layers are important but the computation of the transfer function from each sleeper, which would be required for a phase coherent summation of the vibration in the ground, would be prohibitive. A compromise summation is used and results are compared with measurements.

  1. Behavior of Cell on Vibrating Micro Ridges

    Directory of Open Access Journals (Sweden)

    Haruka Hino

    2015-06-01

    Full Text Available The effect of micro ridges on cells cultured at a vibrating scaffold has been studied in vitro. Several parallel lines of micro ridges have been made on a disk of transparent polydimethylsiloxane for a scaffold. To apply the vibration on the cultured cells, a piezoelectric element was attached on the outside surface of the bottom of the scaffold. The piezoelectric element was vibrated by the sinusoidal alternating voltage (Vp-p < 16 V at 1.0 MHz generated by a function generator. Four kinds of cells were used in the test: L929 (fibroblast connective tissue of C3H mouse, Hepa1-6 (mouse hepatoma, C2C12 (mouse myoblast, 3T3-L1 (mouse fat precursor cells. The cells were seeded on the micro pattern at the density of 2000 cells/cm2 in the medium containing 10% FBS (fetal bovine serum and 1% penicillin/ streptomycin. After the adhesion of cells in several hours, the cells are exposed to the ultrasonic vibration for several hours. The cells were observed with a phase contrast microscope. The experimental results show that the cells adhere, deform and migrate on the scaffold with micro patterns regardless of the ultrasonic vibration. The effects of the vibration and the micro pattern depend on the kind of cells.

  2. Robot Vibrations Caused by Torque Ripples in Power Transmission Mechanisms

    OpenAIRE

    小島, 宏行; 田口, 和哉; 辻, 浩明

    1989-01-01

    When an industrial robot with a power transmission mechanism such as a harmonic drive gear is operated, vibrations resulting from the torque ripple of the power transmission mechanism are frequently generated. However, few studies on robot vibration characteristics owing to torque ripples have been reported. In this paper, the vibrations of a horizontal two-link robot are investigated with consideration given to the torque ripple and the nonlinearity of the power transmission mechanism. In th...

  3. Cases of coupled vibrations and prametric instability in rotating machines

    OpenAIRE

    Luneno, Jean-Claude

    2012-01-01

    The principal task in this research project was to analyse the causes and consequences of coupled vibrations and parametric instability in hydropower rotors; where both horizontal and vertical machines are involved. Vibration is a well-known undesirable behavior of dynamical systems characterised by persistent periodic, quasi-periodic or chaotic motions. Vibrations generate noise and cause fatigue, which initiates cracks in mechanical structures. Motions coupling can in some cases augment the...

  4. Long-range vibration sensor based on correlation analysis of optical frequency-domain reflectometry signals.

    Science.gov (United States)

    Ding, Zhenyang; Yao, X Steve; Liu, Tiegen; Du, Yang; Liu, Kun; Han, Qun; Meng, Zhuo; Chen, Hongxin

    2012-12-17

    We present a novel method to achieve a space-resolved long- range vibration detection system based on the correlation analysis of the optical frequency-domain reflectometry (OFDR) signals. By performing two separate measurements of the vibrated and non-vibrated states on a test fiber, the vibration frequency and position of a vibration event can be obtained by analyzing the cross-correlation between beat signals of the vibrated and non-vibrated states in a spatial domain, where the beat signals are generated from interferences between local Rayleigh backscattering signals of the test fiber and local light oscillator. Using the proposed technique, we constructed a standard single-mode fiber based vibration sensor that can have a dynamic range of 12 km and a measurable vibration frequency up to 2 kHz with a spatial resolution of 5 m. Moreover, preliminarily investigation results of two vibration events located at different positions along the test fiber are also reported.

  5. Good or bad vibrations? Impacts of anthropogenic vibration on the marine epibenthos.

    Science.gov (United States)

    Roberts, Louise; Elliott, Michael

    2017-04-03

    Anthropogenic activities directly contacting the seabed, such as drilling and pile-driving, produce a significant vibration likely to impact benthic invertebrates. As with terrestrial organisms, vibration may be used by marine species for the detection of biotic and abiotic cues, yet the significance of this and the sensitivities to vibration are previously undocumented for many marine species. Exposure to additional vibration may elicit behavioral or physiological change, or even physical damage at high amplitudes or particular frequencies, although this is poorly studied in underwater noise research. Here we review studies regarding the sensitivities and responses of marine invertebrates to substrate-borne vibration. This includes information related to vibrations produced by those construction activities directly impacting the seabed, such as pile-driving. This shows the extent to which species are able to detect vibration and respond to anthropogenically-produced vibrations, although the short and long-term implications of this are not known. As such it is especially important that the sensitivities of these species are further understood, given that noise and energy-generating human impacts on the marine environment are only likely to increase and that there are now legal instruments requiring such effects to be monitored and controlled.

  6. Vibrating fuel grapple. [LMFBR

    Science.gov (United States)

    Chertock, A.J.; Fox, J.N.; Weissinger, R.B.

    A reactor refueling method is described which utilizes a vibrating fuel grapple for removing spent fuel assemblies from a reactor core. It incorporates a pneumatic vibrator in the grapple head which allows additional withdrawal capability without exceeding the allowable axial force limit. The only moving part in the vibrator is a steel ball, pneumatically driven by a gas, such as argon, around a track, with centrifugal force created by the ball being transmitted through the grapple to the assembly handling socket.

  7. Method for Reducing Vibration Noise Transmission in Pipe Systems by Reducing Bending Vibrations Using Curved Tube Elements

    OpenAIRE

    王, 建春; 横田, 正二; 長屋, 幸助

    1995-01-01

    Bending vibrations of a pipe system are trasmitted to an evaporator and generate noise in an air conditioning system. Hence to reduce noise, bending vibrations should be reduced. This paper presents a method for reducing bending vibrations of a pipe system by use of curve tube elements. As a first step, to discuss the validity of the simulation program based on our previous analyses, experimental tests have been performed, and the simulation results are compared with the experimental data for...

  8. Vibrational properties of uracil

    Institute of Scientific and Technical Information of China (English)

    WANG Zhiping; ZHANG Fengshou; ZENG Xianghua; ZHOU Hongyu; GU Bin; CHENG Wei

    2006-01-01

    A semiempirical molecular dynamics model is developed to study the vibrational frequencies of uracil at very low kinetic temperature by using the Fourier transform of velocity autocorrelation function of trajectories of molecular dynamics simulations. The finite difference harmonic method is used to assign the vibrational frequency of each mode. The calculated frequencies are found to be in good agreement with experimental measurements. Moreover, we make up for the lost vibrational modes in experiments self-consistently. A total of 30 vibrational modes and their corresponding frequencies are reported.

  9. Integrated predictive maintenance program vibration and lube oil analysis: Part I - history and the vibration program

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, H.

    1996-12-01

    This paper is the first of two papers which describe the Predictive Maintenance Program for rotating machines at the Palo Verde Nuclear Generating Station. The organization has recently been restructured and significant benefits have been realized by the interaction, or {open_quotes}synergy{close_quotes} between the Vibration Program and the Lube Oil Analysis Program. This paper starts with the oldest part of the program - the Vibration Program and discusses the evolution of the program to its current state. The {open_quotes}Vibration{close_quotes} view of the combined program is then presented.

  10. Broadband vibration energy harvester utilizing three out-of-plane modes of one vibrating body

    Science.gov (United States)

    Park, Shi-Baek; Jang, Seon-Jun; Kim, In-Ho; Choi, Yong Je

    2017-10-01

    In this paper, we introduce the concept, design equation, and realization of a broadband electromagnetic vibrational energy harvester. The spatial vibrating system in the proposed harvester is arranged to have three out-of-plane vibration modes. We devise the design method for its three natural frequencies and accompanying modes and apply it to the broadband energy harvesting by locating three frequencies close to each other. The numerical simulation and the experimental results show that it satisfies the designated frequencies as well as the enhanced bandwidth for power generation.

  11. PREFACE: Vibrations at surfaces Vibrations at surfaces

    Science.gov (United States)

    Rahman, Talat S.

    2011-12-01

    This special issue is dedicated to the phenomenon of vibrations at surfaces—a topic that was indispensible a couple of decades ago, since it was one of the few phenomena capable of revealing the nature of binding at solid surfaces. For clean surfaces, the frequencies of modes with characteristic displacement patterns revealed how surface geometry, as well as the nature of binding between atoms in the surface layers, could be different from that in the bulk solid. Dispersion of the surface phonons provided further measures of interatomic interactions. For chemisorbed molecules on surfaces, frequencies and dispersion of the vibrational modes were also critical for determining adsorption sites. In other words, vibrations at surfaces served as a reliable means of extracting information about surface structure, chemisorption and overlayer formation. Experimental techniques, such as electron energy loss spectroscopy and helium-atom-surface scattering, coupled with infra-red spectroscopy, were continually refined and their resolutions enhanced to capture subtleties in the dynamics of atoms and molecules at surfaces. Theoretical methods, whether based on empirical and semi-empirical interatomic potential or on ab initio electronic structure calculations, helped decipher experimental observations and provide deeper insights into the nature of the bond between atoms and molecules in regions of reduced symmetry, as encountered on solid surfaces. Vibrations at surfaces were thus an integral part of the set of phenomena that characterized surface science. Dedicated workshops and conferences were held to explore the variety of interesting and puzzling features revealed in experimental and theoretical investigations of surface vibrational modes and their dispersion. One such conference, Vibrations at Surfaces, first organized by Harald Ibach in Juelich in 1980, continues to this day. The 13th International Conference on Vibrations at Surfaces was held at the University of

  12. Study on energy harvesting using piezoelectric cantilever generator in fluid environments from ultrasonic vibration%超声液体环境下压电式振动能量采集的研究

    Institute of Scientific and Technical Information of China (English)

    郑慈航; 唐刚; 刘景全; 尹桂林; 余震; 何丹农

    2011-01-01

    An vibration energy harvester which can work in fluid environments is fabricated. Piezoelectric cantilever structure is adopted. Ultrasonic energy in water is harvested. By changing relative dinection of ultrasonic and cantilever, and salinity weigh percent, it is discovered that generating efficiency in ultrasonic liquid enrironment is reduced with the salinity weight percent increases and the device achieves highest efficiency when the angle between ultrasonic transducer plane and cantilever beam is 45° ~60°. The output peak-peak voltage reaches 5.04V excited by 32kHz ultrasonic frequency.%针对在液体环境下工作的器件不利于直接供能这一难题,制作了一种可在液体环境下工作的振动能量采集器,采用压电悬臂梁结构在液体环境中采集水中的超声能量,在32 kHz超声频率激励下,最高获得了5.04V的输出电压.通过改变超声波与悬臂梁的相对方向及液体盐分质量分数,发现能量采集器在超声液体环境下工作的发电效率随盐分质量分数的增加而减小;在当悬臂梁与超声换能器平面的夹角为45°~60°时,能量采集器的发电效率最高.

  13. Non-traditional vibration mitigation methods for reciprocating compressor system

    NARCIS (Netherlands)

    Eijk, A.; Lange, T.J. de; Vreugd, J. de; Slis, E.J.P.

    2016-01-01

    Reciprocating compressors generate vibrations caused by pulsation-induced forces, mechanical (unbalanced) free forces and moments, crosshead guide forces and cylinder stretch forces. The traditional way of mitigating the vibration and cyclic stress levels to avoid fatigue failure of parts of the

  14. Cost-effective and detailed modelling of compressor manifold vibrations

    NARCIS (Netherlands)

    Eijk, A.; Egas, G.; Smeulers, J.P.M.

    1996-01-01

    In systems with large reciprocating compressors, so-called compressor manifold vibrations can contribute to fatigue failure of the pipe system. These vibrations are excited by pulsation-induced forces and by forces generated by the compressor. This paper describes an advanced and accurate method for

  15. Vibration-induced changes in EMG during human locomotion.

    NARCIS (Netherlands)

    Verschueren, S.M.P.; Swinnen, S.P.; Desloovere, K.; Duysens, J.E.J.

    2003-01-01

    The present study was set up to examine the contribution of Ia afferent input in the generation of electromyographic (EMG) activity. Subjects walked blindfolded along a walkway while tendon vibration was applied continuously to a leg muscle. The effects of vibration were measured on mean EMG

  16. Análisis de la eficiencia del sistema de aislamiento de vibraciones de grupos electrógenos MAN 18 V48/60 B // Efficiency analysis of vibration isolation system installed on engine generator sets type MAN 18 V48/60 b

    Directory of Open Access Journals (Sweden)

    Evelio Palomino‐Marín

    2011-01-01

    all the engine generator sets type MAN 18 V48/60 B which are installed in aCuban Power Plant. Cracks with unknown cause have been present on an engine and after a priorevaluation; the vibroisolation system seems to be a possible cause. That’s why vibration spectrawhere registered over and under each vibration isolator, evaluating isolation efficiency in a bandwidthof interest. As preliminary results it was found that some frequencies do not exhibit well efficiencylevels having on this paper an alternate methodology for similar researches.Key words: vibration isolators, vibration isolation, engine generator sets.

  17. Vibrational Schroedinger Cats

    Science.gov (United States)

    Kis, Z.; Janszky, J.; Vinogradov, An. V.; Kobayashi, T.

    1996-01-01

    The optical Schroedinger cat states are simple realizations of quantum states having nonclassical features. It is shown that vibrational analogues of such states can be realized in an experiment of double pulse excitation of vibrionic transitions. To track the evolution of the vibrational wave packet we derive a non-unitary time evolution operator so that calculations are made in a quasi Heisenberg picture.

  18. Vibration Theory, Vol. 3

    DEFF Research Database (Denmark)

    Nielsen, Søren R. K.

    The present textbook has been written based on previous lecture notes for a course on stochastic vibration theory that is being given on the 9th semester at Aalborg University for M. Sc. students in structural engineering. The present 4th edition of this textbook on linear stochastic vibration...

  19. [Vibration on agricultural tractors].

    Science.gov (United States)

    Peretti, Alessandro; Delvecchio, Simone; Bonomini, Francesco; di Bisceglie, Anita Pasqua; Colosio, Claudio

    2013-01-01

    In the article, details related to the diffusion of agricultural tractors in Italy are given and considerations about the effects of vibration on operators, the sources of vibration and suggestions to reduce them are presented. The acceleration values observed in Italy amongst 244 tractors and levels of worker exposure are shown by means of histograms. The relevant data variability is discussed.

  20. Picking up good vibrations

    NARCIS (Netherlands)

    Eijk, A.

    2010-01-01

    The methods that need to be employed to develop the better vibration guidelines to assess the integrity of a reciprocating compressor system are discussed. An R&D project of the European Forum of Reciprocating Compressors (EFRC) has been initiated to develop guidelines for vibrations in reciprocatin

  1. Vibration Theory, Vol. 3

    DEFF Research Database (Denmark)

    Nielsen, Søren R. K.

    The present textbook has been written based on previous lecture notes for a course on stochastic vibration theory that is being given on the 9th semester at Aalborg University for M. Sc. students in structural engineering. The present 2nd edition of this textbook on linear stochastic vibration th...

  2. Mechanical vibration and shock analysis, sinusoidal vibration

    CERN Document Server

    Lalanne, Christian

    2014-01-01

    Everything engineers need to know about mechanical vibration and shock...in one authoritative reference work! This fully updated and revised 3rd edition addresses the entire field of mechanical vibration and shock as one of the most important types of load and stress applied to structures, machines and components in the real world. Examples include everything from the regular and predictable loads applied to turbines, motors or helicopters by the spinning of their constituent parts to the ability of buildings to withstand damage from wind loads or explosions, and the need for cars to m

  3. Interfacial instabilities in vibrated fluids

    Science.gov (United States)

    Porter, Jeff; Laverón-Simavilla, Ana; Tinao Perez-Miravete, Ignacio; Fernandez Fraile, Jose Javier

    2016-07-01

    Vibrations induce a range of different interfacial phenomena in fluid systems depending on the frequency and orientation of the forcing. With gravity, (large) interfaces are approximately flat and there is a qualitative difference between vertical and horizontal forcing. Sufficient vertical forcing produces subharmonic standing waves (Faraday waves) that extend over the whole interface. Horizontal forcing can excite both localized and extended interfacial phenomena. The vibrating solid boundaries act as wavemakers to excite traveling waves (or sloshing modes at low frequencies) but they also drive evanescent bulk modes whose oscillatory pressure gradient can parametrically excite subharmonic surface waves like cross-waves. Depending on the magnitude of the damping and the aspect ratio of the container, these locally generated surfaces waves may interact in the interior resulting in temporal modulation and other complex dynamics. In the case where the interface separates two fluids of different density in, for example, a rectangular container, the mass transfer due to vertical motion near the endwalls requires a counterflow in the interior region that can lead to a Kelvin-Helmholtz type instability and a ``frozen wave" pattern. In microgravity, the dominance of surface forces favors non-flat equilibrium configurations and the distinction between vertical and horizontal applied forcing can be lost. Hysteresis and multiplicity of solutions are more common, especially in non-wetting systems where disconnected (partial) volumes of fluid can be established. Furthermore, the vibrational field contributes a dynamic pressure term that competes with surface tension to select the (time averaged) shape of the surface. These new (quasi-static) surface configurations, known as vibroequilibria, can differ substantially from the hydrostatic state. There is a tendency for the interface to orient perpendicular to the vibrational axis and, in some cases, a bulge or cavity is induced

  4. Systemic functional grammar in natural language generation linguistic description and computational representation

    CERN Document Server

    Teich, Elke

    1999-01-01

    This volume deals with the computational application of systemic functional grammar (SFG) for natural language generation. In particular, it describes the implementation of a fragment of the grammar of German in the computational framework of KOMET-PENMAN for multilingual generation. The text also presents a specification of explicit well-formedness constraints on syntagmatic structure which are defined in the form of typed feature structures. It thus achieves a model of systemic functional grammar that unites both the strengths of systemics, such as stratification, functional diversification

  5. Vibration control in accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Montag, C.

    2011-01-01

    In the vast majority of accelerator applications, ground vibration amplitudes are well below tolerable magnet jitter amplitudes. In these cases, it is necessary and sufficient to design a rigid magnet support structure that does not amplify ground vibration. Since accelerator beam lines are typically installed at an elevation of 1-2m above ground level, special care has to be taken in order to avoid designing a support structure that acts like an inverted pendulum with a low resonance frequency, resulting in untolerable lateral vibration amplitudes of the accelerator components when excited by either ambient ground motion or vibration sources within the accelerator itself, such as cooling water pumps or helium flow in superconducting magnets. In cases where ground motion amplitudes already exceed the required jiter tolerances, for instance in future linear colliders, passive vibration damping or active stabilization may be considered.

  6. Vibrations of rotating machinery

    CERN Document Server

    Matsushita, Osami; Kanki, Hiroshi; Kobayashi, Masao; Keogh, Patrick

    2017-01-01

    This book opens with an explanation of the vibrations of a single degree-of-freedom (dof) system for all beginners. Subsequently, vibration analysis of multi-dof systems is explained by modal analysis. Mode synthesis modeling is then introduced for system reduction, which aids understanding in a simplified manner of how complicated rotors behave. Rotor balancing techniques are offered for rigid and flexible rotors through several examples. Consideration of gyroscopic influences on the rotordynamics is then provided and vibration evaluation of a rotor-bearing system is emphasized in terms of forward and backward whirl rotor motions through eigenvalue (natural frequency and damping ratio) analysis. In addition to these rotordynamics concerning rotating shaft vibration measured in a stationary reference frame, blade vibrations are analyzed with Coriolis forces expressed in a rotating reference frame. Other phenomena that may be assessed in stationary and rotating reference frames include stability characteristic...

  7. Vibrational Spectroscopy of Biomembranes

    Science.gov (United States)

    Schultz, Zachary D.; Levin, Ira W.

    2011-07-01

    Vibrational spectroscopy, commonly associated with IR absorption and Raman scattering, has provided a powerful approach for investigating interactions between biomolecules that make up cellular membranes. Because the IR and Raman signals arise from the intrinsic properties of these molecules, vibrational spectroscopy probes the delicate interactions that regulate biomembranes with minimal perturbation. Numerous innovative measurements, including nonlinear optical processes and confined bilayer assemblies, have provided new insights into membrane behavior. In this review, we highlight the use of vibrational spectroscopy to study lipid-lipid interactions. We also examine recent work in which vibrational measurements have been used to investigate the incorporation of peptides and proteins into lipid bilayers, and we discuss the interactions of small molecules and drugs with membrane structures. Emerging techniques and measurements on intact cellular membranes provide a prospective on the future of vibrational spectroscopic studies of biomembranes.

  8. Directional motion of liquid under mechanical vibrations

    Science.gov (United States)

    Costalonga, Maxime; Brunet, Philippe; Peerhossaini, Hassan

    2014-11-01

    When a liquid is submitted to mechanical vibrations, steady flows or motion can be generated by non-linear effects. One example is the steady acoustic streaming one can observe when an acoustic wave propagates in a fluid. At the scale of a droplet, steady motion of the whole amount of liquid can arise from zero-mean periodic forcing. As It has been observed by Brunet et al. (PRL 2007), a drop can climb an inclined surface when submitted to vertical vibrations above a threshold in acceleration. Later, Noblin et al. (PRL 2009) showed the velocity and the direction of motion of a sessile drop submitted to both horizontal and vertical vibrations can be tuned by the phase shift between these two excitations. Here we present an experimental study of the mean motion of a sessile drop under slanted vibrations, focusing on the effects of drop properties, as well as the inclination angle of the axis of vibrations. It is shown that the volume and viscosity strongly affect the drop mean velocity, and can even change the direction of its motion. In the case of a low viscous drop, gravity can become significant and be modulated by the inclination of the axis of vibrations. Contact line dynamic during the drop oscillations is also investigated.

  9. No Telescoping Effect with Dual Tendon Vibration.

    Directory of Open Access Journals (Sweden)

    Valeria Bellan

    Full Text Available The tendon vibration illusion has been extensively used to manipulate the perceived position of one's own body part. However, findings from previous research do not seem conclusive sregarding the perceptual effect of the concurrent stimulation of both agonist and antagonist tendons over one joint. On the basis of recent data, it has been suggested that this paired stimulation generates an inconsistent signal about the limb position, which leads to a perceived shrinkage of the limb. However, this interesting effect has never been replicated. The aim of the present study was to clarify the effect of a simultaneous and equal vibration of the biceps and triceps tendons on the perceived location of the hand. Experiment 1 replicated and extended the previous findings. We compared a dual tendon stimulation condition with single tendon stimulation conditions and with a control condition (no vibration on both 'upward-downward' and 'towards-away from the elbow' planes. Our results show a mislocalisation towards the elbow of the position of the vibrated arm during dual vibration, in line with previous results; however, this did not clarify whether the effect was due to arm representation contraction (i.e., a 'telescoping' effect. Therefore, in Experiment 2 we investigated explicitly and implicitly the perceived arm length during the same conditions. Our results clearly suggest that in all the vibration conditions there was a mislocalisation of the entire arm (including the elbow, but no evidence of a contraction of the perceived arm length.

  10. Vibration analysis of shell-and-tube heat exchangers: an overview-Part 2: vibration response, fretting-wear, guidelines

    Science.gov (United States)

    Pettigrew, M. J.; Taylor, C. E.

    2003-11-01

    Design guidelines were developed to prevent tube failures due to excessive flow-induced vibration in shell-and-tube heat exchangers. An overview of vibration analysis procedures and recommended design guidelines is presented in this paper. This paper pertains to liquid, gas and two-phase heat exchangers such as nuclear steam generators, reboilers, coolers, service water heat exchangers, condensers, and moisture-separator-reheaters. Part 2 of this paper covers forced vibration excitation mechanisms, vibration response prediction, resulting damage assessment, and acceptance criteria.

  11. Analysis of torsional vibration in an electromechanical transmission system

    Directory of Open Access Journals (Sweden)

    Kai Chen

    2016-06-01

    Full Text Available Aiming at the torsional vibration in the electromechanical transmission system, this article introduces the active vibration method and analyzes the vibration characteristics on the condition of the external excitation, and then, the condition of the permanent magnetic synchronous motor parameter is obtained. In the braking energy recovery working condition, the permanent magnetic synchronous motor is operated in generator mode and is subjected to power control, this cause it to produce negative effect of damping. Negative effect of damping leads to the increasing torsional vibration. Then, the improved power control strategy is introduced to reduce the vibration. Computer simulations are used to demonstrate the active vibration method and the effectiveness of the proposed control strategy, which provides reference for the design of electromechanical systems in the hybrid electrical vehicles.

  12. Reactor vibration reduction based on giant magnetostrictive materials

    Science.gov (United States)

    Rongge, Yan; Weiying, Liu; Yuechao, Wu; Menghua, Duan; Xiaohong, Zhang; Lihua, Zhu; Ling, Weng; Ying, Sun

    2017-05-01

    The vibration of reactors not only produces noise pollution, but also affects the safe operation of reactors. Giant magnetostrictive materials can generate huge expansion and shrinkage deformation in a magnetic field. With the principle of mutual offset between the giant magnetostrictive force produced by the giant magnetostrictive material and the original vibration force of the reactor, the vibration of the reactor can be reduced. In this paper, magnetization and magnetostriction characteristics in silicon steel and the giant magnetostrictive material are measured, respectively. According to the presented magneto-mechanical coupling model including the electromagnetic force and the magnetostrictive force, reactor vibration is calculated. By comparing the vibration of the reactor with different inserted materials in the air gaps between the reactor cores, the vibration reduction effectiveness of the giant magnetostrictive material is validated.

  13. Male courtship vibrations delay predatory behaviour in female spiders.

    Science.gov (United States)

    Wignall, Anne E; Herberstein, Marie E

    2013-12-19

    During courtship, individuals transfer information about identity, mating status and quality. However, male web-building spiders face a significant problem: how to begin courting female spiders without being mistaken for prey? Male Argiope spiders generate distinctive courtship vibrations (shudders) when entering a female's web. We tested whether courtship shudders delay female predatory behaviour, even when live prey is present in the web. We presented a live cricket to females during playbacks of shudder vibrations, or white noise, and compared female responses to a control in which we presented a live cricket with no playback vibrations. Females were much slower to respond to crickets during playback of shudder vibrations. Shudder vibrations also delayed female predatory behaviour in a related spider species, showing that these vibrations do not simply function for species identity. These results suggest that male web-building spiders employ a phylogenetically conserved vibratory signal to ameliorate the risk of pre-copulatory cannibalism.

  14. Compact Active Vibration Control System for a Flexible Panel

    Science.gov (United States)

    Schiller, Noah H. (Inventor); Cabell, Randolph H. (Inventor); Perey, Daniel F. (Inventor)

    2014-01-01

    A diamond-shaped actuator for a flexible panel has an inter-digitated electrode (IDE) and a piezoelectric wafer portion positioned therebetween. The IDE and/or the wafer portion are diamond-shaped. Point sensors are positioned with respect to the actuator and measure vibration. The actuator generates and transmits a cancelling force to the panel in response to an output signal from a controller, which is calculated using a signal describing the vibration. A method for controlling vibration in a flexible panel includes connecting a diamond-shaped actuator to the flexible panel, and then connecting a point sensor to each actuator. Vibration is measured via the point sensor. The controller calculates a proportional output voltage signal from the measured vibration, and transmits the output signal to the actuator to substantially cancel the vibration in proximity to each actuator.

  15. Vibrational Spectra of a Mechanosensitive Channel

    NARCIS (Netherlands)

    Liang, Chungwen; Louhivuori, Martti; Marrink, Siewert J.; Jansen, Thomas L.C.; Knoester, Jasper

    2013-01-01

    We report the simulated vibrational spectra of a mechanosensitive membrane channel in different gating states. Our results show that while linear absorption is insensitive to structural differences, linear dichroism and sum-frequency generation spectroscopies are sensitive to the orientation of the

  16. Built-up edge investigation in vibration drilling of Al2024-T6.

    Science.gov (United States)

    Barani, A; Amini, S; Paktinat, H; Fadaei Tehrani, A

    2014-07-01

    Adding ultrasonic vibrations to drilling process results in an advanced hybrid machining process, entitled "vibration drilling". This study presents the design and fabrication of a vibration drilling tool by which both rotary and vibrating motions are applied to drill simultaneously. High frequency and low amplitude vibrations were generated by an ultrasonic transducer with frequency of 19.65 kHz. Ultrasonic transducer was controlled by a MPI ultrasonic generator with 3 kW power. The drilling tool and workpiece material were HSS two-flute twist drill and Al2024-T6, respectively. The aim of this study was investigating on the effect of ultrasonic vibrations on built-up edge, surface quality, chip morphology and wear mechanisms of drill edges. Therefore, these factors were studied in both vibration and ordinary drilling. Based on the achieved results, vibration drilling offers less built-up edge and better surface quality compared to ordinary drilling.

  17. EFRC guidelines for vibrations in reciprocating compressor systems

    NARCIS (Netherlands)

    Eijk, A.

    2008-01-01

    One of the disadvantages of a reciprocating compressor is that it generates pulsations and vibrations, which, without limitation and proper attention during design, manufacturing, installation and operation, can lead to fatigue failures, inefficiency, capacity limitations and unsafe situations. To j

  18. Measuring molecular reorientation at liquid surfaces with time-resolved sum-frequency spectroscopy: a theoretical framework.

    Science.gov (United States)

    Nienhuys, Han-Kwang; Bonn, Mischa

    2009-05-28

    A theoretical framework is presented for the design and analysis of ultrafast time- and polarization-resolved surface vibrational spectroscopy, aimed at elucidating surface molecular reorientational motion in real time. Vibrational excitation with linearly polarized light lifts the azimuthal symmetry of the surface transition-dipole distribution, causing marked, time-dependent changes in the surface sum-frequency generation (SFG) intensity. The subsequent recovery of the SFG signal generally reflects both vibrational relaxation and reorientational motion of surface molecules. We present experimental schemes that allow direct quantification of the time scale of surface molecular reorientational diffusive motion.

  19. Experimental Study on Piezoelectric Energy Harvesting from Vortex-Induced Vibrations and Wake-Induced Vibrations

    Directory of Open Access Journals (Sweden)

    Min Zhang

    2016-01-01

    Full Text Available A rigid circular cylinder with two piezoelectric beams attached on has been tested through vortex-induced vibrations (VIV and wake-induced vibrations (WIV by installing a big cylinder fixed upstream, in order to study the influence of the different flow-induced vibrations (FIV types. The VIV test shows that the output voltage increases with the increases of load resistance; an optimal load resistance exists for the maximum output power. The WIV test shows that the vibration of the small cylinder is controlled by the vortex frequency of the large one. There is an optimal gap of the cylinders that can obtain the maximum output voltage and power. For a same energy harvesting device, WIV has higher power generation capacity; then the piezoelectric output characteristics can be effectively improved.

  20. Sensitivity improvement techniques for micromechanical vibrating accelerometers

    Directory of Open Access Journals (Sweden)

    Vtorushin Sergey

    2016-01-01

    Full Text Available The paper presents the problems of detecting a desired signal generated by micromechanical vibrating accelerometer. Three detection methods, namely frequency, amplitude and phase are considered in this paper. These methods are used in micromechanical vibrating accelerometers that incorporate a force sensitive element which transforms measured acceleration into the output signal. Investigations are carried out using the ANSYS finite element program and MATLAB/Simulink support package. Investigation results include the comparative analysis of the output signal characteristics obtained by the different detection methods.

  1. Vibrating wire alignment technique

    CERN Document Server

    Xiao-Long, Wang; lei, Wu; Chun-Hua, Li

    2013-01-01

    Vibrating wire alignment technique is a kind of method which through measuring the spatial distribution of magnetic field to do the alignment and it can achieve very high alignment accuracy. Vibrating wire alignment technique can be applied for magnet fiducialization and accelerator straight section components alignment, it is a necessary supplement for conventional alignment method. This article will systematically expound the international research achievements of vibrating wire alignment technique, including vibrating wire model analysis, system frequency calculation, wire sag calculation and the relation between wire amplitude and magnetic induction intensity. On the basis of model analysis this article will introduce the alignment method which based on magnetic field measurement and the alignment method which based on amplitude and phase measurement. Finally, some basic questions will be discussed and the solutions will be given.

  2. Vibration enhanced quantum transport

    CERN Document Server

    Semião, F L; Milburn, G J

    2009-01-01

    In this paper, we study the role of a collective vibrational motion in the phenomenon of electronic energy transfer (EET) between chromophores with different electronic transition frequencies. Previous experimental work on EET in conjugated polymer samples has suggested that the common structural framework of the macromolecule introduce correlations in the energy gap fluctuations which cause coherent EET. We present a simple model describing the coupling between the chromophores and a common vibrational mode, and find that vibration can indeed lead to an enhancement in the transport of excitations across the quantum network. Furthermore, in our model phase information is partially retained in the transfer process from a donor to an acceptor, as experimentally demonstrated in the conjugated polymer system. Consequently, this mechanism of vibration enhanced quantum transport might find applications in quantum information transfer of qubit states or entanglement.

  3. NIF Ambient Vibration Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Noble, C.R.; Hoehler, M.S., S.C. Sommer

    1999-11-29

    LLNL has an ongoing research and development project that includes developing data acquisition systems with remote wireless communication for monitoring the vibrations of large civil engineering structures. In order to establish the capability of performing remote sensing over an extended period of time, the researchers needed to apply this technology to a real structure. The construction of the National Ignition Facility provided an opportunity to test the data acquisition system on a large structure to monitor whether the facility is remaining within the strict ambient vibration guidelines. This document will briefly discuss the NIF ambient vibration requirements and summarize the vibration measurements performed during the Spring and Summer of 1999. In addition, a brief description of the sensors and the data acquisition systems will be provided in Appendix B.

  4. NIF Ambient Vibration Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Noble, C.R.; Hoehler, M.S., S.C. Sommer

    1999-11-29

    LLNL has an ongoing research and development project that includes developing data acquisition systems with remote wireless communication for monitoring the vibrations of large civil engineering structures. In order to establish the capability of performing remote sensing over an extended period of time, the researchers needed to apply this technology to a real structure. The construction of the National Ignition Facility provided an opportunity to test the data acquisition system on a large structure to monitor whether the facility is remaining within the strict ambient vibration guidelines. This document will briefly discuss the NIF ambient vibration requirements and summarize the vibration measurements performed during the Spring and Summer of 1999. In addition, a brief description of the sensors and the data acquisition systems will be provided in Appendix B.

  5. Experience of an assessment of the vertical Francis hydroturbines vibration state at heads from 40 to 300 m

    Science.gov (United States)

    Dolmatov, E.; Zaharov, A.; Ilin, S.; Kuznetsov, I.; Nikiforov, A.

    2016-11-01

    The article covers a choice of main vibration parameter at an assessment of a vibration state of vertical Francis hydroturbines. At present time vibration velocity and vibration displacement are adopted as main parameters of non-rotating parts vibration in the international standard ISO 10816-5:2000 «Mechanical vibration — Evaluation of machine vibration by measurements on non-rotating parts — Part 5: Machine sets in hydraulic power generating and pumping plants» (further ISO 10816-5:2000). The hydraulic turbines refer to the slow-speed machines with rotation speed from 60 to 600 rpm (∼ 1 - 10 Hz). So maximum vibration displacements and dynamic stresses in hydraulic turbines supporting parts are in low-frequency region of vibration spectrum. In this report comparative data of hydro units supporting parts vibration velocity and vibration displacement measurements are presented. Using these data assessment of hydro units vibration state has been done. It is shown that the assessment of a hydro unit vibration state using parameter "vibration displacement" corresponds to the fundamental principles of operational reliability and fatigue strength of hydro units supporting parts. It is noted that when hydro units operate at small and partial loads with high low-frequency unsteady flow (f hydraulic turbines» which was published in 1989. In this document vibration displacement was considered as a main parameter. Evaluation of turbine vibration was performed according to the effecrive value of turbine supporting parts vibration displacement.

  6. 2008 Vibrational Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Philip J. Reid

    2009-09-21

    The conference focuses on using vibrational spectroscopy to probe structure and dynamics of molecules in gases, liquids, and interfaces. The goal is to bring together a collection of researchers who share common interests and who will gain from discussing work at the forefront of several connected areas. The intent is to emphasize the insights and understanding that studies of vibrations provide about a variety of systems.

  7. Time-frequency Analysis on Torsional Vibration of Turbo-generator Shafts%汽轮发电机组轴系扭振的时频特征分析

    Institute of Scientific and Technical Information of China (English)

    向玲; 杨世锡; 唐贵基; 甘春标

    2011-01-01

    针对电网动态模拟系统和汽轮发电机组轴系扭振模拟机,开展了典型工况及故障扰动下的汽轮发电机组轴系扭振试验研究,并利用非平稳信号的时频分析方法Hilbert-Huang变换(HHT)对轴系的扭振信号进行了分析.结果表明:在短路故障的冲击下,机组有机电互作用的扭振发生时,扭转振动的幅值大幅增加,扭振频率也发生了变化;三维时频图显示了扭振幅值开始增大然后逐渐减小,形成一个瓶颈状的峰谷对应曲线;三相短路故障引起的机电互作用的扭振时间大于两相短路故障引起的机电互作用的扭振时间;Hilbert谱图能获得时间、频率和幅值对应的关系,定量刻画了频率和幅值随时间的变化过程.%Based on dynamic simulation system of power grid and torsional vibration simulator of turbo-gen- erator shaft, an experimental test was conducted to study the torsional vibration under typical and dis- turbed working conditions, after which the non-stationary vibration signals were analyzed using Hilbert- Huang Transform (HHT) method. Results show that under short-circuit fault, when torsional vibration of the electrical-mechanical interaction kind exists, the amplitude of torsional vibration increases greatly while the stimulated frequency ehanges~ the 3D time-frequency graph indicates that the amplitude first ri- ses and then drops, forming a corresponding peak-to-valley curve of bottleneck like. The holding time of torsional vibration caused by electrical-mechanical interaction in the case of 3-phase short-circuit fault is longer than that of 2-phase short-circuit fault. Hilbert spectrum quantitatively describes the rapid process of vibration frequency and amplitude varying with the time under electrical disturbances.

  8. Wideband Piezomagnetoelastic Vibration Energy Harvesting

    DEFF Research Database (Denmark)

    Lei, Anders; Thomsen, Erik Vilain

    2014-01-01

    This work presents a small-scale wideband piezomagnetoelastic vibration energy harvester (VEH) aimed for operation at frequencies of a few hundred Hz. The VEH consists of a tape-casted PZT cantilever with thin sheets of iron foil attached on each side of the free tip. The wideband operation...... softening effect. In linear operation (without magnets) the harvester generates a RMS power of 141 μW/g2 at 588 Hz with a relative bandwidth of 3.8% over a 100 kΩ load resistor. When operated with one magnet ideally positioned opposite the cantilever, a RMS power of 265 μW/g2 is generated at 270 Hz...

  9. Development of active vibration isolation system for precision machines

    Science.gov (United States)

    Li, H. Z.; Lin, W. J.; Yang, G. L.

    2010-03-01

    It is a common understanding by manufacturers of precision machines that vibrations are a potentially disastrous threat to precision and throughput. To satisfy the quest for more stable processes and tighter critical dimension control in the microelectronics manufacturing industry, active vibration control becomes increasingly important for high-precision equipment developers. This paper introduced the development of an active vibration isolation system for precision machines. Innovative mechatronic approaches are investigated that can effectively suppress both environmental and payload-generated vibration. In this system, accelerometers are used as the feedback sensor, voice coil motors are used to generate the counter force, and a TI DSP controller is used to couple sensor measurements to actuator forces via specially designed control algorithms in real-time to counteract the vibration disturbances. Experimental results by using the developed AVI prototype showed promising performance on vibration attenuation. It demonstrated a reduction of the settling time from 2s to 0.1s under impulsive disturbances; and a vibration attenuation level of more than 20dB for harmonic disturbances. The technology can be used to suppress vibration for a wide range of precision machines to achieve fast settling time and higher accuracy.

  10. Mechanical vibration to electrical energy converter

    Science.gov (United States)

    Kellogg, Rick Allen; Brotz, Jay Kristoffer

    2009-03-03

    Electromechanical devices that generate an electrical signal in response to an external source of mechanical vibrations can operate as a sensor of vibrations and as an energy harvester for converting mechanical vibration to electrical energy. The devices incorporate a magnet that is movable through a gap in a ferromagnetic circuit, wherein a coil is wound around a portion of the ferromagnetic circuit. A flexible coupling is used to attach the magnet to a frame for providing alignment of the magnet as it moves or oscillates through the gap in the ferromagnetic circuit. The motion of the magnet can be constrained to occur within a substantially linear range of magnetostatic force that develops due to the motion of the magnet. The devices can have ferromagnetic circuits with multiple arms, an array of magnets having alternating polarity and, encompass micro-electromechanical (MEM) devices.

  11. Broadband seismic effects from train vibrations

    Science.gov (United States)

    Fuchs, Florian; Bokelmann, Götz

    2017-04-01

    Seismologists rarely study train induced vibrations which are mainly regarded an unwanted source of noise for classical seismological applications such as earthquake monitoring. A few seismological studies try to utilize train vibrations however as active sources, e.g. for subsurface imaging, but they do not focus on the characteristics of the train signal itself. Most available studies on train induced vibrations take an engineering approach and aim at better understanding the generation and short-distance propagation of train induced vibrations, mainly for mitigation and construction purposes. They mostly rely on numerical simulations and/or short-period or accelerometer recordings obtained directly on the train track or up to few hundred meters away and almost no studies exist with seismic recordings further away from the track. In some of these previous studies sharp and equidistant peaks are present in the vibration spectrum of heavy freight trains, but they do not attempt to explain them. Here we show and analyze various train vibration signals obtained from a set of seismic broadband stations installed in the context of the temporary, large-scale regional seismic network AlpArray. The geometrical restrictions of this seismic network combined with budget and safety considerations resulted in a number of broad-band instruments deployed in the vicinity of busy railway lines. On these stations we observe very characteristic seismic signals associated with different types of trains, typically showing pronounced equidistant spectral lines over a wide frequency range. In this study we analyze the nature of such signals and discuss if they are generated by a source effect or by wave propagation effects in near-surface soil layers.

  12. Active vibration control using DEAP actuators

    Science.gov (United States)

    Sarban, Rahimullah; Jones, Richard W.

    2010-04-01

    Dielectric electro-active polymer (DEAP) is a new type of smart material, which has the potential to be used to provide effective actuation for a wide range of applications. The properties of DEAP material place it somewhere between those of piezoceramics and shape memory alloys. Of the range of DEAP-based actuators that have been developed those having a cylindrical configuration are among the most promising. This contribution introduces the use of a tubular type DEAP actuator for active vibration control purposes. Initially the DEAP-based tubular actuator to be used in this study, produced by Danfoss PolyPower A/S, is introduced along with the static and dynamic characteristics. Secondly an electromechanical model of the tubular actuator is briefly reviewed and its ability to model the actuator's hysteresis characteristics for a range of periodic input signals at different frequencies demonstrated. The model will be used to provide hysteresis compensation in future vibration isolation studies. Experimental active vibration control using the actuator is then examined, specifically active vibration isolation of a 250 g mass subject to shaker generated 'ground vibration'. An adaptive feedforward control strategy is used to achieve this. The ability of the tubular actuator to reject both tonal and broadband random vibratory disturbances is then demonstrated.

  13. 大型客机发动机振动载荷传递特性研究%Exploring Wing-Mounted Engine Vibration Transmission for New Generation Airplanes with Turbofan Engines of High Bypass Ratio

    Institute of Scientific and Technical Information of China (English)

    陈熠; 贺尔铭; 扈西枝; 韩峰

    2012-01-01

    The use of turbofan engines of high bypass ratio has caused the low-frequency structure-borne noise. To investigate the medium and low frequency vibration transmission through wing structure to airframe, we introduce the double-beam dynamic model of a wing and build the "pylon-wing-airframe" dynamic half model of a full airplane, which takes into account the dynamics of an actual airplane. Sections 1 through 4 of the full paper explain the exploration mentioned in the title; their core consists of; ( 1) we use the vibration spectrum of the turbofan engines to calculate the vibration load of the airplane at each section of the airframe transmitted from wing to the air-frame , which provides the input data for estimating the noise level of the pressurized cabin; (2) through simulation , we identify the main path of engines' vibration transmission to the airframe; the simulation results, given in Figs. 6 and 7, and their analysis form, in our opinion, a useful preparation for pylon structure vibration reduction, engine vibration isolation mounting and the acoustic design inside the cabin.%高涵道比涡扇发动机的振动冲击频段向低频转移,使得飞机舱内噪声频率分布中的低频结构传递噪声变得更加突出.为了研究发动机振动载荷通过机翼向机身传递的中低频振动特性,文章针对真实客机的结构动力特性,创新地提出了机翼双梁动力学模型概念,建立了“吊架-机翼-机身”全机动力学有限元模型;基于发动机的振动载荷谱,分析了发动机振动通过机翼向机身结构传递的载荷特性,为后续舱内噪声预计提供了数据输入;并仿真辨识了发动机振动传递的主路径,为舱内声学设计及发动机隔振安装提供了基础数据.文中研究结果对我国大型客机的减振降噪设计工作有重要的工程参考价值.

  14. Detection of the high vibration origin in the body of an electrical generator driven by steam turbine applying diagnostic techniques; Deteccion del origen de alta vibracion en el cuerpo de un generador electrico accionado por turbinas de vapor aplicando tecnicas de diagnostico

    Energy Technology Data Exchange (ETDEWEB)

    Martinez Bravo, Fernando (Mexico)

    2007-11-15

    One of the problems that electric generators present is the high vibration due to causes that can go from simple mechanical unbalance, misalignment, mechanical relaxation, resonance or some other interaction that can influence in the system. In this document is presented the vibration analysis of an electric generator with a capacity of 350 MW, driven by a steam turbine composed of three stages (high pressure, intermediate pressure and low pressure) connected to the electric generator through a rigid connection. [Spanish] Uno de los problemas que se presentan en los generadores electricos es la alta vibracion debida a causas que pueden ir desde un simple desbalance mecanico, desalineamiento, aflojamiento mecanico, resonancia o alguna otra interaccion que pueda influir en el sistema. Se presenta en este documento el analisis de vibracion de un generador electrico con una capacidad de 350 MW, impulsado por una turbina de vapor compuesta de tres etapas (alta presion, presion intermedia y baja presion) acopladas al generador electrico a traves de un acoplamiento rigido.

  15. Nonlinear analysis on the coupling process of electromagnetic vibrator and earth

    Institute of Scientific and Technical Information of China (English)

    CHEN; Zubin; TENG; Jiwen; LIN; Jun; ZHANG; Linhang; JIANG

    2005-01-01

    The linear model based on the hydraulic pressure vibrator has been no longer adaptable to the electromagnetic vibrator. In order to realize the effective transmission of the limited energy from the vibrator to the ground, it is important to study the coupling model of the electromagnetic vibrator and the earth. In this paper, a nonlinear restore term was introduced to the coupling model because of the existence of a large amount of harmonics in the vibrator baseplate. The nonlinear vibration analysis was applied to the model by the multiscale method. In the course of energy transmission from the vibrator to the ground, ultraharmonic resonance was used to explain the generation of harmonics. An improved scheme was advanced to select the cross correlation reference signal in the vibrator seismic exploration. Good application results were obtained in field experiments.

  16. Researches Concerning to Minimize Vibrations when Processing Normal Lathe

    Directory of Open Access Journals (Sweden)

    Lenuța Cîndea

    2015-09-01

    Full Text Available In the cutting process, vibration is inevitable appearance, and in situations where the amplitude exceeds the limits of precision dimensional and shape of the surfaces generated vibrator phenomenon is detrimental.Field vibration is an issue of increasingly developed, so the futures will a better understanding of them and their use even in other sectors.The paper developed experimental measurement of vibrations at the lathe machining normal. The scheme described kinematical machine tool, cutting tool, cutting conditions, presenting experimental facility for measuring vibration occurring at turning. Experimental results have followed measurement of amplitude, which occurs during interior turning the knife without silencer incorporated. The tests were performed continuously for different speed, feed and depth of cut.

  17. Analysis of real-time vibration data

    Science.gov (United States)

    Safak, E.

    2005-01-01

    In recent years, a few structures have been instrumented to provide continuous vibration data in real time, recording not only large-amplitude motions generated by extreme loads, but also small-amplitude motions generated by ambient loads. The main objective in continuous recording is to track any changes in structural characteristics, and to detect damage after an extreme event, such as an earthquake or explosion. The Fourier-based spectral analysis methods have been the primary tool to analyze vibration data from structures. In general, such methods do not work well for real-time data, because real-time data are mainly composed of ambient vibrations with very low amplitudes and signal-to-noise ratios. The long duration, linearity, and the stationarity of ambient data, however, allow us to utilize statistical signal processing tools, which can compensate for the adverse effects of low amplitudes and high noise. The analysis of real-time data requires tools and techniques that can be applied in real-time; i.e., data are processed and analyzed while being acquired. This paper presents some of the basic tools and techniques for processing and analyzing real-time vibration data. The topics discussed include utilization of running time windows, tracking mean and mean-square values, filtering, system identification, and damage detection.

  18. Vibration control of ELTs

    Science.gov (United States)

    Pott, J.-U.

    2011-09-01

    MPIA is the PI institute of the MCAO-supported Fizeau imager LINC-NIRVANA at the LBT, and a partner of the E-ELT first light NIR imager MICADO (both SCAO and MCAO assisted). LINC-NIRVANA is a true pathfinder for future ELT-AO imagers both in terms of size and technology. I will present our vibration control strategies, involving accelerometer based real-time vibration measurements, feedforward and feedback optical path control, predictive filtering, vibration sensitive active control of actuators, and the development of a dynamical model of the entire telescope. Our experiences, made with LINC-NIRVANA, will be fed into the MICADO structural AO design to reach highest on-sky sensitivity.

  19. Optical frequency combs generated mechanically

    CERN Document Server

    Sumetsky, M

    2016-01-01

    It is shown that a highly equidistant optical frequency comb can be generated by the parametric excitation of an optical bottle microresonator with nanoscale effective radius variation by its natural mechanical vibrations.

  20. Vibrations and waves

    CERN Document Server

    Kaliski, S

    2013-01-01

    This book gives a comprehensive overview of wave phenomena in different media with interacting mechanical, electromagnetic and other fields. Equations describing wave propagation in linear and non-linear elastic media are followed by equations of rheological models, models with internal rotational degrees of freedom and non-local interactions. Equations for coupled fields: thermal, elastic, electromagnetic, piezoelectric, and magneto-spin with adequate boundary conditions are also included. Together with its companion volume Vibrations and Waves. Part A: Vibrations this work provides a wealth

  1. Vibrations and Stability

    DEFF Research Database (Denmark)

    Thomsen, Jon Juel

    dynamical phenomena that can be encountered in engineering and scientific practice. It progresses steadily from linear vibration theory over various levels of nonlinearity to bifurcation analysis, global dynamics and chaotic vibrations. It trains the student to analyze simple models, recognize nonlinear...... phenomena and work with advanced tools such as perturbation analysis and bifurcation analysis. Explaining theory in terms of relevant examples from real systems, this book is user-friendly and meets the increasing interest in non-linear dynamics in mechanical/structural engineering and applied mathematics...

  2. Vibrational spectroscopy of resveratrol

    Science.gov (United States)

    Billes, Ferenc; Mohammed-Ziegler, Ildikó; Mikosch, Hans; Tyihák, Ernő

    2007-11-01

    In this article the authors deal with the experimental and theoretical interpretation of the vibrational spectra of trans-resveratrol (3,5,4'-trihydroxy- trans-stilbene) of diverse beneficial biological activity. Infrared and Raman spectra of the compound were recorded; density functional calculations were carried out resulting in the optimized geometry and several properties of the molecule. Based on the calculated force constants, a normal coordinate analysis yielded the character of the vibrational modes and the assignment of the measured spectral bands.

  3. Vibration Propagation in Spider Webs

    Science.gov (United States)

    Hatton, Ross; Otto, Andrew; Elias, Damian

    Due to their poor eyesight, spiders rely on web vibrations for situational awareness. Web-borne vibrations are used to determine the location of prey, predators, and potential mates. The influence of web geometry and composition on web vibrations is important for understanding spider's behavior and ecology. Past studies on web vibrations have experimentally measured the frequency response of web geometries by removing threads from existing webs. The full influence of web structure and tension distribution on vibration transmission; however, has not been addressed in prior work. We have constructed physical artificial webs and computer models to better understand the effect of web structure on vibration transmission. These models provide insight into the propagation of vibrations through the webs, the frequency response of the bare web, and the influence of the spider's mass and stiffness on the vibration transmission patterns. Funded by NSF-1504428.

  4. Oscillation of the lung by chest-wall vibration.

    Science.gov (United States)

    Binks, A P; Bloch-Salisbury, E; Banzett, R B; Schwartzstein, R M

    2001-07-01

    Vibration of the thoracic surface has been shown to modify the drive to breathe and the sensation of dyspnea. It has been suggested that respiratory muscle afferents generate these effects. The possibility that the consequences of chest-wall vibration also involve intra-pulmonary afferents led us to investigate whether such vibration reaches the airways. Two vibratory stimuli were independently applied to four chest-wall sites and two control sites on eight healthy subjects. During separate breath holds, the vibrator was held on each site while subjects periodically opened and closed the pharynx. Airway pressure (P(AW)) was measured at the mouth. Spectral analysis of P(AW) showed pressure oscillations occurred at the same frequency as that of the vibrators when the pharynx was open; oscillation amplitude was vastly reduced when the pharynx was closed. Oscillation amplitude was also significantly larger during vibration at greater amplitude. These data demonstrate that vibration over the chest-wall vibrates the lung and could potentially excite intrapulmonary receptors.

  5. Active vibration control of piezoelectric bonded smart structures using PID algorithm

    Institute of Scientific and Technical Information of China (English)

    Zhang Shunqi; Ru¨diger Schmidt; Qin Xiansheng

    2015-01-01

    Thin-walled structures are sensitive to vibrate under even very small disturbances. In order to design a suitable controller for vibration suppression of thin-walled smart structures, an electro-mechanically coupled finite element (FE) model of smart structures is developed based on first-order shear deformation (FOSD) hypothesis. Considering the vibrations generated by various disturbances, which include free and forced vibrations, a PID control is implemented to damp both the free and forced vibrations. Additionally, an LQR optimal control is applied for comparison. The implemented control strategies are validated by a piezoelectric layered smart plate under var-ious excitations.

  6. Tool-specific performance of vibration-reducing gloves for attenuating palm-transmitted vibrations in three orthogonal directions.

    Science.gov (United States)

    Dong, Ren G; Welcome, Daniel E; Peterson, Donald R; Xu, Xueyan S; McDowell, Thomas W; Warren, Christopher; Asaki, Takafumi; Kudernatsch, Simon; Brammer, Antony

    2014-11-01

    Vibration-reducing (VR) gloves have been increasingly used to help reduce vibration exposure, but it remains unclear how effective these gloves are. The purpose of this study was to estimate tool-specific performances of VR gloves for reducing the vibrations transmitted to the palm of the hand in three orthogonal directions (3-D) in an attempt to assess glove effectiveness and aid in the appropriate selection of these gloves. Four typical VR gloves were considered in this study, two of which can be classified as anti-vibration (AV) gloves according to the current AV glove test standard. The average transmissibility spectrum of each glove in each direction was synthesized based on spectra measured in this study and other spectra collected from reported studies. More than seventy vibration spectra of various tools or machines were considered in the estimations, which were also measured in this study or collected from reported studies. The glove performance assessments were based on the percent reduction of frequency-weighted acceleration as is required in the current standard for assessing the risk of vibration exposures. The estimated tool-specific vibration reductions of the gloves indicate that the VR gloves could slightly reduce (<5%) or marginally amplify (<10%) the vibrations generated from low-frequency (<25 Hz) tools or those vibrating primarily along the axis of the tool handle. With other tools, the VR gloves could reduce palm-transmitted vibrations in the range of 5%-58%, primarily depending on the specific tool and its vibration spectra in the three directions. The two AV gloves were not more effective than the other gloves with some of the tools considered in this study. The implications of the results are discussed.

  7. Effects of Hand Vibration on Motor Output in Chronic Hemiparesis

    Directory of Open Access Journals (Sweden)

    Sibele de Andrade Melo

    2015-01-01

    Full Text Available Background. Muscle vibration has been shown to increase the corticospinal excitability assessed by transcranial magnetic stimulation (TMS and to change voluntary force production in healthy subjects. Objectives. To evaluate the effect of vibration on corticospinal excitability using TMS and on maximal motor output using maximal voluntary contraction (MVC in individuals with chronic hemiparesis. Methodology. Nineteen hemiparetic and 17 healthy control subjects participated in this study. Motor evoked potentials (MEPs and MVC during lateral pinch grip were recorded at first dorsal interosseous muscle in a single session before, during, and after one-minute trials of 80 Hz vibration of the thenar eminence. Results. In hemiparetic subjects, vibration increased MEP amplitudes to a level comparable to that of control subjects and triggered a MEP response in 4 of 7 patients who did not have a MEP at rest. Also, vibration increased the maximal rate of force production (dF/dtmax⁡ in both control and hemiparetic subjects but it did not increase MVC. Conclusion. Motor response generated with a descending cortical drive in chronic hemiparetic subjects can be increased during vibration. Vibration could be used when additional input is needed to reveal motor responses and to increase rate of force generation.

  8. Experimental Analysis of a Piezoelectric Energy Harvesting System for Harmonic, Random, and Sine on Random Vibration

    Energy Technology Data Exchange (ETDEWEB)

    Cryns, Jackson W.; Hatchell, Brian K.; Santiago-Rojas, Emiliano; Silvers, Kurt L.

    2013-07-01

    Formal journal article Experimental analysis of a piezoelectric energy harvesting system for harmonic, random, and sine on random vibration Abstract: Harvesting power with a piezoelectric vibration powered generator using a full-wave rectifier conditioning circuit is experimentally compared for varying sinusoidal, random and sine on random (SOR) input vibration scenarios. Additionally, the implications of source vibration characteristics on harvester design are discussed. Studies in vibration harvesting have yielded numerous alternatives for harvesting electrical energy from vibrations but piezoceramics arose as the most compact, energy dense means of energy transduction. The rise in popularity of harvesting energy from ambient vibrations has made piezoelectric generators commercially available. Much of the available literature focuses on maximizing harvested power through nonlinear processing circuits that require accurate knowledge of generator internal mechanical and electrical characteristics and idealization of the input vibration source, which cannot be assumed in general application. In this manuscript, variations in source vibration and load resistance are explored for a commercially available piezoelectric generator. We characterize the source vibration by its acceleration response for repeatability and transcription to general application. The results agree with numerical and theoretical predictions for in previous literature that load optimal resistance varies with transducer natural frequency and source type, and the findings demonstrate that significant gains are seen with lower tuned transducer natural frequencies for similar source amplitudes. Going beyond idealized steady state sinusoidal and simplified random vibration input, SOR testing allows for more accurate representation of real world ambient vibration. It is shown that characteristic interactions from more complex vibrational sources significantly alter power generation and power processing

  9. A Novel Ropes-DrivenWideband Piezoelectric Vibration Energy Harvester

    Directory of Open Access Journals (Sweden)

    Jinhui Zhang

    2016-12-01

    Full Text Available This paper presents a novel piezoelectric vibration energy harvester (PVEH in which a high-frequency generating beam (HFGB is driven by an array of low-frequency driving beams (LFDBs using ropes. Two mechanisms based on frequency upconversion and multimodal harvesting work together to broaden the frequency bandwidth of the proposed vibration energy harvester (VEH. The experimental results show that the output power of generating beam (GB remains unchanged with the increasing number of driving beams (DBs, compared with the traditional arrays of beams vibration energy harvester (AB-VEH, and the output power and bandwidth behavior can be adjusted by parameters such as acceleration, rope margin, and stiffness of LFDBs, which shows the potential to achieve unlimited wideband vibration energy-harvesting for a variable environment.

  10. General principles of vibrational spectroscopies

    NARCIS (Netherlands)

    Weckhuysen, B.M.; Schoonheydt, R.A.

    2000-01-01

    Atoms in molecules and solids do not remain in fixed relative positions, but vibrate about some mean position. This vibrational motion is quantized and at room temperature, most of the molecules in a given sample are in their lowest vibrational state. Absorption of electromagnetic radiation with

  11. Toral lateral line units of goldfish, Carassius auratus, are sensitive to the position and vibration direction of a vibrating sphere.

    Science.gov (United States)

    Meyer, Gunnar; Klein, Adrian; Mogdans, Joachim; Bleckmann, Horst

    2012-09-01

    We recorded the responses of lateral line units in the midbrain torus semicircularis of goldfish, Carassius auratus, to a 50-Hz vibrating sphere and determined the unit's spatial receptive fields for various distances between fish and sphere and for different directions of sphere vibration. All but one unit responded to the vibrating sphere with an increase in discharge rate. Only a proportion (25%) of the units exhibited phase-locked responses. Receptive fields were narrow or broad and contained one, two or more areas of increased discharge rate. The data show that the receptive fields of toral lateral line units are in many respects similar to those of brainstem units but differ from those of afferent nerve fibres. The responses of primary afferents represent the pressure gradient pattern generated by a vibrating sphere and provide information about sphere location and vibration direction. Across the array of lateral line neuromasts, the fish brain in principle can derive this information. Nevertheless, toral units tuned to a distinct sphere location or sensitive to a distinct sphere vibration direction were not found. Therefore, it is conceivable that the torus semicircularis uses a population code to determine spatial location and vibration direction of a vibrating sphere.

  12. Vibration characteristics of ultrasonic complex vibration for hole machining

    Science.gov (United States)

    Asami, Takuya; Miura, Hikaru

    2012-05-01

    Complex vibration sources that use diagonal slits as a longitudinal-torsional vibration converter have been applied to ultrasonic motors, ultrasonic rock drilling, and ultrasonic welding. However, there are few examples of the application of these sources to ultrasonic machining in combination with an abrasive. Accordingly, a new method has been developed for machining of holes in brittle materials by using the ultrasonic longitudinal and torsional vibration of a hollow-type stepped horn with a diagonal slit vibration converter. In this paper, we compared vibration of a uniform rod and a hollow-type stepped horn, both with diagonal slits, when the conditions of the diagonal slits are constant.

  13. Vibration Sensitive Keystroke Analysis

    NARCIS (Netherlands)

    Lopatka, M.; Peetz, M.-H.; van Erp, M.; Stehouwer, H.; van Zaanen, M.

    2009-01-01

    We present a novel method for performing non-invasive biometric analysis on habitual keystroke patterns using a vibration-based feature space. With the increasing availability of 3-D accelerometer chips in laptop computers, conventional methods using time vectors may be augmented using a distinct fe

  14. Development of vibrating insoles

    NARCIS (Netherlands)

    Hijmans, J.M.; Geertzen, J.H.B.; Schokker, B.; Postema, K.

    2007-01-01

    The objective of this study was to describe the development of vibrating insoles. Insoles, providing a subsensory mechanical noise signal to the plantar side of the feet, may improve balance in healthy young and older people and in patients with stroke or diabetic neuropathy. This study describes th

  15. Simulation of Satellite Vibration Test

    Science.gov (United States)

    Bettacchioli, Alain

    2014-06-01

    During every mechanical qualification test of satellites on vibrator, we systematically notice beating phenomena that appear every time we cross a mode's frequency. There could lead to an over-qualification of the tested specimen when the beating reaches a maximum and a under-qualification when the beating passes by a minimum. On a satellite, three lateral modes raise such a problem in a recurring way: the first structure mode (between 10 and 15 hertz) and the two tanks modes (between 35 and 50 hertz).To step forward in the resolution of this problem, we are developing a simulator which is based on the identification of the responses of the accelerometers that are fixed on the satellite and on the shaker slip table. The estimated transfer functions then allow to reconstruct at once the sensors response and the drive which generated them.For the simulation, we do not select all the sensors but only those on the slip table and those used to limit the input level (notching). We may also add those which were close to generate a notching.To perform its calculations, the simulator reproduces on one hand the unity amplitude signal (cola) which serves as frequency reference for the sweep achievement (generally 3 octaves per minute from 5 to 100 and even 150 Hertz), and on the other hand, the vibrator control loop. The drive amplitude is calculated at each cola's period by taking into account a compression factor. The control applied through the amplifier to the shaker coil is the product of this amplitude by the cola. The simulated measurements are updated at each sampling period thanks to the propagation of the identified model. The superposition of these curves on those supplied by real sensors during the tests allows to validate the simulation.Thereby, it seems possible to actively control the beatings thanks to a real-time corrector which uses these identifications.

  16. Accuracy of electromagnetic tracking with a prototype field generator in an interventional OR setting

    Energy Technology Data Exchange (ETDEWEB)

    Boe, Lars Eirik; Leira, Haakon Olav; Tangen, Geir Arne; Hofstad, Erlend Fagertun; Amundsen, Tore; Langoe, Thomas [Department of Medical Technology, SINTEF Technology and Society, Trondheim (Norway) and Department of Circulation and Medical Imaging, Faculty of Medicine, Norwegian University of Science and Technology (NTNU), Trondheim (Norway); Department of Circulation and Medical Imaging, Faculty of Medicine, Norwegian University of Science and Technology (NTNU), Trondheim (Norway) and Department of Thoracic Medicine, St. Olavs Hospital, Trondheim (Norway); Department of Medical Technology, SINTEF Technology and Society, Trondheim (Norway); Department of Circulation and Medical Imaging, Faculty of Medicine, Norwegian University of Science and Technology (NTNU), Trondheim (Norway) and Department of Thoracic Medicine, St. Olavs Hospital, Trondheim (Norway); Department of Medical Technology, SINTEF Technology and Society, Trondheim (Norway)

    2012-01-15

    Purpose: The authors have studied the accuracy and robustness of a prototype electromagnetic window field generator (WFG) in an interventional radiology suite with a robotic C-arm. The overall purpose is the development of guidance systems combining real-time imaging with tracking of flexible instruments for bronchoscopy, laparoscopic ultrasound, endoluminal surgery, endovascular therapy, and spinal surgery. Methods: The WFG has a torus shape, which facilitates x-ray imaging through its centre. The authors compared the performance of the WFG to that of a standard field generator (SFG) under the influence of the C-arm. Both accuracy and robustness measurements were performed with the C-arm in different positions and poses. Results: The system was deemed robust for both field generators, but the accuracy was notably influenced as the C-arm was moved into the electromagnetic field. The SFG provided a smaller root-mean-square position error but was more influenced by the C-arm than the WFG. The WFG also produced smaller maximum and variance of the error. Conclusions: Electromagnetic (EM) tracking with the new WFG during C-arm based fluoroscopy guidance seems to be a step forward, and with a correction scheme implemented it should be feasible.

  17. Generation and tunable enhancement of a sum-frequency signal in lithium niobate nanowires

    Science.gov (United States)

    Sergeyev, Anton; Reig Escalé, Marc; Grange, Rachel

    2017-02-01

    Recent developments in the fabrication of lithium niobate (LiNbO3) structures down to the nanoscale opens up novel applications of this versatile material in nonlinear optics. Current nonlinear optical studies in sub-micron waveguides are mainly restricted to the generation of second and third harmonics. In this work, we demonstrate the generation and waveguiding of the sum-frequency generation (SFG) signal in a single LiNbO3 nanowire with a cross-section of 517 nm  ×  654 nm. Furthermore, we enhance the guided SFG signal 17.9 times by means of modal phase matching. We also display tuning of the phase-matched wavelength by varying the nanowire cross-section and changing the polarization of the incident laser. The results prove that LiNbO3 nanowires can be successfully used for nonlinear wave-mixing applications and assisting the miniaturization of optical devices. , which features invited work from the best early-career researchers working within the scope of J Phys D. This project is part of the Journal of Physics series’ 50th anniversary celebrations in 2017. Rachel Grange was selected by the Editorial Board of J Phys D as an Emerging Leader.

  18. Structural Integrity Monitoring by Vibration Measurements

    OpenAIRE

    Yan, Ai-Min; De Boe, Pascal; Golinval, Jean-Claude

    2003-01-01

    This paper presents a comparative study on several approaches of structural dam-age diagnosis based on vibration meas-urements. Stochastic subspace identifica-tion method is used to identify modal pa-rameters and to generate a Kalman predic-tion model, which are taken as damage-sensitive features for structural damage detection. A statistical process control technique based on principal component analysis (PCA) is also presented. An im-provement and enhancement of PCA is proposed. It is assum...

  19. Active control of flexural vibrations in beams

    Science.gov (United States)

    Gerhold, Carl H.; Rocha, Rodney

    1989-01-01

    An analytical model of the feedback control system which estimates the voltage generated by the piezoelectric sensor as a function of the dynamic stress at the sensor location and the force exerted by the driver piezoelectric as a function of signal gain is developed. The analytical results are compared to measured results for a cantilever beam excited to vibrate in its first natural mode. The estimated increase in the first mode damping factor is in good agreement with the measured results.

  20. Vibration and acoustic testing of spacecraft

    Science.gov (United States)

    Scharton, T. D.

    2002-01-01

    Spacecraft are subjected to a variety of dynamics environments, which may include: quasi-static, vibration and acoustic loads at launch: pyrotechnic shocks generated by separation mechanisms; on orbit jitter; and sometimes, planetary landing loads. There is a trend in the aerospace industry to rely more on structural analyses and less on testing to simulate these environments, because dynamics testing of spacecraft is time consuming, risky and expensive.

  1. The effects of vibration-reducing gloves on finger vibration.

    Science.gov (United States)

    Welcome, Daniel E; Dong, Ren G; Xu, Xueyan S; Warren, Christopher; McDowell, Thomas W

    2014-01-01

    Vibration-reducing (VR) gloves have been used to reduce the hand-transmitted vibration exposures from machines and powered hand tools but their effectiveness remains unclear, especially for finger protection. The objectives of this study are to determine whether VR gloves can attenuate the vibration transmitted to the fingers and to enhance the understanding of the mechanisms of how these gloves work. Seven adult male subjects participated in the experiment. The fixed factors evaluated include hand force (four levels), glove condition (gel-filled, air bladder, no gloves), and location of the finger vibration measurement. A 3-D laser vibrometer was used to measure the vibrations on the fingers with and without wearing a glove on a 3-D hand-arm vibration test system. This study finds that the effect of VR gloves on the finger vibration depends on not only the gloves but also their influence on the distribution of the finger contact stiffness and the grip effort. As a result, the gloves increase the vibration in the fingertip area but marginally reduce the vibration in the proximal area at some frequencies below 100 Hz. On average, the gloves reduce the vibration of the entire fingers by less than 3% at frequencies below 80 Hz but increase at frequencies from 80 to 400 Hz. At higher frequencies, the gel-filled glove is more effective at reducing the finger vibration than the air bladder-filled glove. The implications of these findings are discussed.

  2. Reduction in ground vibrations by the use of wave obstacles

    OpenAIRE

    Persson, Peter

    2013-01-01

    The increasing size of the population results in that unbuilt spaces needing to be used for the construction of new facilities. Large construction sites can generate disturbing vibrations to nearby buildings, both while construction is underway and afterwards through the operation of subways, for example. The establishment of new areas close to, for example, motorways and railways increases the risk of disturbing vibrations being propagated to the new buildings. It is important that efficient...

  3. Influence of Cable Vibrations on Connectors Used in Automotive Applications

    OpenAIRE

    AMEL Bouzera; ROCHDI El Abdi; ERWANN Carvou; NOUREDDINE Benjemâa; LAURENT Tristani; EL MOSTAFA Zindine

    2012-01-01

    In order to determine the influence of cable vibrations on the contact resistance of connectors, the cable resonant frequency and the resulting movement of both parts of the connector have been studied. The increase of contact voltage, followed by rapidfluctuations generated by wear particles, has been analysed. A test bench designed to monitor wire vibrations was used while the transferred amplitude was measured by a high sensitivity displacement sensor. The contact interface was made of cop...

  4. Active vibration control of structures undergoing bending vibrations

    Science.gov (United States)

    Pla, Frederic G. (Inventor); Rajiyah, Harindra (Inventor)

    1995-01-01

    An active vibration control subassembly for a structure (such as a jet engine duct or a washing machine panel) undergoing bending vibrations caused by a source (such as the clothes agitator of the washing machine) independent of the subassembly. A piezoceramic actuator plate is vibratable by an applied electric AC signal. The plate is connected to the structure such that vibrations in the plate induced by the AC signal cause canceling bending vibrations in the structure and such that the plate is compressively pre-stressed along the structure when the structure is free of any bending vibrations. The compressive prestressing increases the amplitude of the canceling bending vibrations before the critical tensile stress level of the plate is reached. Preferably, a positive electric DC bias is also applied to the plate in its poling direction.

  5. Wireless Inductive Power Device Suppresses Blade Vibrations

    Science.gov (United States)

    Morrison, Carlos R.; Provenza, Andrew J.; Choi, Benjamin B.; Bakhle, Milind A.; Min, James B.; Stefko, George L.; Duffy, Kirsten P.; Fougers, Alan J.

    2011-01-01

    Vibration in turbomachinery can cause blade failures and leads to the use of heavier, thicker blades that result in lower aerodynamic efficiency and increased noise. Metal and/or composite fatigue in the blades of jet engines has resulted in blade destruction and loss of lives. Techniques for suppressing low-frequency blade vibration, such as gtuned circuit resistive dissipation of vibratory energy, h or simply "passive damping," can require electronics incorporating coils of unwieldy dimensions and adding unwanted weight to the rotor. Other approaches, using vibration-dampening devices or damping material, could add undesirable weight to the blades or hub, making them less efficient. A wireless inductive power device (WIPD) was designed, fabricated, and developed for use in the NASA Glenn's "Dynamic Spin Rig" (DSR) facility. The DSR is used to simulate the functionality of turbomachinery. The relatively small and lightweight device [10 lb (approx.=4.5 kg)] replaces the existing venerable and bulky slip-ring. The goal is the eventual integration of this technology into actual turbomachinery such as jet engines or electric power generators, wherein the device will facilitate the suppression of potentially destructive vibrations in fan blades. This technology obviates slip rings, which require cooling and can prove unreliable or be problematic over time. The WIPD consists of two parts: a remote element, which is positioned on the rotor and provides up to 100 W of electrical power to thin, lightweight piezoelectric patches strategically placed on/in fan blades; and a stationary base unit that wirelessly communicates with the remote unit. The base unit supplies inductive power, and also acts as an input and output corridor for wireless measurement, and active control command to the remote unit. Efficient engine operation necessitates minimal disturbance to the gas flow across the turbine blades in any effort to moderate blade vibration. This innovation makes it

  6. Vibrations of tube arrays in transversal flow

    Energy Technology Data Exchange (ETDEWEB)

    Gibert, R.J.; Villard, B. (C.E.N. Saclay, Gif-sur-Yvette (France)); Chabrerie, J. (Ste Fives-Cail-Babcok, La Courneuve, (France)); Sagner, V. (Ste Bertin, Plaisir (France))

    1981-01-01

    The vibrations induced in tube arrays by a transversal flow are of great practical interest because of their destructive effects especially on heat exchangers. Though turbulence can significantly excite the tubes by itself, most intense vibrations are still caused by two fluid-elastic phenomena: - The << lock-in >> effect: The basic phenomenon consists of a generation and a synchronization of vortex shedding by a transversal tube motion when its frequency approaches the shedding frequency and when its level is large enough. The so modified vortex shedding generates much more intense vibrations. The lock-in effects is well known for a single cylinder. Less results have been obtained for bundles. - The whirling instability: In a tube row or a bundle, quasi-steady forces are generated by the displacements of the tubes in the flow field. Adjacent tubes are disymmetrically coupled by these forces and instability can appear beyond a critical flow velocity. For the tube rows H.J. Connors has shown that the phenomena are characterized by a coefficient c (which is a function of the pitch).

  7. Low-energy electron attachment and detachment in vibrationally excited oxygen

    Science.gov (United States)

    Aleksandrov, N. L.; Anokhin, E. M.

    2009-11-01

    Three-body electron attachment to O2 molecules and electron detachment from O_{2}^{-} ions have been theoretically studied in vibrationally excited oxygen and O2-containing mixtures. Assuming that electron attachment and detachment proceed via the formation of vibrationally excited temporary O_{2}^{-} ions, the rates of these processes were determined on the basis of the statistical approach for the vibrational transfer and relaxation in collisions between O_{2}^{-} ions and O2 molecules. The calculated attachment and detachment rate constants turned out to agree well with available measurements in unexcited oxygen. This method was extended to calculate attachment and detachment rates in vibrationally excited oxygen. It was shown that the effect of vibrational excitation on electron detachment is profound, whereas attachment of low-energy electrons to vibrationally excited O2 is inefficient. The calculated vibrational distribution of stable O_{2}^{-} ions turned out to be non-equilibrium in an excited gas and the effective vibrational temperature of the ions was much lower than the vibrational temperature of molecules. An analytical method was suggested to determine this distribution and the effective vibrational temperature. The calculated rate constants were used to simulate the formation and decay of an electron-beam-generated plasma in N2 : O2 mixtures at elevated vibrational temperatures. The calculations showed that vibrational excitation of molecules leads to orders of magnitude increase in the plasma density and in the plasma lifetime, in agreement with available observations.

  8. Improved Active Vibration Isolation Systems

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The control force, feedback gain, and actuator stroke of several active vibration isolation systems were analyzed based on a single-layer active vibration isolation system. The analysis shows that the feedback gain and actuator stroke cannot be selected independently and the active isolation system design must make a compromise between the feedback gain and actuator stroke. The performance of active isolation systems can be improved by the joint vibration reduction using an active vibration isolation system with an adaptive dynamic vibration absorber. The results show that the joint vibration reduction method can successfully avoid the compromise between the feedback gain and actuator stroke. The control force and the object vibration amplitude are also greatly reduced.

  9. Animal Communications Through Seismic Vibrations

    Energy Technology Data Exchange (ETDEWEB)

    Hill, Peggy (University of Tulsa)

    2001-05-02

    Substrate vibration has been important to animals as a channel of communication for millions of years, but our literature on vibration in this context of biologically relevant information is only decades old. The jaw mechanism of the earliest land vertebrates allowed them to perceive substrate vibrations as their heads lay on the ground long before airborne sounds could be heard. Although the exact mechanism of vibration production and the precise nature of the wave produced are not always understood, recent development of affordable instrumentation to detect and measure vibrations has allowed researchers to answer increasingly sophisticated questions about how animals send and receive vibration signals. We now know that vibration provides information used in predator defense, prey detection, recruitment to food, mate choice, intrasexual competition, and maternal/brood social interactions in a variety of insect orders, spiders, crabs, scorpions, chameleons, frogs, golden moles, mole rats, kangaroos rats, wallabies, elephants and bison.

  10. Maladie des vibrations

    Science.gov (United States)

    Shen, Shixin (Cindy); House, Ronald A.

    2017-01-01

    Résumé Objectif Permettre aux médecins de famille de comprendre l’épidémiologie, la pathogenèse, les symptômes, le diagnostic et la prise en charge de la maladie des vibrations, une maladie professionnelle importante et courante au Canada. Sources d’information Une recherche a été effectuée sur MEDLINE afin de relever les recherches et comptes rendus portant sur la maladie des vibrations. Une recherche a été effectuée sur Google dans le but d’obtenir la littérature grise qui convient au contexte canadien. D’autres références ont été tirées des articles relevés. Message principal La maladie des vibrations est une maladie professionnelle répandue touchant les travailleurs de diverses industries qui utilisent des outils vibrants. La maladie est cependant sous-diagnostiquée au Canada. Elle compte 3 éléments : vasculaire, sous la forme d’un phénomène de Raynaud secondaire; neurosensoriel; et musculosquelettique. Aux stades les plus avancés, la maladie des vibrations entraîne une invalidité importante et une piètre qualité de vie. Son diagnostic exige une anamnèse minutieuse, en particulier des antécédents professionnels, un examen physique, des analyses de laboratoire afin d’éliminer les autres diagnostics, et la recommandation en médecine du travail aux fins d’investigations plus poussées. La prise en charge consiste à réduire l’exposition aux vibrations, éviter les températures froides, abandonner le tabac et administrer des médicaments. Conclusion Pour assurer un diagnostic rapide de la maladie des vibrations et améliorer le pronostic et la qualité de vie, les médecins de famille devraient connaître cette maladie professionnelle courante, et pouvoir obtenir les détails pertinents durant l’anamnèse, recommander les patients aux cliniques de médecine du travail et débuter les demandes d’indemnisation de manière appropriée. PMID:28292812

  11. Hydroelastic Vibrations of Ships

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher; Folsø, Rasmus

    2002-01-01

    A formula for the necessary hull girder bending stiffness required to avoid serious springing vibrations is derived. The expression takes into account the zero crossing period of the waves, the ship speed and main dimensions. For whipping vibrations the probability of exceedance for the combined...... wave- and whipping induced bending moment is derived under the assumption that the maximum peak value in a whipping sequence occurs simultaneously with a peak in sagging wave-induced bending moment, but that the magnitudes of these two peaks are statistically independent. The expression can be written...... as the usual Rayleigh distribution for the wave response multiplied by a factor independent of the significant wave height. Finally, the springing and whipping predictions are compared with model test results....

  12. Laser induced structural vibration

    Science.gov (United States)

    Koss, L. L.; Tobin, R. C.

    1983-01-01

    A technique is described for exciting structural vibration by using a focussed laser beam to vaporize material from a target attached to the structure. The rapid ejection of material results in an impulsive reaction to the target which is transmitted to the structure. The method has been studied with a Nd: glass laser, operated in the long pulse mode, in combination with a bismuth target attached in turn to a ballistic pendulum and cantilever beam. The specific mechanical energy was found to be proportional to the laser pulse energy raised to a power in the range 2.5-2.9. The highest efficiency of energy transfer achieved for the first vibrational mode of the cantilever was about 2 millipercent for the maximum laser pulse energy used, 1.5 J, the signal to noise ratio then being about 40 dB.

  13. Vibration-induced droplet atomization

    Science.gov (United States)

    Vukasinovic, Bojan

    The atomization of liquid drops is investigated experimentally using laser vibrometry, high-speed imaging, and particle tracking techniques. The spray is generated by a novel vibration-induced droplet atomization (VIDA) process in which a sessile drop is atomized by an underlying vibrating thin metal diaphragm, resulting in rapid ejection of small secondary droplets from the free surface of the primary drop. Under some conditions, the primary drop can be atomized extremely rapidly by a bursting-like mechanism (e.g., a 0.1 ml water drop can be atomized in 0.4 seconds). The present research has focused on four major areas: global characteristics of VIDA process, instability modes and free surface dynamics of the forced drop, mechanisms of the interface breakup, and parametric characterization of the ensuing spray. Prior to atomization, the drop free surface undergoes three transitions: from axisymmetric standing waves to azimuthal waves, to a newly-observed lattice mode, and to a disordered pre-ejection state. The droplet ejection results from localized collapse of surface troughs and initiation and ultimate breakup of momentary liquid spikes. Breakup begins with capillary pinch-off from spike tips and can be followed by additional pinching of liquid droplets. For a relatively low-viscosity liquid, e.g., water, a capillary-wave instability of the spike is observed in some cases, while for a very viscous liquid, e.g., a glycerin/water solution, the first breakup occurs near the stem of the spike, with or without subsequent breakup of the detached, elongated thread. Different mechanisms dominating the primary breakup of the spike are operative in the low- and high-viscosity ejection regimes. When ejection of the secondary droplets is triggered, the evolution and rate of atomization depend on the coupled dynamics of the primary drop and the vibrating diaphragm. Due to these dynamics, the process can be either self-intensifying or self-decaying. The resulting VIDA spray

  14. Vibrational stability of graphene

    Directory of Open Access Journals (Sweden)

    Yangfan Hu

    2013-05-01

    Full Text Available The mechanical stability of graphene as temperature rises is analyzed based on three different self-consistent phonon (SCP models. Compared with three-dimensional (3-D materials, the critical temperature Ti at which instability occurs for graphene is much closer to its melting temperature Tm obtained from Monte Carlo simulation (Ti ≃ 2Tm, K. V. Zakharchenko, A. Fasolino, J. H. Los, and M. I. Katsnelson, J. Phys. Condens. Matter 23, 202202. This suggests that thermal vibration plays a significant role in melting of graphene while melting for 3-D materials is often dominated by topologic defects. This peculiar property of graphene derives from its high structural anisotropy, which is characterized by the vibrational anisotropic coefficient (VAC, defined upon its Lindermann ratios in different directions. For any carbon based material with a graphene-like structure, the VAC value must be smaller than 5.4 to maintain its stability. It is also found that the high VAC value of graphene is responsible for its negative thermal expansion coefficient at low temperature range. We believe that the VAC can be regarded as a new criterion concerning the vibrational stability of any low-dimensional (low-D materials.

  15. A novel wireless and temperature-compensated SAW vibration sensor.

    Science.gov (United States)

    Wang, Wen; Xue, Xufeng; Huang, Yangqing; Liu, Xinlu

    2014-11-03

    A novel wireless and passive surface acoustic wave (SAW) based temperature-compensated vibration sensor utilizing a flexible Y-cut quartz cantilever beam with a relatively substantial proof mass and two one-port resonators is developed. One resonator acts as the sensing device adjacent to the clamped end for maximum strain sensitivity, and the other one is used as the reference located on clamped end for temperature compensation for vibration sensor through the differential approach. Vibration directed to the proof mass flex the cantilever, inducing relative changes in the acoustic propagation characteristics of the SAW travelling along the sensing device, and generated output signal varies in frequency as a function of vibration.  A theoretical mode using the Rayleigh method was established to determine the optimal dimensions of the cantilever beam. Coupling of Modes (COM) model was used to extract the optimal design parameters of the SAW devices prior to fabrication. The performance of the developed SAW sensor attached to an antenna towards applied vibration was evaluated wirelessly by using the precise vibration table, programmable incubator chamber, and reader unit.  High vibration sensitivity of ~10.4 kHz/g, good temperature stability, and excellent linearity were observed in the wireless measurements.

  16. Remote identification of the vibration amplitude of ship hull

    Directory of Open Access Journals (Sweden)

    A. N. Pinchuk

    2014-01-01

    Full Text Available The aim is to develop the methodological support to determine vibration amplitude of the ship hull remotely using a coherent radar centimeter range based on the variation of the Doppler signal spectrum reflected from a vibrating surface.The paper presents a synthesized mathematical model of the radio signal reflected from the vibrating surface. It is the signal of coherent radar of continuous radiation with a known carrier frequency and the amplitude of the radiated signal. In the synthesis it was believed that the displacement in the radial direction with respect to the vibrating surface radar was sinusoidal.The dependences of the vibration amplitude on the value of the normalized Doppler radio signal spectrum at the second harmonic frequency are obtained. Cycle results of field experiments to study the variability of the sea surface, determining the level of its roughness, allows us to establish that the energy of surface waves of gravitational-capillary range has a high correlation with the wind speed. It is proved that the ratio of the spectral density levels at vibration frequency and its multiple frequencies is specified by the index of phase modulation linearly related to the amplitude of vibration of the ship hull.The results are significant for radar (radar detection of water targets using the coherent radar of centimeter range, ensuring the correct records of noise generated by the scattering of radio waves from the water surface.

  17. A Novel Wireless and Temperature-Compensated SAW Vibration Sensor

    Directory of Open Access Journals (Sweden)

    Wen Wang

    2014-11-01

    Full Text Available A novel wireless and passive surface acoustic wave (SAW based temperature-compensated vibration sensor utilizing a flexible Y-cut quartz cantilever beam with a relatively substantial proof mass and two one-port resonators is developed. One resonator acts as the sensing device adjacent to the clamped end for maximum strain sensitivity, and the other one is used as the reference located on clamped end for temperature compensation for vibration sensor through the differential approach. Vibration directed to the proof mass flex the cantilever, inducing relative changes in the acoustic propagation characteristics of the SAW travelling along the sensing device, and generated output signal varies in frequency as a function of vibration.  A theoretical mode using the Rayleigh method was established to determine the optimal dimensions of the cantilever beam. Coupling of Modes (COM model was used to extract the optimal design parameters of the SAW devices prior to fabrication. The performance of the developed SAW sensor attached to an antenna towards applied vibration was evaluated wirelessly by using the precise vibration table, programmable incubator chamber, and reader unit.  High vibration sensitivity of ~10.4 kHz/g, good temperature stability, and excellent linearity were observed in the wireless measurements.

  18. Control of noise and structural vibration a MATLAB-based approach

    CERN Document Server

    Mao, Qibo

    2013-01-01

    Control of Noise and Structural Vibration presents a MATLAB®-based approach to solving the problems of undesirable noise generation and transmission by structures and of undesirable vibration within structures in response to environmental or operational forces. The fundamentals of acoustics, vibration and coupling between vibrating structures and the sound fields they generate are introduced including a discussion of the finite element method for vibration analysis. Following this, the treatment of sound and vibration control begins, illustrated by example systems such as beams, plates and double plate structures. Sensor and actuator placement is explained as is the idea of modal sensor–actuators. The design of appropriate feedback systems includes consideration of basic stability criteria and robust active structural acoustic control. Single and multi-mode positive position feedback (PPF) control systems are also described in the context of loudspeaker–duct model with non-collocated loudspeaker–microp...

  19. Reference Excitation Unit for Micro-Vibration Test Facilities

    Science.gov (United States)

    Veal, Dan; Hughes, Ben; Wagner, Mark

    2012-07-01

    The verification of hardware, in particular with respect to micro-vibration requirements, is challenging for both numerical simulation and experimental methodology. A commonly used test approach is to measure the interface reaction forces, torques, accelerations, velocities or displacements in all six degrees of freedom generated by the unit under test. In Europe, several test facilities exist to measure these generated micro-vibration forces based on dynamometer, pendulum and reverse pendulum principles. All these facilities and test setups need to be validated and calibrated with traceability to recognized international standards to ensure validity of the measurement results. Ideally, inter-facility comparisons would be conducted with identical excitation input signals and identical boundary conditions to increase confidence in the validity of the measurement produced by different facilities. To facilitate this requirement, the National Physical Laboratory (NPL) - the UK’s national measurement institute, is developing a reference vibration excitation unit that will be capable of generating vibrations, linear or angular, of known amplitude and direction traceable to international standards. This activity is funded by the European Space Agency (ESA) in the frame of a Technology Research Study. This paper covers the design of the unit and how the vibrations generated will be traceable to international standards.

  20. Natural vibration dynamics of Rainbow Bridge, Utah

    Science.gov (United States)

    Moore, J. R.; Thorne, M. S.; Wood, J. R.; Doyle, S.; Stanfield, E.; White, B.

    2015-12-01

    We measured resonant frequencies of Rainbow Bridge, Utah, one of the world's longest rock spans, during a field experiment recording ambient vibration data. Measurements were generated over 20 hours on March 23-24, 2015 using two broadband three-component seismometers placed on the bridge, and compared to concurrent data from nearby reference stations 20 and 220 m distant. We identified seven distinct modes of vibration for Rainbow Bridge between 1 and 6 Hz. Data for each resonant frequency was then analyzed to determine the frequency-dependent polarization vector in an attempt to clarify mode shapes; e.g. the fundamental mode represents out-of-plane horizontal flexure. We compared experimental data to results of 3D numerical modal analysis, using a new photogrammetric model of Rainbow Bridge generated in this study imported into COMSOL Multiphysics. Results compare well with measured data for seven of the first eight modeled modes, matching vibrational frequencies and polarization orientations generally within 10%. Only predicted mode 6 was not explicitly apparent in our experimental data. Large site-to-reference spectral ratios resolved from experimental data indicate high amplification on the bridge as compared to nearby bedrock.

  1. Flow-Induced Vibration of Circular Cylindrical Structures

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Shoei-Sheng [Argonne National Lab. (ANL), Argonne, IL (United States). Components Technology Division

    1985-06-01

    Flow-induced vibration is a term to denote those phenomena associated with the response of structures placed in or conveying fluid flow. More specifically, the terra covers those cases in which an interaction develops between fluid-dynamic forces and the inertia, damping or elastic forces in the structures. The study of these phenomena draws on three disciplines: (1) structural mechanics, (2) mechanical vibration, and (3) fluid dynamics. The vibration of circular cylinders subject to flow has been known to man since ancient times; the vibration of a wire at its natural frequency in response to vortex shedding was known in ancient Greece as aeolian tones. But systematic studies of the problem were not made until a century ago when Strouhal established the relationship between vortex shedding frequency and flow velocity for a given cylinder diameter. The early research in this area has beer summarized by Zdravkovich (1985) and Goldstein (1965). Flow-induced structural vibration has been experienced in numerous fields, including the aerospace industry, power generation/transmission (turbine blades, heat exchanger tubes, nuclear reactor components), civil engineering (bridges, building, smoke stacks), and undersea technology. The problems have usually been encountered or created accidentally through improper design. In most cases, a structural or mechanical component, designed to meet specific objectives, develops problems when the undesired effects of flow field have not been accounted for in the design. When a flow-induced vibration problem is noted in the design stage, the engineer has different options to eliminate the detrimental vibration. Unfortunately, in many situations, the problems occur after the components are already in operation; the "fix" usually is very costly. Flow-induced vibration comprises complex and diverse phenomena; subcritical vibration of nuclear fuel assemblies, galloping of transmission lines, flutter of pipes conveying fluid, and whirling

  2. Contribution à la compensation active des vibrations des machines électriques

    OpenAIRE

    Granjon, Pierre

    2000-01-01

    This work is devoted to elaborate an active control system of rotating machine vibrations. It is based on additional currents supplying the stator coils of the machine. They generate radial forces on the stator frame,and finally create additional vibrations which interact with the machine ones. Therefore, the aim of this system is to process the optimal value of the input currents, in order to minimize the vibration signals power measured on the stator frame by several accelerometers.First, t...

  3. Synthesis of Vibration Waves Based on Wavelet Technology

    Directory of Open Access Journals (Sweden)

    L.H. Zou

    2012-01-01

    Full Text Available A novel method to generate time series of vibration waves is proposed in the paper. Considering the frequency band energy as the criterion, synthesis formulas for fluctuating wind pressure and earthquake ground motion are developed in terms of Daubechies wavelet and Harr wavelet respectively. The wavelet reconstruction method is applicable to both stationary and non-stationary process simulation. Theoretically, for non-stationary (such as seismic process synthesis, it has a better non-stationarity in time-frequency domain than the traditional trigonometric series. Influence of wavelet delamination number and wavelet function type is also analyzed. Numerical results show that the synthesis of vibration waves based on wavelet reconstruction method contains main components of vibration, and can reflect the main properties of practical vibrations.

  4. Trial Study of Vibration-Induced Effects on Spontaneous Potential

    Institute of Scientific and Technical Information of China (English)

    SunWeibin; QiuWeiting; HeZhanxiang

    2003-01-01

    Vibratory excitation generates not only reflections and refractions of wave fields on the subsurface interfaces but also electromagnetic waves with different frequencies. In this paper we address the vibration-induced effects on the spontaneous potential field. The effects of controllable vibration on the spontaneous potential field were studied under real field geologic conditions. Experimental data confirmed that the vibration-induced effects on the spontaneous potential field do exist under field conditions. Monitoring records over a long time interval showed that there existed three information zones in the vibration-induced effects on spontaneous potential field:These are the signal-variant zone, the extreme-stable zone and the relaxation-recovery zone. Combined with different well-site data, it was concluded that the time-variant features of the anomalies in the information zones was closely related to the properties of the subsurface liquid (oil and water).

  5. Vortex induced vibrations of pipe in high waves. Field measurements

    Energy Technology Data Exchange (ETDEWEB)

    Hansen Ottesen, N.-E.; Pedersen, B.

    1999-07-01

    Vortex induced vibrations have been measured full scale on an instrumented pipe placed vertically in the crest zone of high and steep waves. The Reynolds numbers were in the range 105 to 106. It was found that the vortex induced vibrations in the wave motion were generated within a reduced velocity range of 4 and 8. The vibrations grew intermittently with the passing waves. The vibrations took place in 2-3 modes simultaneously. One mode, however, dominated over the other. The growths of the VIV using a modal analysis were consistent with a basic correlation length of 3 diameters for a stationary pipe with a linear growth of the correlation length of 10 diameter for each 0.1 diameter amplitude. (au)

  6. The CFVib Experiment: Control of Fluids in Microgravity with Vibrations

    Science.gov (United States)

    Fernandez, J.; Sánchez, P. Salgado; Tinao, I.; Porter, J.; Ezquerro, J. M.

    2017-08-01

    The Control of Fluids in Microgravity with Vibrations (CFVib) experiment was selected for the 2016 Fly Your Thesis! programme as part of the 65th ESA Parabolic Flight Campaign. The aim of the project is to observe the potentially complex behaviour of vibrated liquids in weightless environments and to investigate the extent to which small-amplitude vibrations can be used to influence and control this behaviour. Piezoelectric materials are used to generate high-frequency vibrations to drive surface waves and large-scale reorientation of the interface. The theory of vibroequilibria, which treats the quasi-stationary surface configurations achieved by this reorientation, was used to predict interesting parameter regimes and interpret fluid behaviour. Here we describe the scientific motivation, objectives, and design of the experiment.

  7. Influence of millisecond time, charge length and detonation velocity on blasting vibration

    Institute of Scientific and Technical Information of China (English)

    陈士海; 吴建; 张子华

    2015-01-01

    The law of blasting vibration caused by blasting in rock is very complex. Traditional numerical methods cannot well characterize all the influencing factors in the blasting process. The effects of millisecond time, charge length and detonation velocity on the blasting vibration are discussed by analyzing the characteristics of vibration wave generated by finite length cylindrical charge. It is found that in multi-hole millisecond blasting, blasting vibration superimpositions will occur several times within a certain distance from the explosion source due to the propagation velocity difference of P-wave and S-wave generated by a short column charge. These superimpositions will locally enlarge the peak velocity of blasting vibration particle. The magnitude and scope of the enlargement are closely related to the millisecond time. Meanwhile, the particle vibration displacement characteristics of rock under long cylindrical charge is analyzed. The results show that blasting vibration effect would no longer increase when the charge length increases to a certain extent. This indicates that the traditional simple calculation method using the maximum charge weight per delay interval to predict the effect of blasting vibration is unreasonable. Besides, the effect of detonation velocity on blasting vibration is only limited in a certain velocity range. When detonation velocity is greater than a certain value, the detonation velocity almost makes no impact on blasting vibration.

  8. Transportation Shock and Vibration Literature Review

    Energy Technology Data Exchange (ETDEWEB)

    Maheras, Steven J.; Lahti, Erik A.; Ross, Steven B.

    2013-06-06

    This report fulfills the M4 milestone M4FT-13OR08220112, "Report Documenting Experimental Activities." The purpose of this report is to document the results of a literature review conducted of studies related to the vibration and shock associated with the normal conditions of transport for rail shipments of used nuclear fuel from commercial light-water reactors. As discussed in Adkins (2013), the objective of this report is to determine if adequate data exist that would enable the impacts of the shock and vibration associated with the normal conditions of transport on commercial light-water reactor used nuclear fuel shipped in current generation rail transportation casks to be realistically modeled.

  9. Active Suppression Of Vibrations On Elastic Beams

    Science.gov (United States)

    Silcox, Richard J.; Fuller, Chris R.; Gibbs, Gary P.

    1993-01-01

    Pairs of colocated piezoelectric transducers, independently controlled by multichannel adaptive controller, employed as actuators and sensors to achieve simultaneous attenuation of both extensional and flexural motion. Single pair used to provide simultaneous control of flexural and extensional waves, or two pairs used to control torsional motion also. Capability due to nature of piezoelectric transducers, when bonded to surfaces of structures and activated by oscillating voltages, generate corresponding oscillating distributions of stresses in structures. Phases and amplitudes of actuator voltages adjusted by controller to impede flow of vibrational energy simultaneously, in waves of various forms, beyond locations of actuators. Concept applies equally to harmonic or random response of structure and to multiple responses of structure to transverse bending, torsion, and compression within structural element. System has potential for many situations in which predominant vibration transmission path through framelike structure.

  10. Vibrations of strongly irregular or fractal resonators

    Science.gov (United States)

    Sapoval, B.; Gobron, Th.

    1993-05-01

    It is shown on a specific example that fractal boundary conditions drastically alter the properties of wave excitations in space. The low-frequency part of the vibration spectrum of a finite-range fractal drum is computed using an analogy between the Helmoltz equation and the diffusion equation. The irregularity of the frontier is found to influence strongly the density of states at low frequency. The fractal perimeter generates a specific screening effect. Very near the frontier, the decrease of the wave form is related directly to the behavior of the harmonic measure. The possibility of localization of the vibrations is qualitatively discussed and we show that localized modes may exist at low frequencies if the geometrical structures possess narrow paths. Possible application of these results to the interpretation of thermal properties of binary glasses is briefly discussed.

  11. Random vibrations theory and practice

    CERN Document Server

    Wirsching, Paul H; Ortiz, Keith

    1995-01-01

    Random Vibrations: Theory and Practice covers the theory and analysis of mechanical and structural systems undergoing random oscillations due to any number of phenomena— from engine noise, turbulent flow, and acoustic noise to wind, ocean waves, earthquakes, and rough pavement. For systems operating in such environments, a random vibration analysis is essential to the safety and reliability of the system. By far the most comprehensive text available on random vibrations, Random Vibrations: Theory and Practice is designed for readers who are new to the subject as well as those who are familiar with the fundamentals and wish to study a particular topic or use the text as an authoritative reference. It is divided into three major sections: fundamental background, random vibration development and applications to design, and random signal analysis. Introductory chapters cover topics in probability, statistics, and random processes that prepare the reader for the development of the theory of random vibrations a...

  12. VIBRATION ISOLATION SYSTEM PROBABILITY ANALYSIS

    Directory of Open Access Journals (Sweden)

    Smirnov Vladimir Alexandrovich

    2012-10-01

    Full Text Available The article deals with the probability analysis for a vibration isolation system of high-precision equipment, which is extremely sensitive to low-frequency oscillations even of submicron amplitude. The external sources of low-frequency vibrations may include the natural city background or internal low-frequency sources inside buildings (pedestrian activity, HVAC. Taking Gauss distribution into account, the author estimates the probability of the relative displacement of the isolated mass being still lower than the vibration criteria. This problem is being solved in the three dimensional space, evolved by the system parameters, including damping and natural frequency. According to this probability distribution, the chance of exceeding the vibration criteria for a vibration isolation system is evaluated. Optimal system parameters - damping and natural frequency - are being developed, thus the possibility of exceeding vibration criteria VC-E and VC-D is assumed to be less than 0.04.

  13. A new vibration mechanism of balancing machine for satellite-borne spinning rotors

    Institute of Scientific and Technical Information of China (English)

    Wang Qiuxiao; Wang Fei

    2014-01-01

    The centrifugal force and overturning moment generated by satellite-borne rotating pay-load have a significant impact on the stability of on-orbit satellite attitude, which must be controlled to the qualified range. For the satellite-borne rotors’ low working revs and large centroidal devia-tion and height, and that the horizontal vibration produced by centrifugal force is not of the same magnitude as the torsional vibration by overturning moment, the balancing machine’s measurement accuracy is low. Analysis shows that the mixture of horizontal vibration and torsional vibration of the vibrational mechanism contribute mainly to the machine’s performance, as well as the instabil-ity of vibration center position. A vibrational mechanism was put forward, in which the horizontal and torsional vibration get separated effectively by way of fixing the vibration center. From exper-imental results, the separation between the weak centrifugal force signal and the strong moment sig-nal was realized, errors caused by unstable vibration center are avoided, and the balancing machine based on this vibration structure is able to meet the requirements of dynamic balancing for the satel-lite’s rotating payloads in terms of accuracy and stability.

  14. A new vibration mechanism of balancing machine for satellite-borne spinning rotors

    Directory of Open Access Journals (Sweden)

    Wang Qiuxiao

    2014-10-01

    Full Text Available The centrifugal force and overturning moment generated by satellite-borne rotating payload have a significant impact on the stability of on-orbit satellite attitude, which must be controlled to the qualified range. For the satellite-borne rotors’ low working revs and large centroidal deviation and height, and that the horizontal vibration produced by centrifugal force is not of the same magnitude as the torsional vibration by overturning moment, the balancing machine’s measurement accuracy is low. Analysis shows that the mixture of horizontal vibration and torsional vibration of the vibrational mechanism contribute mainly to the machine’s performance, as well as the instability of vibration center position. A vibrational mechanism was put forward, in which the horizontal and torsional vibration get separated effectively by way of fixing the vibration center. From experimental results, the separation between the weak centrifugal force signal and the strong moment signal was realized, errors caused by unstable vibration center are avoided, and the balancing machine based on this vibration structure is able to meet the requirements of dynamic balancing for the satellite’s rotating payloads in terms of accuracy and stability.

  15. Computer analysis of railcar vibrations

    Science.gov (United States)

    Vlaminck, R. R.

    1975-01-01

    Computer models and techniques for calculating railcar vibrations are discussed along with criteria for vehicle ride optimization. The effect on vibration of car body structural dynamics, suspension system parameters, vehicle geometry, and wheel and rail excitation are presented. Ride quality vibration data collected on the state-of-the-art car and standard light rail vehicle is compared to computer predictions. The results show that computer analysis of the vehicle can be performed for relatively low cost in short periods of time. The analysis permits optimization of the design as it progresses and minimizes the possibility of excessive vibration on production vehicles.

  16. Studies of surfaces using optical second-harmonic generation

    Energy Technology Data Exchange (ETDEWEB)

    Tom, H.W.K.

    1984-04-01

    The experiments reported in this thesis demonstrate the use of second-harmonic generation (SHG) and sum-frequency generation (SFG) in reflection from surfaces to study various surface properties. The experiments firmly establish SHG as a viable new surface probe that complements existing surface probes in ultrahigh vacuum environments and is in many ways unique for studying interfaces between dense media. Surface structural symmetry can be revealed through the anisotropy in the SH signal from the surface as the sample is rotated about its normal. The form of this anisotropy is derived in theory and verified with an experiment on the Si(100) and (111) surfaces. The SHG and SFG signals from molecules adsorbed on noninteracting substrates have a direct relationship to the number, average orientation, and spectroscopic properties of the molecules. The SH intensity was used to measure the isotherm for adsorption of p-nitrobenzoic acid from ethanolic solution to fused silica. Experiments performed on a strongly-interacting well-characterized Rh(111) surface in ultrahigh vacuum establish the sensitivity of the SH probe in corroboration with other surface probes. For the first time, the SH coverage-dependence was fit by theory in a quantitative way for the case of O-atom adsorption. The sensitivity of SH to adsorption at different sites was established for CO on top- and bridge-sites. SHG was shown to be surface specific in that the SHG from alkali metal surfaces originates from the first two monolayers. SH sensitivity to the adsorption of catalytically-important hydrocarbons and to chemical processes such as benzene dehydrogenation was also demonstrated. 122 references, 27 figures, 2 tables.

  17. Prediction of vibration level in tunnel blasting; Tonneru kusshin happa ni yotte reiki sareru shindo no reberu yosoku ho

    Energy Technology Data Exchange (ETDEWEB)

    Hirata, A. [Kumamoto Industries Univ, Kumamoto (Japan); Yamamoto, M. [Asahi Chemical Industry Co. Ltd., Tokyo (Japan); Inaba, C. [Nishimatsu Construction Co. Ltd., Kanagawa (Japan); Kaneko, K. [Hokkaido Univ (Japan)

    1997-08-01

    For avoiding the generation of public hazard due to ground vibration causes by blasting in tunneling, it is important to devise a blasting method for ensuring the level of the ground vibration caused thereby under a limit, and an exact predication of ground vibration before blasting is desirable. In this study, the characteristics of the ground vibration caused by tunnel blasting are analyzed, and a summary of amplitude spectra calculating method is described. A theoretical analysis method for predicting the vibration level is proposed based on spectrum-multiplicative method. Vibration caused by multistage blasting in tunneling is most strong and deemed as important. When observing the process of elastic wave motion caused by multistage blasting being measured, the process can be divided into three element processes in frequency area as vibration source spectrum, transmission attenuation spectrum and frequency response function vibrating test, and, with the multiplication of them, the amplitude spectra at an observation portion can be estimated. 12 refs., 12 figs.

  18. Chaotic vortex induced vibrations

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, J.; Sheridan, J. [Fluids Laboratory for Aeronautical and Industrial Research (FLAIR), Department of Mechanical and Aerospace Engineering, Monash University, Melbourne, Victoria 3800 (Australia); Leontini, J. S. [Department of Mechanical and Product Design Engineering, Swinburne University of Technology, Hawthorn, Victoria 3122 (Australia); Lo Jacono, D. [Institut de Mécanique des Fluides de Toulouse (IMFT), CNRS, UPS and Université de Toulouse, 31400 Toulouse (France)

    2014-12-15

    This study investigates the nature of the dynamic response of an elastically mounted cylinder immersed in a free stream. A novel method is utilized, where the motion of the body during a free vibration experiment is accurately recorded, and then a second experiment is conducted where the cylinder is externally forced to follow this recorded trajectory. Generally, the flow response during both experiments is identical. However, particular regimes exist where the flow response is significantly different. This is taken as evidence of chaos in these regimes.

  19. Anharmonic vibrations in nuclei

    CERN Document Server

    Fallot, M; Andrés, M V; Catara, F; Lanza, E G; Scarpaci, J A; Chomaz, Ph.

    2003-01-01

    In this letter, we show that the non-linearitites of large amplitude motions in atomic nuclei induce giant quadrupole and monopole vibrations. As a consequence, the main source of anharmonicity is the coupling with configurations including one of these two giant resonances on top of any state. Two-phonon energies are often lowered by one or two MeV because of the large matrix elements with such three phonon configurations. These effects are studied in two nuclei, 40Ca and 208Pb.

  20. Lattice Vibrations in Chlorobenzenes:

    DEFF Research Database (Denmark)

    Reynolds, P. A.; Kjems, Jørgen; White, J. W.

    1974-01-01

    Lattice vibrational dispersion curves for the ``intermolecular'' modes in the triclinic, one molecule per unit cell β phase of p‐C6D4Cl2 and p‐C6H4Cl2 have been obtained by inelastic neutron scattering. The deuterated sample was investigated at 295 and at 90°K and a linear extrapolation to 0°K...... by consideration of electrostatic forces or by further anisotropy in the dispersion forces not described in the atom‐atom model. Anharmonic effects are shown to be large, but the dominant features in the temperature variation of frequencies are describable by a quasiharmonic model....

  1. Man-Induced Vibrations

    DEFF Research Database (Denmark)

    Jönsson, Jeppe; Hansen, Lars Pilegaard

    1994-01-01

    Human motion can cause various types of periodic or transient dynamic loads. The periodic loads are mainly due to jumping, running, dancing, walking and body rocking. Transient loads primarily result from single impulse loads, such as jumping and falling from elevated positions. The response...... concerned with spectator-induced vertical vibrations on grandstands. The idea is to use impulse response analysis and base the load description on the load impulse. If the method is feasable, it could be used in connection with the formulation of requirements in building codes. During the last two decades...

  2. Off-axis Modal Active Vibration Control Of Rotational Vibrations

    NARCIS (Netherlands)

    Babakhani, B.; de Vries, Theodorus J.A.; van Amerongen, J.

    Collocated active vibration control is an effective and robustly stable way of adding damping to the performance limiting vibrations of a plant. Besides the physical parameters of the Active Damping Unit (ADU) containing the collocated actuator and sensor, its location with respect to the

  3. Vibrational relaxation and vibrational cooling in low temperature molecular crystals

    Science.gov (United States)

    Hill, Jeffrey R.; Chronister, Eric L.; Chang, Ta-Chau; Kim, Hackjin; Postlewaite, Jay C.; Dlott, Dana D.

    1988-01-01

    The processes of vibrational relaxation (VR) and vibrational cooling (VC) are investigated in low temperature crystals of complex molecules, specifically benzene, naphthalene, anthracene, and durene. In the VR process, a vibration is deexcited, while VC consists of many sequential and parallel VR steps which return the crystal to thermal equilibrium. A theoretical model is developed which relates the VR rate to the excess vibrational energy, the molecular structure, and the crystal structure. Specific relations are derived for the vibrational lifetime T1 in each of three regimes of excess vibrational energy. The regimes are the following: Low frequency regime I where VR occurs by emission of two phonons, intermediate frequency regime II where VR occurs by emission of one phonon and one vibration, and high frequency regime III where VR occurs by evolution into a dense bath of vibrational combinations. The VR rate in each regime depends on a particular multiphonon density of states and a few averaged anharmonic coefficients. The appropriate densities of states are calculated from spectroscopic data, and together with available VR data and new infrared and ps Raman data, the values of the anharmonic coefficients are determined for each material. The relationship between these parameters and the material properties is discussed. We then describe VC in a master equation formalism. The transition rate matrix for naphthalene is found using the empirically determined parameters of the above model, and the time dependent redistribution in each mode is calculated.

  4. Airflow energy harvesters of metal-based PZT thin films by self-excited vibration

    Science.gov (United States)

    Suwa, E.; Tsujiura, Y.; Kurokawa, F.; Hida, H.; Kanno, I.

    2014-11-01

    We developed self-excited vibration energy harvesters of Pb(Zr,Ti)O3 (PZT) thin films using airflow. To enhance the self-excited vibration, we used 30-μm-thick stainless steel (SS304) foils as base cantilevers on which PZT thin films were deposited by rf-magnetron sputtering. To compensate for the initial bending of PZT/SS304 unimorph cantilever due to the thermal stress, we deposited counter PZT thin films on the back of the SS304 cantilever. We evaluated power-generation performance and vibration mode of the energy harvester in the airflow. When the angle of attack (AOA) was 20° to 30°, large vibration was generated at wind speeds over 8 m/s. By FFT analysis, we confirmed that stable self-excited vibration was generated. At the AOA of 30°, the output power reached 19 μW at wind speeds of 12 m/s.

  5. Ultrafast spectroscopy of model biological membranes

    NARCIS (Netherlands)

    Ghosh, Avishek

    2009-01-01

    In this PhD thesis, I have described the novel time-resolved sum-frequency generation (TR-SFG) spectroscopic technique that I developed during the course of my PhD research and used it study the ultrafast vibrational, structural and orientational dynamics of water molecules at model biological membr

  6. Energy-Saving Vibration Impulse Coal Degradation at Finely Dispersed Coal-Water Slurry Preparation

    Directory of Open Access Journals (Sweden)

    Moiseev V.A.

    2015-01-01

    Full Text Available Theoretical and experimental research results of processes of finely dispersed coal-water slurry preparation for further generation of energetic gas in direct flow and vortex gas generator plants have been presented. It has been stated that frequency parameters of parabolic vibration impulse mill influence degradation degree. Pressure influence on coal parameters in grinding cavity has been proven. Experimental researches have proven efficiency of vibration impulse mill with unbalanced mass vibrator generator development. Conditions of development on intergranular walls of coal cracks have been defined.

  7. Train-induced field vibration measurements of ground and over-track buildings.

    Science.gov (United States)

    Zou, Chao; Wang, Yimin; Moore, James A; Sanayei, Masoud

    2017-01-01

    Transit-oriented development, such as metro depot and over-track building complexes, has expanded rapidly over the last 5years in China. Over-track building construction has the advantage of comprehensive utilization of land resources, ease of commuting to work, and provide funds for subway construction. But the high frequency of subway operations into and out of the depots can generate excessive vibrations that transmit into the over track buildings, radiate noise within the buildings, hamper the operation of vibration sensitive equipment, and adversely affect the living quality of the building occupants. Field measurements of vibration during subway operations were conducted at Shenzhen, China, a city of 10.62 million people in southern China. Considering the metro depot train testing line and throat area train lines were the main vibration sources, vibration data were captured in five measurement setups. The train-induced vibrations were obtained and compared with limitation of FTA criteria. The structure-radiated noise was calculated using measured vibration levels. The vertical vibration energy directly passed through the columns on both sides of track into the platform, amplifying vibration on the platform by up to 6dB greater than ground levels at testing line area. Vibration amplification around the natural frequency in the vertical direction of over-track building made the peak values of indoor floor vibration about 16dB greater than outdoor platform vibration. We recommend to carefully examining design of new over-track buildings within 40m on the platform over the throat area to avoid excessive vertical vibrations and noise. For both buildings, the measured vertical vibrations were less than the FTA limit. However, it is demonstrated that the traffic-induced high-frequency noise has the potential to annoy occupants on the upper floors.

  8. Spectrum Generating Algebra for X$_{3}$ Molecules

    CERN Document Server

    Bijker, R; Leviatan, A

    1995-01-01

    A new spectrum generating algebra for a unified description of rotations and vibrations in polyatomic molecules is introduced. An application to nonlinear X$_3$ molecules shows that this model (i) incorporates exactly the relevant point group, (ii) provides a complete classification of oblate top states, and (iii) treats properly both degenerate and nondegenerate vibrations.

  9. Vibrations and Stability: Solved Problems

    DEFF Research Database (Denmark)

    Thomsen, Jon Juel

    Worked out solutions for exercise problems in J. J. Thomsen 'Vibrations and Stability: Advanced Theory, Analysis, and Tools', Springer, Berlin - Heidelberg, 2003.......Worked out solutions for exercise problems in J. J. Thomsen 'Vibrations and Stability: Advanced Theory, Analysis, and Tools', Springer, Berlin - Heidelberg, 2003....

  10. Studies Of Vibrations In Gearboxes

    Science.gov (United States)

    Choy, Fred K.; Ruan, Yeefeng F.; Tu, Yu K.; Zakrajsek, James J.; Oswald, Fred B.; Coy, John J.; Townsend, Dennis P.

    1994-01-01

    Three NASA technical memorandums summarize studies of vibrations in gearboxes. Directed toward understanding and reducing gearbox noise caused by coupling of vibrations from meshing gears, through gear shafts and their bearings, to surfaces of gearbox housings. Practical systems in which understanding and reduction of gearbox noise beneficial include helicopter, car, and truck transmissions; stationary geared systems; and gear-driven actuator systems.

  11. Vibrational spectra of ordered perovskites

    NARCIS (Netherlands)

    Corsmit, A.F.; Hoefdraad, H.E.; Blasse, G.

    1972-01-01

    The vibrational spectra of the molecular M6+O6 (M = Mo, Te, W) group in ordered perovskites of the type Ba2M2+M6+O6 are reported. These groups have symmetry Oh, whereas their site symmetry is also Oh. An assignment of the internal vibrations is presented.

  12. Structure-borne sound structural vibrations and sound radiation at audio frequencies

    CERN Document Server

    Cremer, L; Petersson, Björn AT

    2005-01-01

    Structure-Borne Sound"" is a thorough introduction to structural vibrations with emphasis on audio frequencies and the associated radiation of sound. The book presents in-depth discussions of fundamental principles and basic problems, in order to enable the reader to understand and solve his own problems. It includes chapters dealing with measurement and generation of vibrations and sound, various types of structural wave motion, structural damping and its effects, impedances and vibration responses of the important types of structures, as well as with attenuation of vibrations, and sound radi

  13. A study on the transient piping vibration of power plant. Secondary piping system of Wolsung 1 unit

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Hyun; Kim, Yeon Whan [Korea Electric Power Corp. (KEPCO), Taejon (Korea, Republic of). Research Center

    1996-08-01

    In order to maintain a safe operation and availability of generating facilities, qualitative and quantitative assessment of piping vibration was performed vibration sources and damages of piping support was identified on the second piping system of Wolsung nuclear power plant unit 1 .Inspected piping supports and structures in both hot and cold condition .Established evaluation procedures of piping vibration .Performed the static analysis of 2 nd piping system .Established optimal vibration reducing method .The measured vibration level after installing rigid supports and energy absorbing type restraint was reduced about 7 times in velocity unit (author). 24 refs., 95 figs.

  14. Theoretical and experimental research on characteristics of lateral vibration for a pre-stress bolt supporting system

    Institute of Scientific and Technical Information of China (English)

    LI Qing-feng; ZHU Chuan-qu; DUAN Yu

    2009-01-01

    According to the structure and stress trait of bearing bolts,a lateral-vibration mechanics model was established for them,and the relation between lateral-vibration fre-quency and axial load was analyzed; then,lateral-vibration trait of bearing bolts was stud-ied through laboratory simulation test.The results indicate that vibration frequency of bolt support system increases as well as axial force,the detection on axial load of bolts can be made by generating lateral vibration of bearing bolts.Theoretical and experimental re-search results show that frequency method is effective for detecting the axial force of bolt support system.

  15. Metrology of vibration measurements by laser techniques

    Science.gov (United States)

    von Martens, Hans-Jürgen

    2008-06-01

    Metrology as the art of careful measurement has been understood as uniform methodology for measurements in natural sciences, covering methods for the consistent assessment of experimental data and a corpus of rules regulating application in technology and in trade and industry. The knowledge, methods and tools available for precision measurements can be exploited for measurements at any level of uncertainty in any field of science and technology. A metrological approach to the preparation, execution and evaluation (including expression of uncertainty) of measurements of translational and rotational motion quantities using laser interferometer methods and techniques will be presented. The realization and dissemination of the SI units of motion quantities (vibration and shock) have been based on laser interferometer methods specified in international documentary standards. New and upgraded ISO standards are reviewed with respect to their suitability for ensuring traceable vibration measurements and calibrations in an extended frequency range of 0.4 Hz to higher than 100 kHz. Using adequate vibration exciters to generate sufficient displacement or velocity amplitudes, the upper frequency limits of the laser interferometer methods specified in ISO 16063-11 for frequencies procedures (i.e. measurement uncertainty 0.05 % at frequencies <= 10 kHz, <= 1 % up to 100 kHz).

  16. Damping of acoustic vibrations in gold nanoparticles

    Science.gov (United States)

    Pelton, Matthew; Sader, John E.; Burgin, Julien; Liu, Mingzhao; Guyot-Sionnest, Philippe; Gosztola, David

    2009-08-01

    Studies of acoustic vibrations in nanometre-scale particles can provide fundamental insights into the mechanical properties of materials because it is possible to precisely characterize and control the crystallinity and geometry of such nanostructures. Metal nanoparticles are of particular interest because they allow the use of ultrafast laser pulses to generate and probe high-frequency acoustic vibrations, which have the potential to be used in a variety of sensing applications. So far, the decay of these vibrations has been dominated by dephasing due to variations in nanoparticle size. Such inhomogeneities can be eliminated by performing measurements on single nanoparticles deposited on a substrate, but unknown interactions between the nanoparticles and the substrate make it difficult to interpret the results of such experiments. Here, we show that the effects of inhomogeneous damping can be reduced by using bipyramidal gold nanoparticles with highly uniform sizes. The inferred homogeneous damping is due to the combination of damping intrinsic to the nanoparticles and the surrounding solvent; the latter is quantitatively described by a parameter-free model.

  17. High fidelity quantum gates with vibrational qubits.

    Science.gov (United States)

    Berrios, Eduardo; Gruebele, Martin; Shyshlov, Dmytro; Wang, Lei; Babikov, Dmitri

    2012-11-26

    Physical implementation of quantum gates acting on qubits does not achieve a perfect fidelity of 1. The actual output qubit may not match the targeted output of the desired gate. According to theoretical estimates, intrinsic gate fidelities >99.99% are necessary so that error correction codes can be used to achieve perfect fidelity. Here we test what fidelity can be accomplished for a CNOT gate executed by a shaped ultrafast laser pulse interacting with vibrational states of the molecule SCCl(2). This molecule has been used as a test system for low-fidelity calculations before. To make our test more stringent, we include vibrational levels that do not encode the desired qubits but are close enough in energy to interfere with population transfer by the laser pulse. We use two complementary approaches: optimal control theory determines what the best possible pulse can do; a more constrained physical model calculates what an experiment likely can do. Optimal control theory finds pulses with fidelity >0.9999, in excess of the quantum error correction threshold with 8 × 10(4) iterations. On the other hand, the physical model achieves only 0.9992 after 8 × 10(4) iterations. Both calculations converge as an inverse power law toward unit fidelity after >10(2) iterations/generations. In principle, the fidelities necessary for quantum error correction are reachable with qubits encoded by molecular vibrations. In practice, it will be challenging with current laboratory instrumentation because of slow convergence past fidelities of 0.99.

  18. The Vibration Ring. Phase 1; [Seedling Fund

    Science.gov (United States)

    Asnani, Vivake M.; Krantz, Timothy L.; Delap, Damon C.; Stringer, David B.

    2014-01-01

    The vibration ring was conceived as a driveline damping device to prevent structure-borne noise in machines. It has the appearance of a metal ring, and can be installed between any two driveline components like an ordinary mechanical spacer. Damping is achieved using a ring-shaped piezoelectric stack that is poled in the axial direction and connected to an electrical shunt circuit. Surrounding the stack is a metal structure, called the compression cage, which squeezes the stack along its poled axis when excited by radial driveline forces. The stack in turn generates electrical energy, which is either dissipated or harvested using the shunt circuit. Removing energy from the system creates a net damping effect. The vibration ring is much stiffer than traditional damping devices, which allows it to be used in a driveline without disrupting normal operation. In phase 1 of this NASA Seedling Fund project, a combination of design and analysis was used to examine the feasibility of this concept. Several designs were evaluated using solid modeling, finite element analysis, and by creating prototype hardware. Then an analytical model representing the coupled electromechanical response was formulated in closed form. The model was exercised parametrically to examine the stiffness and loss factor spectra of the vibration ring, as well as simulate its damping effect in the context of a simplified driveline model. The results of this work showed that this is a viable mechanism for driveline damping, and provided several lessons for continued development.

  19. The origins of vibration theory

    Science.gov (United States)

    Dimarogonas, A. D.

    1990-07-01

    The Ionian School of natural philosophy introduced the scientific method of dealing with natural phenomena and the rigorous proofs for abstract propositions. Vibration theory was initiated by the Pythagoreans in the fifth century BC, in association with the theory of music and the theory of acoustics. They observed the natural frequency of vibrating systems and proved that it is a system property and that it does not depend on the excitation. Pythagoreans determined the fundamental natural frequencies of several simple systems, such as vibrating strings, pipes, vessels and circular plates. Aristoteles and the Peripatetic School founded mechanics and developed a fundamental understanding of statics and dynamics. In Alexandrian times there were substantial engineering developments in the field of vibration. The pendulum as a vibration, and probably time, measuring device was known in antiquity, and was further developed by the end of the first millennium AD.

  20. Force Limited Vibration Testing Monograph

    Science.gov (United States)

    Scharton, Terry D.

    1997-01-01

    The practice of limiting the shaker force in vibration tests was investigated at the NASA Jet Propulsion Laboratory (JPL) in 1990 after the mechanical failure of an aerospace component during a vibration test. Now force limiting is used in almost every major vibration test at JPL and in many vibration tests at NASA Goddard Space Flight Center (GSFC) and at many aerospace contractors. The basic ideas behind force limiting have been in the literature for several decades, but the piezo-electric force transducers necessary to conveniently implement force limiting have been available only in the last decade. In 1993, funding was obtained from the NASA headquarters Office of Chief Engineer to develop and document the technology needed to establish force limited vibration testing as a standard approach available to all NASA centers and aerospace contractors. This monograph is the final report on that effort and discusses the history, theory, and applications of the method in some detail.

  1. Particularidades de la medición de presión sonora y vibraciones en grupos electrógenos MAN 18 V48/60 B // Distinctive features for sound pressure level and vibration measurements over engine generator sets type MAN 18 v48/60 b

    Directory of Open Access Journals (Sweden)

    Yanexi Cepero‐Aguilera

    2011-01-01

    Full Text Available Como parte de las líneas de investigación del Centro de Estudios en Ingeniería de Mantenimiento, sedesarrolla un proyecto de investigación encaminado a establecer las pautas para la evaluación de lacondición de grupos electrógenos. El presente artículo muestra las particularidades de la mediciónde sonido y vibraciones sobre un Grupo Electrógeno MAN 18 V48/60 B. Se analiza lo indicado en elestándar ISO 3744 concluyéndose con la imposibilidad práctica de su aplicación en el entornoindustrial y para grandes máquinas como lo es el caso de los grupos electrógenos MAN 18 V48/60 B.El interés de esta investigación se enfoca al generador del grupo electrógeno y por ello no obstante,se efectuaron mediciones de presión sonora orientando el micrófono hacia los cojinetes de este,sobre los cuales también se registraron sus vibraciones siguiendo lo indicado en el estándar ISO8528-9. El análisis comparativo de los registros espectrales de presión sonora y de vibracionesobligó a convertir los espectros FFT en espectros de ancho de banda proporcional constante. Comoresultado fundamental se obtiene la no correlación de las frecuencias espectrales de presión sonoracon las de vibraciones y una evaluación preliminar del generador exhibiendo una condición normal.Palabras claves: nivel de presión sonora, medición de vibraciones, ancho de banda proporcionalconstante, grupos electrógenos._________________________________________________________________AbstractA research project for condition monitoring of engine generator sets is developed as part of mainresearches at Maintenance Engineering Research Center. Sound pressure level and vibrationmeasurements over an engine generator set MAN 18 V48/60 B are made with the goal of identifythose frequencies present in both, sound pressure level and vibration spectra which could give thepossibility to use sound pressure level as a symptom parameter because of the continuous feature ofthis kind of

  2. Characterization of a novel instrument for vibration exercise.

    Science.gov (United States)

    Xu, L; Rabotti, C; Mischi, M

    2012-01-01

    Vibration exercise (VE) has been suggested as an effective option to improve muscle strength and power performance. Several studies link the effects of vibration training to enhanced neuromuscular stimulation and typically to involuntary reflex mechanisms. However, the underlying mechanisms are still unclear and information for the most appropriate vibration training protocols is limited. This study proposes to realize a new vibration exercise system for the biceps brachii. Amplitude, frequency, and baseline of the vibrating load, which is generated by an electromechanical actuator, can be adjusted dynamically by a feedback control loop. A second-order model is employed to identify the relation between the mechanical load and the input voltage driving the actuator. An adaptive normalized least mean square algorithm is proposed to remove the motion artifacts from the measured electromyography (EMG) data. Our results show a high correlation (0.99) between the second-order model fit and the measured data, permitting accurate control on the supplied load for vibrations up to 80 Hz. Furthermore, preliminary validation with 4 volunteers showed an excellent performance in the motion artifact removal, enabling reliable evaluation of the neuromuscular activation.

  3. Study on Vibration Isolation Design of Dual Piezoelectric Cooling Jets

    Directory of Open Access Journals (Sweden)

    Guang-Min Luo

    2015-05-01

    Full Text Available The traditional cooling fans can’t be applied in modern consumer electronic products because the modern electronic products always have slim shapes. In recent years, GE’s Dual Piezoelectric Cooling Jets (DCJ constructed by piezoelectricity materials had been developed and employed in modern electronic products’ cooling. The main cooling principle of DCJ is utilizing variation of heat field which is conducted by vibration to accomplish heat exchange. However, the vibration generated by DCJ will be transmitted to adjacent devices and cause the extra vibration problems. Appropriate glue and isolated damper; like rubber and cohesive polymer; can reduce the transmission of vibration. Glue is applied to bond the adjacent piezo thin plates, and isolated damped is applied to fasten DCJ on the base of electronic products. In this study, the numerical simulation package ANSYS is utilized to simulate the vibration reduction effects of various kinds of glue and isolated dampers. Furthermore, the simulation results are also employed to confirm the better isolated types that can isolate the extra vibration effectively.

  4. Evaluation of blast-induced vibration effects on structures 1

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jong Rim; Jeon, Gyu Shick; Lee, Dae Soo; Joo, Kwang Ho; Lee, Woong Keon [Korea Electrotechnology Research Inst., Changwon (Korea, Republic of); Ryu, Chang Ha; Chung, So Keul; Lee, Kyung Won; Shin, Hee Soon; Chun, Sun Woo; Park, Yeon Jun; Synn, Joong Ho; Choi, Byung Hee [Korea Inst. of Geology Mining and Materials, Taejon (Korea, Republic of)

    1995-12-31

    Due to the difficulties of obtaining construction site for new plants, following ones are inevitably being built in the site adjacent to existing power plants. Therefore considerable thought has been recently given to the dynamic loading generated by blasting works near the plants to maintain the safety of structures and facilities in power plants. Our own standard for safety level of blast vibration is not prepared yet, and foreign standards have been generally employed without theoretical and experimental verification. Safety-related structures of power plants and facilities have to be protected against the effects of possible hazards due to blast vibration. Earthquakes have been considered a major dynamic design loading as a requirement of plant design, but the effects of blast-induced vibration are not. In order to ensure the safety, rational safe criterion should be established and blast design should be satisfy it, which requires the development of a model for prediction of vibration level through more systematic measurement and analysis. The main objectives of the study are : to provide background data for establishing the rational safe vibration limits, to develop models for prediction of blast vibration level, to establish safe blast design criterion, and to accumulate techniques for field measurements, data acquisition and analysis (author). 80 refs., 347 figs.

  5. Vibration measurements of high-heat-load monochromators for DESY PETRA III extension

    Energy Technology Data Exchange (ETDEWEB)

    Kristiansen, Paw, E-mail: paw.kristiansen@fmb-oxford.com [FMB Oxford Ltd, Unit 1 Ferry Mills, Oxford OX2 0ES (United Kingdom); Horbach, Jan; Döhrmann, Ralph; Heuer, Joachim [DESY, Deutsches Elektronen-Synchrotron Hamburg, Notkestrasse 85, 22607 Hamburg (Germany)

    2015-05-09

    Vibration measurements of a cryocooled double-crystal monochromator are presented. The origins of the vibrations are identified. The minimum achieved vibration of the relative pitch between the two crystals is 48 nrad RMS and the minimum achieved absolute vibration of the second crystal is 82 nrad RMS. The requirement for vibrational stability of beamline optics continues to evolve rapidly to comply with the demands created by the improved brilliance of the third-generation low-emittance storage rings around the world. The challenge is to quantify the performance of the instrument before it is installed at the beamline. In this article, measurement techniques are presented that directly and accurately measure (i) the relative vibration between the two crystals of a double-crystal monochromator (DCM) and (ii) the absolute vibration of the second-crystal cage of a DCM. Excluding a synchrotron beam, the measurements are conducted under in situ conditions, connected to a liquid-nitrogen cryocooler. The investigated DCM utilizes a direct-drive (no gearing) goniometer for the Bragg rotation. The main causes of the DCM vibration are found to be the servoing of the direct-drive goniometer and the flexibility in the crystal cage motion stages. It is found that the investigated DCM can offer relative pitch vibration down to 48 nrad RMS (capacitive sensors, 0–5 kHz bandwidth) and absolute pitch vibration down to 82 nrad RMS (laser interferometer, 0–50 kHz bandwidth), with the Bragg axis brake engaged.

  6. Two-photon vibrational excitation of air by long-wave infrared laser pulses

    CERN Document Server

    Palastro, J P; Johnson, L A; Hafizi, B; Wahlstrand, J K; Milchberg, H M

    2016-01-01

    Ultrashort long-wave infrared (LWIR) laser pulses can resonantly excite vibrations in N2 and O2 through a two-photon transition. The absorptive, vibrational component of the ultrafast optical nonlinearity grows in time, starting smaller than, but quickly surpassing, the electronic, rotational, and vibrational refractive components. The growth of the vibrational component results in a novel mechanism of 3rd harmonic generation, providing an additional two-photon excitation channel, fundamental + 3rd harmonic. The original and emergent two-photon excitations drive the resonance exactly out of phase, causing spatial decay of the absorptive, vibrational nonlinearity. This nearly eliminates two-photon vibrational absorption. Here we present simulations and analytical calculations demonstrating how these processes modify the ultrafast optical nonlinearity in air. The results reveal nonlinear optical phenomena unique to the LWIR regime of ultrashort pulse propagation in atmosphere.

  7. Studies on the full vibrational energy spectra for some electronic states of diatomic molecular ions XY+

    Institute of Scientific and Technical Information of China (English)

    LIU Yi-ding; SUN Wei-guo; REN Wei-yi

    2006-01-01

    The first accurate studies on the vibrational spectroscopic constants and the corresponding full vibrational energy spectra of some electronic states of diatomic molecular ions XY+ were performed using algebraic method(AM).The AM is applied on the X1Σ+ state of BeH+,the X2Σ+ state of CO+ , the X21-Π state of F2+ the A2Πu state of O2+ and theX2Σ+g Li2+.The results show that AM can generate accurate vibrational spectroscopic constants as well as accurate full vibrational energy spectra by using some accurate experimental vibrational energies,and that the AM vibrational energies are better than other theoretical data.

  8. On the control of vibrations using synchrophasing

    Science.gov (United States)

    Dench, M. R.; Brennan, M. J.; Ferguson, N. S.

    2013-09-01

    This paper describes the application of a technique, known as synchrophasing, to the control of machinery vibration. It is applicable to machinery installations, in which several synchronous machines, such as those driven by electrical motors, are fitted to an isolated common structure known as a machinery raft. To reduce the vibration transmitted to the host structure to which the machinery raft is attached, the phase of the electrical supply to the motors is adjusted so that the net transmitted force to the host structure is minimised. It is shown that while this is relatively simple for an installation consisting of two machines, it is more complicated for installations in which there are more than two machines, because of the interaction between the forces generated by each machine. The development of a synchrophasing scheme, which has been applied to propeller aircraft, and is known as Propeller Signature Theory (PST) is discussed. It is shown both theoretically and experimentally, that this is an efficient way of controlling the phase of multiple machines. It is also shown that synchrophasing is a worthwhile vibration control technique, which has the potential to suppress vibration transmitted to the host structure by up to 20 dB at certain frequencies. Although the principle of synchronisation has been demonstrated on a one-dimensional structure, it is believed that this captures the key features of the approach. However, it should be realised that the mode-shapes of a machinery raft may be more complex than that of a one-dimensional structure and this may need to be taken into account in a real application.

  9. VERTICAL VIBRATION ANALYSIS OF AXISYMMETRIC SATURATED SOIL

    Institute of Scientific and Technical Information of China (English)

    CAI Yuan-qiang; XU Chang-jie; ZHENG Zao-feng; WU Da-zhi

    2006-01-01

    Based on Biot's dynamic consolidation equations, by means of Laplace-Hankel transform technology, the integral solutions of stress and displacement in saturated soil with subjacent rock-stratum under axisymmetric arbitrary excitations were derived. Influence of the reflected wave generated by the boundary was revealed. Numerical results indicate that the vibration frequency has some effect on the vertical displacement of saturated soil. The vertical displacement at the surface of saturated soil lags in phase with the load. Furthermore, the dynamic permeability coefficient of saturated soil has significant effect on the vertical displacement at the initial stage of load applied, but when the load becomes stable, the effect is inapparent.

  10. Transient vibration of thin viscoelastic orthotropic plates

    Institute of Scientific and Technical Information of China (English)

    J. Soukup; F. Vale(s); J. Volek; J. Sko(c)ilas

    2011-01-01

    This article deals with solutions of transient vibration of a rectangular viscoelastic orthotropic thin 2D plate for particular deformation models according to Flügge and Timoshenko-Mindlin. The linear model, a general standard viscoelastic body, of the rheologic properties of a viscoelastic material was applied. The time and coordinate curves of the basic quantities displacement, rotation, velocity, stress and deformation are compared. The results obtained by an approximate analytic method are compared with numerical results for 3D plate generated by FEM application and with experimental investigation.

  11. Orbiting droplets on a vibrated bath

    Science.gov (United States)

    Sampara, Naresh; Burger, Loic; Gilet, Tristan; Microfluidics, university of liege Team

    2015-11-01

    A millimeter-sized oil droplet can bounce on a vertically vibrated liquid bath for unlimited time. It may couple to the surface wave it emits; leading to horizontal self-propulsion called walking. When several walkers coexist close to one another, they either repel or attract each other, in response to the superposition of the waves they generate. Attraction leads to various bound states, including droplets that orbit around each other. We have experimentally investigated the variety of quantized orbital motions exhibited by two, three and more identical walkers, as a function of forcing acceleration. Each motion is quantified in terms of droplet and wave energy.

  12. Vibration properties of and power harvested by a system of electromagnetic vibration energy harvesters that have electrical dynamics

    Science.gov (United States)

    Cooley, Christopher G.

    2017-09-01

    This study investigates the vibration and dynamic response of a system of coupled electromagnetic vibration energy harvesting devices that each consist of a proof mass, elastic structure, electromagnetic generator, and energy harvesting circuit with inductance, resistance, and capacitance. The governing equations for the coupled electromechanical system are derived using Newtonian mechanics and Kirchhoff circuit laws for an arbitrary number of these subsystems. The equations are cast in matrix operator form to expose the device's vibration properties. The device's complex-valued eigenvalues and eigenvectors are related to physical characteristics of its vibration. Because the electrical circuit has dynamics, these devices have more natural frequencies than typical electromagnetic vibration energy harvesters that have purely resistive circuits. Closed-form expressions for the steady state dynamic response and average power harvested are derived for devices with a single subsystem. Example numerical results for single and double subsystem devices show that the natural frequencies and vibration modes obtained from the eigenvalue problem agree with the resonance locations and response amplitudes obtained independently from forced response calculations. This agreement demonstrates the usefulness of solving eigenvalue problems for these devices. The average power harvested by the device differs substantially at each resonance. Devices with multiple subsystems have multiple modes where large amounts of power are harvested.

  13. An electromagnetic inerter-based vibration suppression device

    Science.gov (United States)

    Gonzalez-Buelga, A.; Clare, L. R.; Neild, S. A.; Jiang, J. Z.; Inman, D. J.

    2015-05-01

    This paper describes how an inerter-based device for structural vibration suppression can be realized using an electromagnetic transducer such as a linear motor. When the motor shaft moves, a difference of voltage is generated across the transducer coil. The voltage difference is proportional to the relative velocity between its two terminals. The electromagnetic transducer will exert a force proportional to current following the Lorentz principle if the circuit is closed around the transducer coil. If an electronic circuit consisting of a capacitor, an inductance and a resistance with the appropriate configuration is connected, the resulting force reflected back into the mechanical domain is equivalent to that achieved by a mechanical inerter-based device. The proposed configuration is easy to implement and very versatile, provided a high quality conversion system with negligible losses. With the use of electromagnetic devices, a new generation of vibration absorbers can be realized, for example in the electrical domain it would be relatively uncomplicated to synthesize multi-frequency or real time tunable vibration absorbers by adding electrical components in parallel. In addition by using resistance emulators in the electrical circuits, part of the absorbed vibration energy can be converted into usable power. Here an electromagnetic tuned inerter damper (E-TID) is tested experimentally using real time dynamic substructuring. A voltage compensation unit was developed in order to compensate for coil losses. This voltage compensation unit requires power, which is acquired through harvesting from the vibration energy using a resistance emulator. A power balance analysis was developed in order to ensure the device can be self sufficient. Promising experimental results, using this approach, have been obtained and are presented in this paper. The ultimate goal of this research is the development of autonomous electromagnetic vibration absorbers, able to harvest energy

  14. Refocusing vibrating targets in SAR images

    Science.gov (United States)

    Wang, Qi; Santhanam, Balu; Pepin, Matthew; Atwood, Tom; Hayat, Majeed M.

    2012-06-01

    In synthetic-aperture radar (SAR) returned signals, ground-target vibrations introduce a phase modulation that is linearly proportional to the vibration displacement. Such modulation, termed the micro-Doppler effect, introduces ghost targets along the azimuth direction in reconstructed SAR images that prevents SAR from forming focused images of the vibrating targets. Recently, a discrete fractional Fourier transform (DFrFT) based method was developed to estimate the vibration frequencies and instantaneous vibration accelerations of the vibrating targets from SAR returned signals. In this paper, a demodulation-based algorithm is proposed to reconstruct focused SAR images of vibrating targets by exploiting the estimation results of the DFrFT-based vibration estimation method. For a single-component harmonic vibration, the history of the vibration displacement is first estimated from the estimated vibration frequency and the instantaneous vibration accelerations. Then a reference signal whose phase is modulated by the estimated vibration displacement with a delay of 180 degree is constructed. After that, the SAR phase history from the vibration target is multiplied by the reference signal and the vibration-induced phase modulation is canceled. Finally, the SAR image containing the re-focused vibration target is obtained by applying the 2-D Fourier transform to the demodulated SAR phase history. This algorithm is applied to simulated SAR data and successfully reconstructs the SAR image containing the re-focused vibrating target.

  15. Train-induced ground vibrations: modeling and experiments

    NARCIS (Netherlands)

    Ditzel, A.

    2003-01-01

    Ground vibrations generated by high-speed trains are of great concern because of the possible damage they can cause to buildings or other structures near the track, and the annoyance to the public living in the vicinity of the track. Particularly in soft-soil regions, where the wave speed is compara

  16. Prevention of environmental vibrations from uneven roads and sleeping policemen

    NARCIS (Netherlands)

    Gerritsen, W.; Waarts, P.H.; Pelgröm, L.J.W.

    1999-01-01

    KOAC•WMD Dutch Road Research Laboratories and TNO Building and Construction Research have developed the perfect tool to predict the level of vibrations generated by traffic passing sleeping policemen and/or uneven roads. The tool consists of a quick investigation of the wave propagation through soil

  17. Train induced vibrations in geosynthetic reinforced railway embankments

    DEFF Research Database (Denmark)

    Zania, Varvara; Hededal, Ole; Krogsbøll, Anette

    2011-01-01

    High–speed trains may generate ground vibrations which cause undesirable environmental and economical impacts such as nuisance of the passengers, deflections along the rail, and possibly impairment of the stability of the embankments. The increase of the velocity of a moving load on homogeneous...

  18. Effect of Slot Combination and Skewed Slot on Electromagnetic Vibration of Capacitor Motor under Load

    Science.gov (United States)

    Hirotsuka, Isao; Tsuboi, Kazuo

    The capacitor motor (CRM) is widely used to drive industrial equipments and electric home appliances. Recently, the reduction in the vibration and noise of the CRM has become increasingly important from the standpoint of environmental improvement. However, the electromagnetic vibration of the CRM under load has not been analyzed sufficiently. Therefore, we have studied the electromagnetic vibration of CRM for the purpose of reducing it. In a previous paper, the relationships for a backward magnetic field, the equivalent circuit current, and the vibration of the CRM were clarified. The present paper theoretically and experimentally discusses the effect of the slot combination and skewed slot on the electromagnetic vibration of CRM under load. The primary conclusions are as follows: (1) In the case of 4-pole and 6-pole CRMs, the dominant electromagnetic vibration of CRMs was theoretically attributed to three types of electromagnetic force waves. Two types of electromagnetic force waves are generated: one wave is generated by the interaction of two forward magnetic fluxes, such as those of a three-phase squirrel-cage induction motor, and the other wave is generated under the influence of a backward magnetic flux. (2) The characteristics of dominant electromagnetic vibration depending on load and running capacitor were classified theoretically and experimentally into three types based on the characteristics of the electromagnetic force wave and equivalent circuit current. (3) The influences of magnetic saturation in dominant electromagnetic vibration were verified experimentally and their causes were clarified theoretically in relation to electromagnetic force waves.

  19. MR Damper Controlled Vibration Absorber for Enhanced Mitigation of Harmonic Vibrations

    Directory of Open Access Journals (Sweden)

    Felix Weber

    2016-12-01

    Full Text Available This paper describes a semi-active vibration absorber (SVA concept based on a real-time controlled magnetorheological damper (MR-SVA for the enhanced mitigation of structural vibrations due to harmonic disturbing forces. The force of the MR damper is controlled in real-time to generate the frequency and damping controls according to the behaviour of the undamped vibration absorber for the actual frequency of vibration. As stiffness and damping emulations in semi-active actuators are coupled quantities the control is formulated to prioritize the frequency control by the controlled stiffness. The control algorithm is augmented by a stiffness correction method ensuring precise frequency control when the desired control force is constrained by the semi-active restriction and residual force of the MR damper. The force tracking task is solved by a model-based feed forward with feedback correction. The MR-SVA is numerically and experimentally validated for the primary structure with nominal eigenfrequency and when de-tuning of −10%, −5%, +5% and +10% is present. Both validations demonstrate that the MR-SVA improves the vibration reduction in the primary structure by up to 55% compared to the passive tuned mass damper (TMD. Furthermore, it is shown that the MR-SVA with only 80% of tuned mass leads to approximately the same enhanced performance while the associated increased relative motion amplitude of the tuned mass is more than compensated be the reduced dimensions of the mass. Therefore, the MR-SVA is an appropriate solution for the mitigation of tall buildings where the pendulum mass can be up to several thousands of metric tonnes and space for the pendulum damper is limited.

  20. Gap junctional communication in osteocytes is amplified by low intensity vibrations in vitro.

    Directory of Open Access Journals (Sweden)

    Gunes Uzer

    Full Text Available The physical mechanism by which cells sense high-frequency mechanical signals of small magnitude is unknown. During exposure to vibrations, cell populations within a bone are subjected not only to acceleratory motions but also to fluid shear as a result of fluid-cell interactions. We explored displacements of the cell nucleus during exposure to vibrations with a finite element (FE model and tested in vitro whether vibrations can affect osteocyte communication independent of fluid shear. Osteocyte like MLO-Y4 cells were subjected to vibrations at acceleration magnitudes of 0.15 g and 1 g and frequencies of 30 Hz and 100 Hz. Gap junctional intracellular communication (GJIC in response to these four individual vibration regimes was investigated. The FE model demonstrated that vibration induced dynamic accelerations caused larger relative nuclear displacement than fluid shear. Across the four regimes, vibrations significantly increased GJIC between osteocytes by 25%. Enhanced GJIC was independent of vibration induced fluid shear; there were no differences in GJIC between the four different vibration regimes even though differences in fluid shear generated by the four regimes varied 23-fold. Vibration induced increases in GJIC were not associated with altered connexin 43 (Cx43 mRNA or protein levels, but were dependent on Akt activation. Combined, the in silico and in vitro experiments suggest that externally applied vibrations caused nuclear motions and that large differences in fluid shear did not influence nuclear motion (<1% or GJIC, perhaps indicating that vibration induced nuclear motions may directly increase GJIC. Whether the increase in GJIC is instrumental in modulating anabolic and anti-catabolic processes associated with the application of vibrations remains to be determined.

  1. The influence of vibrations on surface roughness formed during precision boring

    Science.gov (United States)

    Korzeniewski, Dariusz; Znojkiewicz, Natalia

    2017-01-01

    In this paper, the analysis of vibrations on surface roughness generated during boring with the application of the conventional boring tool and one with the damper is presented. The experiments included the measurement of vibration accelerations carried out with the piezoelectric sensor, as well as the evaluation of surface roughness parameters after each machining pass. The obtained results reveal that in the investigated range, no stability loss was found. Furthermore, the growth of the rotational speed induces the increase of vibration level, as well as the growth of the differences between the vibration values generated during boring with the conventional tool and one equipped with damper. Vibrations have also the direct influence on the machined surface roughness. In case of the tool equipped with the damper, the tool's overhang L had more intense influence than rotational speed n. However, for the conventional boring tool this dependency was unequivocal.

  2. Effectiveness of Stationary Humans and Tuned Mass Dampers in Controlling Floor vibrations

    DEFF Research Database (Denmark)

    Pedersen, Lars

    2006-01-01

    and the vibrating floor. The paper presents results of controlled tests made with a vibrating test floor carrying stationary crowds of people and how these results are employed in the context of formulating a model for the passive damping mechanism generated by stationary humans. The paper illustrates...... a dynamic excitation generated by humans in motion. The vibration levels are compared with those expected if the else wise empty structures were fitted with a tuned mass damper so as to illustrate the effectiveness of the crowd in mitigating floor vibrations. Since a stationary crowd of people changes......Floor vibrations can be annoying to stationary humans (sitting or standing) on a floor, and therefore codes and standards specify threshold values for floor acceleration levels. For very responsive floors if can be necessary to fit the floor with a passive damping source (such as a tuned mass...

  3. Molecular vibrations the theory of infrared and Raman vibrational spectra

    CERN Document Server

    Wilson, E Bright; Cross, Paul C

    1980-01-01

    Pedagogical classic and essential reference focuses on mathematics of detailed vibrational analyses of polyatomic molecules, advancing from application of wave mechanics to potential functions and methods of solving secular determinant.

  4. On the Use of Quantum Algebras in Rotation-Vibration Spectroscopy

    OpenAIRE

    1995-01-01

    A two-parameter deformation of the Lie algebra u$_2$ is used, in conjunction with the rotor system and the oscillator system, to generate a model for rotation-vibration spectroscopy of molecules and nuclei.

  5. Vibrational Spectroscopy of Methyl benzoate

    CERN Document Server

    Maiti, Kiran Sankar

    2014-01-01

    Methyl benzoate (MB) is studied as a model compound for the development of new IR pulse schemes with possible applicability to biomolecules. Anharmonic vibrational modes of MB are calculated on different level (MP2, SCS, CCSD(T) with varying basis sets) ab-initio PESs using the vibrational self-consistent field (VSCF) method and its correlation corrected extensions. Dual level schemes, combining different quantum chemical methods for diagonal and coupling potentials, are systematically studied and applied successfully to reduce the computational cost. Isotopic substitution of {\\beta}-hydrogen by deuterium is studied to obtain a better understanding of the molecular vibrational coupling topology.

  6. Magnetic damping of ski vibrations

    Energy Technology Data Exchange (ETDEWEB)

    Yonnet, J.-P. [CNRS, St. Martin d' Heres (France). Lab. d' Electrotech. de Grenoble; Patton, A.C.; Philippe; Arnould; Bressan, C. [CNRS, St. Martin d' Heres (France). Lab. d' Electrotech. de Grenoble]|[Skis Dynastar S.A., Sallanches (France)

    1998-07-01

    An original damping device has been developed to reduce ski vibrations. Ski movement is transmitted to a conductive sheet situated in a multipole magnetic field created by permanent magnets. The conductive sheet is simultaneously submitted to eddy current and friction forces, giving the damping effect. The eddy current damper is more efficient for high frequency than for low frequency vibrations and consequently is very well adapted to ski vibrations. Bench and snow tests show the positive effects of the damper, which will be commercially available before the end of this year. (orig.)

  7. Vibrational Autodetachment in Nitroalkane Anions

    Science.gov (United States)

    Adams, Christopher L.; Weber, J. Mathias

    2010-06-01

    Nitroalkanes have electron affinities ge 1370 cm-1, well below the excitation energies for CH stretching modes, with the excess charge localized on the nitro group. Upon absorption of an IR photon in a CH stretching vibrational mode, the absorbed energy is redistributed in the molecule. If enough energy is transferred to the NO2 stretching/wagging modes, the excess electron residing on the nitro group is emitted. Vibrational autodetachment (VAD) spectra encode information regarding intramolecular vibrational relaxation (IVR) processes leading up to electron emission. We present VAD photoelectron spectroscopy of polyatomic molecular anions and discuss how a VAD photoelectron spectrum can be modeled.

  8. Generation of green frequency comb from chirped χ{sup (2)} nonlinear photonic crystals

    Energy Technology Data Exchange (ETDEWEB)

    Lai, C.-M. [Department of Electronic Engineering, Ming Chuan University, Taoyuan, Taiwan (China); Chang, K.-H.; Yang, Z.-Y.; Fu, S.-H.; Tsai, S.-T.; Hsu, C.-W.; Peng, L.-H. [Department of Electrical Engineering and Graduate Institute of Photonics and Optoelectronics, National Taiwan University, Taipei, Taiwan (China); Yu, N. E. [Advanced Photonics Research Institute, Gwangju Institute of Science and Technology, Gwangju (Korea, Republic of); Boudrioua, A. [LPL, CNRS - UMR 7538, Université Paris 13, Sorbone Paris Cité (France); Kung, A. H. [Institute of Atomic and Molecular Sciences, Academia Sinica, Taipei, Taiwan (China); Institute of Photonics Technologies, National Tsing Hua University, Hsinchu, Taiwan (China)

    2014-12-01

    Spectrally broad frequency comb generation over 510–555 nm range was reported on chirped quasi-phase-matching (QPM) χ{sup (2)} nonlinear photonic crystals of 12 mm length with periodicity stepwise increased from 5.9 μm to 7.1 μm. When pumped with nanosecond infrared (IR) frequency comb derived from a QPM optical parametric oscillator (OPO) and spanned over 1040 nm to 1090 nm wavelength range, the 520 nm to 545 nm up-converted green spectra were shown to consist of contributions from (a) second-harmonic generation among the signal or the idler modes, and (b) sum-frequency generation (SFG) from the neighboring pairs of the signal or the idler modes. These mechanisms led the up-converted green frequency comb to have the same mode spacing of 450 GHz as that in the IR-OPO pump comb. As the pump was further detuned from the aforementioned near-degeneracy point and moved toward the signal (1020–1040 nm) and the idler (1090–1110 nm) spectral range, the above QPM parametric processes were preserved in the chirped QPM devices to support up-converted green generation in the 510–520 nm and the 545–555 nm spectral regime. Additional 530–535 nm green spectral generation was also observed due to concurrence of multi-wavelength SFG processes between the (signal, idler) mode pairs. These mechanisms facilitate the chirped QPM device to support a single-pass up-conversion efficiency ∼10% when subject to an IR-OPO pump comb with 200 mW average power operated near- or off- the degeneracy point.

  9. Vibration transmissibility characteristics of smart spring vibration isolation system

    Institute of Scientific and Technical Information of China (English)

    倪德; 朱如鹏; 陆凤霞; 鲍和云; 付秋菊

    2014-01-01

    The objective of this work was to study the vibration transmissibility characteristics of the undamped and damped smart spring systems. The frequency response characteristics of them were analyzed by using the equivalent linearization technique, and the possible types of the system motion were distinguished by using the starting and ending frequencies. The influences of system parameters on the vibration transmissibility characteristics were discussed. The following conclusions may be drawn from the analysis results. The undamped smart spring system may simultaneously have one starting frequency and one ending frequency or only have one starting frequency, and the damped system may simultaneously have two starting frequencies and one ending frequency. There is an optimal control parameter to make the peak value of the vibration transmissibility curve of the system be minimum. When the mass ratio is far away from the stiffness ratio, the vibration transmissibility is small. The effect of the damping ratio on the system vibration transmissibility is significant while the control parameter is less than its optimal value. But the influence of the relative damping ratio on the vibration transmissibility is small.

  10. 14 CFR 33.33 - Vibration.

    Science.gov (United States)

    2010-01-01

    ... STANDARDS: AIRCRAFT ENGINES Design and Construction; Reciprocating Aircraft Engines § 33.33 Vibration. The... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Vibration. 33.33 Section 33.33 Aeronautics... vibration and without imparting excessive vibration forces to the aircraft structure. ...

  11. 14 CFR 33.63 - Vibration.

    Science.gov (United States)

    2010-01-01

    ... STANDARDS: AIRCRAFT ENGINES Design and Construction; Turbine Aircraft Engines § 33.63 Vibration. Each engine... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Vibration. 33.63 Section 33.63 Aeronautics... because of vibration and without imparting excessive vibration forces to the aircraft structure. ...

  12. Femtosecond nonlinear spectroscopy at surfaces: Second-harmonic probing of hole burning at the Si(111)7x7 surface and fourier-transform sum-frequency vibrational spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    McGuire, John Andrew [Univ. of California, Berkeley, CA (United States)

    2004-11-24

    The high temporal resolution and broad bandwidth of a femtosecond laser system are exploited in a pair of nonlinear optical studies of surfaces. The dephasing dynamics of resonances associated with the adatom dangling bonds of the Si(111)7 x 7 surface are explored by transient second-harmonic hole burning, a process that can be described as a fourth-order nonlinear optical process. Spectral holes produced by a 100 fs pump pulse at about 800 nm are probed by the second harmonic signal of a 100 fs pulse tunable around 800 nm. The measured spectral holes yield homogeneous dephasing times of a few tens of femtoseconds. Fits with a Lorentzian spectral hole centered at zero probe detuning show a linear dependence of the hole width on pump fluence, which suggests that charge carrier-carrier scattering dominates the dephasing dynamics at the measured excitation densities. Extrapolation of the deduced homogeneous dephasing times to zero excitation density yields an intrinsic dephasing time of {approx} 70 fs. The presence of a secondary spectral hole indicates that scattering of the surface electrons with surface optical phonons at 570 cm-1 occurs within the first 200 fs after excitation. The broad bandwidth of femtosecond IR pulses is used to perform IR-visible sum frequency vibrational spectroscopy. By implementing a Fourier-transform technique, we demonstrate the ability to obtain sub-laser-bandwidth spectral resolution. FT-SFG yields a greater signal when implemented with a stretched visible pulse than with a femtosecond visible pulse. However, when compared with multichannel spectroscopy using a femtosecond IR pulse but a narrowband visible pulse, Fourier-transform SFG is found to have an inferior signal-to-noise ratio. A mathematical analysis of the signal-to-noise ratio illustrates the constraints on the Fourier-transform approach.

  13. Vibrational spectroscopy at high external pressures the diamond anvil cell

    CERN Document Server

    Ferraro, John R

    1984-01-01

    Vibrational Spectroscopy at High External Pressures: The Diamond Anvil Cell presents the effects of high pressure on the vibrational properties of materials as accomplished in a diamond anvil cell (DAC). The DAC serves the dual purpose of generating the pressures and being transparent to infrared radiation, allowing the observation of changes caused by pressure. The optical probes highlighted will deal principally with infrared and Raman scattering, although some observations in the visible region will also be presented. The book begins with a discussion of the effects of pressure and pres

  14. Finite-amplitude vibration of a bubble and sonoluminescence

    Institute of Scientific and Technical Information of China (English)

    Qian Zu-Wen; Xiao Ling; Guo Liang-Hao

    2004-01-01

    Numerical solutions of the differential equation for a bubble performing finite-amplitude vibration are given in detail for a variety of situations. The results demonstrate that in lower acoustic pressure (maximum Mach number very low) its vibration has bounce. When acoustic pressure is in excess of 1.18atm and the instantaneous radius of the bubble approaches its equivalent Van der Waals radius, the maximum velocity and acceleration on the surface of a bubble have a huge increase in a very short period, which seems to favour the sonoluminescence. In vacuum environment (0.1atm),an intensive sonoluminescence could be generated.

  15. Vibration interaction in a multiple flywheel system

    Science.gov (United States)

    Firth, Jordan; Black, Jonathan

    2012-03-01

    This paper investigates vibration interaction in a multiple flywheel system. Flywheels can be used for kinetic energy storage in a satellite Integrated Power and Attitude Control System (IPACS). One hitherto unstudied problem with IPACS is vibration interaction between multiple unbalanced wheels. This paper uses a linear state-space dynamics model to study the impact of vibration interaction. Specifically, imbalance-induced vibration inputs in one flywheel rotor are used to cause a resonant whirling vibration in another rotor. Extra-synchronous resonant vibrations are shown to exist, but with damping modeled the effect is minimal. Vibration is most severe when both rotors are spinning in the same direction.

  16. Electrical Interface for a Self-Powered MR Damper-Based Vibration Reduction System

    Directory of Open Access Journals (Sweden)

    Jastrzębski Łukasz

    2016-09-01

    Full Text Available The study investigates the behaviour of an electrical interface incorporated in a MR damper-based vibration reduction system powered with energy recovered from vibration. The interface, comprising the R, L and C elements, is connected in between the coil in an electromagnetic electric generator and the control coil in the MR damper and its function is to convert the output voltage from the generator. The interface model was formulated and computer simulations were performed to find out how the parameters of the interface should influence the frequency responses of the vibration reduction system.

  17. Vibration insensitive optical ring cavity

    Institute of Scientific and Technical Information of China (English)

    Miao Jin; Jiang Yan-Yi; Fang Su; Bi Zhi-Yi; Ma Long-Sheng

    2009-01-01

    The mounting configuration of an optical ring cavity is optimized for vibration insensitivity by finite element analysis. A minimum response to vertical accelerations is found by simulations made for different supporting positions.

  18. Generation and characterization of 2.2 W-level 318.6 nm narrow-linewidth ultra-violet laser

    CERN Document Server

    Wang, Jieying; He, Jun; Wang, Junmin

    2016-01-01

    We have demonstrated a high-power and narrow-linewidth ultra-violet (UV) laser system at 318.6 nm for single-step 6S1/2-nP (n=70~100) Rydberg excitation of cesium atoms. Based on commercial fiber lasers and efficient nonlinear frequency conversion technology, our system can generate 2.26 W UV laser output from cavity-enhanced second-harmonic generation (SHG) followed by sum-frequency generation (SFG) of two infrared lasers at 1560.5 nm and 1076.9 nm. The maximum doubling efficiency is 57.3%. The enhanced doubling cavity is actively stabilized by using the PDH modulation method, while the 637.2 nm laser is indirectly modulated through the SFG process which transfers modulation from the 1560.5 nm seed laser to the red laser. The typical UV laser power fluctuation is less than 0.87% over 30 minutes, and the continuously tunable range of the UV laser frequency is more than 6 GHz.

  19. Vibration Theory, Vol. 1B

    DEFF Research Database (Denmark)

    Asmussen, J. C.; Nielsen, Søren R. K.

    The present collection of MATLAB exercises has been published as a supplement to the textbook, Svingningsteori, Bind 1 and the collection of exercises in Vibration theory, Vol. 1A, Solved Problems. Throughout the exercise references are made to these books. The purpose of the MATLAB exercises is ...... is to give a better understanding of the physical problems in linear vibration theory and to surpress the mathematical analysis used to solve the problems. For this purpose the MATLAB environment is excellent....

  20. Harmonic vibrations of multispan beams

    DEFF Research Database (Denmark)

    Dyrbye, Claes

    1996-01-01

    Free and forced harmonic vibrations of multispan beams are determined by a method which implies 1 equation regardless of the configuration. The necessary formulas are given in the paper. For beams with simple supports and the same length of all (n) spans, there is a rather big difference between...... the n´th and the (n+1)´th eigenfrequency. The reason for this phenomenon is explained.Keywords: Vibrations, Eigenfrequencies, Beams....

  1. C-130J Human Vibration

    Science.gov (United States)

    2005-08-01

    during an attack of blanching (Griffin, 1990; Wasserman, 1987). Bone and joint disorders (e.g., osteoarthritis, degeneration or deformity of bones of...1756 4 vibrate in the range of 8 to 1000 Hz (Griffin, 1990). Local vibration has been associated with circulatory disorders, bone and joint ... disorders , neurological disorders, muscle disorders and other general disorders (e.g., central nervous system) (Griffin, 1990). The most prominent

  2. Semiactive control for vibration attenuation

    Energy Technology Data Exchange (ETDEWEB)

    Leitmann, G. [Univ. of California, Berkeley, CA (United States). Coll. of Engineering

    1994-12-31

    With the advent of materials, such as electrorheological fluids, whose material properties can be altered rapidly by means of external stimuli, employing such materials as actuators for the controlled attenuation of undesirable vibrations is now possible. Such control schemes are dubbed semiactive in that they attenuate vibrations whether applied actively or passively. The author investigates various such control schemes, allowing for both separate and joint control of the stiffness and damping characteristics of the material.

  3. Vibrational spectroscopy at electrified interfaces

    CERN Document Server

    Wieckowski, Andrzej; Braunschweig, Björn

    2013-01-01

    Reviews the latest theory, techniques, and applications Surface vibrational spectroscopy techniques probe the structure and composition of interfaces at the molecular level. Their versatility, coupled with their non-destructive nature, enables in-situ measurements of operating devices and the monitoring of interface-controlled processes under reactive conditions. Vibrational Spectroscopy at Electrified Interfaces explores new and emerging applications of Raman, infrared, and non-linear optical spectroscopy for the study of charged interfaces. The book draws from hu

  4. Probing Site-Specific Structural Information of Peptides at Model Membrane Interface In Situ.

    Science.gov (United States)

    Ding, Bei; Panahi, Afra; Ho, Jia-Jung; Laaser, Jennifer E; Brooks, Charles L; Zanni, Martin T; Chen, Zhan

    2015-08-19

    Isotope labeling is a powerful technique to probe detailed structures of biological molecules with a variety of analytical methods such as NMR and vibrational spectroscopies. It is important to obtain molecular structural information on biological molecules at interfaces such as cell membranes, but it is challenging to use the isotope labeling method to study interfacial biomolecules. Here, by individually (13)C═(16)O labeling ten residues of a peptide, Ovispirin-1, we have demonstrated for the first time that a site-specific environment of membrane associated peptide can be probed by the submonolayer surface sensitive sum frequency generation (SFG) vibrational spectroscopy in situ. With the peptide associated with a single lipid bilayer, the sinusoidal trend of the SFG line width and peak-center frequency suggests that the peptide is located at the interface beneath the lipid headgroup region. The constructive interferences between the isotope labeled peaks and the main peptide amide I peak contributed by the unlabeled components were used to determine the membrane orientation of the peptide. From the SFG spectral peak-center frequency, line width, and polarization dependence of the isotope labeled units, we deduced structural information on individual units of the peptide associated with a model cell membrane. We also performed molecular dynamics (MD) simulations to understand peptide-membrane interactions. The physical pictures described by simulation agree well with the SFG experimental result. This research demonstrates the feasibility and power of using isotope labeling SFG to probe molecular structures of interfacial biological molecules in situ in real time.

  5. Aircraft vibration and flutter

    Directory of Open Access Journals (Sweden)

    R. R. Aggarwal

    1958-04-01

    Full Text Available "The paper outlines the theoretical and experimental procedure one has to adopt for flutter prevention during the various stages (project, design and prototype of the development of modern aircraft. With the advent of high speed, the aerodynamic coefficients have to be calculated with due regards to the effects of compressibility, finite aspect ratio of the lifting surfaces, sweep back and other peculiar shapes of the wings. The use of thin, small aspect ratio with external masses, necessitates the computation of higher frequency modes of vibration. Single degree of freedom flutter and the effect of control surface non-linearities has also become very important. Thus, it is shown how the availability of high speed computing machines, improved experimental technique for model and full scale testing has not kept pace with the uncertainties associated with the transonic speeds, low aspect ratio and the high frequency modes. Cross-checking of theoretical and experimental results at every stage seem to be the only answer."

  6. Calculation of ground vibration spectra from heavy military vehicles

    Science.gov (United States)

    Krylov, V. V.; Pickup, S.; McNuff, J.

    2010-07-01

    The demand for reliable autonomous systems capable to detect and identify heavy military vehicles becomes an important issue for UN peacekeeping forces in the current delicate political climate. A promising method of detection and identification is the one using the information extracted from ground vibration spectra generated by heavy military vehicles, often termed as their seismic signatures. This paper presents the results of the theoretical investigation of ground vibration spectra generated by heavy military vehicles, such as tanks and armed personnel carriers. A simple quarter car model is considered to identify the resulting dynamic forces applied from a vehicle to the ground. Then the obtained analytical expressions for vehicle dynamic forces are used for calculations of generated ground vibrations, predominantly Rayleigh surface waves, using Green's function method. A comparison of the obtained theoretical results with the published experimental data shows that analytical techniques based on the simplified quarter car vehicle model are capable of producing ground vibration spectra of heavy military vehicles that reproduce basic properties of experimental spectra.

  7. Vibrating Wingstroke Mechanism Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposed work will develop a new method and mechanism for generating wing stroke motion of any shape and orientation. The mechanism will provide power, lift and...

  8. An innovative and multi-functional smart vibration platform

    Science.gov (United States)

    Olmi, C.; Song, G.; Mo, Y. L.

    2007-08-01

    Recently, there has been increasing efforts to incorporate vibration damping or energy dissipation mechanisms into civil structures, particularly by using smart materials technologies. Although papers about structural vibration control using smart materials have been published for more than two decades, there has been little research in developing teaching equipment to introduce smart materials to students via in-classroom demonstration or hands-on experiments. In this paper, an innovative and multi-functional smart vibration platform (SVP) has been developed by the Smart Materials and Structures Laboratory at the University of Houston to demonstrate vibration control techniques using multiple smart materials for educational and research purposes. The vibration is generated by a motor with a mass imbalance mounted on top of the frame. Shape memory alloys (SMA) and magneto-rheological (MR) fluid are used to increase the stiffness and damping ratio, respectively, while a piezoceramic sensor (lead zirconate titanate, or PZT) is used as a vibration sensing device. An electrical circuit has been designed to control the platform in computer-control or manual mode through the use of knobs. The former mode allows for an automated demonstration, while the latter requires the user to manually adjust the stiffness and damping ratio of the frame. In addition, the system accepts network connections and can be used in a remote experiment via the internet. This platform has great potential to become an effective tool for teaching vibration control and smart materials technologies to students in civil, mechanical and electrical engineering for both education and research purposes.

  9. Fluid patterns and dynamics induced by vibrations in microgravity conditions

    Science.gov (United States)

    Porter, Jeff; Tinao Perez-Miravete, Ignacio; Laverón-Simavilla, Ana

    Understanding the effects of vibrations is extremely important in microgravity environments where residual acceleration, or g-jitter, is easily generated by crew manoeuvring or machinery, and can have a significant impact on material processing systems and on-board experiments. Indeed, vibrations can dramatically affect fluid behaviour whether gravity is present or not, inducing instability in some cases while suppressing it in others. We will describe the results of investigations being conducted at the ESA affiliated Spanish User Support and Operations Centre (E-USOC) on the effect of vibrations on fluids interfaces, most notably with the forcing oriented parallel to the fluid surface. Pattern formation properties will be described in detail, and the importance of symmetry constraints and mean flows will be considered. Current exper-imental results are intriguing and have challenged existing assumptions in the field, particularly with regard to the parametric instability underlying subharmonic cross-waves. They suggest an intimate connection between Faraday waves, which are observed in vertically vibrated systems, and cross-waves, which are found in horizontally forced systems. Concurrent theoretical work, based on the analysis of reduced models, and on numerical simulations, will then be described. Finally, this research will be placed in a microgravity context and used to motivate the defini-tion of a proposed set of experiments on the International Space Station (ISS). The experiments would be in the large-aspect-ratio-limit, requiring relatively high frequency but low amplitude vibrations, where comparatively little microgravity research has been done. The interest of such a microgravity experiment will be discussed, with emphasis on fluid management and the potential of vibrations to act as a kind of artificial gravity by orienting surfaces (or density contours) perpendicular to the axis of vibration.

  10. Feasibility of coded vibration in a vibro-ultrasound system for tissue elasticity measurement.

    Science.gov (United States)

    Zhao, Jinxin; Wang, Yuanyuan; Yu, Jinhua; Li, Tianjie; Zheng, Yong-Ping

    2016-07-01

    The ability of various methods for elasticity measurement and imaging is hampered by the vibration amplitude on biological tissues. Based on the inference that coded excitation will improve the performance of the cross-correlation function of the tissue displacement waves, the idea of exerting encoded external vibration on tested samples for measuring its elasticity is proposed. It was implemented by integrating a programmable vibration generation function into a customized vibro-ultrasound system to generate Barker coded vibration for elasticity measurement. Experiments were conducted on silicone phantoms and porcine muscles. The results showed that coded excitation of the vibration enhanced the accuracy and robustness of the elasticity measurement especially in low signal-to-noise ratio scenarios. In the phantom study, the measured shear modulus values with coded vibration had an R(2 )= 0.993 linear correlation to that of referenced indentation, while for single-cycle pulse the R(2) decreased to 0.987. In porcine muscle study, the coded vibration also obtained a shear modulus value which is more accurate than the single-cycle pulse by 0.16 kPa and 0.33 kPa at two different depths. These results demonstrated the feasibility and potentiality of the coded vibration for enhancing the quality of elasticity measurement and imaging.

  11. A novel vibrational energy harvester with electric double layer electrets

    Science.gov (United States)

    Ono, S.; Miwa, K.; Iori, J.; Mitsuya, H.; Ishibashi, K.; Sano, C.; Toshiyoshi, H.; Fujita, H.

    2016-11-01

    We propose a new type of vibrational energy harvester with an electric double layer (EDL) electrets. Instead of using any external bias-voltage source or dielectric layer on top of the metal electrode to sustain EDL, we succeed to anchor the ions to polymer network to form the EDL electrets. By changing contact area between the EDL electrets and the electrode, large electric current is generated in the circuit. Owing to extremely large capacitance of the EDL electret, vibrational energy harvesters have the unique capability to leverage the high- density charge accumulation to the electrode and obtained current density becomes as high as 200 μA/cm2 with output voltage of 1V even with low frequency vibrations as low as 1 Hz.

  12. Application of Sub-Micrometer Vibrations to Mitigate Bacterial Adhesion

    Directory of Open Access Journals (Sweden)

    Will R. Paces

    2014-03-01

    Full Text Available As a prominent concern regarding implantable devices, eliminating the threat of opportunistic bacterial infection represents a significant benefit to both patient health and device function. Current treatment options focus on chemical approaches to negate bacterial adhesion, however, these methods are in some ways limited. The scope of this study was to assess the efficacy of a novel means of modulating bacterial adhesion through the application of vibrations using magnetoelastic materials. Magnetoelastic materials possess unique magnetostrictive property that can convert a magnetic field stimulus into a mechanical deformation. In vitro experiments demonstrated that vibrational loads generated by the magnetoelastic materials significantly reduced the number of adherent bacteria on samples exposed to Escherichia coli, Staphylococcus epidermidis and Staphylococcus aureus suspensions. These experiments demonstrate that vibrational loads from magnetoelastic materials can be used as a post-deployment activated means to deter bacterial adhesion and device infection.

  13. Performance Study of Diagonally Segmented Piezoelectric Vibration Energy Harvester

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae Eun [Catholic Univ. of Daegu, Daegu (Korea, Republic of)

    2013-08-15

    This study proposes a piezoelectric vibration energy harvester composed of two diagonally segmented energy harvesting units. An auxiliary structural unit is attached to the tip of a host structural unit cantilevered to a vibrating base, where the two components have beam axes in opposite directions from each other and matched short-circuit resonant frequencies. Contrary to the usual observations in two resonant frequency-matched structures, the proposed structure shows little eigenfrequency separation and yields a mode sequence change between the first two modes. These lead to maximum power generation around a specific frequency. By using commercial finite element software, it is shown that the magnitude of the output power from the proposed vibration energy harvester can be substantially improved in comparison with those from conventional cantilevered energy harvesters with the same footprint area and magnitude of a tip mass.

  14. Nonlinear random vibration experimental results and research needs

    Science.gov (United States)

    Ibrahim, R. A.

    Experimental investigations of random excitation of dynamic systems are valuable but scarce. They are particularly important for nonlinear random vibration, since different approaches can lead to different results for the same problem. They are also useful in providing physical insight into a number of complex dynamic phenomena. The scarcity of random vibration testing is mainly due to a number of difficulties and errors encountered in generating the correct random excitation, and data acquisition. The purpose of this review article is to assess the recent experimental results reported in the literature by the author and others. An attempt will be made to correlate the experimental measurements qualitatively with those predicted analytically. In most cases, no quantitative comparisons have been made. New research directions based on recent analytical and experimental developments in the theory of nonlinear random vibration will also be outlined.

  15. Sensitive acoustic vibration sensor using single-mode fiber tapers.

    Science.gov (United States)

    Li, Yi; Wang, Xiaozhen; Bao, Xiaoyi

    2011-05-01

    Optical fiber sensors are a good alternative to piezoelectric devices in electromagnetic sensitive environments. In this study, we reported a fiber acoustic sensor based on single-mode fiber (SMF) tapers. The fiber taper is used as the sensing arm in a Mach-Zehnder interferometer. Benefiting from their micrometer dimensions, fiber tapers have shown higher sensitivities to the acoustic vibrations than SMFs. Under the same conditions, the thinnest fiber taper in this report, with a diameter of 1.7 µm, shows a 20 dB improvement in the signal to noise ratio as compared to that of an SMF. This acoustic vibration sensor can detect the acoustic waves over the frequencies of 30 Hz-40 kHz, which is limited by the acoustic wave generator in experiments. We also discussed the phase changes of fiber tapers with different diameters under acoustic vibrations.

  16. Balanced polarization maintaining fiber Sagnac interferometer vibration sensor.

    Science.gov (United States)

    Wada, Kenji; Narui, Hirokazu; Yamamoto, Daiki; Matsuyama, Tetsuya; Horinaka, Hiromichi

    2011-10-24

    To achieve a nearly zero-delay operating point in a polarization-maintaining (PM) fiber Sagnac interferometer, two identical PM fibers were incorporated so that their two main axes were orthogonally coupled to each other. A simple fiber vibration sensor system was constructed with a light emitting diode and a balanced PM fiber Sagnac interferometer, in which one of the PM fibers was used as a sensing cable and the other as a reference cable. The vibration sensor was confirmed to be temperature-compensated and generated a phase shift per unit length and unit strain of the sensor of 4.7 milliradian/(m·με) when mechanical vibrations with 1 kHz sinusoidal and triangular waves were stably observed under an input power of 10 μW.

  17. Low-energy electron attachment and detachment in vibrationally excited oxygen

    Energy Technology Data Exchange (ETDEWEB)

    Aleksandrov, N L; Anokhin, E M, E-mail: nick_aleksandrov@mail.r, E-mail: nick_aleksandrov@hotmail.co [Moscow Institute of Physics and Technology, Dolgoprudny, 141700 (Russian Federation)

    2009-11-21

    Three-body electron attachment to O{sub 2} molecules and electron detachment from O{sub 2}{sup -} ions have been theoretically studied in vibrationally excited oxygen and O{sub 2}-containing mixtures. Assuming that electron attachment and detachment proceed via the formation of vibrationally excited temporary O{sub 2}{sup -} ions, the rates of these processes were determined on the basis of the statistical approach for the vibrational transfer and relaxation in collisions between O{sub 2}{sup -} ions and O{sub 2} molecules. The calculated attachment and detachment rate constants turned out to agree well with available measurements in unexcited oxygen. This method was extended to calculate attachment and detachment rates in vibrationally excited oxygen. It was shown that the effect of vibrational excitation on electron detachment is profound, whereas attachment of low-energy electrons to vibrationally excited O{sub 2} is inefficient. The calculated vibrational distribution of stable O{sub 2}{sup -} ions turned out to be non-equilibrium in an excited gas and the effective vibrational temperature of the ions was much lower than the vibrational temperature of molecules. An analytical method was suggested to determine this distribution and the effective vibrational temperature. The calculated rate constants were used to simulate the formation and decay of an electron-beam-generated plasma in N{sub 2} : O{sub 2} mixtures at elevated vibrational temperatures. The calculations showed that vibrational excitation of molecules leads to orders of magnitude increase in the plasma density and in the plasma lifetime, in agreement with available observations.

  18. Acceleration of the reaction OH + CO → H + CO2 by vibrational excitation of OH.

    Science.gov (United States)

    Kohno, Nanase; Izumi, Mari; Kohguchi, Hiroshi; Yamasaki, Katsuyoshi

    2011-05-19

    The collision complex formed from a vibrationally excited reactant undergoes redissociation to the reactant, intramolecular vibrational relaxation (randomization of vibrational energy), or chemical reaction to the products. If attractive interaction between the reactants is large, efficient vibrational relaxation in the complex prevents redissociation to the reactants with the initial vibrational energy, and the complex decomposes to the reactants with low vibrational energy or converts to the products. In this paper, we have studied the branching ratios between the intramolecular vibrational relaxation and chemical reaction of an adduct HO(v)-CO formed from OH(X(2)Π(i)) in different vibrational levels v = 0-4 and CO. OH(v = 0-4) generated in a gaseous mixture of O(3)/H(2)/CO/He irradiated at 266 nm was detected with laser-induced fluorescence (LIF) via the A(2)Σ(+)-X(2)Π(i) transition, and H atoms were probed by the two-photon excited LIF technique. From the kinetic analysis of the time-resolved LIF intensities of OH(v) and H, we have found that the intramolecular vibrational relaxation is mainly governed by a single quantum change, HO(v)-CO → HO(v-1)-CO, followed by redissociation to OH(v-1) and CO. With the vibrational quantum number v, chemical process from the adduct to H + CO(2) is accelerated, and vibrational relaxation is decelerated. The countertrend is elucidated by the competition between chemical reaction and vibrational relaxation in the adduct HOCO.

  19. A power flow method for evaluating vibration from underground railways

    Science.gov (United States)

    Hussein, M. F. M.; Hunt, H. E. M.

    2006-06-01

    One of the major sources of ground-borne vibration is the running of trains in underground railway tunnels. Vibration is generated at the wheel-rail interface, from where it propagates through the tunnel and surrounding soil into nearby buildings. An understanding of the dynamic interfaces between track, tunnel and soil is essential before engineering solutions to the vibration problem can be found. A new method has been developed to evaluate the effectiveness of vibration countermeasures. The method is based on calculating the mean power flow from the tunnel, paying attention to that part of the power which radiates upwards to places where buildings' foundations are expected to be found. The mean power is calculated for an infinite train moving through the tunnel with a constant velocity. An elegant mathematical expression for the mean power flow is derived, which can be used with any underground-tunnel model. To evaluate the effect of vibration countermeasures and track properties on power flow, a comprehensive three-dimensional analytical model is used. It consists of Euler-Bernoulli beams to account for the rails and the track slab. These are coupled in the wavenumber-frequency domain to a thin shell representing the tunnel embedded within an infinite continuum, with a cylindrical cavity representing the surrounding soil.

  20. Surface instabilities and reorientation induced by vibration in microgravity conditions

    Science.gov (United States)

    Porter, Jeff; Laverón-Simavilla, Ana; Tinao Perez-Miravete, Ignacio; Fernandez Fraile, Jose Javier; Ezquerro Navarro, Jose Miguel

    2012-07-01

    The behavior of vibrated fluids and, in particular, the surface or interfacial instabilities that commonly arise in these systems have been the subject of continued experimental and theoretical attention since Faraday's seminal experiments in 1831. Both orientation and frequency are critical in determining the response of the fluid to excitation. Low frequencies are associated with sloshing while higher frequencies may generate Faraday waves or cross-waves, depending on whether the axis of vibration is perpendicular or parallel to the interface. In addition, high frequency vibrations are known to produce large scale reorientation of the fluid (vibroequilibria), an effect that becomes especially pronounced in the absence of gravity. We describe the results of investigations conducted at the ESA affiliated Spanish User Support and Operations Centre (E-USOC) on the effect of vibrations on fluid interfaces, particularly the interaction between Faraday waves, which arise in vertically vibrated systems, cross-waves, which are found in horizontally forced systems, and large scale reorientation (vibroequilibria). Ongoing ground experiments utilizing a dual-axis shaker configuration are described, including the effect on pattern formation of varying the two independent forcing frequencies, amplitudes, and phases. Theoretical results, based on the analysis of reduced models, and on numerical simulations, are then described and compared to experiment. Finally, the interest of a corresponding microgravity experiment is discussed and implications for fluid management strategies considered.

  1. Acoustic and Vibration Environment for Crew Launch Vehicle Mobile Launcher

    Science.gov (United States)

    Vu, Bruce T.

    2007-01-01

    A launch-induced acoustic environment represents a dynamic load on the exposed facilities and ground support equipment (GSE) in the form of random pressures fluctuating around the ambient atmospheric pressure. In response to these fluctuating pressures, structural vibrations are generated and transmitted throughout the structure and to the equipment items supported by the structure. Certain equipment items are also excited by the direct acoustic input as well as by the vibration transmitted through the supporting structure. This paper presents the predicted acoustic and vibration environments induced by the launch of the Crew Launch Vehicle (CLV) from Launch Complex (LC) 39. The predicted acoustic environment depicted in this paper was calculated by scaling the statistically processed measured data available from Saturn V launches to the anticipated environment of the CLV launch. The scaling was accomplished by using the 5-segment Solid Rocket Booster (SRB) engine parameters. Derivation of vibration environment for various Mobile Launcher (ML) structures throughout the base and tower was accomplished by scaling the Saturn V vibration environment.

  2. Vibration Characteristics of An Offshore Platform and Its Vibration Control

    Institute of Scientific and Technical Information of China (English)

    李华军; 王树青; 杨永春; 王燕

    2002-01-01

    A template offshore platform, located in the Bohai Bay of China, has exhibited excessive, unexpected vibration un-der mildly hostile sea conditions, which has affected the normal operation of the platform. Since the structure was de-signed to sustain more severe wave climate, the cause of the excessive vibration has been suspected to originate from othersources. The main objectives of this study are to investigate the causes of the excessive vibration, and to explore possibleremedies to solve the problem. In this paper, the vibration behavior of the offshore platform is analyzed by means of finiteelement (FE) modeling, field measurements and laboratory test. Results of analysis suggest that relative movement andimpact between the piles and the jacket legs exist, i.e. the piles and the jacket are not perfectly connected. The discon-nection of the piles and jacket weakens the overall stiffness of the platform, and therefore produces unexpected excessivevibration. In this study, measures for reducing the excessive vibration are proposed to control the response of the platform .

  3. Thoracic vibrations in stingless bees (Melipona seminigra): resonances of the thorax influence vibrations associated with flight but not those associated with sound production.

    Science.gov (United States)

    Hrncir, Michael; Gravel, Anne-Isabelle; Schorkopf, Dirk Louis P; Schmidt, Veronika M; Zucchi, Ronaldo; Barth, Friedrich G

    2008-03-01

    Bees generate thoracic vibrations with their indirect flight muscles in various behavioural contexts. The main frequency component of non-flight vibrations, during which the wings are usually folded over the abdomen, is higher than that of thoracic vibrations that drive the wing movements for flight. So far, this has been concluded from an increase in natural frequency of the oscillating system in association with the wing adduction. In the present study, we measured the thoracic oscillations in stingless bees during stationary flight and during two types of non-flight behaviour, annoyance buzzing and forager communication, using laser vibrometry. As expected, the flight vibrations met all tested assumptions for resonant oscillations: slow build-up and decay of amplitude; increased frequency following reduction of the inertial load; and decreased frequency following an increase of the mass of the oscillating system. Resonances, however, do not play a significant role in the generation of non-flight vibrations. The strong decrease in main frequency at the end of the pulses indicates that these were driven at a frequency higher than the natural frequency of the system. Despite significant differences regarding the main frequency components and their oscillation amplitudes, the mechanism of generation is apparently similar in annoyance buzzing and forager vibrations. Both types of non-flight vibration induced oscillations of the wings and the legs in a similar way. Since these body parts transform thoracic oscillations into airborne sounds and substrate vibrations, annoyance buzzing can also be used to study mechanisms of signal generation and transmission potentially relevant in forager communication under controlled conditions.

  4. Vibrations on board and health effects

    DEFF Research Database (Denmark)

    Jensen, Anker; Jepsen, Jørgen Riis

    2014-01-01

    There is only limited knowledge of the exposure to vibrations of ships’ crews and their risk of vibration-induced health effects. Exposure to hand-arm vibrations from the use of vibrating tools at sea does not differ from that in the land-based trades. However, in contrast to most other work places......, seafarers are also exposed to vibrations to the feet when standing on vibrating surfaces onboard. Anecdotal reports have related the development of “white feet” to local exposure to vibration, e.g. in mining, but this connection has not been investigated in the maritime setting. As known from studies...... of the health consequences of whole body vibrations in land-transportation, such exposure at sea may affect ships’ passengers and crews. While the relation of back disorders to high levels of whole body vibration has been demonstrated among e.g. tractor drivers, there are no reported epidemiological evidence...

  5. Vibration Compensation for Scanning Tunneling Microscope

    Institute of Scientific and Technical Information of China (English)

    LI Meng-chao; FU Xing; WEI Xiao-lei; HU Xiao-tang

    2003-01-01

    The influence of vibration is already one of main obstacles for improving the nano measuring accuracy.The techniques of anti-vibration,vibration isolation and vibration compensation become an important branch in nano measuring field.Starting with the research of sensitivity to vibration of scanning tunneling microscope(STM),the theory,techniques and realization methods of nano vibration sensor based on tunnel effect are initially investigated,followed by developing the experimental devices.The experiments of the vibration detection and vibration compensation are carried out.The experimental results show that vibration sensor based on tunnel effect is characterized by high sensitivity,good frequency characteristic and the same vibratory response characteristic consistent with STM.

  6. Investigation for parametric vibration of rolling mill

    Institute of Scientific and Technical Information of China (English)

    唐华平; 丁睿; 吴运新; 钟掘

    2002-01-01

    The vibration unsteady condition of rolling mill caused by flexural vibration of strip has been investigated. The parametric flexural vibration equation of rolled strip has been established. The parametric flexural vibration stability of rolled strip has been studied and the regions of stability and unstability have been determined based on Floquet theory and perturbation method. The flexural-vibration of strip is unstable when the frequency of variable tension is two times as the natural frequency of flexural-vibration strip. The characteristic of current in a temp driving motor's main loop has been studied and tested, it has been proved that there are 6 harmonic component and 12 harmonic component in main loop of driving motor electricity. The vertical vibration of working roller has been tested, the test result approves that the running unsteady is caused by parametric vibration. It attaches importance to the parametric vibration of rolling mill.

  7. Comparative Vibration Levels Perceived Among Species in a Laboratory Animal Facility

    Science.gov (United States)

    Norton, John N; Kinard, Will L; Reynolds, Randall P

    2011-01-01

    The current study was performed to determine the vibration levels that were generated in cages on a ventilated rack by common construction equipment in frequency ranges likely to be perceived by humans, rats, and mice. Vibration generated by the ventilated rack blower caused small but significant increases in some of the abdominal, thoracic, and head resonance frequency ranges (RFR) and sensitivity frequency ranges (SFR) in which each species is most likely to be affected by and perceive vibration, respectively. Vibration caused by various items of construction equipment at 3 ft from the cage were evaluated relative to the RFR and SFR of humans, rats, and mice in 3 anatomic locations. In addition, the vibration levels in the RFR and SFR that resulted from the use of a large jackhammer and were measured at various locations and distances in the facility and evaluated in terms of humans, rats, and mice in 3 anatomic locations. Taken together, the data indicate that a given vibration source generates vibration in frequency ranges that are more likely to affect rats and mice as compared with humans. PMID:22330711

  8. Comparative vibration levels perceived among species in a laboratory animal facility.

    Science.gov (United States)

    Norton, John N; Kinard, Will L; Reynolds, Randall P

    2011-09-01

    The current study was performed to determine the vibration levels that were generated in cages on a ventilated rack by common construction equipment in frequency ranges likely to be perceived by humans, rats, and mice. Vibration generated by the ventilated rack blower caused small but significant increases in some of the abdominal, thoracic, and head resonance frequency ranges (RFR) and sensitivity frequency ranges (SFR) in which each species is most likely to be affected by and perceive vibration, respectively. Vibration caused by various items of construction equipment at 3 ft from the cage were evaluated relative to the RFR and SFR of humans, rats, and mice in 3 anatomic locations. In addition, the vibration levels in the RFR and SFR that resulted from the use of a large jackhammer and were measured at various locations and distances in the facility and evaluated in terms of humans, rats, and mice in 3 anatomic locations. Taken together, the data indicate that a given vibration source generates vibration in frequency ranges that are more likely to affect rats and mice as compared with humans.

  9. Railway cuttings and embankments: Experimental and numerical studies of ground vibration.

    Science.gov (United States)

    Kouroussis, Georges; Connolly, David P; Olivier, Bryan; Laghrouche, Omar; Costa, Pedro Alves

    2016-07-01

    Railway track support conditions affect ground-borne vibration generation and propagation. Therefore this paper presents a combined experimental and numerical study into high speed rail vibrations for tracks on three types of support: a cutting, an embankment and an at grade section. Firstly, an experimental campaign is undertaken where vibrations and in-situ soil properties are measured at three Belgian rail sites. A finite element model is then developed to recreate the complex ground topology at each site. A validation is performed and it is found that although the at-grade and embankment cases show a correlation with the experimental results, the cutting case is more challenging to replicate. Despite this, each site is then analysed to determine the effect of earthworks profile on ground vibrations, with both the near and far fields being investigated. It is found that different earthwork profiles generate strongly differing ground-borne vibration characteristics, with the embankment profile generating lower vibration levels in comparison to the cutting and at-grade cases. Therefore it is concluded that it is important to consider earthwork profiles when undertaking vibration assessments.

  10. SIMULATION OF VIBRATION STRESS RELIEF AFTER WELDING BASED ON FEM

    Institute of Scientific and Technical Information of China (English)

    X.C.Zhao; Y.D.Zhang; H.W.Zhang; Q.Wu

    2008-01-01

    A finite element model is developed for the simulation of vibration stress relief (VSR) after welding.For the nonresonant vibration,the reduction in stress strongly depends on the amplitude of vibration.For the resonant vibration,the vibration frequency is the key for stress relief.The vibration frequency should be close to the structure natural frequency for the desired vibration mode.Only small vibration amplitude is required,which will be amplified during vibration.Vibration time does not have a major impact on vibration stress relief.When the amplitude of vibration stress relief is large,the treatment will be more effective.

  11. Development of a semi-active dynamic vibration absorber for longitudinal vibration of propulsion shaft system based on magnetorheological elastomer

    Science.gov (United States)

    Liu, Gaoyu; Lu, Kun; Zou, Donglin; Xie, Zhongliang; Rao, Zhushi; Ta, Na

    2017-07-01

    The control of the longitudinal pulsating force and the vibration generated is very important to improve the stealth performance of a submarine. Magnetorheological elastomer (MRE) is a kind of intelligent composite material, whose mechanical properties can be continuously, rapidly and reversibly controlled by an external magnetic field. It can be used as variable-stiffness components in the design of a semi-active dynamic vibration absorber (SDVA), which is one of the effective means of longitudinal vibration control. In this paper, an SDVA is designed based on the MRE’s magnetic-induced variable stiffness characteristic. Firstly, a mechanical model of the propulsion shaft system with the SDVA is proposed, theoretically discussed and numerically validated. Then, the mechanical performance of the MRE under different magnetic fields is tested. In addition, the magnetic circuit and the overall structure of the SDVA are designed. Furthermore, electromagnetic and thermodynamic simulations are carried out to guarantee the structural design. The frequency shift property of the SDVA is found through dynamic simulations and validated by a frequency shift experiment. Lastly, the vibration absorption capacity of the SDVA is investigated. The results show that the magnetorheological effect of the MRE and the frequency shift of the SDVA are obvious; the SDVA has relatively acceptable vibration absorption capacity.

  12. Vibrations to Waves

    Science.gov (United States)

    Sillitto, Winifred

    1977-01-01

    Presented is the design of an electrical analogue of the simple pendulum--a one-dimensional oscillator resonating within a frequency range which can be generated and observed with readily available instruments. One possible study sequence is outlined. (Author/MA)

  13. Vibrational Microspectroscopy for Cancer Screening

    Directory of Open Access Journals (Sweden)

    Fiona M. Lyng

    2015-02-01

    Full Text Available Vibrational spectroscopy analyses vibrations within a molecule and can be used to characterise a molecular structure. Raman spectroscopy is one of the vibrational spectroscopic techniques, in which incident radiation is used to induce vibrations in the molecules of a sample, and the scattered radiation may be used to characterise the sample in a rapid and non-destructive manner. Infrared (IR spectroscopy is a complementary vibrational spectroscopic technique based on the absorption of IR radiation by the sample. Molecules absorb specific frequencies of the incident light which are characteristic of their structure. IR and Raman spectroscopy are sensitive to subtle biochemical changes occurring at the molecular level allowing spectral variations corresponding to disease onset to be detected. Over the past 15 years, there have been numerous reports demonstrating the potential of IR and Raman spectroscopy together with multivariate statistical analysis techniques for the detection of a variety of cancers including, breast, lung, brain, colon, oral, oesophageal, prostate and cervical cancer. This paper discusses the recent advances and the future perspectives in relation to cancer screening applications, focussing on cervical and oral cancer.

  14. Remote Electromagnetic Vibration of Steerable Needles for Imaging in Power Doppler Ultrasound.

    Science.gov (United States)

    Cabreros, Sarah S; Jimenez, Nina M; Greer, Joseph D; Adebar, Troy K; Okamura, Allison M

    2015-05-01

    Robotic needle steering systems for minimally invasive medical procedures require complementary medical imaging systems to track the needles in real time. Ultrasound is a promising imaging modality because it offers relatively low-cost, real-time imaging of the needle. Previous methods applied vibration to the base of the needle using a voice coil actuator, in order to make the needle visible in power Doppler ultrasound. We propose a new method for needle tip vibration, using electromagnetic actuation of small permanent magnets placed inside the needle to improve needle tip visibility in power Doppler imaging. Robotic needle insertion experiments using artificial tissue and ex vivo porcine liver showed that the electromagnetic tip vibration method can generate a stronger Doppler response compared to the previous base vibration method, resulting in better imaging at greater needle depth in tissue. It also eliminates previous issues with vibration damping along the shaft of the needle.

  15. Advanced tip design for liquid phase vibration mode atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Muramatsu, Hiroshi; Yamamoto, Yuji [School of Bionics, Tokyo University of Technology, 1404-1 Katakura, Hachioji, Tokyo 192-0982 (Japan); Shigeno, Masatsugu; Shirakawabe, Yoshiharu; Inoue, Akira [Technology Center, Seiko Instruments Inc., 563 Takatsukashinden, Matsudo, Chiba 271-2222 (Japan); Kim, Woo-Sik [Department of Chemical Engineering, Kyunghee University, Kyungki-Do 449-701 (Korea, Republic of); Kim, Seung Jin; Chang, Sang-Mok [Department of Chemical Engineering, Hadan 840, Saha-Gu, Busan 604-714 (Korea, Republic of); Kim, Jong Min [Department of Chemical Engineering, Hadan 840, Saha-Gu, Busan 604-714 (Korea, Republic of)], E-mail: jmkim3@dau.ac.kr

    2008-03-24

    We have fabricated polymer tips for atomic force microscopy in order to elucidate the effects of tip length and shape on cantilever vibration damping in liquids. The vibration damping is investigated by measuring the vibration amplitude of cantilevers as a function of tip-sample distance. The cantilever with a short tip provides a higher damping effect over long tip-sample distances. When the vibration amplitude was rescaled to show the effect of the cantilever width on oscillation damping, the vibration amplitude of cantilevers with various tip lengths was similarly obtained in a long distance range over 50 {mu}m. This similarity is explained by an acoustic damping model in which an acoustic wave is generated by the cantilever. Finally, the results indicate a cantilever with a sufficiently long tip compared to the cantilever width can dramatically reduce the long-range damping effect in a liquid environment.

  16. Track-position and vibration control simulation for strut of the Stewart platform

    Institute of Scientific and Technical Information of China (English)

    Zhao-dong XU; Chen-hui WENG

    2013-01-01

    Vibrations inherently generated by on-board disturbance sources degrade the performance of the instruments in an on-orbit spacecraft, which have stringent accuracy requirements.The Stewart platform enables both track-positioning and vibration control.The strut of the Stewart platform is designed as a piezoelectric (PZT) element in series with a voice coil motor (VCM) element and a viscoelastic element.The track-positioning system uses a VCM as the main positioning control driver and a PZT as the positioning compensator.The vibration control system uses the characteristics of struts including active and passive control elements to attenuate the vibration.Simulation results indicate that the Stewart platform with the designed struts has good performance in tracking and vibration attenuation with different interference waves.

  17. Analysis of vibration and pressure pulsation in positive displacement drilling motors

    Energy Technology Data Exchange (ETDEWEB)

    Hamlin, D.B.; Dreesen, D.S.

    1998-12-31

    Three, Moineau principle, positive displacement (drilling) motors were tested on a dynamometer using water, air/mist, and foam. In conjunction with a traditional motor performance test, data were collected at 5000 samples per second using an adapted seismic data acquisition system. Shaft speed, torque, pressure, and three-axis vibration data were processed using Seismic Analysis Code (SAC) to obtain energy density spectrums (EDSs). Cascade plots were generated by plotting the EDSs against shaft speed. The cascade plots revealed that pressure pulses and motor vibrations are closely related to the eccentric rotation of the rotor in the power section. Excessive no-load vibrations were not observed in the small motors and test apparatus used; increasing torque usually decreases the amplitude of vibrations observed. Motor vibration amplitudes were as a rule not increased when compressible fluids were substituted for water.

  18. Passive Micro Vibration Isolator Utilizing Flux Pinning Effect for Satellites

    Science.gov (United States)

    Shibata, Takuma; Sakai, Shin-ichiro

    2016-09-01

    Information related to the origin of space and evolution of galaxy can be obtained using the observation satellites. In recent years, high pointing accuracy is demanded for getting more detailed data about distant stars and galaxies. As a result, vibration isolators that consist of a main structure and a TTM (Tip Tilt Mirror) have been adopted for observation satellites. However, cutting the low frequency vibrations off passively with the conventional methods is difficult. A vibration isolator that uses pinning effect is proposed for solving this problem. The pinning effect is acquired by cooling the type-II superconductor below the critical temperature and it generates a pinning force to maintain the relative distance and attitude between a type- II superconductor and a material that generates magnetic flux. The mission part and the bus part of the satellite are equipped with superconductors and permanent magnets and these parts perform short distance formation flight by applying the effect. This method can cut vibrations from low to high frequency bands off passively. In addition, Meissner effect can prevent collision of the mission and bus parts. In order to investigate the performance of this system, experiments and simulations are carried out and the results are discussed.

  19. Torsional Vibration of a Shafting System under Electrical Disturbances

    Directory of Open Access Journals (Sweden)

    Ling Xiang

    2012-01-01

    Full Text Available Torsional vibration responses of a nonlinear shafting system are studied by a modified Riccati torsional transfer matrix combining with the Newmark-β method. Firstly, the system is modeled as a chain consisting of an elastic spring with concentrated mass points, from which a multi-segment lumped mass model is established. Secondly, accumulated errors are eliminated from the eigenfrequencies and responses of the system's torsional vibration by this newly developed procedure. The incremental transfer matrix method, combining the modified Riccati torsional transfer matrix with Newmark-β method, is further applied to solve the dynamical equations for the torsional vibration of the nonlinear shafting system. Lastly, the shafting system of a turbine-generator is employed as an illustrating example, and simulation analysis has been performed on the transient responses of the shaft's torsional vibrations during typical power network disturbances, such as three-phase short circuit, two-phase short circuit and asynchronous juxtaposition. The results validate the present method and are instructive for the design of a turbo-generator shaft.

  20. Influence of Cable Vibrations on Connectors Used in Automotive Applications

    Directory of Open Access Journals (Sweden)

    AMEL Bouzera

    2012-10-01

    Full Text Available In order to determine the influence of cable vibrations on the contact resistance of connectors, the cable resonant frequency and the resulting movement of both parts of the connector have been studied. The increase of contact voltage, followed by rapidfluctuations generated by wear particles, has been analysed. A test bench designed to monitor wire vibrations was used while the transferred amplitude was measured by a high sensitivity displacement sensor. The contact interface was made of copper alloy and tin coated. The connector was connected to a resistive power supplytransmitting different currents and voltage values. Two investigations were performed on the contact voltage measured with a fast sampling oscilloscope which enabled histograms and a Fast FourierTransform analysis to be obtained. The appearance of contact fluctuations observed during the fretting generated by cable vibrations, and depending upon the wear effect, is attributed toelectromechanical phenomena. Some slow fluctuations are well correlated to the vibration period while the rapid ones are linked to an electrical conduction perturbation in the granular interface caused by the connector movement.

  1. Ultrasonic metal welding with a vibration source using longitudinal and torsional vibration transducers

    Science.gov (United States)

    Asami, Takuya; Tamada, Yosuke; Higuchi, Yusuke; Miura, Hikaru

    2017-07-01

    Conventional ultrasonic metal welding for joining dissimilar metals uses a linear vibration locus, although this method suffers from problems such as low overall weld strength. Our previous studies have shown that ultrasonic welding with a planar vibration locus improves the weld strength. However, the vibration source in our previous studies had problems in longitudinal-torsional vibration controllability and small welding tip. Therefore, the study of the optimal shape of the vibration locus was difficult. Furthermore, improvement of weld strength cannot be expected. We have developed a new ultrasonic vibration source that can control the longitudinal-torsional vibration and can connect to a large welding tip. In this study, we clarified the longitudinal-torsional vibration controllability of the developed ultrasonic vibration source. Moreover, we clarified that using the planar locus of the developed vibration source produced a higher weld strength than our previous studies, and clarified the optimal shape of the vibration locus.

  2. Vibration analysis of atomising discs

    Energy Technology Data Exchange (ETDEWEB)

    Deng, H; Ouyang, H, E-mail: H.Ouyang@liverpool.ac.u [Department of Engineering, University of Liverpool, Liverpool L69 3GH (United Kingdom)

    2009-08-01

    The centrifugal atomisation of metallic melts using a spinning disc is an important process for powder production and spray deposition. In the manufacturing process the high-temperature melt flows down to the surface of the atomising disc spinning at very high speed. It is observed that there is a hydraulic jump of the melt flow prior to atomisation. In this paper, the dynamic model of the atomising disc as a spinning Kirchhoff plate with this hydraulic jump is established. The flowing melt is modelled as moving mass and weight force in the radial direction. Using a Galerkin method, it is found that the vibration properties of the atomising disc vary with the disc clamping ratio. The amplitude of the vibration is largely raised when the clamping ratio is smaller than the critical jump radius ratio. It is also found that the disc vibration is non-stationary before becoming steady and the amplitude decreases with increasing disc speed.

  3. Mechanical Vibrations Modeling and Measurement

    CERN Document Server

    Schmitz, Tony L

    2012-01-01

    Mechanical Vibrations:Modeling and Measurement describes essential concepts in vibration analysis of mechanical systems. It incorporates the required mathematics, experimental techniques, fundamentals of modal analysis, and beam theory into a unified framework that is written to be accessible to undergraduate students,researchers, and practicing engineers. To unify the various concepts, a single experimental platform is used throughout the text to provide experimental data and evaluation. Engineering drawings for the platform are included in an appendix. Additionally, MATLAB programming solutions are integrated into the content throughout the text. This book also: Discusses model development using frequency response function measurements Presents a clear connection between continuous beam models and finite degree of freedom models Includes MATLAB code to support numerical examples that are integrated into the text narrative Uses mathematics to support vibrations theory and emphasizes the practical significanc...

  4. Vibration suppression using smart structures

    Science.gov (United States)

    Garcia, Ephrahim; Inman, Daniel J.; Dosch, Jeffrey

    1991-01-01

    The control of structures for vibration suppression is discussed in the context of using smart materials and structures. Here the use of smart structures refers to using embedded piezoelectric devices as both control actuators and sensors. Using embedded sensors and actuators allows great improvements in performance over traditional structures (both passive and active) for vibration suppression. The application of smart structures to three experimental flexible structures is presented. The first is a flexible beam, the second is a flexible beam undergoing slewing motion, the third is a ribbed antenna. A simple model of a piezoelectric actuator/sensor is presented. The equations of motion for each structure is presented. The control issues considered as those associated with multi-input, multi-output control, PID control and LQR control implementation. A modern control analysis illustrates the usefulness of smart structures for vibration suppression.

  5. Source model for blasting vibration

    Institute of Scientific and Technical Information of China (English)

    DING; Hua(丁桦); ZHENG; Zhemin(郑哲敏)

    2002-01-01

    By analyzing and comparing the experimental data, the point source moment theory and the cavity theory, it is concluded that the vibrating signals away from the blasting explosive come mainly from the natural vibrations of the geological structures near the broken blasting area. The source impulses are not spread mainly by the inelastic properties (such as through media damping, as believed to be the case by many researchers) of the medium in the propagation pass, but by this structure. Then an equivalent source model for the blasting vibrations of a fragmenting blasting is proposed, which shows the important role of the impulse of the source's time function under certain conditions. For the purpose of numerical simulation, the model is realized in FEM, The finite element results are in good agreement with the experimental data.

  6. Fuzzy Sliding Mode Control of Plate Vibrations

    Directory of Open Access Journals (Sweden)

    Manu Sharma

    2010-01-01

    Full Text Available In this paper, fuzzy logic is meshed with sliding mode control, in order to control vibrations of a cantilevered plate. Test plate is instrumented with a piezoelectric sensor patch and a piezoelectric actuator patch. Finite element method is used to obtain mathematical model of the test plate. A design approach of a sliding mode controller for linear systems with mismatched time-varying uncertainties is used in this paper. It is found that chattering around the sliding surface in the sliding mode control can be checked by the proposed fuzzy sliding mode control approach. With presented fuzzy sliding mode approach the actuator voltage time response has a smooth decay. This is important because an abrupt decay can excite higher modes in the structure. Fuzzy rule base consisting of nine rules, is generated from the sliding mode inequality. Experimental implementation of the control approach verify the theoretical findings. For experimental implementation, size of the problem is reduced using modal truncation technique. Modal displacements as well as velocities of first two modes are observed using real-time kalman observer. Real time implementation of fuzzy logic based control has always been a challenge because a given set of rules has to be executed in every sampling interval. Results in this paper establish feasibility of experimental implementation of presented fuzzy logic based controller for active vibration control.

  7. Handheld vibration effects shoulder motion.

    Science.gov (United States)

    Tripp, B L; Eberman, L E; Dwelly, P M

    2009-12-01

    We explored effects of handheld vibration on glenohumeral motion in competitive overhead-throwing athletes. We used a randomized, blinded pre-test post-test cross-over design. Each arm of each subject experienced 2 conditions (1-control, 1-experimental), each with pre-test and post-test measures; the order of which was randomized. Participants included Division-I baseball and softball players (n=35: age=20+/-2 yr, height=178+/-9 cm, mass=84+/-12 kg, years of sport participation=13+/-4 yrs). During the experimental condition, participants held a vibrating (2.2 mm, 15 Hz, 20 s), 2.55 kg (5.62 lbs) Mini-VibraFlex dumbbell (Orthometric, New York, NY) in neutral glenohumeral rotation. During the control condition, participants held the still dumbbell (0 mm, 0 Hz, 20 s). Participants rested one min after each trial (3). We used a digital protractor to assess range of motion bilaterally, employing a standard technique for measuring maximal internal (IR) and external rotation (ER). Repeated-measures analyses of variance indicated that range of dominant IR increased 6.8% ( P=0.001, ES=0.16) after handheld vibration. Handheld vibration did not affect range of dominant ER ( P>0.05, 1-beta=0.20), non-dominant IR ( P>0.05, 1-beta=0.41), or non-dominant ER ( P>0.05, 1-beta=0.05). Short bouts of handheld vibration increased dominant IR in collegiate baseball and softball athletes. These results suggest that handheld vibration may help maintain glenohumeral IR that is vital to the healthy and competitive throwing shoulder.

  8. DOWNHOLE VIBRATION MONITORING & CONTROL SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Martin E. Cobern

    2004-08-31

    The deep hard rock drilling environment induces severe vibrations into the drillstring, which can cause reduced rates of penetration (ROP) and premature failure of the equipment. The only current means of controlling vibration under varying conditions is to change either the rotary speed or the weight-on-bit (WOB). These changes often reduce drilling efficiency. Conventional shock subs are useful in some situations, but often exacerbate the problems. The objective of this project is development of a unique system to monitor and control drilling vibrations in a ''smart'' drilling system. This system has two primary elements: (1) The first is an active vibration damper (AVD) to minimize harmful axial, lateral and torsional vibrations. The hardness of this damper will be continuously adjusted using a robust, fast-acting and reliable unique technology. (2) The second is a real-time system to monitor drillstring vibration, and related parameters. This monitor adjusts the damper according to local conditions. In some configurations, it may also send diagnostic information to the surface via real-time telemetry. The AVD is implemented in a configuration using magnetorheological (MR) fluid. By applying a current to the magnetic coils in the damper, the viscosity of the fluid can be changed rapidly, thereby altering the damping coefficient in response to the measured motion of the tool. Phase I of this program entailed modeling and design of the necessary subsystems and design, manufacture and test of a full laboratory prototype. Phase I of the project was completed by the revised end date of May 31, 2004. The objectives of this phase were met, and all prerequisites for Phase II have been completed.

  9. DOWNHOLE VIBRATION MONITORING & CONTROL SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Martin E. Cobern

    2004-08-31

    The deep hard rock drilling environment induces severe vibrations into the drillstring, which can cause reduced rates of penetration (ROP) and premature failure of the equipment. The only current means of controlling vibration under varying conditions is to change either the rotary speed or the weight-on-bit (WOB). These changes often reduce drilling efficiency. Conventional shock subs are useful in some situations, but often exacerbate the problems. The objective of this project is development of a unique system to monitor and control drilling vibrations in a ''smart'' drilling system. This system has two primary elements: (1) The first is an active vibration damper (AVD) to minimize harmful axial, lateral and torsional vibrations. The hardness of this damper will be continuously adjusted using a robust, fast-acting and reliable unique technology. (2) The second is a real-time system to monitor drillstring vibration, and related parameters. This monitor adjusts the damper according to local conditions. In some configurations, it may also send diagnostic information to the surface via real-time telemetry. The AVD is implemented in a configuration using magnetorheological (MR) fluid. By applying a current to the magnetic coils in the damper, the viscosity of the fluid can be changed rapidly, thereby altering the damping coefficient in response to the measured motion of the tool. Phase I of this program entailed modeling and design of the necessary subsystems and design, manufacture and test of a full laboratory prototype. Phase I of the project was completed by the revised end date of May 31, 2004. The objectives of this phase were met, and all prerequisites for Phase II have been completed.

  10. Correlation of operating parameters on turbine shaft vibrations

    Science.gov (United States)

    Dixit, Harsh Kumar; Rajora, Rajeev

    2016-05-01

    The new generation of condition monitoring and diagnostics system plays an important role in efficient functioning of power plants. In most of the rotating machine, defects can be detected by such a system much before dangerous situation occurs. It allows the efficient use of stationary on-line continuous monitoring system for condition monitoring and diagnostics as well. Condition monitoring of turbine shaft can not only reduce expenses of maintenance of turbo generator of power plants but also prevents likely shutdown of plant, thereby increases plant load factor. Turbo visionary parameters are essential part of health diagnosis system of turbo generator. Particularly steam pressure, steam temperature and lube oil temperature are important parameters to monitor because they are having much influence on turbine shaft vibration and also governing systems are available for change values of those parameters. This paper includes influence of turbo visionary parameters i.e., steam temperature, steam pressure, lube oil temperature, turbine speed and load on turbine shaft vibration at turbo generator at 195 MW unit-6,Kota Super Thermal Power Station by measuring vibration amplitude and analyze them in MATLAB.

  11. Ultrafast vibrations of gold nanorings

    DEFF Research Database (Denmark)

    Kelf, T; Tanaka, Y; Matsuda, O;

    2011-01-01

    elucidate the corresponding mode shapes and find that the substrate plays an important role in determining the mode damping. This study demonstrates the need for a plasmonic nano-optics approach to understand the optical excitation and detection mechanisms for the vibrations of plasmonic nanostructures.......We investigate the vibrational modes of gold nanorings on a silica substrate with an ultrafast optical technique. By comparison with numerical simulations, we identify several resonances in the gigahertz range associated with axially symmetric deformations of the nanoring and substrate. We...

  12. Innovative Techniques Simplify Vibration Analysis

    Science.gov (United States)

    2010-01-01

    In the early years of development, Marshall Space Flight Center engineers encountered challenges related to components in the space shuttle main engine. To assess the problems, they evaluated the effects of vibration and oscillation. To enhance the method of vibration signal analysis, Marshall awarded Small Business Innovation Research (SBIR) contracts to AI Signal Research, Inc. (ASRI), in Huntsville, Alabama. ASRI developed a software package called PC-SIGNAL that NASA now employs on a daily basis, and in 2009, the PKP-Module won Marshall s Software of the Year award. The technology is also used in many industries: aircraft and helicopter, rocket engine manufacturing, transportation, and nuclear power."

  13. Localized vibrations of graphene nanoribbons

    Science.gov (United States)

    Savin, A. V.; Kivshar, Yu. S.

    2016-08-01

    Vibrational modes of graphene nanoribbons are studied. It is demonstrated that in an unstretched graphene nanoribbon, localized vibrations (in the form of breathers) can occur only at the edges. The largest number of localized edge oscillations is expected for the nanoribbons with the armchair structure. Stretching of a nanoribbon can lead to the appearance of new types of strongly localized oscillations. When a nanoribbon is stretched, in its oscillatory spectrum a frequency gap appears in which the frequencies of the localized modes are located. An armchair nanoribbon can support localized modes only at its edges, while a highly stretched zigzag nanoribbon can support them both at the edges and inside the nanoribbon.

  14. Characteristics of Vibration Induced by Cavitation

    Institute of Scientific and Technical Information of China (English)

    WANG Guo-yu; TAO Lei; LIU Shu-yan; QIAN Jian-jun

    2005-01-01

    Cavitation-induced vibration characteristics and the relations between the vibration and cavitation are studied. Cavitation vibrations are measured around a model hollow-jet valve by an accelerometer under cavitating and non-cavitating conditions. The measurement data is analyzed by FFT method. The corresponding cavitating flow patterns are photographed by a high-speed camera with an xenon flash lamp. The frequency band of the vibration induced by cavitation is determined. To compare the vibration intensities under different cavitation conditions, a definition of vibration acceleration level is introduced based on power spectral density of the vibration. By the analysis of vibration, the definitions of characteristic cavitation number are suggested. According to these cavitation numbers, the cavitation process is divided into three stages, that is, incipient cavitation, subcavitation and supercavitation.

  15. Ultrasonic vibration for structural health monitoring

    Science.gov (United States)

    Liang, Y.; Yan, F.; Borigo, C.; Rose, J. L.

    2013-01-01

    Guided waves and vibration analysis are two useful techniques in Nondestructive Evaluation and Structural Health Monitoring. Bridging the gap between guided waves and vibration, a novel testing method ultrasonic vibration is demonstrated here. Ultrasonic vibration is capable to achieve defect detection sensitivity as ultrasonic guided waves, while maintaining the efficiency of traditional vibration in the way of adopting several sensors to cover the whole structure. In this new method, continuous guided wave energy will impinge into the structure to make the structure vibrate steadily. The steady state vibration is achieved after multiple boundary reflections of the continuous guided wave. In ultrasonic vibration experiments, annual array transducer is used as the actuator. The loading functions are tuned by the frequencies and phase delays among each transducer element. Experiments demonstrate good defect detection ability of by optimally selecting guided wave loadings.

  16. Modelling of vibration of gear transmissions

    Science.gov (United States)

    Zeman, Vladimir; Nemecek, Josef

    The method for mathematical modeling of spatial vibrations of the spur gear transmissions is presented. This method enables a substantial reduction of the number of degrees of freedom with relatively high accuracy in calculating vibration amplitude.

  17. System precisely controls oscillation of vibrating mass

    Science.gov (United States)

    Hancock, D. J.

    1967-01-01

    System precisely controls the sinusoidal amplitude of a vibrating mechanical mass. Using two sets of coils, the system regulates the drive signal amplitude at the precise level to maintain the mechanical mass when it reaches the desired vibration amplitude.

  18. Impact Vibration Attenuation for a Flexible Robotic Manipulator through Transfer and Dissipation of Energy

    Directory of Open Access Journals (Sweden)

    Yushu Bian

    2013-01-01

    Full Text Available Due to the presence of system flexibility, impact can excite severe large amplitude vibration responses of the flexible robotic manipulator. This impact vibration exhibits characteristics of remarkable nonlinearity and strong energy. The main goal of this study is to put forward an energy-based control method to absorb and attenuate large amplitude impact vibration of the flexible robotic manipulator. The method takes advantage of internal resonance and is implemented through a vibration absorber based on the transfer and dissipation of energy. The addition of the vibration absorber to the flexible arm generates a coupling effect between vibration modes of the system. By means of analysis on 2:1 internal resonance, the exchange of energy is proven to be existent. The impact vibrational energy can be transferred from the arm to the absorber and dissipated through the damping of the absorber. The results of numerical simulations are promising and preliminarily verify that the method is feasible and can be used to combat large amplitude impact vibration of the flexible manipulator undergoing rigid motion.

  19. Vibration isolation using six degree-of-freedom quasi-zero stiffness magnetic levitation

    Science.gov (United States)

    Zhu, Tao; Cazzolato, Benjamin; Robertson, William S. P.; Zander, Anthony

    2015-12-01

    In laboratories and high-tech manufacturing applications, passive vibration isolators are often used to isolate vibration sensitive equipment from ground-borne vibrations. However, in traditional passive isolation devices, where the payload weight is supported by elastic structures with finite stiffness, a design trade-off between the load capacity and the vibration isolation performance is unavoidable. Low stiffness springs are often required to achieve vibration isolation, whilst high stiffness is desired for supporting payload weight. In this paper, a novel design of a six degree of freedom (six-dof) vibration isolator is presented, as well as the control algorithms necessary for stabilising the passively unstable maglev system. The system applies magnetic levitation as the payload support mechanism, which realises inherent quasi-zero stiffness levitation in the vertical direction, and zero stiffness in the other five dofs. While providing near zero stiffness in multiple dofs, the design is also able to generate static magnetic forces to support the payload weight. This negates the trade-off between load capacity and vibration isolation that often exists in traditional isolator designs. The paper firstly presents the novel design concept of the isolator and associated theories, followed by the mechanical and control system designs. Experimental results are then presented to demonstrate the vibration isolation performance of the proposed system in all six directions.

  20. Sensitivity of footbridge vibrations to stochastic walking parameters

    Science.gov (United States)

    Pedersen, Lars; Frier, Christian

    2010-06-01

    Some footbridges are so slender that pedestrian traffic can cause excessive vibrations and serviceability problems. Design guidelines outline procedures for vibration serviceability checks, but it is noticeable that they rely on the assumption that the action is deterministic, although in fact it is stochastic as different pedestrians generate different dynamic forces. For serviceability checks of footbridge designs it would seem reasonable to consider modelling the stochastic nature of the main parameters describing the excitation, such as for instance the load amplitude and the step frequency of the pedestrian. A stochastic modelling approach is adopted for this paper and it facilitates quantifying the probability of exceeding various vibration levels, which is useful in a discussion of serviceability of a footbridge design. However, estimates of statistical distributions of footbridge vibration levels to walking loads might be influenced by the models assumed for the parameters of the load model (the walking parameters). The paper explores how sensitive estimates of the statistical distribution of vertical footbridge response are to various stochastic assumptions for the walking parameters. The basis for the study is a literature review identifying different suggestions as to how the stochastic nature of these parameters may be modelled, and a parameter study examines how the different models influence estimates of the statistical distribution of footbridge vibrations. By neglecting scatter in some of the walking parameters, the significance of modelling the various walking parameters stochastically rather than deterministically is also investigated providing insight into which modelling efforts need to be made for arriving at reliable estimates of statistical distributions of footbridge vibrations. The studies for the paper are based on numerical simulations of footbridge responses and on the use of Monte Carlo simulations for modelling the stochastic nature of

  1. Cellulose produced by Gluconacetobacter xylinus strains ATCC 53524 and ATCC 23768: Pellicle formation, post-synthesis aggregation and fiber density.

    Science.gov (United States)

    Lee, Christopher M; Gu, Jin; Kafle, Kabindra; Catchmark, Jeffrey; Kim, Seong H

    2015-11-20

    The pellicle formation, crystallinity, and bundling of cellulose microfibrils produced by bacterium Gluconacetobacter xylinus were studied. Cellulose pellicles were produced by two strains (ATCC 53524 and ATCC 23769) for 1 and 7 days; pellicles were analyzed with scanning electron microscopy (SEM), X-ray diffraction (XRD), vibrational sum-frequency-generation (SFG) spectroscopy, and attenuated total reflectance infrared (ATR-IR) spectroscopy. The bacterial cell population was higher at the surface exposed to air, indicating that the newly synthesized cellulose is deposited at the top of the pellicle. XRD, ATR-IR, and SFG analyses found no significant changes in the cellulose crystallinity, crystal size or polymorphic distribution with the culture time. However, SEM and SFG analyses revealed cellulose macrofibrils produced for 7 days had a higher packing density at the top of the pellicle, compared to the bottom. These findings suggest that the physical properties of cellulose microfibrils are different locally within the bacterial pellicles.

  2. Predicting Statistical Distributions of Footbridge Vibrations

    DEFF Research Database (Denmark)

    Pedersen, Lars; Frier, Christian

    2009-01-01

    The paper considers vibration response of footbridges to pedestrian loading. Employing Newmark and Monte Carlo simulation methods, a statistical distribution of bridge vibration levels is calculated modelling walking parameters such as step frequency and stride length as random variables. The imp......The paper considers vibration response of footbridges to pedestrian loading. Employing Newmark and Monte Carlo simulation methods, a statistical distribution of bridge vibration levels is calculated modelling walking parameters such as step frequency and stride length as random variables...

  3. Theory and Normal Mode Analysis of Change in Protein Vibrational Dynamics on Ligand Binding

    Energy Technology Data Exchange (ETDEWEB)

    Mortisugu, Kei [RIKEN, Japan; Njunda, Brigitte [Computational Molecular Biophysics, Interdisciplinary Center for Scientific Computing (IWR); Smith, Jeremy C [ORNL

    2009-12-01

    The change of protein vibrations on ligand binding is of functional and thermodynamic importance. Here, this process is characterized using a simple analytical 'ball-and-spring' model and all-atom normal-mode analysis (NMA) of the binding of the cancer drug, methotrexate (MTX) to its target, dihydrofolate reductase (DHFR). The analytical model predicts that the coupling between protein vibrations and ligand external motion generates entropy-rich, low-frequency vibrations in the complex. This is consistent with the atomistic NMA which reveals vibrational softening in forming the DHFR-MTX complex, a result also in qualitative agreement with neutron-scattering experiments. Energy minimization of the atomistic bound-state (B) structure while gradually decreasing the ligand interaction to zero allows the generation of a hypothetical 'intermediate' (I) state, without the ligand force field but with a structure similar to that of B. In going from I to B, it is found that the vibrational entropies of both the protein and MTX decrease while the complex structure becomes enthalpically stabilized. However, the relatively weak DHFR:MTX interaction energy results in the net entropy gain arising from coupling between the protein and MTX external motion being larger than the loss of vibrational entropy on complex formation. This, together with the I structure being more flexible than the unbound structure, results in the observed vibrational softening on ligand binding.

  4. Theoretical calculation of ozone vibrational infrared intensities

    Science.gov (United States)

    Adler-Golden, S. M.; Langhoff, S. R.; Bauschlicher, C. W., Jr.; Carney, G. D.

    1985-01-01

    An ab initio dipole moment function for ozone has been computed using the CASSCF (complete active space self-consistent field) method, and forms the basis for a calculation of ozone infrared band intensities. Vibrational wave functions were generated using the variational method with potential energy surfaces derived from experimental force constants. Computed values of the permanent dipole moment, dipole moment derivatives, and infrared band strengths are all found to be in remarkably good agreement with experiment. Intensities are predicted for hot bands for which experimental values are unavailable, and implications for atmospheric ozone spectroscopy are discussed. As the dipole moment matrix element signs are now established for nearly all of the observed bands, further refinement of the dipole moment function is possible.

  5. Vibration damping for the Segmented Mirror Telescope

    Science.gov (United States)

    Maly, Joseph R.; Yingling, Adam J.; Griffin, Steven F.; Agrawal, Brij N.; Cobb, Richard G.; Chambers, Trevor S.

    2012-09-01

    The Segmented Mirror Telescope (SMT) at the Naval Postgraduate School (NPS) in Monterey is a next-generation deployable telescope, featuring a 3-meter 6-segment primary mirror and advanced wavefront sensing and correction capabilities. In its stowed configuration, the SMT primary mirror segments collapse into a small volume; once on location, these segments open to the full 3-meter diameter. The segments must be very accurately aligned after deployment and the segment surfaces are actively controlled using numerous small, embedded actuators. The SMT employs a passive damping system to complement the actuators and mitigate the effects of low-frequency (operating deflection shapes of the mirror and to quantify segment edge displacements; relative alignment of λ/4 or better was desired. The TMDs attenuated the vibration amplitudes by 80% and reduced adjacent segment phase mismatches to acceptable levels.

  6. Tactile perception of skin and skin cream by friction induced vibrations.

    Science.gov (United States)

    Ding, Shuyang; Bhushan, Bharat

    2016-11-01

    Skin cream smooths, softens, and moistens skin by altering surface roughness and tribological properties of skin. Sliding generates vibrations that activate mechanoreceptors located in skin. The brain interprets tactile information to identify skin feel. Understanding the tactile sensing mechanisms of skin with and without cream treatment is important to numerous applications including cosmetics, textiles, and robotics sensors. In this study, frequency spectra of friction force and friction induced vibration signals were carried out to investigate tactile perception by an artificial finger sliding on skin. The influence of normal load, velocity, and cream treatment time were studied. Coherence between friction force and vibration signals were found. The amplitude of vibration decreased after cream treatment, leading to smoother perception. Increasing normal load or velocity between contacting surfaces generated a smoother perception with cream treatment, but rougher perception without treatment. As cream treatment time increases, skin becomes smoother. The related mechanisms are discussed.

  7. Study of core support barrel vibration monitoring using ex-core neutron noise analysis and fuzzy logic algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Christian, Robby; Song, Seon Ho [Nuclear and Quantum Engineering Department, Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Kang, Hyun Gook [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2015-03-15

    The application of neutron noise analysis (NNA) to the ex-core neutron detector signal for monitoring the vibration characteristics of a reactor core support barrel (CSB) was investigated. Ex-core flux data were generated by using a nonanalog Monte Carlo neutron transport method in a simulated CSB model where the implicit capture and Russian roulette technique were utilized. First and third order beam and shell modes of CSB vibration were modeled based on parallel processing simulation. A NNA module was developed to analyze the ex-core flux data based on its time variation, normalized power spectral density, normalized cross-power spectral density, coherence, and phase differences. The data were then analyzed with a fuzzy logic module to determine the vibration characteristics. The ex-core neutron signal fluctuation was directly proportional to the CSB's vibration observed at 8Hz and15Hzin the beam mode vibration, and at 8Hz in the shell mode vibration. The coherence result between flux pairs was unity at the vibration peak frequencies. A distinct pattern of phase differences was observed for each of the vibration models. The developed fuzzy logic module demonstrated successful recognition of the vibration frequencies, modes, orders, directions, and phase differences within 0.4 ms for the beam and shell mode vibrations.

  8. Implementation of alarm system for vibration monitoring of KOMAC facility

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae-Ha; Ahn, Tae-Sung; Song, Young-Gi; Kwon, Hyeok-Jung; Cho, Yong-Sub [KOMAC, Gyeongju (Korea, Republic of)

    2015-05-15

    For operating 100 MeV linac, Devices have to be operated in certain order. Thus malfunction of a device cause damage to linac and related devices. To protect linac, machine protect system (MPS) has been developed. The MPS protects the components by monitoring hardwired signals. When values of operating parameters go beyond or below limit, alarm will be generated and interlock system which stops related devices in certain sequence will run. Other factor, giving damage to linac is disaster. A strong vibration such as earthquake causes malfunction of devices and damage to linac. Against disaster, the monitoring system based on Experimental Physics and Industrial Control System (EPICS) was implemented. Configuration and Implementation of the monitoring system are presented and some preliminary results are reported. KOMAC implemented alarm system for a strong vibration and fire. Alarm is generated in unusual situation. Coping rapidly with situation, damages for Linac and related devices can be reduced.

  9. Non-equilibrium Casimir force between vibrating plates.

    Directory of Open Access Journals (Sweden)

    Andreas Hanke

    Full Text Available We study the fluctuation-induced, time-dependent force between two plates confining a correlated fluid which is driven out of equilibrium mechanically by harmonic vibrations of one of the plates. For a purely relaxational dynamics of the fluid we calculate the fluctuation-induced force generated by the vibrating plate on the plate at rest. The time-dependence of this force is characterized by a positive lag time with respect to the driving. We obtain two distinctive contributions to the force, one generated by diffusion of stress in the fluid and another related to resonant dissipation in the cavity. The relation to the dynamic Casimir effect of the electromagnetic field and possible experiments to measure the time-dependent Casimir force are discussed.

  10. Vibrations of Railroad Due to The Passage of The Underground Train

    Science.gov (United States)

    Konowrocki, Robert; Bajer, Czesław

    2010-03-01

    In the paper we present results of vibration measurements in the train and on the base of the railroad in tunnels of Warsaw Underground. Measurements were performed at straight and curved sections of the track. The paper is focused on the influence of the lateral slip in rail/wheel contact zone on the generation of vibrations and a noise. Vibrations were analyzed in terms of accelerations, velocities or displacements as a function of time and frequency. Results ware compared with the experiment of rolling of the wheel with lateral sleep. In both cases we observed double periodic oscillations.

  11. Resonant vibration control of rotating beams

    DEFF Research Database (Denmark)

    Svendsen, Martin Nymann; Krenk, Steen; Høgsberg, Jan Becker

    2011-01-01

    Rotatingstructures,like e.g.wind turbine blades, may be prone to vibrations associated with particular modes of vibration. It is demonstrated, how this type of vibrations can be reduced by using a collocated sensor–actuator system, governed by a resonant controller. The theory is here demonstrate...

  12. 33 CFR 159.103 - Vibration test.

    Science.gov (United States)

    2010-07-01

    ...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.103 Vibration test. The device... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Vibration test. 159.103 Section... subjected to a sinusoidal vibration for a period of 12 hours, 4 hours in each of the x, y, and z planes, at...

  13. Active Vibration Dampers For Rotating Machinery

    Science.gov (United States)

    Kascack, Albert F.; Ropchock, John J.; Lakatos, Tomas F.; Montague, Gerald T.; Palazzolo, Alan; Lin, Reng Rong

    1994-01-01

    Active dampers developed to suppress vibrations in rotating machinery. Essentially feedback control systems and reciprocating piezoelectric actuators. Similar active damper containing different actuators described in LEW-14488. Concept also applicable to suppression of vibrations in stationary structures subject to winds and earthquakes. Active damper offers adjustable suppression of vibrations. Small and lightweight and responds faster to transients.

  14. Vibration Theory, Vol. 1A

    DEFF Research Database (Denmark)

    Nielsen, Søren R. K.

    The present collection of solved problems has been published as a supplement to the textbook Svingningsteori. Bind 1. Lineær svingningsteori,Aalborg tekniske Universitetsforlag, 1991, whicj is used in the introductory course on linear vibration theory that is being given on th e8th semester at th...

  15. Vibrational Modes of Trumpet Bells

    Science.gov (United States)

    MOORE, T. R.; KAPLON, J. D.; MCDOWALL, G. D.; MARTIN, K. A.

    2002-07-01

    We report on an investigation of the normal modes of vibration of the bells of several modern trumpets. We describe the results of experiments using electronic speckle-pattern interferometry to visualize the modal structure and we show that the mode frequencies follow a generalized version of Chladni's law.

  16. Chladni's law for vibrating plates

    Science.gov (United States)

    Rossing, Thomas D.

    1982-03-01

    The normal vibrational modes of free circular plates can be classified according to the number of nodal diameters m and the number of nodal circles n. Chladni observed that the addition of one nodal circle raised the frequency f about the same amount as adding two nodal diameters, and Rayleigh pointed out that f is proportional to (m+2n)2 for large f. Waller, however, concluded that the number of nodal diameters necessary to raise the frequency as much as a nodal circle varies from two to five. We have examined data on the vibrations of flat and non-flat circular plates and fitted their vibration frequencies to the relationship f = c(m+bn)k. By proper choice of c it is possible to satisfy Chladni's law (b = 2, k = 2) over quite a wide range of frequency in flat plates. Non-flat plates such as cymbals and bells, require different choices of b and k. A brief history of Chladni patterns, and suggestions for observing and demonstrating the vibrational modes of plates are included (AIP).

  17. Vibrational states on Pd surfaces

    Science.gov (United States)

    Sklyadneva, I. Yu.; Rusina, G. G.; Chulkov, E. V.

    1997-04-01

    We present the calculation of vibrational modes and lattice relaxation for the Pd(100), (110) and (111) surfaces. The surface phonon frequencies and polarizations are obtained using embedded-atom potentials. Comparison of the calculated frequency values with available experimental data gives agreement within 0.2 THz.

  18. Ultrafast vibrations of gold nanorings

    DEFF Research Database (Denmark)

    Kelf, T; Tanaka, Y; Matsuda, O

    2011-01-01

    We investigate the vibrational modes of gold nanorings on a silica substrate with an ultrafast optical technique. By comparison with numerical simulations, we identify several resonances in the gigahertz range associated with axially symmetric deformations of the nanoring and substrate. We...

  19. New perspectives on mechanisms of sound generation in songbirds

    DEFF Research Database (Denmark)

    Goller, Franz; Larsen, Ole Næsbye

    2002-01-01

    -tone mechanism similar to human phonation with the labia forming a pneumatic valve. The classical avian model proposed that vibrations of the thin medial tympaniform membranes are the primary sound generating mechanism. As a direct test of these two hypotheses we ablated the medial tympaniform membranes in two......The physical mechanisms of sound generation in the vocal organ, the syrinx, of songbirds have been investigated mostly with indirect methods. Recent direct endoscopic observation identified vibrations of the labia as the principal sound source. This model suggests sound generation in a pulse...... atmosphere) as well as direct (labial vibration during tonal sound) measurements of syringeal vibrations support a vibration-based soundgenerating mechanism even for tonal sounds....

  20. Ground vibrations due to pile and sheet pile driving : prediction models of today

    OpenAIRE

    Deckner, Fanny; Viking, Kenneth; Hintze, Staffan

    2012-01-01

    As part of aconstruction work pile and sheet pile driving unavoidably generates vibrations.As of today construction works are often located in urban areas and along withsociety’s increasing concern of environmental impact the need for vibrationprediction prior to construction is of immediate interest. This study presents a review of the predictionmodels existing today. For prediction of ground vibrations from pile and sheetpile driving there are roughly three different types of models; empiri...