WorldWideScience

Sample records for gaza hukkunute arv

  1. Maailma kriitikat trotsiv Iisrael jätkab Gaza blokeerimist / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2010-01-01

    ÜRO Julgeolekunõukogu arutas maailma avalikkuse meelepaha pälvinud Iisraeli erioperatsiooni Gazasse suunduvate abilaevadega, milles hukkunute arv on ikka veel ebaselge. ÜRO leidis, et kokkupõrke asjaolud peab välja selgitama sõltumatu uurimine

  2. Social arv

    DEFF Research Database (Denmark)

    Jensen, Bente

    Denne publikation er det første arbejdspapir/rapport i serien om forskningsprojektet "Handlekompetence i pædagogisk arbejde med socialt udsatte børn og unge - indsats og effekt (HPA-projektet). Social arv og det deraf afledte begreb om 'udsatte børn', som er det samfundsproblem, der danner rammen...... om HPA-projektets intervenstionsdel og -analyser er ikke et entydigt begreb. Formålet med papiret er derfor at indkredse diskussionen om social arv set som reproduktion af ulighed og på den baggrund belyse relevante indikatorer som kan tjene som baggrundvariable i studiet af effekter i relation til...... samfundets institutionelle mulighder for at skabe fornyelse på det sociale område gennem social intervention...

  3. Anaesthesia and ARV

    African Journals Online (AJOL)

    Adele

    As more and more HIV infected patients gain access to antiretroviral medication, this drug class and its patients have gained particular significance for anaesthetists. This paper offers an overview of antiretrovirals (ARV) with a specific focus on the implications for anaesthetic management. The four main classes of ARV's are ...

  4. Social opdrift - social arv

    DEFF Research Database (Denmark)

    Ejrnæs, Morten; Gabrielsen, G.; Nørrung, Per

    "Social opdrift - social arv" stiller på flere måder spørgsmål ved begrebet social arv. Bogen konkluderer blandt andet, at langt de fleste børn, der opvokser i en socialt belastet familie, bliver velfungerende voksne. Professionelle, der møder socialt belastede familier, har derfor et stort ansvar....... Naturligvis skal der tages hånd om udsatte børn, men det kræver samtidig stor opmærksomhed at sørge for, at fokuseringen på den sociale arv ikke tager overhånd, så det bliver en selvopfyldende profeti."Social opdrift - social" arv viser, hvordan forskningsresultater er blevet fremlagt på en måde, som har...... medvirket til at skabe en skæv opfattelse af, at forældrenes problemer er hovedårsag til børns sociale problemer. I selvstændige analyser vises, hvordan data, der normalt bruges som "bevis" for den sociale arvs betydning, tydeligt illustrerer, at det er en undtagelse, at børn får sociale problemer af samme...

  5. (ARV) treatment training programme

    African Journals Online (AJOL)

    A successful ARV programme requires that all components of a functional management system be put in place for effective and efficient functioning. This would include logistics, human resources, financial planning, and monitoring and evaluation systems, as well as sustainable institutional capacities. The Nigerian national ...

  6. (ARV) treatment training programme

    African Journals Online (AJOL)

    Winnie

    successful ARV programme requires that all components of a functional management system be put in place for ... It examines knowledge and skills gained, ... Oluwole Odutolu is a public health physician and consultant monitoring and evaluation specialist to the World Bank/UNAIDS Global HIV/AIDS Monitoring and.

  7. Heideggers sorte arv

    DEFF Research Database (Denmark)

    Olesen, Søren Gosvig

    2015-01-01

    Martin Heidegger var antisemit, men er hans tænkning og intellektuelle arv det også? Søren Gosvig Olesen opsøger den store tyske tænkers arvinger og bindene fra 1938-48 i Heideggers efterladte ’Sorte hæfter’, hvor den lille mands meninger blander sig med en stor tænkers tanker......Martin Heidegger var antisemit, men er hans tænkning og intellektuelle arv det også? Søren Gosvig Olesen opsøger den store tyske tænkers arvinger og bindene fra 1938-48 i Heideggers efterladte ’Sorte hæfter’, hvor den lille mands meninger blander sig med en stor tænkers tanker...

  8. Social arv og ulighed

    DEFF Research Database (Denmark)

    Jensen, Bente

    2017-01-01

    Artiklen søger at komme tættere på spørgsmål om hvordan dagtilbud kan gøre en forskel for social udsatte børn ved for det første at indkredse forskning om dagtilbuds betydning set i relation til en social arv- og ulighedsproblematik. For det andet belyses eksempler fra dansk interventionsforskning...

  9. Gaza võitmatu armaada / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2010-01-01

    Katsest viia laevadega humanitaarabi Gaza sektorisse. Autor on arvamusel, et kui Vabaduse laevastik ongi saavutanud soovitu ja murdnud blokaadi, siis uus tasakaal pole julgeoleku mõttes sugugi kindlam

  10. West Bank Gaza Geo-MIS System

    Data.gov (United States)

    US Agency for International Development — The Geo-MIS System is USAID/West Bank and Gaza's primary system for capturing and managing projectrelated information. Its purpose is to assist USAID and its...

  11. Expanding community through ARV provision in Thailand.

    Science.gov (United States)

    Lyttleton, C; Beesey, A; Sitthikriengkrai, M

    2007-01-01

    Anti-retrovirals (ARVs) have altered the complexion of HIV/AIDS management in Thailand. In 2005, ARVs were included within a subsidised health scheme making provision widespread. Increased access has been brought about through the legal and political advocacy of the Thai Network for People Living with HIV/AIDS (TNP+) who now play a central role in expanded ARV provision. HIV-infected volunteers help the state deliver comprehensive services and assist with follow-up and adherence programs. Alongside improvements in drug provision, a focus on pharmaceutical treatment has left other issues, such as community support of orphans and the social responses to living with HIV, less central within community responses. As they take on new responsibilities, people living with HIV/AIDS (PLHA) groups move from activities focused on reversing local stigma to constitute a new social movement that is increasingly prominent in Thai civil society. Networks of PLHA confront new social and political challenges as they also seek to broaden access to marginalised groups who remain excluded from these services. Many ethnic minority groups without full Thai citizenship have been denied access to subsidised health services including ARVs. As part of a broadening advocacy profile, the PLHA movement is now engaging in a politics of difference defined not simply by presence or absence of HIV but also by wider issues of national identity and belonging.

  12. Towards universal ARV access: Achievements and challenges in ...

    African Journals Online (AJOL)

    Information on staff training, vacancy rates and funding allocations for the ARV roll-out was obtained from official government reports. Projections were made of expected new ARV enrolments for 2008 and 2009 and compared with goals set by the National Strategic Plan (NSP) to achieve universal access to ARVs by 2011.

  13. The Zeus from Gaza re-examined

    Directory of Open Access Journals (Sweden)

    Ovadiah, Asher

    1997-12-01

    Full Text Available The re-examination of the monumental statue of Zeus from Gaza, nowadays exhibited in the Istanbul Archaeological Museums, comprises an iconographical, as well as a stylistic comparative analysis. Comparisons with monumental sculpture (Jupiter Verospi, Jupiter Otricoli, Capitoline Jupiter from Carthage, and the Zeus in the Metropolitan Museum of Art, statuettes, and other artistic media (vase painting, gems, coins indicate that this work of art shows an eclectic character of various artistic trends and concepts, based on Classical-Hellenistic features. It is plausible to conclude that the Zeus from Gaza is a Roman work of art, created by an anonymous artist and may be dated to the second century AD.Se realiza un nuevo examen, a través de análisis iconográfico y estilístico, de la estatua monumental del Zeus hallado en Gaza, hoy en el Museo Arqueológico de Estambul. Sus paralelos en escultura monumental, estatuillas y otros objetos artísticos —pintura vascular, gemas y monedas—, indican que esta obra de arte tiene un carácter ecléctico con tendencias varias y distintos conceptos artísticos de tipo clásico-helenístico. Es plausible concluir que tenemos en el Zeus de Gaza una obra romana anónima fechable en el siglo II d.C.

  14. IDRC in the West Bank and Gaza

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC has supported research in the. West Bank and Gaza since 1984. Early research focused on agriculture, then expanded to include the effects of conflict, legal reform, environmental health hazards, water conservation, and economic policy. Much of this research contributes knowledge that serves both local and.

  15. hiv management rural arv provision – policy implications for ...

    African Journals Online (AJOL)

    2006-12-02

    Dec 2, 2006 ... high level of horizontal integration of the ARV programme into existing PHC services from the start. ... different approaches, the integration of ARV services into PHC level of care is key in the success of many ... be linked to TB tracing teams, home-based care systems, community health worker programmes ...

  16. Towards universal ARV access: Achievements and challenges in ...

    African Journals Online (AJOL)

    New ARV enrolments increased annually to 25% of the estimated need by the end of 2007. Average waiting times to enrolment decreased from 5.82 months to 3.24 months. Median CD4 counts at enrolment increased from 89 to 124 cells/μl. There is a staff vacancy rate of 38% in the ARV programme and an inadequate ...

  17. HIV status disclosure and ARV adherence among patients attending ...

    African Journals Online (AJOL)

    HIV status disclosure and ARV adherence among patients attending Jomo Kenyatta University comprehensive care clinic. ... Failure to daily intake of Anti Retrovirals (ARV) not only prevents treatment failure but may also lead to viral development of resistance to the drugs. The fact that HIV is mainly sexually transmitted ...

  18. Gaza mässab Arafati valitsemise vastu / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2004-01-01

    Palestiina võitlejad ründasid Palestiina omavalitsuse julgeolekujõudusid Gaza sektoris, avaldades protesti president Yasser Arafati otsuse vastu määrata piirkonna julgeolekujuhiks lähisugulane Mussa Arafat. Peaminister Ahmed Qurei andis lahkumisavalduse. Kaart: Protestid Gazas

  19. Influence of ARVs on Some Biochemical Changes in Liver Non ...

    African Journals Online (AJOL)

    Influence of ARVs on Some Biochemical Changes in Liver Non Enzymatic Markers of HIV Positive Patients Attending Specialist Hospital Sokoto, Nigeria. MG Abubakar, MM Abduljalil, G Bola-Alaka, YI Nasiru ...

  20. Hybrid Underwater Vehicle: ARV Design and Development

    Directory of Open Access Journals (Sweden)

    Zhigang DENG

    2014-02-01

    Full Text Available The development of SMU-I, a new autonomous & remotely-operated vehicle (ARV is described. Since it has both the characteristics of autonomous underwater vehicle (AUV and remote operated underwater vehicle (ROV, it is able to achieve precision fix station operation and manual timely intervention. In the paper the initial design of basic components, such as vehicle, propulsion, batteries etc. and the control design of motion are introduced and analyzed. ROV’s conventional cable is replaced by a fiber optic cable, which makes it available for high-bandwidth real-time video, data telemetry and high-quality teleoperation. Furthermore, with the aid of the manual real-time remote operation and ranging sonar, it also resolves the AUV’s conflicting issue, which can absolutely adapt the actual complex sea environment and satisfy the unknown mission need. The whole battery system is designed as two-battery banks, whose voltages and temperatures are monitored through CAN (controller area network bus to avoid battery fire and explosion. A fuzzy-PID controller is designed for its motion control, including depth control and direction control. The controller synthesizes the advantage of fuzzy control and PID control, utilizes the fuzzy rules to on-line tune the parameters of PID controller, and achieves a better control effect. Experiment results demonstrate to show the effectiveness of the test-bed.

  1. Sõjaroim reaalajas : Iisrael kasutab Gazas valge fosfori pomme / Christopher Bollyn

    Index Scriptorium Estoniae

    Bollyn, Christopher

    2009-01-01

    Ajalehe The Times väitel kasutab Iisrael rünnakutes Gaza sektorile valge fosfori pomme, mis on Genfi konventsiooniga keelatud. Vt. samas: Genfi konventsioon ; Fosforitükid põlevad kehas luudeni välja

  2. The Egypt-Gaza Border and its Effect on Israeli-Egyptian Relations

    National Research Council Canada - National Science Library

    Sharp, Jeremy M

    2008-01-01

    .... Israel claims that ongoing smuggling of sophisticated weaponry into the Gaza Strip could dramatically strengthen the military capabilities of Hamas, which seized control of the Gaza Strip in 2007...

  3. Equity in access to ARV drugs in Malawi

    African Journals Online (AJOL)

    2007-05-01

    May 1, 2007 ... Based on data collected through a qualitative research methodology, it was found that achieving equity in provision ... RÉSUMÉ. Cette communication aborde le sujet de l'équité vis-à-vis la distribution des drogues ARV au sein du système de .... exhaustive because it was in large measure determined.

  4. Arved Viirlaid teises kaanonis / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    2002-01-01

    Arved Viirlaid 80. Ka tema juubeliks ilmunud ingliskeelsest luulekogust "Selected poems" (tlk. Taimi Ene Moks ja R. W. Stedingh). Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 417-420, pealk.: Teises Kaanonis: Viirlaiu luule inglise keeles

  5. factors influencing adherence to arvs among patients attending

    African Journals Online (AJOL)

    2014-04-01

    Apr 1, 2014 ... FACTORS INFLUENCING ADHERENCE TO ARVS AMONG PATIENTS ATTENDING COMPREHENSIVE CARE CLINIC. WITHIN JOMO KENYATTA ... AIDS-related mortality is increasing among 20 to 49 year olds (Adults in their ..... Impact of HIV/AIDS on Labor Markets, Productivity and Welfare in Southern ...

  6. knowledge and attitudes towards the use of arvs among adults

    African Journals Online (AJOL)

    To assess knowledge and attitudes towards the use of ARV drugs among adults in Dodoma urban district. Study design ... (75.6%) reported to be getting information through the media such as television, radio and magazine. About 84.9% of males and ... social empowerment and implementation of a programme on ARV ...

  7. Challenges confronting health care workers in government's ARV ...

    African Journals Online (AJOL)

    Challenges confronting health care workers in government's ARV rollout: rights and responsibilities. ... Potchefstroom Electronic Law Journal/Potchefstroomse Elektroniese Regsblad ... Unless the rights of HCWs are recognised and their needs adequately addressed, the best laid plans of government will be at risk.

  8. Abortide arv kahaneb Eestis iga aastaga / Rebekka Lotman

    Index Scriptorium Estoniae

    Lotman, Rebekka, 1978-

    2005-01-01

    Vt. ka Zdorovje dlja Vsehh 2005 märts, lk. 6. Kuigi abortide arv väheneb Eestis iga aastaga, tuleb naistearstide hinnangul oodata veel kümmekond aastat, et see langeks sama madalale tasemele nagu Põhjamaades. Lisaks diagramm abortide arvu kohta 1991-2004

  9. Technology Development Through Pooling ARV Drug Patents: A Vision from China

    Science.gov (United States)

    Liu, Li; Lu, Hongzhou

    2010-01-01

    Unaffordable prices still bar the end-users in China from accessing ARV drugs. Patent protection of ARV drugs has dramatically limited the availability of these lifesaving drugs to AIDS patients in China. The way Chinese government can go to breakthrough the ARV drug patents are suggested as: Make more generic drugs available through compulsory licensing, impartment from other countries or building ARVs plants by partnerships between governments or generic drug companies.Do a thorough and detailed research on the patent application of ARV drugs to find out the loophole.Try patent pool to make AIDS medicines more affordable and appropriate for patients. PMID:20224635

  10. Lapsetoetuse saajate arv tõuseb / Eli Lilles

    Index Scriptorium Estoniae

    Lilles, Eli

    2007-01-01

    1. septembrist saavad lapsetoetust ja teisi peretoetusi ka 16-19-aastased noored, kes õpivad õhtuses õppevormis või kaugõppes. Ilmunud ka Türi Rahvaleht 7. september 2007, lk. 4, pealkiri kujul : lapsetoetuse saajate arv suurenes; Vooremaa 11. september 2007, lk. 5, pealkiri kujul: lapsetoetust saavad ka õhtukoolis õppijad; Lõuna-Mulgimaa 8. september 2007, lk. 6, pealkiri kujul: lapse- ja peretoetused

  11. Designing ARVs Patent Pool Up to Trade & Policy Evolutionary Dynamics.

    Science.gov (United States)

    Dionisio, Daniele; Racalbuto, Vincenzo; Messeri, Daniela

    2010-01-19

    Patent pools for second and third-line Fixed Dose Combination (FDC) antiretroviral drugs (ARVs) should not be delayed as they are instrumental to urgent public health needs in the under-served markets.Nonetheless, multinational originator companies still seem to perceive patent pooling for ARVs as a minefield that would offer the generic competitors lots of deeply exploitable opportunities, to the detriment of patent owner's rights.This paper analyses the brand industry concerns, while looking for a strategy up to a really equitable and free world market, without any discrimination between end-users in wealthy and resource-limited countries.This strategy would urge partnerships between originator companies first to make newer FDC ARVs quickly available and allow patent pool agreements with generic counterparts to be negotiated straight afterwards.The patent pool strategy highlighted in this paper would assert the primacy of health over for-profit policies, while aligning with the 61(st) WHO's Assembly recommendations and G7, G8 and World Trade Organisation's warnings and pledges against trade protectionism.

  12. Determinants of hemoglobin level in adolescence students at Gaza ...

    African Journals Online (AJOL)

    Purpose: Hemoglobin (Hb) level could be affected by different interfering factors that include nutritional, socio-demographical, economical, and habitual determinant factors. The present study was designed to identify possible factors that could affect the hemoglobin level in adolescence students (14-22 years) at Gaza Strip, ...

  13. Epidemiology and Outcomes of Hospitalized Burn Patients in Gaza ...

    African Journals Online (AJOL)

    BACKGROUNG: Burns are serious health problems and leading causes of mortality and morbidity in the Eastern Mediterranean Region. This study aimed to overview the epidemiological profile and to present outcomes among hospitalized burn patients in AL Alamy burn center in Gaza. METHODS: This was a ...

  14. Clients satisfaction with local design consultancy practices in Gaza ...

    African Journals Online (AJOL)

    The aim of this paper is to investigate the degree of public clients satisfaction with local consultancy practices in the Gaza strip. The paper deals with three types of clients: Local Ministries, Municipalities and other organizations such as Palestinian Water ity, United Nation Development Program, and the Palestinian ...

  15. West Bank and Gaza | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    We have supported research in the West Bank and Gaza since 1984. Early research focused on agriculture, then expanded to include the effects of conflict, legal reform, environmental health hazards, water conservation, and economic policy. Much of this research contributes knowledge for local and international players ...

  16. Tööpuudus hiilib kikivarvul Võrumaale / Arved Breidaks

    Index Scriptorium Estoniae

    Breidaks, Arved, 1975-

    2008-01-01

    Võrumaal on töötute arv eelmise aastaga võrreldes tõusma hakanud: mullu suvel maakonnas registreeritud 3,9%-line töötuse määr asendus tänavu juuli lõpus 5,4%-lise töötusega. Lisa: Töötus Võrumaal. Vt. samas: Kuidas iseloomustate olukorda Võrumaa tööjõuturul? Vastavad Martin Arula (AS Toftan), Kaido Mäesalu (AS Suwem), Meelis Munski (AS Semuehitus), Indrek Klampe (OÜ Selista Ehitus), Andres Visanpuu (Võru TÜ)

  17. Glycogen synthase kinase-3 inhibitors suppress the AR-V7-mediated transcription and selectively inhibit cell growth in AR-V7-positive prostate cancer cells.

    Science.gov (United States)

    Nakata, Daisuke; Koyama, Ryokichi; Nakayama, Kazuhide; Kitazawa, Satoshi; Watanabe, Tatsuya; Hara, Takahito

    2017-06-01

    Recent evidence suggests that androgen receptor (AR) splice variants, including AR-V7, play a pivotal role in resistance to androgen blockade in prostate cancer treatment. The development of new therapeutic agents that can suppress the transcriptional activities of AR splice variants has been anticipated as the next generation treatment of castration-resistant prostate cancer. High-throughput screening of AR-V7 signaling inhibitors was performed using an AR-V7 reporter system. The effects of a glycogen synthase kinase-3 (GSK3) inhibitor, LY-2090314, on endogenous AR-V7 signaling were evaluated in an AR-V7-positive cell line, JDCaP-hr, by quantitative reverse transcription polymerase chain reaction. The relationship between AR-V7 signaling and β-catenin signaling was assessed using RNA interference. The effect of LY-2090314 on cell growth in various prostate cancer cell lines was also evaluated. We identified GSK3 inhibitors as transcriptional suppressors of AR-V7 using a high-throughput screen with an AR-V7 reporter system. LY-2090314 suppressed the reporter activity and endogenous AR-V7 activity in JDCaP-hr cells. Because silencing of β-catenin partly rescued the suppression, it was evident that the suppression was mediated, at least partially, via the activation of β-catenin signaling. AR-V7 signaling and β-catenin signaling reciprocally regulate each other in JDCaP-hr cells, and therefore, GSK3 inhibition can repress AR-V7 transcriptional activity by accumulating intracellular β-catenin. Notably, LY-2090314 selectively inhibited the growth of AR-V7-positive prostate cancer cells in vitro. Our findings demonstrate the potential of GSK3 inhibitors in treating advanced prostate cancer driven by AR splice variants. In vivo evaluation of AR splice variant-positive prostate cancer models will help illustrate the overall significance of GSK3 inhibitors in treating prostate cancer. © 2017 Wiley Periodicals, Inc.

  18. AR Variant ARv567es Induces Carcinogenesis in a Novel Transgenic Mouse Model of Prostate Cancer

    Directory of Open Access Journals (Sweden)

    Gang Liu

    2013-09-01

    Full Text Available Androgen deprivation therapy remains the primary treatment modality for patients with metastatic prostate cancer but is uniformly marked by progression to castration-resistant prostate cancer (CRPC after a period of regression. Continued activation of androgen receptor (AR signaling is attributed as one of the most important mechanisms underlying failure of therapy. Recently, the discovery of constitutively active AR splice variants (AR-Vs adds more credence to this idea. Expression of AR-Vs in metastases portends a rapid progression of the tumor. However, the precise role of the AR-Vs in CRPC still remains unknown. ARv567es is one of the two AR variants frequently found in human CRPC xenografts and metastases. Herein, we developed a probasin (Pb promoter-driven ARv567es transgenic mouse, Pb-ARv567es, to evaluate the role of ARv567es in both autonomous prostate growth and progression to CRPC. We found that expression of ARv567es in the prostate results in epithelial hyperplasia by 16 weeks and invasive adenocarcinoma is evident by 1 year of age. The underlying genetic cellular events involved a cell cycle-related transcriptome and differential expression of a spectrum of genes that are critical for tumor initiation and progression. These findings indicate that ARv567es could induce tumorigenesis de novo and signifies the critical role of AR-Vs in CRPC. Thus, the Pb-ARv567es mouse could provide a novel model in which the role of AR variants in prostate cancer progression can be examined.

  19. Dietary behaviours and dental fluorosis among Gaza Strip children.

    Science.gov (United States)

    Abuhaloob, L; Abed, Y

    2013-07-01

    A high prevalence of dental fluorosis has been identified among children in the Gaza Strip. This study aimed to determine the history of breastfeeding and dietary behaviours among children in the Gaza Strip and to examine potential associations with the prevalence and severity of dental fluorosis. A cross-sectional study recruited a stratified cluster random sample of 350 children aged 12-18 years and their mothers. Data about dietary behaviours in the first 7 years of life were collected by interview questionnaire. Dental fluorosis was determined using the Thyllstrup-Fejerskov index. A majority of children were breastfed exclusively in the first 6 months (82.9%) but 98.1% were given tea in the first year of life. The prevalence of dental fluorosis was 78.0%. Both intake of animal proteins and plant proteins were negatively associated with the prevalence and severity of dental fluorosis. Further studies to investigate fluoride intake is required to plan preventive interventions.

  20. The Impact of HIV/AIDS and ARV Treatment on Worker Absenteeism: Implications for African Firms

    Science.gov (United States)

    Habyarimana, James; Mbakile, Bekezela; Pop-Eleches, Cristian

    2010-01-01

    We characterize medium and long-run labor market impacts of HIV/AIDS and ARV treatment using unique panel data of worker absenteeism and information from an AIDS treatment program at a large mining firm in Botswana. We present robust evidence of an inverse-V shaped pattern in worker absenteeism around the time of ARV treatment inception.…

  1. Research on Fairing design and CFD Analysis of Submarine Pipeline Inspection ARV

    Directory of Open Access Journals (Sweden)

    Jin Xiaojian

    2017-01-01

    Full Text Available Along with the fast development of the ocean exploitation, the cost-effective requirement of autonomous & remotely operated vehicle (ARV, which can perform more complicated missions such as the oil exploitation and the inspection of the submarine pipeline is more urgent. The submarine pipeline inspection ARV can help us better understand, protect and efficiently utilize them for human welfare. Fairing design of a new detection ARV are introduced in this paper. In order to select an appropriate thruster that will achieve the required speed of the ARV, the ANSYS-CFX tools are used to predicted the drag force. The CFD results reveal the distribution of velocity and pressure values of the ARV. In order to verify the CFD modeling process, a towed body was developed and analyzed, compared against the corresponding physical test data.

  2. Promosi Kesehatan Nola Pender Berpengaruh Terhadap Pengetahuan dan Kepatuhan ODHA Minum ARV

    OpenAIRE

    Tuti Asrianti Utami

    2017-01-01

    The success rate of ARV therapy depends on the adherence of HIV-AIDS patients in ARV treatment. The purpose of this study was to analyze the effect of NolaPender health promotion to improve the knowledge and adherence of PLWHA (People living with HIV-AIDS) with ARV in SintCarolus Health Service (SCHS) and Persahabatan General Hospital (PGH). This study used a Pre-Post test Quasi Eksperimantal Non Equivalent Control Group and a total sample of 90 respondents were recruited through the use of c...

  3. The Rh allele frequencies in Gaza city in Palestine

    Directory of Open Access Journals (Sweden)

    Skaik Younis

    2011-01-01

    Full Text Available Background: The Rh blood group system is the second most clinically significant blood group system. It includes 49 antigens, but only five (D, C, E, c and e are the most routinely identified due to their unique relation to hemolytic disease of the newborn (HDN and transfusion reactions. Frequency of the Rh alleles showed variation, with regard to race and ethnic. Objectives: The purpose of the study was to document the Rh alleles′ frequencies amongst males (M and females (F in Gaza city in Palestine. Materials and Methods: Two hundred and thirty-two blood samples (110 M and 122 F were tested against monoclonal IgM anti-C,anti-c, anti-E, anti-e and a blend of monoclonal/polyclonal IgM/IgG anti-D. The expected Rh phenotypes were calculated using gene counting method. Results: The most frequent Rh antigen in the total sample was e, while the least frequent was E.The order of the combined Rh allele frequencies in both M and F was CDe > cDe > cde > CdE > cDE > Cde > CDE. A significant difference was reported between M and F regarding the phenotypic frequencies (P < 0.05. However, no significance (P > 0.05 was reported with reference to the observed and expected Rh phenotypic frequencies in either M or F students. Conclusion: It was concluded that the Rh antigens, alleles and phenotypes in Gaza city have unique frequencies, which may be of importance to the Blood Transfusion Center in Gaza city and anthropology.

  4. Kalvi Kõva : dzhiibi arvelevõtu tasu võiks olla 100 000 krooni / Arved Breidaks

    Index Scriptorium Estoniae

    Breidaks, Arved, 1975-

    2008-01-01

    Sotsiaaldemokraat, parlamendiliige Kalvi Kõva soovitab automaksu plaanival valitsusel tõsta autode registreerimise tasu maasturite puhul kuni 100 000 kroonini. Lisa: Esmakordselt registreeritud uued sõiduautod. Vt. samas: Arved Breidaks. Võrumaa autostub.

  5. MORBILI PADA ANAK DALAM PENGOBATAN ANTI RETRO VIRAL (ARV

    Directory of Open Access Journals (Sweden)

    Surya Dipta Nugraha

    2016-03-01

    Full Text Available MEASLES IN CHILDREN WITH ANTI RETRO VIRAL (ARV ON TREATMENT ABSTRACT Introduction: Morbili is an acute viral infectious disease caused by a virus transmitted morbili. Morbili is a contagious acute viral infectious disease that is characterized by three stages: catarrhal stage, eruption stage and convalence stage. Another name morbili is measles, measles, or rubeola. Morbili caused by a virus that is classified as Family paramyxovirus, the virus genus morbili contained in nasopharyngeal secretions and blood during the prodromal period until 24 hours after the onset of spots. Case: Patient male, 6 years old, Hindu, Balinese tribe, came with complaints of febris since 5 days ago. Febris is not measured with a thermometer. The heat is felt up and down, getting better with medicine. Complaints red spots felt since 1 day ago. Originally discovered red spots appear in the neck area and then to the face and chest. The incidence of rash accompanied by itching and heat. This complaint is accompanied with nosebleeds 1 day ago, cough with sputum since 5 days ago and the red eye from one day ago. Patients feel the first time such complaints. Having a history of antiretroviral use regularly since 1.5 years old. Keywords: rash, morbili, HIV, antiretroviral drugs.

  6. Promosi Kesehatan Nola Pender Berpengaruh Terhadap Pengetahuan dan Kepatuhan ODHA Minum ARV

    Directory of Open Access Journals (Sweden)

    Tuti Asrianti Utami

    2017-05-01

    Full Text Available The success rate of ARV therapy depends on the adherence of HIV-AIDS patients in ARV treatment. The purpose of this study was to analyze the effect of NolaPender health promotion to improve the knowledge and adherence of PLWHA (People living with HIV-AIDS with ARV in SintCarolus Health Service (SCHS and Persahabatan General Hospital (PGH. This study used a Pre-Post test Quasi Eksperimantal Non Equivalent Control Group and a total sample of 90 respondents were recruited through the use of consecutive sampling with inclusion criteria where 45 respondents served as intervention group in SCHS and the remaining as control group in PGH from May-June 2016. The result showed most respondents were in the late adulthood stage (36-55 years old, male, having advanced education, working, exposed to counseling service, having family support as well as peer group support, easy in reaching health service and with health insurance. NolaPender health promotion increased the knowledge of ARV (mean score pre intervention was 5.31 to post intervention 7.04, and improving the adherence of taking ARV from moderate to good adherence as many as 51.1%. There was an effect of Nola Pender health promotion using booklet to respondents’ knowledge (p-value=0.000 from 13.3% to 91.1% and also effect of knowledge improvement of ARV to the adherence of taking ARV, with the support from peer group from 30.2% to 87.2%. The study recommends to continue this program of Nola Pender health promotion for PLWHA taking ARV in a structured and well planned system.

  7. School furniture match to students' anthropometry in the Gaza Strip.

    Science.gov (United States)

    Agha, Salah R

    2010-03-01

    This study aimed at comparing primary school students' anthropometry to the dimensions of school furniture and determining whether the furniture used matches the students' anthropometry. A sample of 600 male students, whose ages were between 6 and 11 years, from five primary schools in the Gaza Strip governorates participated in the study. Several students' body dimensions were measured. The dimensions measured included elbow-seat height, shoulder height, knee height, popliteal height and buttock-popliteal length. Measurements of the dimensions of the classroom furniture indicated that there was a considerable mismatch between the students' body dimensions and the classroom furniture. The mismatches in seat height, seat depth and desk height occurred for 99% of the students, while the mismatch for the back rest height was only 35%. Two design specifications were proposed in order to decrease the mismatch percentage based on the data obtained. The two proposed designs showed a considerable improvement in the match percentages as compared to the existing design. STATEMENT OF RELEVANCE: Having identified mismatches between the dimensions of the school furniture used in primary schools in the Gaza Strip, two new design specifications are proposed and shown to improve match with the students' anthropometric dimensions. The findings of the study are also an important addition to local knowledge on school children's anthropometry.

  8. Measurements of the radon-222 and its daughters concentrations throughout Gaza strip, Palestine

    International Nuclear Information System (INIS)

    Rasas, M.F.; Yassin, S.S.; Shabat, M.M.

    2005-01-01

    High Radon levels are present in the granite and grandiositic rocks that. spread in sand dunes along coast of Gaza. Such materials are rich in uranium and T widely used in the construction of dwelling in the Gaza, and their contribution to high indoor Radon levels is most relevant.The present work aims to investigate approaches, measures and detection of indoor Radon level throughout Gaza Strip. Five hundred CR-39 dosimeters were distributed over six locations in the middle Yv-region of Gaza Strip. Results suggest that Radon concentrations range from l3.36 to 83.82 Bq/m 3 and a maximum value of 97.01 Bq/m 3 .The average Radon concentrations was 37.83 Bq/m 3 with standard deviation of 11.23.The results provide a framework for future studies that include a large, broader survey of Radon concentration in Palestine

  9. Iisrael lõdvendab Gaza maablokaadi / Hendrik Vosman, Jürgen Tamme

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Israeli valitsus vähendas piiranguid ja lubab nüüd toiduaineid, mänguasju, kirjatarbeid, madratseid ja rätikuid Gaza sektorisse tarnida. Hamas nimetas blokaadi leevendamise otsust tühiseks meediapropagandaks

  10. (q) as a sociolinguistic variable in the Arabic of Gaza City

    OpenAIRE

    William M Cotter

    2016-01-01

    This study examines the effect of dialect contact between the indigenous residents of Gaza City and refugees originally from the city of Jaffa. The study offers a quantitative sociolinguistic investigation of the variable (q) in the speech of 22 residents of Gaza City. The sample is divided along the lines of dialect background, gender, and is separated into three age groups. Analysis of the data has revealed that for (q) a significant correlation exists with dialect background and gender, wi...

  11. Loss of Subcellular Lipid Transport Due to ARV1 Deficiency Disrupts Organelle Homeostasis and Activates the Unfolded Protein Response*

    Science.gov (United States)

    Shechtman, Caryn F.; Henneberry, Annette L.; Seimon, Tracie A.; Tinkelenberg, Arthur H.; Wilcox, Lisa J.; Lee, Eunjee; Fazlollahi, Mina; Munkacsi, Andrew B.; Bussemaker, Harmen J.; Tabas, Ira; Sturley, Stephen L.

    2011-01-01

    The ARV1-encoded protein mediates sterol transport from the endoplasmic reticulum (ER) to the plasma membrane. Yeast ARV1 mutants accumulate multiple lipids in the ER and are sensitive to pharmacological modulators of both sterol and sphingolipid metabolism. Using fluorescent and electron microscopy, we demonstrate sterol accumulation, subcellular membrane expansion, elevated lipid droplet formation, and vacuolar fragmentation in ARV1 mutants. Motif-based regression analysis of ARV1 deletion transcription profiles indicates activation of Hac1p, an integral component of the unfolded protein response (UPR). Accordingly, we show constitutive splicing of HAC1 transcripts, induction of a UPR reporter, and elevated expression of UPR targets in ARV1 mutants. IRE1, encoding the unfolded protein sensor in the ER lumen, exhibits a lethal genetic interaction with ARV1, indicating a viability requirement for the UPR in cells lacking ARV1. Surprisingly, ARV1 mutants expressing a variant of Ire1p defective in sensing unfolded proteins are viable. Moreover, these strains also exhibit constitutive HAC1 splicing that interacts with DTT-mediated perturbation of protein folding. These data suggest that a component of UPR induction in arv1Δ strains is distinct from protein misfolding. Decreased ARV1 expression in murine macrophages also results in UPR induction, particularly up-regulation of activating transcription factor-4, CHOP (C/EBP homologous protein), and apoptosis. Cholesterol loading or inhibition of cholesterol esterification further elevated CHOP expression in ARV1 knockdown cells. Thus, loss or down-regulation of ARV1 disturbs membrane and lipid homeostasis, resulting in a disruption of ER integrity, one consequence of which is induction of the UPR. PMID:21266578

  12. Quaternary alluvial deposits of Wadi Gaza in the middle of the Gaza Strip (Palestine): Facies, granulometric characteristics, and their paleoflow direction

    Science.gov (United States)

    Ubeid, Khalid Fathi

    2016-06-01

    The Quaternary rocks of the Gaza Strip mainly consist of clastic sedimentary rocks. In Wadi Gaza, the outcropping rocks consist of brownish fine-grained deposits, sandstones, and conglomerates. The deposits have been studied from a genetic point of view, and six facies have been described: (i) graded clast-supported conglomerates, (ii) cross-bedded clast-supported conglomerates, (iii) sandy matrix conglomerates, (iv) cross-laminated medium-grained sandstones, (v) graded coarse-grained sandstones, and (vi) massive sandstones. The field work observations and granulometric analysis show that the sphericity of the grains increase toward the west, where its value ranges from ∼0.64 in the east to ∼0.70 in the west. In addition, the grain forms tend to be disc shape in the east, whereas they tend to be disc-to spheroid shape in the west, and they become well rounded to well sorted toward the west. Moreover, the features, geometry, and spatial relationship among these facies suggest that the Wadi Gaza was meandering wadi fed from Beir Sheva and the Northern Negev in the southeast of Gaza Strip through Wadi Al Shallala and Wadi Sheneq and from Hebron mountains in the West Bank at the east through Wadi Al Shari'a alluvials. Within the Gaza Strip, paleocurrent data ranges from 210° to 310°, indicating a mean a paleoflow direction to the W (276°) and a median value about 275°. The sedimentary rocks in the Wadi Gaza are considered to be deposited in two periods of climate conditions: the coarse-grained rocks were deposited during the period of wet condition before 12.4 ka age, whereas the eolinite fine-grained rocks were deposited during semiarid climate conditions which are younger in age than 12.4 ka.

  13. Urban planning and interactions with atmospheric pollution in Arve valley

    Science.gov (United States)

    Langlois de Septenville, William; Cossart, Étienne

    2017-04-01

    Atmospheric pollution is a major concern of urbanised areas and territory managers have to conduct efficient policies to decrease population exposure and vulnerability. Even if pollution peaks are subject to an important mediatisation and to a large part of preventive actions, background pollution remains responsible of the largest sanitary effects. They depend on (1) the concentration and the duration of the exposure and (2) to the kind of pollutants considered. Many sources of pollutants can be identified in urban areas as heating, industry or traffic; and each of them generates specific particles. Currently, the major part of pollution risk studies focuses on modelling particle emissions and their dissemination in the environment. These kinds of studies highlight the hazard intensity and its spatiality, commonly named the hazard exposure. Another part of risk studies, less frequent, considers the vulnerability. Vulnerability is a complex concept that involves a wide range of scales and objects ranging from biophysical parameters to social characteristics. They notably concern accessibility to information, knowledge and perceptions about the risk. The Arve valley (south-east of France) is subject to heavy pollution concentrations. High levels recording in this area have imposed the implementation of an Atmosphere Protection Plan. This type of plan is triggered if a peak occurs and enforces provisional binding measures for polluters, such as highway speed limitation for traffic emissions. These measures are only focused on emissions and have no effect for reducing vulnerability and exposition, for a long- and short-term time scales. An opportunity to ensure this objective is to consider how local urban morphologies can combine exposition and vulnerability situations. Indeed, cities have been planned without taking into account atmospheric pollution and morphologies. This context may conduct to the increase in both of these two risk components and producing

  14. Sustainability of ARV provision in developing countries: challenging a framework based on program history

    Directory of Open Access Journals (Sweden)

    Thiago Botelho Azeredo

    Full Text Available Abstract The provision of ARVs is central to HIV/AIDS programs, because of its impact on the course of the disease and on quality of life. Although first-line treatments costs have declined, treatment-associated expenses are steeper each year. Sustainability is therefore an important variable for the success of treatment programs. A conceptual framework on sustainability of ARV provision was developed, followed by data collection instruments. The pilot study was undertaken in Brazil. Bolivia, Peru and Mozambique, were visited. Key informants were identified and interviewed. Investigation of sustainability related to ARV provision involved implementation and routinization events of provision schemes. Evidence of greater sustainability potential was observed in Peru, where provision is implemented and routinized by the National HIV/AIDS program and expenditures met by the government. In Mozambique, provision is dependent on donations and external aid, but the country displays a great effort to incorporate ARV provision and care in routine healthcare activities. Bolivia, in addition to external dependence on financing and management of drug supply, presents problems regarding implementation and routinization. The conceptual framework was useful in recognizing events that influence sustainable ARV provision in these countries.

  15. Al-Qaeda in Gaza: Isolating “the Base”

    Directory of Open Access Journals (Sweden)

    Warren Marshall

    2010-11-01

    Full Text Available In 1996, Osama bin Laden declared jihad against the American forces occupying Saudi Arabia, calling for Muslims to expel the infidels from the “land of the two holy places.” The first sacred ground mentioned in this statement, however, was not Saudi Arabia but Palestine. His words seething with hatred, bin Laden scorned the Arab regimes for failing to recapture Jerusalem and described the situation as a festering wound upon the Islamic 'umma'.[1] Fourteen years later, even after orchestrating devastating attacks in three Western capitals, Bin Laden’s al-Qaeda is still unable to do much against Israel besides issuing scathing diatribes. Its most vigorous efforts to establish itself in the Palestinian arena have been in the Gaza Strip. Here, however, al-Qaeda-linked groups are stymied by a perhaps surprising adversary: Hamas. But despite Hamas’s efforts to suppress them, 'Salafi'-jihadi groups maintain an underground presence. Even if al-Qaeda affiliates remain weak operationally in comparison to Hamas, al-Qaeda’s ideology of global jihad seems to be on the rise in Gaza. Meanwhile, the al-Qaeda leadership is relentless in pursuing new and ingenious ways for its agents to penetrate the Strip. A Hamas weakened by a tightened blockade or another war with Israel would leave an opening for 'Salafi'-jihadi militants. The prospect of these al-Qaeda-linked factions upsetting a fragile peace needs to be considered among the many other factors relevant to engagement with Hamas.

  16. Increasing Neonatal Mortality among Palestine Refugees in the Gaza Strip

    Science.gov (United States)

    van den Berg, Maartje M.; Madi, Haifa H.; Khader, Ali; Hababeh, Majed; Zeidan, Wafa’a; Wesley, Hannah; Abd El-Kader, Mariam; Maqadma, Mohamed; Seita, Akihiro

    2015-01-01

    Background The United Nations Relief and Works Agency for Palestine refugees in the Near East (UNRWA) has periodically estimated infant mortality rates among Palestine refugees in Gaza. These surveys have recorded a decline from 127 per 1000 live births in 1960 to 20.2 in 2008. Methods We used the same preceding-birth technique as in previous surveys. All multiparous mothers who came to the 22 UNRWA health centres to register their last-born child for immunization were asked if their preceding child was alive or dead. We based our target sample size on the infant mortality rate in 2008 and included 3128 mothers from August until October 2013. We used multiple logistic regression analyses to identify predictors of infant mortality. Findings Infant mortality in 2013 was 22.4 per 1000 live births compared with 20.2 in 2008 (p = 0.61), and this change reflected a statistically significant increase in neonatal mortality (from 12.0 to 20.3 per 1000 live births, p = 0.01). The main causes of the 65 infant deaths were preterm birth (n = 25, 39%), congenital anomalies (n = 19, 29%), and infections (n = 12, 19%). Risk factors for infant death were preterm birth (OR 9.88, 3.98–24.85), consanguinity (2.41, 1.35–4.30) and high-risk pregnancies (3.09, 1.46–6.53). Conclusion For the first time in five decades, mortality rates have increased among Palestine refugee newborns in Gaza. The possible causes of this trend may include inadequate neonatal care. We will estimate infant and neonatal mortality rates again in 2015 to see if this trend continues and, if so, to assess how it can be reversed. PMID:26241479

  17. AR Variant ARv567es Induces Carcinogenesis in a Novel Transgenic Mouse Model of Prostate Cancer12

    Science.gov (United States)

    Liu, Gang; Sprenger, Cynthia; Sun, Shihua; Epilepsia, Kathryn Soriano; Haugk, Kathleen; Zhang, Xiaotun; Coleman, Ilsa; Nelson, Peter S; Plymate, Stephen

    2013-01-01

    Androgen deprivation therapy remains the primary treatment modality for patients with metastatic prostate cancer but is uniformly marked by progression to castration-resistant prostate cancer (CRPC) after a period of regression. Continued activation of androgen receptor (AR) signaling is attributed as one of the most important mechanisms underlying failure of therapy. Recently, the discovery of constitutively active AR splice variants (AR-Vs) adds more credence to this idea. Expression of AR-Vs in metastases portends a rapid progression of the tumor. However, the precise role of the AR-Vs in CRPC still remains unknown. ARv567es is one of the two AR variants frequently found in human CRPC xenografts and metastases. Herein, we developed a probasin (Pb) promoter-driven ARv567es transgenic mouse, Pb-ARv567es, to evaluate the role of ARv567es in both autonomous prostate growth and progression to CRPC. We found that expression of ARv567es in the prostate results in epithelial hyperplasia by 16 weeks and invasive adenocarcinoma is evident by 1 year of age. The underlying genetic cellular events involved a cell cycle-related transcriptome and differential expression of a spectrum of genes that are critical for tumor initiation and progression. These findings indicate that ARv567es could induce tumorigenesis de novo and signifies the critical role of AR-Vs in CRPC. Thus, the Pb-ARv567es mouse could provide a novel model in which the role of AR variants in prostate cancer progression can be examined. PMID:24027426

  18. Diktaator Gaddafi: kõige taga on Al-Qaeda / Inga Höglund

    Index Scriptorium Estoniae

    Höglund, Inga

    2011-01-01

    Meeleavaldustest Liibüas. Meeleavaldajad on enda kontrolli alla saanud suure osa riigist, hukkunute arv võib aga ulatuda ligi 800ni. Gaddafi arvates on vägivallalaine taga Al-Qaeda juht Osama bin Laden

  19. Baltic death race 2004 / Julia Balandina

    Index Scriptorium Estoniae

    Balandina, Julia

    2005-01-01

    Leedu on Baltimaades autoõnnetuste arvu poolest esimesel kohal. Balti riikide teedeohutusega tegelevate ametnike sõnul on paljude liiklusõnnetuste põhjuseks halb liikluskultuur. Tabel: Hukkunute arv Baltimaades; Lätlaste hoolimatus

  20. Traagilisi õnnetusi jääb aastatega vähemaks / Vahur Koorits

    Index Scriptorium Estoniae

    Koorits, Vahur, 1981-

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 8. jaan. 2008, lk. 3. Liiklusavariides, tulekahjudes ja tööõnnetustes hukkunute arv oli 2007. aastal väiksem kui varasematel aastatel. Diagramm: Elu muutus natuke ohutumaks

  1. Most common genotypes and risk factors for HCV in Gaza strip: a cross sectional study

    Directory of Open Access Journals (Sweden)

    Abu-Jadallah Salah Y

    2009-07-01

    Full Text Available Abstract Background The present work aims at determining HCV genotypes in patients with chronic HCV infection, in Gaza strip, Palestine. The most common risk factors for HCV transmission were also evaluated in conjunction with the genotyping data. Results The study shows that there are only two major genotypes of HCV in Gaza Strip: Genotype 1 (subtypes 1a and 1b collectively contribute to 28.3% of the cases, and genotype 4 (subtypes 4a and 4c/d collectively contribute to 64.1% of the cases. Mixed infection with the two genotypes was also present among 7.6% of the cases. In this study a statistically significant relationship was established between the distribution of these genotypes and the patients' living place, traveling history, history of blood transfusion and history of surgical operations. Conclusion The present study is the first to link HCV genotyping in Gaza strip with its possible roots of transmission. Traveling to endemic countries, especially Egypt; blood transfusion and surgical operations are major roots of HCV infection in Gaza strip. The results indicate that iatrogenic and nosocomial procedures may be responsible for the majority of HCV infections in Gaza strip.

  2. Tööõnnetuste arv Ida-Virus väheneb / Erika Prave

    Index Scriptorium Estoniae

    Prave, Erika, 1970-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 7. dets. 2004, lk. 3. Tööinspektsiooni viimase üheksa aasta statistikast järeldub, et tööõnnetuste arv on Ida-Virumaal aastatega vähenenud peaaegu poole võrra

  3. Mind the gap: access to ARV medication, rights and the politics of scale in South Africa.

    Science.gov (United States)

    Jones, Peris Sean

    2012-01-01

    Global access to anti-retroviral medication (ARVs) has increased exponentially in recent years. As a relatively recent phenomenon for the global South, much knowledge is being added, but analysis of 'access' to ARVs remains partial. The main research objective of this article is to gain a fuller picture of the range of forces constituting 'access' to ARVs by providing a local community case study from Hammanskraal, South Africa. A qualitative and relational approach situates specific points of 'local' access to ARVs within relations stretched over space. Spatial awareness enables us to consider the reinforcing effects of local geographies upon access to health care but also simultaneously sees this in relation to non-local geographies. The concept of scale is pivotal to creating linkages across space and reveals a number of 'gaps' in access that otherwise might not be shown. Elaborating on the meaning of "access" to treatment produces a more rounded picture of the context that people-living-with-AIDS encounter. A multi-scale and multi-disciplinary analysis of 'access' is therefore also highly informative in a related sense, namely, for closing the gap between human rights standards and actual implementation. A geographical imagination is useful not only to 'mind' but also to close the 'gap' in both senses. Copyright © 2010 Elsevier Ltd. All rights reserved.

  4. Effect of antiretroviral drug (arved) on hepatic enzymes in albino rats ...

    African Journals Online (AJOL)

    In the rush to put as many patients as possible on a potent ART, with very little or no laboratory monitory, limited attention has been given to side effects. This study was therefore designed to evaluate the effects of antiretroviral drugs arved® , on aspartate amino transferase (AST), alanine amino transferase (ALT) and ...

  5. A novel rudivirus, ARV1, of the hyperthermophilic archaeal genus Acidianus

    DEFF Research Database (Denmark)

    Vestergaard, Gisle Alberg; Häring, Monika; Peng, Xu

    2005-01-01

    Virus ARV1, the first member of the family Rudiviridae infecting hyperthermophilic archaea of the genus Acidianus, was isolated from a hot spring in Pozzuoli, Italy. The rod-shaped virions, 610 +/- 50 nm long and 22 +/- 3 nm wide, are non-enveloped and carry a helical nucleoprotein core, with three...

  6. Püsiühenduste arv kasvas aastaga poole võrra / Tõnu Vare

    Index Scriptorium Estoniae

    Vare, Tõnu, 1947-

    2005-01-01

    Uuringufirma Point Topic andmetel oli 30. septembri 2004. a. seisuga Interneti püsiühenduste arv maailmas 136,4 miljonit. Diagrammid: Püsiühendustega leibkondade osakaal (%) Euroopas; 512 Kb/s allalaadimiskiirusega püsiühenduse kuutasu (eurodes)

  7. Pharmaceutical Equivalence of Distributed Generic Antiretroviral (ARV) in Asian Settings: The Cross-Sectional Surveillance Study - PEDA Study.

    Science.gov (United States)

    Sapsirisavat, Vorapot; Vongsutilers, Vorasit; Thammajaruk, Narukjaporn; Pussadee, Kanitta; Riyaten, Prakit; Kerr, Stephen; Avihingsanon, Anchalee; Phanuphak, Praphan; Ruxrungtham, Kiat

    2016-01-01

    Ensuring that medicines meet quality standards is mandatory for ensuring safety and efficacy. There have been occasional reports of substandard generic medicines, especially in resource-limiting settings where policies to control quality may be less rigorous. As HIV treatment in Thailand depends mostly on affordable generic antiretrovirals (ARV), we performed quality assurance testing of several generic ARV available from different sources in Thailand and a source from Vietnam. We sampled Tenofovir 300mg, Efavirenz 600mg and Lopinavir/ritonavir 200/50mg from 10 primary hospitals randomly selected from those participating in the National AIDS Program, 2 non-government organization ARV clinics, and 3 private drug stores. Quality of ARV was analyzed by blinded investigators at the Faculty of Pharmaceutical Science, Chulalongkorn University. The analysis included an identification test for drug molecules, a chemical composition assay to quantitate the active ingredients, a uniformity of mass test and a dissolution test to assess in-vitro drug release. Comparisons were made against the standards described in the WHO international pharmacopeia. A total of 42 batches of ARV from 15 sources were sampled from January-March 2015. Among those generics, 23, 17, 1, and 1 were Thai-made, Indian-made, Vietnamese-made and Chinese-made, respectively. All sampled products, regardless of manufacturers or sources, met the International Pharmacopeia standards for composition assay, mass uniformity and dissolution. Although local regulations restrict ARV supply to hospitals and clinics, samples of ARV could be bought from private drug stores even without formal prescription. Sampled generic ARVs distributed within Thailand and 1 Vietnamese pharmacy showed consistent quality. However some products were illegally supplied without prescription, highlighting the importance of dispensing ARV for treatment or prevention in facilities where continuity along the HIV treatment and care cascade

  8. The Role of ARV Associated Adverse Drug Reactions in Influencing Adherence Among HIV-Infected Individuals: A Systematic Review and Qualitative Meta-Synthesis.

    Science.gov (United States)

    Li, Haochu; Marley, Gifty; Ma, Wei; Wei, Chongyi; Lackey, Mellanye; Ma, Qingyan; Renaud, Françoise; Vitoria, Marco; Beanland, Rachel; Doherty, Meg; Tucker, Joseph D

    2017-02-01

    Poor adherence remains a major barrier to achieving the clinical and public health benefits of antiretroviral drugs (ARVs). A systematic review and qualitative meta-synthesis was conduct to evaluate how ARV adverse drug reactions may influence ARV adherence. Thirty-nine articles were identified, and 33 reported that ARV adverse drug reactions decreased adherence and six studies found no influence. Visually noticeable adverse drug reactions and psychological adverse reactions were reported as more likely to cause non-adherence compared to other adverse drug reactions. Six studies reported a range of adverse reactions associated with EFV-containing regimens contributing to decreased adherence. Informing HIV-infected individuals about ARV adverse drug reactions prior to initiation, counselling about coping mechanisms, and experiencing the effectiveness of ARVs on wellbeing may improve ARV adherence.

  9. Pour une autre lecture de la guerre de Gaza

    Directory of Open Access Journals (Sweden)

    Jean-François Legrain

    2009-02-01

    Full Text Available En décalage avec les idées reçues habituellement, l'Auteur propose une relecture de l'offensive l’armée israélienne dans la bande de Gaza (27 décembre 2008-21 janvier 2009 tant des justifications de son déclenchement avancées par le gouvernement israélien que sur l’approche de son bilan menée en termes de victoire palestinienne. Considérant qu'elle s'inscrit dans une logique israélienne consistant à tout mettre en œuvre pour repousser sine die tout accord sur le fond avec les Palestiniens, il suggère que la force réelle ou alléguée de Hamas est utilisée par le gouvernement israélien pour justifier auprès de la communauté internationale en termes de lutte contre le terrorisme une politique en réalité visant à détruire toute institutionnalisation du nationalisme palestinien.This article is an attempt to explore new schemes for the full understandig of what was the challenge in the last war in Gaza’s Strip. Between December 27th and January 21st nothing less than 1330 people died while 5450 others remained injuried on the Palestinian side. Ten Israeli soldiers and three civilians died in the meantime. This article is an interpretation of the Israeli way of managing the image of the Palestinian resistance movment in years, through the Muslim Brothers, FATHA, and now Hamas, as a danger for democracy and the western world. The figure of the trouble maker is used in order to justify a long term conflict which end Israel is the only country capable to put an end to.

  10. Assessment by Employers of Newly Graduated Civil Engineers from the Islamic University of Gaza

    Science.gov (United States)

    Enshassi, Adnan; Hassouna, Ahmed

    2005-01-01

    The evaluation process is very important to identify and recognize the strengths and the weaknesses of graduated students. The purpose of this paper is to evaluate the performance of the newly graduated civil engineers from the Islamic University of Gaza in Palestine. The methodology was based on questionnaires and informal interview. The…

  11. Gaza ceasefire crumbles while West embarks on a new round of hand-wringing

    DEFF Research Database (Denmark)

    Pace, Michelle

    2014-01-01

    Tragically, the 72-hour ceasefire brokered between the Israeli Defence Force and Hamas collapsed within two hours – just as shops in Gaza were opening and the fishing fleet setting out to sea for the first time in days. It’s unclear how the truce was broken, and both sides are flinging blame...

  12. Straitjackets and flak jackets: the BBC, 'boundary work' and the failed 2009 DEC Appeal for Gaza

    NARCIS (Netherlands)

    P. McCurdy (Patrick); J.M. Engelbert (Jiska)

    2012-01-01

    textabstractThis article, which is part of larger research project, considers the justification discourse of BBC Executives following the public outrage over the BBC’s decision not to air the 2009 DEC Appeal for Gaza. The BBC’s justification is characterised by a recurrent conceptualisation of the

  13. Difficulties Students Face in Understanding Drama in English Literature at the Islamic University of Gaza (IUG)

    Science.gov (United States)

    Shakfa, Mahmoud Dawoud Ali

    2012-01-01

    The present paper explores the problems of English Language and Literature junior and senior majors, who are enrolled in a drama course at the Islamic University of Gaza (IUG). The course emphasizes the significance of drama. Morgan (1987: 7) defines drama as an "art of communication," which is essential in teaching literature. A survey…

  14. 3 CFR - Unexpected Urgent Refugee and Migration Needs Related to Gaza

    Science.gov (United States)

    2010-01-01

    ... 3 The President 1 2010-01-01 2010-01-01 false Unexpected Urgent Refugee and Migration Needs... of January 27, 2009 Unexpected Urgent Refugee and Migration Needs Related to Gaza Memorandum for the..., including section 2(c)(1) of the Migration and Refugee Assistance Act of 1962 (the “Act”), as amended (22 U...

  15. Online Teacher Training in a Context of Forced Immobility: The Case of Gaza, Palestine

    Science.gov (United States)

    Fassetta, Giovanna; Imperiale, Maria Grazia; Frimberger, Katja; Attia, Mariam; Al-Masri, Nazmi

    2017-01-01

    This article discusses an action research study that involved the design and delivery of an online training course for teachers of Arabic to speakers of other languages in the Gaza Strip (Palestine). Grounded in Freirean pedagogy, the course aimed to respond to the employment needs of university graduates by creating opportunities for online…

  16. Prevalence of congenital heart disease among Palestinian children born in the Gaza Strip.

    Science.gov (United States)

    Zaqout, Mahmoud; Aslem, Emad Said; Oweida, Forijat Sadeldin; De Wolf, Daniel

    2014-10-01

    This study was designed to estimate the birth prevalence of children with congenital heart disease born in the Gaza Strip during 2010 and to compare these with estimates from elsewhere. We reviewed the medical records of all children born in 2010 who were diagnosed, treated, and/or followed up in the four paediatric cardiology clinics in the Gaza Strip. Data were also obtained from El Makassed Hospital in East Jerusalem and from the Schneider Hospital, Wolfson Medical Center, and Tel HaShomer Hospital in Israel, where we had referred some of our patients for percutaneous or surgical treatment. A total of 598 children with congenital heart disease were detected among the 59,757 children born alive in the Gaza Strip during 2010, yielding a birth incidence of 10 per 1000 live births. The most frequently occurring conditions were ventricular septal defects (28%), ostium secundum atrial septal defects (17%), patent ductus arteriosus (8.5%), and pulmonary valve abnormalities (8%). In this study, 7% of the children died. The actuarial survival at 6 months and 1 year of age was 94% and 93%, respectively, and remained stable over 18 months of follow-up. The birth incidence of congenital heart disease in the Gaza Strip in 2010 (10 per 1000) is higher than most estimates in Western Europe (8.2 per 1000 live births) and North America (6.9 per 1000 live births) but is similar to estimates from other parts of Asia (9.3 per 1000 live births).

  17. Profil Lipodistrofi dan Dislipidemia pada Pasien Prepubertas dengan HIV yang Mendapat Terapi ARV di Rumah Sakit Cipto Mangunkusumo

    Directory of Open Access Journals (Sweden)

    Yessi Yuniarti

    2016-11-01

    Kesimpulan. Prevalensi lipodistrofi dan dislipidemia cukup tinggi pada pasien prepubertas dengan HIV yang mendapatkan terapi ARV. Mayoritas subyek yang mengalami lipodistrofi memiliki massa lemak tubuh, TLK triceps dan subscapular yang normal.

  18. On Dávid Kaposi's "Violence and understanding in Gaza: The British broadsheets' coverage of the war"

    OpenAIRE

    Wazir, Ali

    2016-01-01

    It has not been easy to develop comprehensive understanding of this protracted conflict especially in the backdrop of time to time incidents of war/violence in Gaza. Many authors have approached the conflict with variety of perspectives. Within this context, Professor Dávid Kaposi, who works at the University of East London UK, has published the book: Violence and Understanding in Gaza: The British Broadsheets’ Coverage of the War. Here he has applied both quantitative and qualitative method...

  19. The Advanced Re-Entry Vehicle (ARV) a Development Step from ATV Toward Manned Transportation Systems

    Science.gov (United States)

    Bottacini, M.; Berthe, P.; Vo, X.; Pietsch, K.

    2011-08-01

    The Advanced Re-entry Vehicle (ARV) programme has been undertaken by Europe with the objective to contribute to the preparation of a future European crew transportation system, while providing a valuable logistic support to the ISS through an operational cargo return system. This development would allow: - the early acquisition of critical technologies; - the design, development and testing of elements suitable for the follow up human rated transportation system. These vehicles should also serve future LEO infrastructures and exploration missions. With the aim to satisfy the above objectives a team composed by major European industries and led by EADS Astrium Space Transportation is currently conducting the phase A of the programme under contract with the European Space Agency (ESA). Two vehicle versions are being investigated: a Cargo version, transporting cargo only to/from the ISS, and a Crew version, which will allow the transfer of both crew and cargo to/from the ISS. The ARV Cargo version, in its present configuration, is composed of three modules. The Versatile Service Module (VSM) provides to the system the propulsion/GNC for orbital manoeuvres and attitude control and the orbital power generation. Its propulsion system and GNC shall be robust enough to allow its use for different launch stacks and different LEO missions in the future. The Un-pressurised Cargo Module (UCM) provides the accommodation for about 3000 kg of un-pressurised cargo and is to be sufficiently flexible to ensure the transportation of: - orbital infrastructure components (ORU's); - scientific / technological experiments; - propellant for re-fuelling, re-boost (and deorbiting) of the ISS. The Re-entry Module (RM) provides a pressurized volume to accommodate active/passive cargo (2000 kg upload/1500 kg download). It is conceived as an expendable conical capsule with spherical heat- hield, interfacing with the new docking standard of the ISS, i.e. it carries the IBDM docking system, on a

  20. Price Reversal Pattern of ARV Drugs: A Transaction-Cost Approach Digression

    Directory of Open Access Journals (Sweden)

    Frank LORNE

    2015-05-01

    Full Text Available A price reversal pattern of ARV drugs was noted across lower and middle income countries in that the lower-income countries have higher prices relative to higher-income countries based on a 2008-2009 Summary Report by World Health Organization. The transaction costs affecting AVR drug pricing can be broadly classified into two kinds: One between the final users and the opinion/knowledge experts, and the other between the opinion/knowledge experts and the manufacturers. Economist’s version of price discrimination needs to be modified by including transaction costs. Transaction costs also point to institution creditability factors that will affect NGO procurement.

  1. Social arv

    DEFF Research Database (Denmark)

    Jensen, Bente

    Arbejdspapir som er udarbejdet i forbindelse med HPA-projektet og brugt i en anden udgivelse fra 2007. Nu genudgivet med nyt forord og ISBN nummer, samt udgive via DPU's forlag som e-bog......Arbejdspapir som er udarbejdet i forbindelse med HPA-projektet og brugt i en anden udgivelse fra 2007. Nu genudgivet med nyt forord og ISBN nummer, samt udgive via DPU's forlag som e-bog...

  2. Metals detected by ICP/MS in wound tissue of war injuries without fragments in Gaza

    OpenAIRE

    Skaik, Sobhi; Abu-Shaban, Nafiz; Abu-Shaban, Nasser; Barbieri, Mario; Barbieri, Maurizio; Giani, Umberto; Manduca, Paola

    2010-01-01

    Abstract Background The amount and identity of metals incorporated into "weapons without fragments" remain undisclosed to health personnel. This poses a long-term risk of assumption and contributes to additional hazards for victims because of increased difficulties with clinical management. We assessed if there was evidence that metals are embedded in "wounds without fragments" of victims of the Israeli military operations in Gaza in 2006 and 2009. Methods Biopsies of "wounds without fragment...

  3. Language and civilian deaths: denying responsibility for casualties in the Gaza conflict 2014

    OpenAIRE

    Finlay, W.M.L.

    2017-01-01

    The UNHCR estimated that 1,462 civilians were killed in Gaza and six civilians were killed in Israel during the conflict of 2104. This article uses Discursive Psychology to examine how Israeli spokespeople described the conflict, and Israel’s actions, in ways that denied responsibility for civilian deaths. They did this using a number of discursive strategies. These included: a) using passive and noun constructions which minimized reference to civilian deaths and erased Israeli involvement in...

  4. Clinical and Biochemical Associations with Diabetic Retinopathy in Male Patients in the Gaza Strip

    Directory of Open Access Journals (Sweden)

    Ayman M. AbuMustafa

    2017-11-01

    Full Text Available BackgroundThere are limited data on the prevalence and risk factors for diabetic retinopathy (DR in the Gaza Strip.ObjectiveTo assesses clinical and biochemical associated with DR in males with type 2 diabetes mellitus (T2DM in the Gaza Strip.MethodsOne hundred and fifty males with T2DM from the Gaza Strip underwent a questionnaire interview, serum biochemical analysis, and assessment of their previous urine and blood results.ResultsThe prevalence of DR was 24.7%. The duration of diabetes and prevalence of neuropathy, nephropathy, cardiovascular disease, and recurrent infections were significantly higher among patients with DR compared with those without DR (p < 0.05. Serum urea, creatinine, glucose, cholesterol, and low-density lipoprotein cholesterol were significantly elevated, whilst eGFR and high-density lipoprotein cholesterol were significantly lower in patients with DR compared with patients without DR (p < 0.05. Urinary albumin concentration and albumin creatinine ratio (ACR was higher in patients with DR. ACR correlated significantly with the duration of T2DM (r = 0.311, p < 0.001, glucose (r = 0.479, p < 0.001, urea (r = 0.337, p < 0.001, creatinine (r = 0.275, p = 0.001, and GFR (r = −0.275, p < 0.001.ConclusionThese data show a high prevalence of DR in an unselected cohort of patients with T2DM and relationships to modifiable risk factors in Gaza.

  5. Exploring water and food security: the water footprint of domestic food production in the Gaza Strip

    Science.gov (United States)

    Recanati, Francesca; Castelletti, Andrea; Dotelli, Giovanni; Melià, Paco

    2016-04-01

    Water scarcity and food security are major issues in the Gaza Strip. This area is characterized by one of the highest densities in the world and it is affected by both severe scarcity of water resources and limited trading possibilities.Given this context, the enhancement of domestic food production is considered a fundamental strategy in achieving food security in the area. For this reason, rural people play a crucial role in implementing sustainable strategies for enhancing the domestic food production while preserving water resources. In order to investigate the effectiveness of existing agricultural scenarios in achieving food security in a sustainable manner, we propose a framework to assess food production systems in terms of their contribution to the nutritional and economic conditions of rural households and their impact on water resources. In particular, the latter has been carried out through the water footprint indicator proposed by the Water Footprint Network. The case study analyzed is a sample farm located in the Gaza Strip, whose food production is based on horticulture, animal husbandry and aquaculture. The study is articulated into two main parts: first, we compare alternative scenarios of vegetal and animal food production in terms of food supply, water consumption and economic income at the household scale; then, we extend the analysis to evaluate the potential contribution of domestic food production to the food security in the whole Gaza Strip, focusing on the nutritional dimension, and providing a preliminary assessment of the environmental and economic sustainability. In particular, we evaluate water appropriation for domestic food production and compare it with the availability of water resources in the region. The outcomes highlight that the domestic food production can potentially satisfy both a basic diet and economic income for rural household, but the related appropriation of freshwater results unsustainable with respect to the fresh

  6. Application of ann for predicting water quality parameters in the mediterranean sea along gaza-palestine

    International Nuclear Information System (INIS)

    Zaqoot, H.A.; Unar, M.A.

    2008-01-01

    Seawater pollution problems are gaining interest world wide because of their health impacts and other environmental issues. Intense human activities in areas surrounding enclosed and semi-enclosed seas such as the Mediterranean Sea always produce in the long term a strong environmental impact in the form of coastal and marine degradation. This paper is concerned with the use of ANNs (Artificial Neural Networks) MLP ( Multilayer Perceptron) model for the prediction of pH and EC (Electrical Conductivity) in water quality parameters along Gaza city coast. MLP neural networks are trained and developed with reference to three major oceanographic parameters (water temperature, wind speed and turbidity) to predict the values of pH and EC; these parameters are considered as inputs of the neural network. The data collected comprised of four years and collected from nine locations along Gaza coastline. Results show that the model has high capability and accuracy in predicting both parameters. The network performance has been validated with different data sets and the results show satisfactory performance. Results of the developed model have been compared with multiple regression statistical models and found that MLP predictions are slightly better than the conventional methods. Prediction results prove that the proposed approach is suitable for modeling the water quality in the Mediterranean Sea along Gaza. (author)

  7. L´Ekphrasis Eikonos de Procope de Gaza en tant que reflet de la société de l´Antiquité tardive

    Czech Academy of Sciences Publication Activity Database

    Drbal, Vlastimil

    2011-01-01

    Roč. 69, č. 3 (2011), s. 106-122 ISSN 0007-7712 Grant - others:AV ČR (CZ)(CZ) M300920901 Program:M Institutional research plan: CEZ:AV0Z90920516 Keywords : ekphrasis * Late Antiquity * Gaza * Procopius of Gaza Subject RIV: AB - History

  8. Possible health effects of liquefied petroleum gas on workers at filling and distribution stations of Gaza governorates.

    Science.gov (United States)

    Sirdah, M M; Al Laham, N A; El Madhoun, R A

    2013-03-01

    Liquefied petroleum gas (LPG) is widely used in the Gaza Strip for domestic purposes, in agriculture and industry and, illegally, in cars. This study aimed to identify possible health effects on workers exposed to LPG in Gaza governorates. Data were collected by a questionnaire interview, and haematological and biochemical analyses of venous blood samples were made from 30 workers at filling and distribution stations and 30 apparently healthy controls. Statistically significant differences were found in all self-reported health-related complaints among LPG workers versus controls. LPG workers had significantly higher values of red blood cell counts, haemoglobin, haematocrit mean corpuscular haemoglobin and platelet counts. They also had significantly higher values of kidney function tests (urea, creatinine and uric acid) and liver function enzyme activities (aspartate aminotransferase and alanine aminotransferase). LPG workers at Gaza Strip petroleum stations are at higher risk for health-related symptoms and clinical abnormalities.

  9. Androgen receptor and its splice variant, AR-V7, differentially regulate FOXA1 sensitive genes in LNCaP prostate cancer cells.

    Science.gov (United States)

    Krause, William C; Shafi, Ayesha A; Nakka, Manjula; Weigel, Nancy L

    2014-09-01

    Prostate cancer (PCa) is an androgen-dependent disease, and tumors that are resistant to androgen ablation therapy often remain androgen receptor (AR) dependent. Among the contributors to castration-resistant PCa are AR splice variants that lack the ligand-binding domain (LBD). Instead, they have small amounts of unique sequence derived from cryptic exons or from out of frame translation. The AR-V7 (or AR3) variant is constitutively active and is expressed under conditions consistent with CRPC. AR-V7 is reported to regulate a transcriptional program that is similar but not identical to that of AR. However, it is unknown whether these differences are due to the unique sequence in AR-V7, or simply to loss of the LBD. To examine transcriptional regulation by AR-V7, we have used lentiviruses encoding AR-V7 (amino acids 1-627 of AR with the 16 amino acids unique to the variant) to prepare a derivative of the androgen-dependent LNCaP cells with inducible expression of AR-V7. An additional cell line was generated with regulated expression of AR-NTD (amino acids 1-660 of AR); this mutant lacks the LBD but does not have the AR-V7 specific sequence. We find that AR and AR-V7 have distinct activities on target genes that are co-regulated by FOXA1. Transcripts regulated by AR-V7 were similarly regulated by AR-NTD, indicating that loss of the LBD is sufficient for the observed differences. Differential regulation of target genes correlates with preferential recruitment of AR or AR-V7 to specific cis-regulatory DNA sequences providing an explanation for some of the observed differences in target gene regulation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  10. Severe extremity amputations in surviving Palestinian civilians caused by explosives fired from drones during the Gaza War.

    Science.gov (United States)

    Heszlein-Lossius, Hanne; Al-Borno, Yahya; Shaqoura, Samar; Skaik, Nashwa; Giil, Lasse Melvær; Gilbert, Mads

    2018-02-21

    During four separate Israeli military attacks on Gaza (2006, 2009, 2012, and 2014), about 4000 Palestinians were killed and more than 17 000 injured (412 killed and 1264 injured in 2006; 1383 killed and more than 5300 injured in 2009; 130 killed and 1399 injured in 2012; and 2251 killed and 11 231 injured in 2014). An unknown number of people had traumatic amputations of one or more extremities. Use of unmanned Israeli drones for surveillance and armed attacks on Gaza was evident, but exact figures on numbers of drone strikes on Gaza are not available. The aim of this study was to explore the medical consequences of strikes on Gaza with different weapons, including drones. We studied a cohort of civilians in the Gaza Strip who had one of more traumatic limb amputation during the Israeli military attacks between 2006 and 2016. The study was done at The Artificial Limb and Polio Center (ALPC) in the Gaza Strip where most patients are treated and trained after amputation. We used standardised forms and validated instruments to record date and mechanism of injury, self-assessed health, socioeconomic status, anatomical location and length of amputation, comorbidity, and the results of a detailed clinical examination. The studied cohort consisted of 254 Paletinian civilians (234 [92%] men, 20 [8%] women, and 43 [17%] children aged 18 years and younger) with traumatic amputations caused by different weapons. 216 (85%) people had amputations proximal to wrist or ankle, 131 (52%) patients had more than one major amputation or an amputation above the knee, or both, and 136 (54%) people were injured in attacks with Israeli drones, including eight (40%) of the women. The most severe amputations were caused by drone attacks (p=0·0001). Extremity injuries after drone attacks led to immediate amputation more often than with other weapons (p=0·014). Patients injured during cease-fire periods were younger than patients injured during periods of declared Israeli military

  11. "Resilience in Palestinian adolescents living in Gaza": Correction to Aitcheson et al. (2016).

    Science.gov (United States)

    2017-01-01

    Reports an error in "Resilience in Palestinian Adolescents Living in Gaza" by Rozanna J. Aitcheson, Soleman H. Abu-Bader, Mary K. Howell, Deena Khalil and Salman Elbedour ( Psychological Trauma: Theory, Research, Practice, and Policy , Advanced Online Publication, May 30, 2016, np). There were grammatical errors to the Method section of the abstract and the Method subsection Participants. Corrected versions are provided. (The following abstract of the original article appeared in record 2016-26488-001.) Objective: The pathogenic impact of ongoing political conflict on children and adolescents has been well-documented in the literature. The present study, by contrast, examined the factors that support adolescent health and utilized a salutogenic model to examine prevalence of depression and anxiety and predictors of resilience in a group of adolescents attending secondary school in Gaza. There were 335 Palestinian adolescents (n = 335) enrolled in 11th and 12th grades in secondary schools in Gaza refugee camps completed the Beck Depression Inventory, the Beck Anxiety Inventory, and self-report measures assessing coping skills, self-regulation, optimism, parenting style, family sense of coherence, national identity, ethnic identity, and other demographic variables. Participants with stronger national identity, stronger family sense of coherence, greater self-regulation, and more optimism reported less depressive and anxious symptoms. In a logistic regression analysis, significant predictors of resilience (minimal to no anxiety and depression, n = 135) were age, optimism, family sense of coherence, ethnic identity, self-regulation, and coping skills. These findings indicate that older age, optimism, perception of family seeing the world as comprehensible, manageable, and meaningful, stronger Arab ethnic identity, greater self-regulation and stronger coping skills promote adolescent adaptation and health. Salutogenesis frames information about how resilient youth

  12. Possible Hematological Changes Associated with Acute Gastroenteritis among Kindergarten Children in Gaza.

    Science.gov (United States)

    Al Laham, N A; Elyazji, M S; Al-Haddad, R J; Ridwan, F N

    2015-01-01

    Gastroenteritis is considered one of the leading causes of morbidity and mortality in children especially in developing countries. It is a major childhood problem in Gaza and one of the most common etiologic agents of iron deficiency anemia (IDA). This study was conducted to investigate possible changes in blood parameters that are associated with gastroenteritis infection among kindergarten children in Gaza. A cross-sectional case-control study was performed including kindergarten children suffering from gastroenteritis and matched healthy control group. Types of etiological agents were identified using standard microbiological and serological procedures. Blood samples were collected for estimation of complete blood count and for determination of serum iron, total iron binding capacity (TIBC), and transferrin saturation. Independent sample t-test was used for comparisons and performed using SPSS software version 17(Chicago Illinois USA). The prevalence of enteric pathogens among cases (88.5% [85/96]) was significantly higher than in asymptomatic controls (11.1% [6/54]). The most common enteric pathogens isolated were Entamoeba histolytica (28% [42/91]) and Giardia lamblia (26.7% [40/91]). Blood tests revealed that 21.8% (21/96) of cases and 14.8% (8/54) of controls had IDA, which were not significantly different. Meanwhile, a significant difference was found between the TIBC and hemoglobin in cases compared to controls. This study indicates that gastroenteritis infection could be considered as a common health problem in kindergarten children in Gaza, and it is possibly associated with changes in hemoglobin concentration and TIBC.

  13. Iron deficiency anemia among kindergarten children living in the marginalized areas of Gaza Strip, Palestine

    Directory of Open Access Journals (Sweden)

    Mahmoud Mohammed Sirdah

    2014-04-01

    Full Text Available Background: iron deficiency anemia is the most common type of nutritional anemia; it has been recognized as an important health problem in Palestine. This study was conducted to estimate the prevalence and to identify possible risk factors of iron deficiency anemia among kindergarten children living in the marginalized areas of the Gaza Strip and to evaluate the effectiveness of supplementing oral iron formula in the anemic children. Methods: the study included 735 (384 male and 351 female kindergarten children. Data was collected by questionnaire interviews, anthropometric measurements, and complete blood count analysis. All iron deficient anemic children were treated using an oral iron formula (50 mg ferrous carbonate + 100 mg vitamin C /5 mL and the complete blood count was reassessed after three months. A univariate analysis and a multiple logistic regression model were constructed; crude and adjusted odds ratios (OR, and 95% confidence intervals (95% CI were calculated. Results: the overall prevalence of iron deficiency anemia was 33.5% with no significant differences between boys and girls. Significantly different prevalences of iron deficiency anemia were reported between different governorates of the Gaza Strip. Governorate, low education level of the parents and smoking are significant risk factors for children developing anemia. Significantly lower complete blood count parameters, except for WBC, were reported in anemic children. The oral iron treatment significantly improved hemoglobin concentrations, and normalized the iron deficiency marker. Conclusions: iron deficiency anemia is a serious health problem among children living in the marginalized areas of the Gaza Strip, which justifies the necessity for national intervention programs to improve the health status for the less fortunate development areas.

  14. Microbial water quality of coastal recreational water in the Gaza Strip, Palestine

    Directory of Open Access Journals (Sweden)

    MAZEN T. ABUALTAYEF

    2014-05-01

    Full Text Available Abualtayef MT, Abd Rabou AN, Abu Foul AA, Ghabayen SM, Elsinwar HM. 2014. Microbial water quality of coastal recreational water in the Gaza Strip, Palestine. Nusantara Bioscience 6: 26-32. Wastewater disposal into the Mediterranean coast of the Gaza Strip has many negative effects, whether on the environment or on human health, thus microbiological analysis of seawater samples was carried out. The microbial analysis was confined on two types of fecal indicators (fecal coliform and fecal streptococci, in addition to a single type of bacteria (pseudomonas. This study was conducted between the beginning of July 2012 to the mid of October 2012 over an area extended from the proposed Khan Younis fishing port to Gaza fishing port, with a length of about 23 km. The study area was divided into five zones. The samples were collected in two rounds: the first round included 75 samples that collected along the study area during the summer season. The second round included 19 samples that collected in the autumn season to compare it with their counterparts that have been collected in the summer season. Laboratory analysis showed the presence of contamination in many of these samples. The results also showed that the pollution was concentrated in and surrounding the mouths of wastewater outfalls. Depending on the microbial analyses, which have been collected in the first round, the fecal coliform appeared in 61% of the samples, while fecal streptococci appeared in all samples and pseudomonas appeared in 33% of the samples. The pollutants were widespread along the study area, which are the result mainly from wastewater discharge into the sea. A risk analysis was done for season variations using the second moment method; in general, it was found that risk in both seasons was high especially in summer.

  15. Evaluation of advanced medical imaging services at Governmental Hospitals-Gaza Governorates, Palestine

    Directory of Open Access Journals (Sweden)

    K.M. Abushab

    2018-01-01

    Full Text Available Medical imaging services are the key tool to diagnose many diseases and have an important role in monitoring treatment and predicting outcome. The current study conducted to evaluate advanced medical imaging services (CT and MRI at Governmental Hospitals-Gaza Governorates, Palestine. Triangulated study design was used (checklist, questionnaire and key informant interview. The researcher used arbitrated checklist to evaluate medical imaging facilities. Census study conducted on all Radiologic Technologists and medical imaging departments at three main governmental hospitals in the Gaza Strip, which offered advanced medical imaging. In addition, three key informant interviews with Radiologic Technologists manager were conducted. Researcher have directly interviewed 20 participants (75% Males; 80% older than 30; 90% bachelor and master degrees and 80% more than 10 years' experience. Researcher have directly interviewed 20 participants (75% Males; 80% older than 30; 90% bachelor and master degrees and 80% more than 10 years' experience. Each RT at European Gaza hospital is expected to perform 25 cases in the morning shift against 6 and 13 cases at Indonesia and Al-Shifa Hospital, respectively. Both of Computed Tomography and Magnetic Resonance Imaging departments showed that “60%, 78% and 91%” and “86%, 100% and 90%” followed standard regarding to their structures, occupational safety and essential supplies, respectively. An observable shortage in number of radiographic machines and Radiologic Technologists at all advanced medical imaging departments. All departments showed clear defect in structure, design and essential supplies. Critical readings were observed respecting to insufficient radiation protection tools and holding of Thermoluminescence Dosimeters.

  16. Resilience and distress: Israelis respond to the disengagement from Gaza and the second Lebanese war.

    Science.gov (United States)

    Ben-Zur, Hasida; Gilbar, Ora

    2011-10-01

    Resilience and distress in Israeli society were assessed at three points in time: before and after the Israeli disengagement from Gaza, and after the second Lebanese war. A random sample of 366 Israelis was assessed for nation-related anxiety and hostility, personal resources and post-traumatic symptoms. The lowest levels of anxiety were observed at the second time point, after the disengagement. Respondents with high-resilience profiles showed lower levels of post-traumatic symptoms and higher levels of personal resources. The findings underscore Israelis' resilience and the importance of personal resources in ongoing nationally stressful situations.

  17. Inpatient management of community-acquired pneumonia at the European Gaza Hospital: a clinical audit.

    Science.gov (United States)

    Alyacoubi, Said; Abuowda, Yousef; Albarqouni, Loai; Böttcher, Bettina; Elessi, Khamis

    2018-02-21

    Disease severity scores such as CURB-65 are often used to guide the management of patients with community-acquired pneumonia. Early and adequate empirical antibiotic treatment reduces mortality. The aim of this study was to examine the severity assessment and management of patients presenting with community-acquired pneumonia at the European Gaza Hospital in the Gaza Strip and to compare this to the best available evidence. Medical records of all patients admitted to the European Gaza Hospital with a diagnosis of community-acquired pneumonia between Dec 1, 2015, and March 31, 2016, were reviewed retrospectively. Clinical practice was compared with recommendations for severity assessment and the management of community-acquired pneumonia, as reported in guidelines by the National Institute for Health and Care Excellence and the American Thoracic Society. Ethical approval was obtained from the General Directorate of Human Resources. 141 patients were admitted to the European Gaza Hospital with community-acquired pneumonia during the study period. Records of 41 patients were missing or could not be retrieved. The mean age of patients was 55·9 years (SD 20·2). Blood urea and nitrogen concentrations were not documented for 48 (48%) patients, and respiratory rate was not documented for 73 (73%) patients. The CURB-65 score was determined only for 12 (12%) patients. Microbiological testing was done only for two (2%) patients. Although 18 different antibiotic regimens were used, 81 (81%) patients received a β-lactam plus macrolide combination therapy, either given alone (49 [49%] patients) or with another antibiotic (32 [32%] patients), which is in line with the recommendations for patients admitted to hospital with community-acquired pneumonia. 43 (43%) patients received anti-viral drugs, and 41 (41%) patients received corticosteroids. Clinicians were poorly adherent to current standards of care in severity assessment and management of community-acquired pneumonia

  18. Offshore tsunami deposits signify risk for heavily populated southern Levant Coastline (Gaza and Ashkelon)

    Science.gov (United States)

    Hoffmann, Nadine; Goodman-Tchernov, Beverly; Galanti, Barak; Katz, Oded

    2016-04-01

    The southern Levantine coastline is exposed to a variety of potential tsunami-generating sources, including far field influences such as large earthquakes and volcanic eruptions as well as near field offshore landslides along the continental slope, where slumping features are present throughout the area. Not only does this coast boast a long history of continuous occupation but also today large cities (e.g. Tel Aviv, Ashdod, Ashkelon, and Gaza) and related critical infrastructure such as ports, power plants, chemical industries, roads, etc. are located along this corridor. In addition, further to the south, the Gaza Strip has one of the highest population densities in the world and is dependent on external assistance for many basic needs, goods and infrastructure. Newly obtained sediment cores from the shallow shelf offshore Ashkelon (~12 km north of Gaza City) exhibit several events that can be linked to historical records. These cores can be subdivided in two general horizon types that show relative changes to one another across different proxies. The continuous input of Nile-delta sands results in a homogenous and stable 'background' sediment represented by well sorted, finer sands, few inclusions, lower proportions of A. parkinsoniana relative to fossil tests, and very few yellow-stained and blackened specimens. Contrasting these normal marine condition deposits are high energy tsunamigenic deposits characterized by poor sorting, with inclusions of a range of whole, articulated, and fragmented shells, wood, charcoal, and sub-angular to rounded pebbles. Newly mapped and quantified offshore bathymetric evidence for landslides and slumping motion has identified features that are large enough to generate tsunamis that would affect the study area. These were modeled as possible sources and compared to different far field events. Some of those tsunamigenic horizons could be assigned to specific events ranging between the youngest at 1202AD to the oldest prehistoric

  19. Genetic variability of Candida albicans in HIV/AIDS patient with and without ARV therapy and non HIV/AIDS

    Directory of Open Access Journals (Sweden)

    Retno Puji Rahayu

    2012-03-01

    Full Text Available Background: Oral candidiasis is the mostly found oral manifestation in HIV/AIDS infected patient caused by immunocompromised especially immunodeficiency. Clinical symptoms is severe pain in oral cavity and dry mouth because of xerostomia which cause the loss of appetite. Candida albicans (C. albicans is normal flora in oral cavity which plays as opportunistic pathogen and also the cause of oral candidiasis. Almost 90% of HIV–infected patient have oral candidiasis. This condition is clinical problem which has not been well-managed yet. C. albicans colonized oral mucous cavity has different genetic variability for each strain. Phenotype of C. albicans has been determined by genetic factor and environtment. This condition stimulate differences of genotype among various strain of C. albicans in the world. Purpose: The purpose of this research is to analyze the genetic variability of C.albicans which colonized in the mucous oral cavity of HIV/AIDS patient in Surabaya in the treatment with and without ARV therapy and non HIV/AIDS. Methods: This research has been identify and characterize the prevalent strain of C. albicans isolat in Surabaya (East Java in HIV/AIDS infected patient with oral candidiasis by method of Iatron candidal check. The highlight of this research including cytology examination by Papanicoloau staining, C. albicans culture, spheroplast making, DNA isolation and genetic variability checking by randomly amplyfied polymorphism DNA (RAPD. Results: C. albicans colonizing oral mucosa of non-HIV patients had a predisposition of farther genetic relationship (genetic distance of 0.452 with C. albicans colonizing oral mucosa of HIV ARV and HIV non-ARV patients. The genetic distance was ranging between 0 and 1, where 9 was long genetic distance and 1 was short genetic distance. In contrast, C. albicans colonizing oral mucosa of HIV ARV have predisposition of closer genetic relationship (genetic distance of 0.762 with C. albicans colonizing

  20. Dynamics of the Asymmetric Conflict between the State of Israel and Radical Organizations of Gaza Strip (2009-2012

    Directory of Open Access Journals (Sweden)

    A A Kornilov

    2014-12-01

    Full Text Available The authors consider military policy of the State of Israel in regard to the radical organizations of the Gaza Strip during 2009-2012. The article focuses on the military standoff 2012, during which the Jewish State with minimum losses from its part could greatly weaken Hamas and others radical organizations.

  1. Performance of Wastewater Treatment Plants in Gaza Strip Potential use of Wastewater and Sludge in Agriculture

    Energy Technology Data Exchange (ETDEWEB)

    Shomar, B.H.; Mueller, G.; Yahya, A.

    2003-07-01

    Twelve elements (Ag, Al, As, Cd, Ca, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) were analyzed in 120 composite samples of influent and effluent wastewater; the results revealed that domestic wastewater influent contains considerable amounts of heavy metals and the partially functional treatment plants of Gaza are able to remove 40-70% of most metals during the treatment process. Heavy metals in 31 industrial wastewater effluents are within the ranges of international standards. All industries of Gaza are light, despite that they have no treatment facilities, their effluents are being discharged to municipal sewerage system and the existing treatment plants are capable to absorb the industrial effluents with no significant impact on treatment bioprocesses. Thirty parameters were determined in 35 sludge samples; P, AOX, C, S, CaCO{sub 3}, Mg, Ca, Na, K, Li, Cu, Zn, Ni, Pb, Mn, Fe, Cr, Co, Cd, As, Hg, Ti, Se, Br, Rb, Th, Sr, Y, U, and Zr. Although there are no treatment facilities for sludge within the treatment plants, the results indicated that sludge in general is clean of heavy metals. Zinc and AOX only showed anomalous concentrations; more than 85% of sludge samples showed that averages of zinc and AOX are 2000 mg/kg and 550 mg Cl/kg, respectively, which exceed the standards of all industrial countries for sludge to be used in land application. (author)

  2. Perception of Contracting parties on Construction Safety in the Gaza Strip, Palestine

    International Nuclear Information System (INIS)

    Enhassi, Adnan Ali; Hassouna, Ahmed Mohamed; Mayer, P.E.; Choudhary, R.M.

    2007-01-01

    The construction industry is one of the most hazardous industries in developing countries. Understanding the safety climate or culture of a workplace, the perceptions and attitudes of workforce are important factors in assessing safety needs. The construction industry in Palestine, by its inherent nature, is susceptible to potentially dangerous conditions that affect the safety of all personnel working in construction projects. This paper reports, based on a questionnaire survey, the perception of owners, consultants and contractors towards safety in the Gaza Strip. The results showed that, most of the participants in the survey had accidents in their construction projects. The findings indicated that, main causes of fatalities and injuries are falling from heights, dropped objects and materials and being caught under excavations. Carelessness of workers, lack of safety knowledge and lack of safety training are the main three reasons that contributed to the increase rate of accidents among construction workers in the Gaza Strip. Therefore, contactors should prepare safety training programs which help personnel to carry out various accidents preventive activities effectively. Training material should discuss the cost of accidents, the influence of good safety performance and should stress the safety objectives of the company, the relevant laws and legislation and contractual relationships with clients regarding safety matters. (author)

  3. Dual Therapy Treatment Strategies for the Management of Patients Infected with HIV: A Systematic Review of Current Evidence in ARV-Naive or ARV-Experienced, Virologically Suppressed Patients.

    Science.gov (United States)

    Baril, Jean-Guy; Angel, Jonathan B; Gill, M John; Gathe, Joseph; Cahn, Pedro; van Wyk, Jean; Walmsley, Sharon

    2016-01-01

    We reviewed the current literature regarding antiretroviral (ARV)-sparing therapy strategies to determine whether these novel regimens can be considered appropriate alternatives to standard regimens for the initial treatment of ARV-naive patients or as switch therapy for those patients with virologically suppressed HIV infection. A search for studies related to HIV dual therapy published from January 2000 through April 2014 was performed using Biosis, Derwent Drug File, Embase, International Pharmaceutical Abstracts, Medline, Pascal, SciSearch, and TOXNET databases; seven major trial registries, and the abstracts of major conferences. Using predetermined criteria for inclusion, an expert review committee critically reviewed and qualitatively evaluated all identified trials for efficacy and safety results and potential limitations. Sixteen studies of dual therapy regimens were critiqued for the ARV-naive population. Studies of a protease inhibitor/ritonavir in combination with the integrase inhibitor raltegravir or the nucleoside reverse transcriptase inhibitor lamivudine provided the most definitive evidence supporting a role for dual therapy. In particular, lopinavir/ritonavir or darunavir/ritonavir combined with raltegravir and lopinavir/ritonavir combined with lamivudine demonstrated noninferiority to standard of care triple therapy after 48 weeks of treatment. Thirteen trials were critiqued in ARV-experienced, virologically suppressed patients. The virologic efficacy outcomes were mixed. Although overall data regarding toxicity are limited, when compared with standard triple therapy, certain dual therapy regimens may offer advantages in renal function, bone mineral density, and limb fat changes; however, some dual combinations may elevate lipid or bilirubin levels. The potential benefits of dual therapy regimens include reduced toxicity, improved tolerability and adherence, and reduced cost. Although the data reviewed here provide valuable insights into the

  4. Wintertime Local Wind Dynamics from Scanning Doppler Lidar and Air Quality in the Arve River Valley

    Directory of Open Access Journals (Sweden)

    Tiphaine Sabatier

    2018-03-01

    Full Text Available Air quality issues are frequent in urbanized valleys, particularly in wintertime when a temperature inversion forms and the air within the valley is stably stratified over several days. In addition to pollutant sources, local winds can have a significant impact on the spatial distribution and temporal evolution of pollutant concentrations. They can be very complex and difficult to represent in numerical weather prediction models, particularly under stable conditions. Better knowledge of these local winds from observations is also a prerequisite to improving air quality prediction capability. This paper analyses local winds during the Passy-2015 field experiment that took place in a section of the Arve river valley, near Chamonix–Mont-Blanc. This location is one of the worst places in France regarding air quality. The wind analysis, which is mainly based on scanning Doppler lidar data sampling a persistent temperature inversion episode, reveals features consistent with the higher pollutant concentrations observed in this section of the valley as well as their spatial heterogeneities. In particular, an elevated down-valley jet is observed at night in the northern half of the valley, which, combined with a weak daytime up-valley wind, leads to very poor ventilation of the lowest layers. A northeast–southwest gradient in ventilation is observed on a daily-average, and is consistent with the PM10 heterogeneities observed within the valley.

  5. GAMBARAN KEPATUHAN ORANG DENGAN HIV-AIDS (ODHA DALAM MINUM OBAT ARV DI KOTA BANDUNG, PROVINSI JAWA BARAT, TAHUN 2011-2012

    Directory of Open Access Journals (Sweden)

    Sugiharti Sugiharti

    2015-04-01

    Full Text Available Latar belakang : Jumlah penderita HIV di Indonesia hingga Juni 2012 mencapai 86.762 orang dan untuk penderita AIDS 32.103 orang. Secara nasional, provinsi Jawa Barat termasuk salah satu dari                         5 provinsi dengan  kasus HIV-AIDS tertinggi di Indonesia. Tujuan : Mengetahui tingkat kepatuhan ODHA dalam mengkonsumsi obat ARV dan faktor-faktor yang mendukung ODHA dalam hal minum obat ARV. Metode : Penelitian ini menggunakan metode kualitatif dan kuantitatif. Pengambilan data dilakukan dengan wawancara mendalam dan observasi pada ODHA dan Pengawas Minum Obat (PMO ODHA yang menjadi sampel penelitian. Hasil : Sebanyak 9 dari 11 ODHA memiliki tingkat kepatuhan ODHA minum obat ARV > 95%. Faktor-faktor yang mendukung ODHA dalam minum obat ARV adalah faktor keluarga, teman, Forum WPA (Warga Peduli AIDS dan faktor internal dalam diri ODHA. Sedangkan faktor yang menghambat adalah rasa bosan dan jenuh minum obat, efek samping obat, stigma masyarakat dan biaya pengobatan. Kesimpulan : Untuk mencapai tingkat kepatuhan minum obat ARV > 95%, diperlukan dukungan dari keluarga, teman dan Forum WPA, serta faktor internal dalam diri ODHA seperti  motivasi diri untuk tetap hidup dan melakukan aktifitas yang baik.   Kata kunci : ARV, Kepatuhan, ODHA

  6. Differential regulation of metabolic pathways by androgen receptor (AR) and its constitutively active splice variant, AR-V7, in prostate cancer cells.

    Science.gov (United States)

    Shafi, Ayesha A; Putluri, Vasanta; Arnold, James M; Tsouko, Efrosini; Maity, Suman; Roberts, Justin M; Coarfa, Cristian; Frigo, Daniel E; Putluri, Nagireddy; Sreekumar, Arun; Weigel, Nancy L

    2015-10-13

    Metastatic prostate cancer (PCa) is primarily an androgen-dependent disease, which is treated with androgen deprivation therapy (ADT). Tumors usually develop resistance (castration-resistant PCa [CRPC]), but remain androgen receptor (AR) dependent. Numerous mechanisms for AR-dependent resistance have been identified including expression of constitutively active AR splice variants lacking the hormone-binding domain. Recent clinical studies show that expression of the best-characterized AR variant, AR-V7, correlates with resistance to ADT and poor outcome. Whether AR-V7 is simply a constitutively active substitute for AR or has novel gene targets that cause unique downstream changes is unresolved. Several studies have shown that AR activation alters cell metabolism. Using LNCaP cells with inducible expression of AR-V7 as a model system, we found that AR-V7 stimulated growth, migration, and glycolysis measured by ECAR (extracellular acidification rate) similar to AR. However, further analyses using metabolomics and metabolic flux assays revealed several differences. Whereas AR increased citrate levels, AR-V7 reduced citrate mirroring metabolic shifts observed in CRPC patients. Flux analyses indicate that the low citrate is a result of enhanced utilization rather than a failure to synthesize citrate. Moreover, flux assays suggested that compared to AR, AR-V7 exhibits increased dependence on glutaminolysis and reductive carboxylation to produce some of the TCA (tricarboxylic acid cycle) metabolites. These findings suggest that these unique actions represent potential therapeutic targets.

  7. Exposure to war traumatic experiences, post-traumatic stress disorder and post-traumatic growth among nurses in Gaza.

    Science.gov (United States)

    Shamia, N A; Thabet, A A M; Vostanis, P

    2015-12-01

    What is known on the subject? This study builds on existing research on war-related factors that may affect health-care staff by particularly focusing on trauma exposure in both professional and everyday life, as well as on correlates of later positive psychological changes. What this paper adds to existing knowledge? It shows that one in five nursing staff working in Gaza experienced post-traumatic stress symptoms within the clinical range, 2 years after an incursion on Gaza and after being exposed to substantial trauma during this period. Participants appeared to develop a variety of post-traumatic growth responses following trauma exposure. Although nurses experienced traumatic events both as civilians and in their health-care capacity, personal exposure was strongly associated with PTSD symptoms. What are the implications for practice? Support to nursing and other health-care professionals in war situations should entail different levels, remain available well after an acute conflict, and take into consideration both personal and practice-related traumatic events. Mental health nursing practitioners can play a pivotal role in this. To establish the association between war traumatic experiences, post-traumatic stress disorder (PTSD) symptoms and post-traumatic growth among nurses in the Gaza Strip, 2 years after an incursion on Gaza, and during a period of ongoing trauma exposure. This study builds on existing evidence by considering exposure to personal and work-related traumatic events, and on factors associated with later positive psychological adaptation. The sample consisted of 274 randomly selected nurses in Gaza who completed the Gaza Traumatic Events Checklist, PTSD Checklist, and Posttraumatic Growth Inventory. Of the nurses, 19.7% reported full PTSD. There was a significant relationship between traumatic events and PTSD scores; as well as between community-related traumatic events and post-traumatic growth. Participants reported a range of traumatic

  8. FCJ-200 When Memes Go to War: Viral Propaganda in the 2014 Gaza-Israel Conflict

    Directory of Open Access Journals (Sweden)

    Chris Rodley

    2016-03-01

    Full Text Available During the Gaza-Israel conflict of July-August 2014, a large volume of creative, multimodal digital content aimed at influencing public opinion was disseminated on social media by belligerents and their supporters. This paper highlights two related features of this ‘viral agitprop’: the use of a diverse range of novel, hypermediated forms to represent a limited set of messages, and thematisation of the act of mediation itself. I argue that these practices are a response to the challenges of communicating with multiple publics within data streams that are crowded, competitive and fast-moving. I suggest this content represents a distinctive new Internet genre which problematises accounts of the relationship between war and media by Friedrich Kittler and Jean Baudrillard.

  9. Profiles of refugee and non-refugee Palestinians from the West Bank and Gaza.

    Science.gov (United States)

    Al-qudsi, S S

    2000-01-01

    Relying on demographic and labor surveys which the Palestinian Central Bureau of Statistics collected in 1995, this article investigates the profile of West Bank and Gaza refugees. Refugees are better educated and have higher fertility than non-refugee Palestinians, but the difference is small. However, they have a significantly lower participation rate, a higher unemployment rate and a higher incidence of arrests and work stoppage than the corresponding rates among non-refugee Palestinians. A smaller proportion of Palestinians commute to work into the Israeli labor market and refugees earn lower wages than nonrefugees. Returns to investment in education are small for both groups. High fertility among refugees imposes a future challenge for policy makers in terms of resources required for the provision of appropriate education and health facilities. Employing future labor market entrants is another serious policy challenge.

  10. The city as a battlespace: from Gaza to Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Márcio José Mendonça

    2018-03-01

    Full Text Available This study sees the city not only as the primary venue of the capitalism, but as a stage of future wars, as it is observed that the city has been taken and thought as a battlespace in contemporary wars. We are considering that the city has been used by insurgent groups such as terrorists, insurgents and drug traffickers, who hide and use the physical infrastructure of the city in fighting regular armies as a way to reduce military power disparities. Because of this, his life in the city has been affected by conflicts in urban terrain, that aim to not only destroy the enemy, but to destroy its survival space, denying the city. This destruction of the urban space as part of a war strategy, is first analyzed in Gaza, and then to question the extent to which this occurs in the city of Rio de Janeiro.

  11. Ionic and isotopic ratios for identification of salinity sources and missing data in the Gaza aquifer

    Science.gov (United States)

    Ghabayen, Said M. S.; McKee, Mac; Kemblowski, Mariush

    2006-03-01

    Groundwater is the only source of fresh water in the Gaza Strip. However, it is severely polluted and requires immediate effort to improve its quality and increase its usable quantity. Intensive exploitation of groundwater in the Gaza Strip over the past 40 years has disturbed the natural equilibrium between fresh and saline water, and has resulted in increased salinity in most areas. Salinization in the coastal aquifer may be caused by a single process or a combination of different processes, including seawater intrusion, upconing of brines from the deeper parts of the aquifer, flow of saline water from the adjacent Eocene aquifer, return flow from irrigation water, and leakage of wastewater. Each of these sources is characterized by a distinguishable chemistry and well known isotopic ratios. In this paper Na/Cl, SO 4/Cl, Br/Cl, Ca/(HCO 3+SO 4), and Mg/Ca ionic ratios were used to distinguish different salinization sources. δ11B and 87Sr/ 86Sr isotopic composition were also included in the model to study their importance in this monitoring task. The task of monitoring and the associated decision making process are characterized by a high degree of uncertainty with respect to input data and accuracy of models. For this reason, probabilistic expert systems, and more specifically, Bayesian belief networks (BBNs) are used to identify salinization origins. The BBN model incorporates the theoretical background of salinity sources, area-specific monitoring data that are characteristically incomplete in their coverage, expert judgment, and common sense reasoning to produce a geographic distribution for the most probable sources of salinization. The model is also designed to show areas where additional data on chemical and isotopic parameters are needed.

  12. Dietary Patterns and Metabolic Syndrome among Type 2 Diabetes Patients in Gaza Strip, Palestine.

    Science.gov (United States)

    El Bilbeisi, Abdel Hamid; Hosseini, Saeed; Djafarian, Kurosh

    2017-05-01

    The prevalence of metabolic syndrome is raising worldwide; however, the role of diet in the origin of metabolic syndrome is not understood well. This study identifies major dietary patterns among type 2 diabetes mellitus patients with and without metabolic syndrome; and its association with metabolic syndrome components in Gaza Strip, Palestine. This cross sectional study was conducted among 1200 previously diagnosed type 2 diabetes mellitus (both genders, aged 20 - 64 years) patients receiving care in primary healthcare centers in Gaza Strip, Palestine. Metabolic syndrome was defined based on the International Diabetes Federation criteria; dietary patterns were evaluated using a validated semi-quantitative food frequency questionnaire. Statistical analysis was performed using SPSS version 20. Two major dietary patterns were identified by factor analysis: Asian-like pattern and sweet-soft drinks-snacks pattern. After adjustment for confounding variables, patients in the highest tertile of the Asian-like pattern characterized by a high intake of whole grains, potatoes, beans, legumes, vegetables, tomatoes and fruithad a lower odds for (Metabolic syndrome, central obesity, high triglycerides, low HDL cholesterol and high blood pressure), (OR 0.766 CI 95% (.642-.914)), (OR 0.797 CI 95% (.652-.974)), (OR 0.791 CI 95% (.687-.911)), (OR 0.853 CI 95% (.743-.978)) and (OR 0.815 CI 95% (.682-.973)) respectively, (P value metabolic syndrome and its components. The Asian-like pattern may be associated with a lower prevalence of metabolic syndrome and its components among type 2 diabetes patients.

  13. Prevalence and predictors of traditional medicine utilization among persons living with AIDS (PLWA) on antiretroviral (ARV) and prophylaxis treatment in both rural and urban areas in South Africa.

    Science.gov (United States)

    Hughes, G D; Puoane, T R; Clark, B L; Wondwossen, T L; Johnson, Q; Folk, W

    2012-01-01

    Previous studies have reported that majority of antiretroviral (ARV) treatment-naïve patients use traditional medicine (TM). Given that TM use is ubiquitous in South Africa especially for chronic conditions, there is a potential for ARV non-adherence and serious drug interactions among patients with HIV/AIDs who use TM. The motivating factors for TM use in HIV/AIDS patients on ARV and prophylaxis treatment have not been well defined in South Africa. This study aimed to investigate the prevalence, facilitators, predictors, and types of TM used among persons living with HIV/AIDS on antiretroviral treatment. The study was a cross-sectional survey which involved 100 participants enrolled at ARV clinics in two South African provinces. Univariate and bivariate analyses were performed to assess the relationships between variables and potential predictors of TM. Sixteen percent of participants on ARV reported TM use. Seventy-nine percent used TM prior to a diagnosis of HIV. Participants were more likely to use TM if they were from a rural province, female, older, unmarried, employed, had limited education, or were HIV-positive for less than five years. TM users reported utilizing herbal or medicinal mixtures that were claimed to heal all conditions. This study provides insights into the treatment modalities selected by patients with HIV/AIDS in South Africa who are receiving ARV. This study revealed that less than 20% of participants co-used TM and ARV. However, close to 80% of participants utilize TM before contracting HIV, which is in keeping with approximate estimates by the WHO.

  14. Assessing food security in water scarce regions by Life Cycle Analysis: a case study in the Gaza strip

    Science.gov (United States)

    Recanati, Francesca; Castelletti, Andrea; Melià, Paco; Dotelli, Giovanni

    2013-04-01

    Food security is a major issue in Palestine for both political and physical reasons, with direct effects on the local population living conditions: the nutritional level of people in Gaza is classified by FAO as "insecure". As most of the protein supply comes from irrigated agricultural production and aquaculture, freshwater availability is a limiting factor to food security, and the primary reason for frequent conflicts among food production processes (e.g. aquaculture, land livestock or different types of crops). In this study we use Life Cycle Analysis to assess the environmental impacts associated to all the stages of water-based protein production (from agriculture and aquaculture) in the Gaza strip under different agricultural scenarios and hydroclimatic variability. As reported in several recent studies, LCA seems to be an appropriate methodology to analyze agricultural systems and assess associated food security in different socio-economic contexts. However, we argue that the inherently linear and static nature of LCA might prove inadequate to tackle with the complex interaction between water cycle variability and the food production system in water-scarce regions of underdeveloped countries. Lack of sufficient and reliable data to characterize the water cycle is a further source of uncertainty affecting the robustness of the analysis. We investigate pros and cons of LCA and LCA-based option planning in an average size farm in Gaza strip, where farming and aquaculture are family-based and integrated by reuse of fish breeding water for irrigation. Different technological solutions (drip irrigation system, greenhouses etc.) are evaluated to improve protein supply and reduce the pressure on freshwater, particularly during droughts. But this use of technology represent also a contribution in increasing sustainability in agricultural processes, and therefore in economy, of Gaza Strip (reduction in chemical fertilizers and pesticides etc.).

  15. Human rights violations during Israel's attack on the Gaza Strip: 27 December 2008 to 19 January 2009.

    Science.gov (United States)

    Marton, Ruchama

    2011-01-01

    The Israeli attack on the Gaza Strip from 27 December 2008 to 19 January 2009 was characterised by gross, unprecedented human rights violations, which were the result of a deliberate political decision to overlook the loss of civilian lives in order to save those of Israeli soldiers. These violations included attacking medical personnel and civilians, impeding emergency medical evacuations, restricting health care for the civilian population, preventing referral to care outside the Gaza Strip and jeopardising distribution of medical supplies and food. This article will focus on the right to health of Palestinians under Israeli occupation by presenting case studies that have been collected by Physicians for Human Rights-Israel. It will emphasise how the Palestinian medical system has been stretched to its breaking point, severely and negatively affecting the provision of medical services; the consequences of denying patients referral to care outside the Gaza Strip; and other severe violations of human rights. It will conclude by reiterating that only the withdrawal of Israeli occupation from Palestinian land can guarantee the right to health of Palestinians.

  16. Safety Culture in Neonatal Intensive Care Units in the Gaza Strip, Palestine: A Need for Policy Change.

    Science.gov (United States)

    Abu-El-Noor, Nasser Ibrahim; Hamdan, Motasem Abduallah; Abu-El-Noor, Mysoon Khalil; Radwan, Abdal-Karim Said; Alshaer, Ahmed Ali

    Assessment of the prevailing safety culture within the Gazan health care system can be used to identify problem areas. Specifically, the need for improvements, raising awareness about patient safety, the identification and evaluation of existing safety programs and interventions for improving the safety culture. This study aims to assess the safety culture in the neonatal intensive care units (NICUs) in Gaza Strip hospitals and to assess the safety culture in regards to caregivers' characteristics. In a cross-sectional study using a census sample, we surveyed all nurses and physicians working in at all the NICUs in the Gaza Strip, Palestine. The Safety Attitudes Questionnaire (SAQ) which includes six scales was used to assess participants' attitudes towards safety culture. The overall score for SAQ was 63.9. Domains' scores ranged between 55.5 (perception of management) and 71.8 (stress recognition). The scores reported by our participants fell below the 75 out of a possible score of 100, which was considered as a cut-off point for a positive score. Moreover, our results revealed substantial variation in safety culture domain scores among participating NICUs. These results should be an indicator to our health care policy makers to modify current or adopt new health care policies to improve safety culture. It should also be a call to design customized programs for improving the safety culture in NICUs in the Gaza Strip. Copyright © 2017 Elsevier Inc. All rights reserved.

  17. A SUSTAINABLE APPROACH FOR URBAN INTEGRATION OF HAMM M SAM RAH IN THE HISTORIC CITY OF GAZA

    Directory of Open Access Journals (Sweden)

    Nihad Almughany

    2009-03-01

    Full Text Available Throughout historical ages, Gaza has been viewed amongst the most important cities of Palestine. The historic centre of Gaza is among the most important sites in the city as it bustles with business activities and is the place of major historic sites, and cultural and architectural legacy in the region. The city of Gaza used to have several public baths which were built to meet the hygiene and health needs of the local inhabitants. Furthermore, they played an important social role as gathering places for socio-cultural events, parties and meetings. It is most unfortunate that a large number of these baths have disappeared, apart from the Samarah bath in Al Zaitoun neighbourhood at the heart of the old city. Hence, the preservation of this unique genuine heritage building is of high importance. This paper attempts to establish key scenarios to integrate the hammām into the Old City urban fabric. The study is based on the hypothesis stating that a sustainable approach can be achieved by associating the hammām to its urban context. Thus, the hammām will constitute an important part of a touristic tour including the main urban entities composing the old City: Al-Omari Mosque, Qisaria Market, Pasha Palace and Khan Al- Zait. Three main scenarios will be proposed, analyzed and explored. The study concludes by suggesting an appropriate scenario for the adaptive re-use of the building, in order to preserve the hammam.

  18. Utetshka gaza

    Index Scriptorium Estoniae

    2006-01-01

    Norra välisminister Jonas Gahr Stoere lubas läbirääkimistel Saksamaa välisministri Frank Walter Steinmeieriga suurendada gaasitarneid Saksamaale, sest Norra võtab kasutusele uusi tehnoloogiaid ja Barentsi meres asuvaid uusi gaasivälju. Saksamaa otsib alternatiivseid gaasitarnijaid, et vähendada sõltuvust Venemaa gaasist

  19. An overview of the mental health system in Gaza: an assessment using the World Health Organization's Assessment Instrument for Mental Health Systems (WHO-AIMS).

    Science.gov (United States)

    Saymah, Dyaa; Tait, Lynda; Michail, Maria

    2015-01-01

    Mental health system reform is urgently needed in Gaza to respond to increasing mental health consequences of conflict. Evidence from mental health systems research is needed to inform decision-making. We aimed to provide new knowledge on current mental health policy and legislation, and services and resource use, in Gaza to identify quality gaps and areas for urgent intervention. As part of a mixed methods study, we used the World Health Organization's Assessment Instrument for Mental Health Systems Version 2·2 to collect data on mental health services and resources. Data collection was carried out in 2011, based on the year 2010. Gaza's mental health policy suggests some positive steps toward reform such as supporting deinstitutionalisation of mental health services. The decrease in the number of beds in the psychiatric hospital and the progressive transition of mental healthcare toward more community based care are indicative of deinstitutionalisation. However, mental health legislation in support of deinstitutionalisation in Gaza is lacking. The integration of mental health into primary healthcare and general hospitals has not been fully achieved. Mental health in Gaza is underfunded, human rights protection of service users is absent, and human resources, service user advocacy, and mental health training are limited. Priority needs to be given to human rights protection, mental health training, and investment in human and organisational resources. Legislation is needed to support policy and plan development. The ongoing political conflict and expected increase in need for mental health services demonstrates an urgent response is necessary.

  20. Trends in Decline of Antiretroviral Resistance among ARV-Experienced Patients in the HIV Outpatient Study: 1999–2008

    Directory of Open Access Journals (Sweden)

    Kate Buchacz

    2012-01-01

    Full Text Available Background. Little is known about temporal trends in frequencies of clinically relevant ARV resistance mutations in HIV strains from U.S. patients undergoing genotypic testing (GT in routine HIV care. Methods. We analyzed cumulative frequency of HIV resistance among patients in the HIV Outpatient Study (HOPS who, during 1999–2008 and while prescribed antiretrovirals, underwent GT with plasma HIV RNA >1,000 copies/mL. Exposure ≥4 months to each of three major antiretroviral classes (NRTI, NNRTI and PI was defined as triple-class exposure (TCE. Results. 906 patients contributed 1,570 GT results. The annual frequency of any major resistance mutations decreased during 1999–2008 (88% to 79%, P=0.05. Resistance to PIs decreased among PI-exposed patients (71% to 46%, P=0.010 as exposure to ritonavir-boosted PIs increased (6% to 81%, P<0.001. Non-significant declines were observed in resistance to NRTIs among NRTI-exposed (82% to 67%, and triple-class-resistance among TCE patients (66% to 41%, but not to NNRTIs among NNRTI-exposed. Conclusions. HIV resistance was common but declined in HIV isolates from subgroups of ARV-experienced HOPS patients during 1999–2008. Resistance to PIs among PI-exposed patients decreased, possibly due to increased representation of patients whose only PI exposures were to boosted PIs.

  1. Investigating the Relationship Between Drone Warfare and Civilian Casualties in Gaza

    Directory of Open Access Journals (Sweden)

    Dr. Ann Rogers

    2014-12-01

    Full Text Available Unmanned aerial vehicles (UAVs, better known as drones, are increasingly touted as ‘humanitarian’ weapons that contribute positively to fighting just wars and saving innocent lives. At the same time, civilian casualties have become the most visible and criticized aspect of drone warfare. It is argued here that drones contribute to civilian casualties not in spite of, but because of, their unique attributes. They greatly extend war across time and space, pulling more potential threats and targets into play over long periods, and because they are low-risk and highly accurate, they are more likely to be used. The assumption that drones save lives obscures a new turn in strategic thinking that sees states such as Israel and the US rely on large numbers of small, highly discriminating attacks applied over time to achieve their objectives. This examination of Israel’s 2014 war in Gaza argues that civilian casualties are not an unexpected or unintended consequence of drone warfare, but an entirely predictable outcome.

  2. Fractional Urinary Fluoride Excretion (FUFE) of 3-4 year children in the Gaza Strip.

    Science.gov (United States)

    Abuhaloob, L; Maguire, A; Moynihan, P

    2015-03-01

    A positive association between dental fluorosis prevalence and fluoride (F) concentration in drinking waters has been detected in Gaza Strip. Total Daily Fluoride Retention (TDFR), and Fractional Urinary Fluoride Excretion (FUFE) indicate F body burden; important in assessing fluorosis risk in susceptible age groups. 1, To determine and compare Daily Urinary Fluoride Excretion (DUFE) and FUFE of 3-4-year-olds living in lower ( 1.2 ) ppm F tap water areas; 2, To determine any relationship between i, DUFE and tap water F; ii, DUFE and Total Daily Fluoride Intake (TDFI); iii, TDFI and TDFR. 24-hour urine and tap water samples were collected from 216 children exposed to lower (n = 81), moderate (n = 72), or higher (n = 63) tap water F. ANOVA with Tukey's Test and Pearson's correlation were used to examine differences in mean DUFE and FUFE and relationships between variables. Mean drinking water F was 0.11(sd 0.17), 0.14 (sd 0.28) and 0.38 (sd 0.63) ppmF respectively. Differences (p water F; DUFE and TDFI, and; TDFI and TDFR. DUFEs of children drinking waters with 0.11 and 0.14ppm F, represented low F usage. The group drinking 0.38ppm F water represented optimal F usage. The weak significant positive association of DUFE with home tap water F suggests low validity for tap water F in estimating F exposure.

  3. Nurses and Physicians Attitudes toward Nurse-Physician Collaboration: A Survey from Gaza Strip, Palestine

    Directory of Open Access Journals (Sweden)

    Aymen Elsous

    2017-01-01

    Full Text Available Interprofessional collaboration and teamwork between nurses and physicians is essential for improving patient outcomes and quality of health services. This study examined the attitudes of nurses and physicians toward nurse-physician collaboration. A cross-sectional study was conducted among nurses and physicians (n=414 in two main referral public hospitals in the Gaza Strip using the Arabic Jefferson Scale of Attitude toward Physician-Nurse Collaboration. Descriptive statistics and difference of means, proportions, and correlations were examined using Student’s t-test, one-way ANOVA, and Pearson correlation and p<0.05 was considered as statistical significant. Response rate was 42.8% (75.6% for nurses and 24.4% for physicians. Nurses expressed more positives attitudes toward collaboration than physicians (M ± SD on four-point scale: 3.40±0.30 and 3.01±0.35, resp. and experience duration was not proved to have an interesting influence. Teamwork approach in the professional practice should be recognized taking into consideration that the relationship between physicians and nurses is complementary and nurses are partners in patient care.

  4. Factores que influyen en la decisión de licitar o no licitar en la Franja de Gaza - perspectivas de los contratistas Factors affecting bid/no bid decision in the Gaza Strip -contractors' perspectives

    Directory of Open Access Journals (Sweden)

    Adnan Enshassi

    2011-01-01

    Full Text Available La decisión de licitar o no licitar un determinado proyecto es crucial para la sobrevivencia de los contratistas. El objetivo de este artículo es identificar y clasificar los factores que determinan la decisión de licitar o no licitar, de acuerdo a su importancia relativa desde la perspectiva de contratistas locales que operan en la Franja de Gaza, Palestina. Se identificaron un total de setenta y ocho factores, por medio de una revisión exhaustiva de la literatura, para evaluar los factores más importantes que afectan las decisiones de los contratistas por licitar no licitar en la Franja de Gaza. Se desarrolló una medición dentro de una muestra compuesta por setenta y tres contratistas clasificados bajo la categoría construcción, y sesenta y cinco de ellos respondieron a una razón de 89%. Los resultados ilustran que la reputación de los clientes, la capacidad financiera de éstos, el potencial financiero del proyecto y la disponibilidad constructiva de materias primas en los mercados locales, así como la estabilidad de la industria de la construcción, fueron los principales factores críticos que influyen en las decisiones de licitar o no licitar. Este estudio sugiere que los contratistas y clientes debieran mejorar sus sistemas financieros y aptitudes para poder mantenerse dentro del negocio.To bid or not to bid for a certain project is considered to be a crucial decision for contractors' survival. The objective of this paper is to identify and rank the factors that affect the bid/no bid decision according to their relative importance from the perspective of the local contractors operating in the Gaza Strip, Palestine. A total of seventy-eight factors were identified through a comprehensive literature review to evaluate the most important factors that affect the contractors' decisions to bid or not in the Gaza strip. A survey was conducted on a sample of seventy three contractors classified under the building category, and sixty

  5. Integrating a public health and human rights approach into mental health services for Palestinians in the Gaza Strip.

    Science.gov (United States)

    Diab, Marwan; Jamei, Yasser Abu; Kagee, Ashraf; Veronese, Guido

    2018-02-21

    In the context of violations of human rights and insecurity, the Gaza Community Mental Health Programme (GCMHP) provides mental health services and psychosocial interventions that match local cultural and social norms. The GCMHP uses a community mental health approach to promote the psychological wellbeing of the people living in the Gaza Strip and advocate on mental health issues. The GCMHP provides preventive and therapeutic care to a broad public health spectrum of Gazan society. Services are provided in terms of preventative public health at the primary, secondary, and tertiary levels. Data reported here are from 2014-16. For primary prevention, our services include advocacy, public awareness, and media campaigns aimed at raising awareness about and preventing common mental disorders and behavioural difficulties in children. 35 878 people are estimated to have benefited from these programmes. The GCMHP also provides psychological first aid and crisis intervention to vulnerable persons and a free telephone counselling service. About 12 943 persons have received individual sessions, and 2590 persons have received telephone counselling. The GCMHP also provides training to enhance the skills of professionals of local organisations working in mental health and psychosocial services. 3557 people have attended these programmes. As secondary prevention, the GCMHP offers individual and group psychotherapy, and routine home visits are provided for torture survivors and individuals and families exposed to cumulative trauma. 11 713 individuals have received such services. As tertiary prevention, rehabilitation services including physiotherapy and occupational therapy are provided to help patients regain their role as active members of the community. 398 people have received these services. A public health-oriented approach to mental health services fits the socioecological model that locates individuals and families within the context of their community, religious

  6. Representations of victimization and responsibility during the Second Intifada and the Gaza War in German quality newspapers

    Directory of Open Access Journals (Sweden)

    Felix Gaisbauer

    2012-10-01

    Full Text Available The German press has often been accused of fanning, through one-sided reportage (bias on the Israeli-Palestinian conflict, not only anti-Israeli, but also anti-Semitic attitudes in their readers. A content analytic study by Maurer and Kempf (2011 of a representative sample of the reportage on the second Intifada and the Gaza war does not support these claims. The study concentrated above all on escalation vs. de-escalation-oriented representations of the conflict parties. Using the same text material (N = 396 newspaper articles, the present study has the aim of determining the representation (framing of Israeli and Palestinian victims, as well as the representation of responsibility for this victimization in German quality newspapers. By means of Latent Class Analysis, consistent patterns of style characteristics are identified that emphasize or suppress the aspects of victimization and responsibility. These media frames are then studied in regard to their partisanship (bias and tendency over time (second Intifada vs. Gaza war. It was found that from the second Intifada to the Gaza war the media frames increasingly show a pro-Palestinian bias, while the pro-Israeli bias in the reportage becomes weaker. In part, this is counterbalanced in that frames that try for balance with a pro-Israeli tendency emphasize Israeli civilian victims. Thereby all the newspapers studied display the here identified forms of bias to the same degree, so that it is not the press „in itself“ that can be judged to be biased, but rather the individual articles in all the newspapers take clear positions.

  7. Israelkritik und Antisemitismus? Eine vergleichende Analyse der deutschen Presseberichterstattung über 2. Intifada und Gaza-Krieg

    Directory of Open Access Journals (Sweden)

    Markus Maurer

    2011-10-01

    Full Text Available Die deutsche Medienberichterstattung über den Nahost-Konflikt wurde verschiedentlich dahingehend kritisiert, einen anti-israelische Bias zu haben, der die alten, gebräuchlichen Vorurteile und Stereotype gegenüber Juden stärke und die Anschuldigung unterstütze, die Juden würden die Tragik des Holocaust missbrauchen um die israelische Palästina-Politik zu rechtfertigen: Insbesondere während des Gaza-Krieges sei Israel als Aggressor dargestellt, der palästinensische Terrorismus dagegen heruntergespielt worden. Bisher gibt es kaum systematische Forschung zu dieser Frage. Die vorliegende Studie soll diese Lücke zu füllen helfen, indem sie eine vergleichende Inhaltsanalyse der Berichterstattung über die 2. Intifada und den Gaza-Krieg in Die Welt, Frankfurter Allgemeine Zeitung, Süddeutsche Zeitung, Frankfurter Rundschau und Tageszeitung vornimmt. Eine repräsentative Stichprobe von 396 Artikeln aus diesen Zeitungen, die das gesamte politische Spektrum von rechts nach links abdecken, wurde entlang der drei Dimensionen (1 Darstellung des Verhaltens der Konfliktparteien, (2 Bewertung ihrer Intentionen und Handlungen, und (3 Interpunktion des Konfliktes & Darstellung seiner Opfer analysiert. Die Ergebnisse der Studie zeigen, dass die Darstellung beider Konflikte weit differenzierter war als von ihren Kritikern angenommen. Auch während des Gaza-Krieges hat die deutsche Qualitätspresse ihr Bestes getan, sich nicht auf die Seite der Palästinenser zu schlagen. Falls sie tatsächlich zur Stärkung anti-israelischer oder sogar antisemitischer Einstellungen beigetragen hat, so war dies eher der Erzeugung von Reaktanz geschuldet als einem anti-israelischen Bias der Berichterstattung.

  8. Supply chain solutions to improve the distribution of antiretroviral drugs (ARVs to clinics in rural areas: A case study of the QwaQwa district

    Directory of Open Access Journals (Sweden)

    Mamolise Mokheseng

    2017-10-01

    Full Text Available This article serves as a case study based on research that was performed in the QwaQwa district in the Free State Province where the distribution of ARVs to the regional Manapo hospital, as well as between the hospital and its peripheral clinics, was interrupted and inconsistent due to problems in the supply chain. An unreliable and interrupted ARV supply chain creates the risk of virus reactivation and eventual patient mortality. The objectives of the study were to explore the problems experienced with the ARV distribution practices at the Manapo hospital, and to recommend ways in which the distribution of ARVs can be improved so that patients can receive an uninterrupted supply. The nature of the topic researched dictated the use of mainly the quantitative research method. The main problems identified include: Wrong and no uniform practice of ordering stock by the hospital and the clinics; lack of reliable, structured transportation from the depot to the hospital; as well as poor inventory management and poor overall communication. Recommendations to address the problems include: Implementing a supply chain planning and design process; improving inventory management and warehousing practices; implementing more effective and reliable distribution and transportation processes; as well as improving supply chain coordination and overall communication.

  9. A Simulation/Optimization approach to manage groundwater resources in the Gaza aquifer (Palestinian Territories) under climate change conditions

    Science.gov (United States)

    Dentoni, Marta; Qahman, Khalid; Deidda, Roberto; Paniconi, Claudio; Lecca, Giuditta

    2013-04-01

    The Gaza aquifer is the main source of water for agricultural, domestic, and industrial uses in the Gaza Strip. The rapid increase on water demand due to continuous population growth has led to water scarcity and contamination by seawater intrusion (SWI). Furthermore, current projections of future climatic conditions (IPCC, 2007) point to potential decreases in available water, both inflows and outflows. A numerical assessment of SWI in the Gaza coastal aquifer under climate induced changes has been carried out by means of the CODESA-3D model of density-dependent variably saturated flow and salt transport in groundwaters. After integrating available data on climatology, geology, geomorphology, hydrology, hydrogeology, soil use, and groundwater exploitation relative to the period 1935-2010, the calibrated and validated model was used to simulate the response of the hydrological basin to actual and future scenarios of climate change obtained from different regional circulation models. The results clearly show that, if current pumping rates are maintained, seawater intrusion will worsen. To manage sustainable aquifer development under effective recharge operations and water quality constraints, a decision support system based on a simulation/optimization (S/O) approach was applied to the Gaza study site. The S/O approach is based on coupling the CODESA-3D model with the Carroll's Genetic Algorithm Driver. The optimization model incorporates two conflicting objectives using a penalty method: maximizing pumping rates from the aquifer wells while limiting the salinity of the water withdrawn. The resulting coastal aquifer management model was applied over a 30-year time period to identify the optimum spatial distribution of pumping rates at the control wells. The optimized solution provides for a general increase in water table levels and a decrease in the total extracted salt mass while keeping total abstraction rates relatively constant, with reference to non

  10. Information-Motivation-Behavioral Skills Barriers Associated with Intentional versus Unintentional ARV Non-adherence Behavior among HIV-Positive Patients in Clinical Care

    Science.gov (United States)

    Norton, Wynne E.; Amico, K. Rivet; Fisher, William A.; Shuper, Paul A.; Ferrer, Rebecca A.; Cornman, Deborah H.; Trayling, Cynthia; Redding, Caroline; Fisher, Jeffrey D.

    2014-01-01

    Since the arrival of antiretroviral (ARV) therapy, HIV has become better characterized as a chronic disease rather than a terminal illness, depending in part on one’s ability to maintain relatively high levels of adherence. Despite research concerning barriers and facilitators of ARV adherence behavior, relatively little is known about specific challenges faced by HIV-positive persons who report “taking a break” from their ARV medications. The present study employed the Information-Motivation-Behavioral Skills Model of ARV Adherence as a framework for understanding adherence-related barriers that may differentiate between non-adherent patients who report “taking a break” versus those who do not report “taking a break” from their ARV medications. A sample of 327 HIV-positive patients who reported less than 100% adherence at study baseline provided data for this research. Participants who reported “taking a break” from their HIV medications without first talking to their healthcare provider were classified as intentionally non-adherent, while those who did not report “taking a break” without first talking with their healthcare provider were classified as unintentionally non-adherent. Analyses examined differences between intentionally versus unintentionally non-adherent patients with respect to demographic characteristics and responses to the adherence-related information, motivation, and behavioral skills questionnaire items. Few differences were observed between the groups on demographics, adherence-related information or adherence-related motivation; however, significant differences were observed on about half of the adherence-related behavioral skills items. Implications for future research, as well as the design of specific intervention components to reduce intentionally non-adherent behavior, are discussed. PMID:20552469

  11. One flag, two rallies: Mechanisms of public opinion in Israel during the 2014 Gaza war.

    Science.gov (United States)

    Feinstein, Yuval

    2018-01-01

    In Israel, public reaction to the 2014 Gaza war included massive support for the military operation and a sharp increase in the popularity of Prime Minister Netanyahu. To understand what caused these "rally-round-the-flag" (RRTF) effects, panel data were collected from a representative sample of the Jewish majority in Israel during and after the war. The article integrate empirical and theoretical arguments from public opinion studies, and from social and political psychology, to contextualize and guide the analysis. The results reveal that perceived threat to collective security produced two simultaneous rally outcomes through distinct processes: First, increased identification with the ethno-national Jewish group led to a rally behind Israel's prime minister. Second, anger toward Hamas and sentiment of national superiority, which was activated by increased ethno-national identification, produced a rally behind the military operation. In addition to explaining its specific empirical case, this study makes three broader contributions. First, it extends the investigation of the RRTF phenomenon in wartime beyond the popularity of the head of the state (the focus of most previous studies) by also examining levels of support for the use of military power. Second, it reveals some of the mechanisms through which distinct elements of popular nationalism mediate the relationship between war events and heterogeneous rally effects. Third, this study shows that the mechanisms that have been detected in studies of individual attitudes and behavior in small groups under conditions of perceived threat or competition can help explain the behavior of these individuals as members of larger, imagined national communities during war. Copyright © 2017 Elsevier Inc. All rights reserved.

  12. Iisrael lubab nädalaid kestvat sõda, et pühkida Hamas Gazas võimult / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2008-01-01

    Iisrael vastas Hamasi rünnakutele väidetavalt tugevaima pommitamisega Gaza sektoris 1967. a. sõjast saadik, selle üheks põhjuseks peavad vaatlejad Iisraeli sisepoliitilist olukorda. Vt. samas: Hamas ei taha siiani leppida Iisraeli riigi olemasoluga

  13. Health journalism in the service of power: 'moral complacency' and the Hebrew media in the Gaza-Israel conflict.

    Science.gov (United States)

    Birenbaum-Carmeli, Daphna

    2014-05-01

    The power of health news as a vehicle in the production of meaning in the service of power is the core of this article. Tracking the media coverage of a medical service, it shows how a routine practice can be invoked at a time of armed conflict so as to enhance a benevolent state image. The case at hand is the medical treatment of Gaza children in Israeli hospitals. A series of Internet searches revealed a group of publications on the subject in the Hebrew media, during and shortly after Israel's assault on Gaza in the winter of 2008-2009. In the press articles the treatments were invariably constituted as the epitome of Israel's compassion towards the enemy's children. This image relied, however, on a simultaneous silencing of other aspects of these treatments, which would have challenged this image. The monolithic depictions give rise to the notion of reversed moral panic or 'moral complacency', wherein the media amplifies a little-known social phenomenon into an epitome of societal values and charges it with significance on a national scale. The article ends with considering some features that possibly render health news an especially convenient domain for state-supportive media presentations. © 2014 The Author. Sociology of Health & Illness © 2014 Foundation for the Sociology of Health & Illness/John Wiley & Sons Ltd.

  14. Melatonin Inhibits Androgen Receptor Splice Variant-7 (AR-V7)-Induced Nuclear Factor-Kappa B (NF-κB) Activation and NF-κB Activator-Induced AR-V7 Expression in Prostate Cancer Cells: Potential Implications for the Use of Melatonin in Castration-Resistant Prostate Cancer (CRPC) Therapy.

    Science.gov (United States)

    Liu, Vincent Wing Sun; Yau, Wing Lung; Tam, Chun Wai; Yao, Kwok-Ming; Shiu, Stephen Yuen Wing

    2017-05-31

    A major current challenge in the treatment of advanced prostate cancer, which can be initially controlled by medical or surgical castration, is the development of effective, safe, and affordable therapies against progression of the disease to the stage of castration resistance. Here, we showed that in LNCaP and 22Rv1 prostate cancer cells transiently overexpressing androgen receptor splice variant-7 (AR-V7), nuclear factor-kappa B (NF-κB) was activated and could result in up-regulated interleukin ( IL ) -6 gene expression, indicating a positive interaction between AR-V7 expression and activated NF-κB/IL-6 signaling in castration-resistant prostate cancer (CRPC) pathogenesis. Importantly, both AR-V7-induced NF-κB activation and IL-6 gene transcription in LNCaP and 22Rv1 cells could be inhibited by melatonin. Furthermore, stimulation of AR-V7 mRNA expression in LNCaP cells by betulinic acid, a pharmacological NF-κB activator, was reduced by melatonin treatment. Our data support the presence of bi-directional positive interactions between AR-V7 expression and NF-κB activation in CRPC pathogenesis. Of note, melatonin, by inhibiting NF-κB activation via the previously-reported MT₁ receptor-mediated antiproliferative pathway, can disrupt these bi-directional positive interactions between AR-V7 and NF-κB and thereby delay the development of castration resistance in advanced prostate cancer. Apparently, this therapeutic potential of melatonin in advanced prostate cancer/CRPC management is worth translation in the clinic via combined androgen depletion and melatonin repletion.

  15. The effects of the Israeli siege on health provision in the Gaza Strip: a qualitative and theoretical analysis.

    Science.gov (United States)

    Smith, Ron J

    2018-02-21

    Siege, a process of political domination aimed at isolating an entire population, is a unique threat to health-care provision. The aim of this study was to qualitatively examine the effects of the Israeli siege on the practices and systems that underlie health in the Gaza Strip. Data were from participant observation between 2009 and 2017, including 20 interviews with doctors and health administrators in non-governmental organisations (NGO), government, and UN sectors. All participants were provided with a description of the study and provided written consent to participate. The study was approved through the Human Subjects Review process at Bucknell University and the University of Washington. The data were analysed using a critical political economic framework, based on the concepts of primitive accumulation, accumulation by dispossession, surplus populations, and de-development. These analytical frames are further developed to interpret neoliberal trends in health-care systems organising and financing as they apply in the distorted social and economic context of siege. The elimination of political sovereignty through the twin processes of occupation and siege are the primary impediments to the successful promotion of public health in the Gaza Strip. Findings indicate that siege impinges on effective health-care provision by withholding materials and resources and undermining the health care at a systems level. These strains pose considerable threats to health care, within the ministry of health and among other entities in the Gaza Strip that deliver care. Gazan society is divested of the underpinnings necessary for a well functioning sovereign health-care infrastructure. Instead of a self-governing, independent system, this analysis reveals a system that is comprised of captive clients who are entirely dependent on Israel, international bodies, and the aid industry for goods and services, with no means of independent development. The siege represents a

  16. An interdisciplinary framework for measuring and supporting adherence in HIV prevention trials of ARV-based vaginal rings.

    Science.gov (United States)

    MacQueen, Kathleen M; Tolley, Elizabeth E; Owen, Derek H; Amico, K Rivet; Morrow, Kathleen M; Moench, Thomas; Friend, David R; Friedland, Barbara

    2014-01-01

    Product adherence and its measurement have emerged as a critical challenge in the evaluation of new HIV prevention technologies. Long-acting ARV-based vaginal rings may simplify use instructions and require less user behaviour, thereby facilitating adherence. One ARV-based ring is in efficacy trials and others, including multipurpose rings, are in the pipeline. Participant motivations, counselling support and measurement challenges during ring trials must still be addressed. In previous HIV prevention trials, this has been done largely using descriptive and post-hoc methods that are highly variable and minimally evaluated. We outline an interdisciplinary framework for systematically investigating promising strategies to support product uptake and adherence, and to measure adherence in the context of randomized, blinded clinical trials. The interdisciplinary framework highlights the dual use of adherence measurement (i.e. to provide feedback during trial implementation and to inform interpretation of trial findings) and underscores the complex pathways that connect measurement, adherence support and enacted adherence behaviour. Three inter-related approaches are highlighted: 1) adherence support - sequential efforts to define motivators of study product adherence and to develop, test, refine and evaluate adherence support messages; 2) self-reported psychometric measures - creation of valid and generalizable measures based in easily administered scales that capture vaginal ring use with improved predictive ability at screening, baseline and follow-up that better engage participants in reporting adherence; and 3) more objective measurement of adherence - real-time adherence monitoring and cumulative measurement to correlate adherence with overall product effectiveness through innovative designs, models and prototypes using electronic and biometric technologies to detect ring insertion and/or removal or expulsion. Coordinating research along these three pathways will

  17. Early Initiation of ARV During Pregnancy to Move towards Virtual Elimination of Mother-to-Child-Transmission of HIV-1 in Yunnan, China.

    Science.gov (United States)

    Meyers, Kathrine; Qian, Haoyu; Wu, Yingfeng; Lao, Yunfei; Chen, Qingling; Dong, Xingqi; Li, Huiqin; Yang, Yiqing; Jiang, Chengqin; Zhou, Zengquan

    2015-01-01

    To identify factors associated with mother-to-child-transmission and late access to prevention of maternal to child transmission (PMTCT) services among HIV-infected women; and risk factors for infant mortality among HIV-exposed infants in order to assess the feasibility of virtual elimination of vertical transmission and pediatric HIV in this setting. Observational study evaluating the impact of a provincial PMTCT program. The intervention was implemented in 26 counties of Yunnan Province, China at municipal and tertiary health care settings. Log linear regression models with generalized estimating equations were used to identify unadjusted and adjusted correlates for late ARV intervention and MTCT. Cox proportional hazard models with robust sandwich estimation were applied to examine correlates of infant mortality. Mother-to-child- transmission rate of HIV was controlled to 2%, with late initiation of maternal ARV showing a strong association with vertical transmission and infant mortality. Risk factors for late initiation of maternal ARV were age, ethnicity, education, and having a husband not tested for HIV. Mortality rate among HIV-exposed infants was 2.9/100 person-years. In addition to late initiation of maternal ARV, ethnicity, low birth weight and preterm birth were associated with infant mortality. This PMTCT program in Yunnan achieved low rates of MTCT. However the infant mortality rate in this cohort of HIV-exposed children was almost three times the provincial rate. Virtual elimination of MTCT of HIV is an achievable goal in China, but more attention needs to be paid to HIV-free survival.

  18. Early Initiation of ARV During Pregnancy to Move towards Virtual Elimination of Mother-to-Child-Transmission of HIV-1 in Yunnan, China.

    Directory of Open Access Journals (Sweden)

    Kathrine Meyers

    Full Text Available To identify factors associated with mother-to-child-transmission and late access to prevention of maternal to child transmission (PMTCT services among HIV-infected women; and risk factors for infant mortality among HIV-exposed infants in order to assess the feasibility of virtual elimination of vertical transmission and pediatric HIV in this setting.Observational study evaluating the impact of a provincial PMTCT program.The intervention was implemented in 26 counties of Yunnan Province, China at municipal and tertiary health care settings. Log linear regression models with generalized estimating equations were used to identify unadjusted and adjusted correlates for late ARV intervention and MTCT. Cox proportional hazard models with robust sandwich estimation were applied to examine correlates of infant mortality.Mother-to-child- transmission rate of HIV was controlled to 2%, with late initiation of maternal ARV showing a strong association with vertical transmission and infant mortality. Risk factors for late initiation of maternal ARV were age, ethnicity, education, and having a husband not tested for HIV. Mortality rate among HIV-exposed infants was 2.9/100 person-years. In addition to late initiation of maternal ARV, ethnicity, low birth weight and preterm birth were associated with infant mortality.This PMTCT program in Yunnan achieved low rates of MTCT. However the infant mortality rate in this cohort of HIV-exposed children was almost three times the provincial rate. Virtual elimination of MTCT of HIV is an achievable goal in China, but more attention needs to be paid to HIV-free survival.

  19. Prevalence and associated factors influencing stunting in children aged 2-5 years in the Gaza Strip-Palestine: a cross-sectional study.

    Science.gov (United States)

    El Kishawi, Rima Rafiq; Soo, Kah Leng; Abed, Yehia Awad; Muda, Wan Abdul Manan Wan

    2017-12-21

    Stunting continues to be a major public health problem in developing countries. It is one of the most important risk factors for morbidity and mortality during childhood. In Palestine, it is another health problem, which adds to the catastrophic issues in the region. This study aimed to determine the prevalence of stunting and its associated factors among preschool children in the Gaza Strip. A cross-sectional study design was conducted in the Gaza Strip. A total of 357 children aged 2-5 years and their mothers aged 18-50 years were recruited. A multistage cluster sampling was used in the selection of the study participants from three geographical areas in the Gaza Strip: Jabalia refugee camp, El Remal urban area, and Al Qarara rural area. A structured questionnaire was used for face- to -face interviews with the respective child's mother to collect sociodemographic information and feeding practice. Anthropometric measurements for children were taken to classify height-for-age (HAZ), while maternal height was measured as well. Descriptive and binary logistic regression analyses were applied to determine the prevalence and associated factors with stunting. The total prevalence of stunting in this study was 19.6%, with the highest prevalence being (22.6%) in Jabalia refugee camp. It turns out that shorter mothers had increased the odds of stunting in preschool children in the Gaza Strip. Children born to mothers whose height was 1.55-1.60 m or 1.60 m. Moreover, parental consanguinity increased the risk of stunted children (p = 0. 015). This study showed the prevalence of stunting was of alarming magnitude in the Gaza Strip. Our results also demonstrated that parental consanguinity and short maternal stature were associated with stunting. Culturally appropriate interventions and appropriate strategies should be implemented to discourage these types of marriages. Policy makers must also raise awareness of the importance of the prevention and control of

  20. AR-V7 in circulating tumor cells cluster as a predictive biomarker of abiraterone acetate and enzalutamide treatment in castration-resistant prostate cancer patients.

    Science.gov (United States)

    Okegawa, Takatsugu; Ninomiya, Naoki; Masuda, Kazuki; Nakamura, Yu; Tambo, Mitsuhiro; Nutahara, Kikuo

    2018-03-05

    We examined whether androgen receptor splice variant 7 (AR-V7) in circulating tumor cell(CTC)clusters can be used to predict survival in patients with bone metastatic castration resistant-prostate cancer (mCRPC) treated with abiraterone or enzalutamide. We retrospectively enrolled 98 patients with CRPC on abiraterone or enzalutamide, and investigated the prognostic value of CTC cluster detection (+ v -) and AR-V7 detection (+ v -) using a CTC cluster detection - based AR-V7 mRNA assay. We examined ≤50% prostate-specific antigen (PSA) responses, PSA progression-free survival (PSA-PFS), clinical and radiological progression-free survival (radiologic PSF), and overall survival (OS). We then assessed whether AR-V7 expression in CTC clusters identified after On-chip multi-imaging flow cytometry was related to disease progression and survival after first-line systemic therapy. All abiraterone-treated or enzalutamide-treated patients received prior docetaxel. The median follow-up was 20.7 (range: 3.0-37.0) months in the abiraterone and enzalutamide cohorts, respectively. Forty-nine of the 98 men (50.0%) were CTC cluster (-), 23 of the 98 men (23.5%) were CTC cluster(+)/AR-V7(-), and 26 of the 98 men (26.5%) were CTC cluster(+)/AR-V7(+). CTC cluster(+)/AR-V7(+) patients were more likely to have EOD ≥3 at diagnosis (P = 0.003), pain (P = 0.023), higher alkaline phosphatase levels (P cluster(+), CTC cluster(+)/AR-V7(-), and ALP >UNL were independently associated with a poor PSA-PFS, radiographic PFS, and OS in abiraterone-treated patients and enzalutamide-treated patients. The CTC clusters and AR-V7-positive CTC clusters detected were important for assessing the response to abiraterone or enzalutamide therapy and for predicting disease outcome. © 2018 Wiley Periodicals, Inc.

  1. CLOSE RANGE PHOTOGRAMMETRY APPLIED TO THE DOCUMENTATION OF AN ARCHAEOLOGICAL SITE IN GAZA STRIP, PALESTINE

    Directory of Open Access Journals (Sweden)

    E. Alby

    2013-07-01

    Full Text Available In a geopolitical very complex context as the Gaza Strip it has to be dealt with an enhancement of an archaeological site. This site is the monastery of St. Hilarion. To enable a cultural appropriation of a place with several identified phases of occupation must undertake extensive archaeological excavation. Excavate in this geographical area is to implement emergency excavations, so the aim of such a project can be questioned for each mission. Real estate pressure is also a motivating setting the documentation because the large population density does not allow systematic studies of underground before construction projects. This is also during the construction of a road that the site was discovered. Site dimensions are 150 m by 80 m. It is located on a sand dune, 300 m from the sea. To implement the survey, four different levels of detail have been defined for terrestrial photogrammetry. The first level elements are similar to objects, capitals, fragment of columns, tiles for example. Modeling of small objects requires the acquisition of very dense point clouds (density: 1 point / 1 mm on average. The object must then be a maximum area of the sensor of the camera, while retaining in the field of view a reference pattern for the scaling of the point cloud generated. The pictures are taken at a short distance from the object, using the images at full resolution. The main obstacle to the modeling of objects is the presence of noise partly due to the studied materials (sand, smooth rock, which do not favor the detection of points of interest quality. Pretreatments of the cloud will be achieved meticulously since the ouster of points on a surface of a small object results in the formation of a hole with a lack of information, useful to resulting mesh. Level 2 focuses on the stratigraphic units such as mosaics. The monastery of St. Hilarion identifies thirteen floors of which has been documented years ago by silver photographs, scanned later

  2. Close Range Photogrammetry Applied to the Documentation of AN Archaeological Site in Gaza Strip, Palestine

    Science.gov (United States)

    Alby, E.; Elter, R.; Ripoche, C.; Quere, N.; de Strasbourg, INSA

    2013-07-01

    In a geopolitical very complex context as the Gaza Strip it has to be dealt with an enhancement of an archaeological site. This site is the monastery of St. Hilarion. To enable a cultural appropriation of a place with several identified phases of occupation must undertake extensive archaeological excavation. Excavate in this geographical area is to implement emergency excavations, so the aim of such a project can be questioned for each mission. Real estate pressure is also a motivating setting the documentation because the large population density does not allow systematic studies of underground before construction projects. This is also during the construction of a road that the site was discovered. Site dimensions are 150 m by 80 m. It is located on a sand dune, 300 m from the sea. To implement the survey, four different levels of detail have been defined for terrestrial photogrammetry. The first level elements are similar to objects, capitals, fragment of columns, tiles for example. Modeling of small objects requires the acquisition of very dense point clouds (density: 1 point / 1 mm on average). The object must then be a maximum area of the sensor of the camera, while retaining in the field of view a reference pattern for the scaling of the point cloud generated. The pictures are taken at a short distance from the object, using the images at full resolution. The main obstacle to the modeling of objects is the presence of noise partly due to the studied materials (sand, smooth rock), which do not favor the detection of points of interest quality. Pretreatments of the cloud will be achieved meticulously since the ouster of points on a surface of a small object results in the formation of a hole with a lack of information, useful to resulting mesh. Level 2 focuses on the stratigraphic units such as mosaics. The monastery of St. Hilarion identifies thirteen floors of which has been documented years ago by silver photographs, scanned later. Modeling of pavements is

  3. In depth analysis of risk factors for coeliac disease amongst children under 18 years Old in the Gaza strip. A cross sectional study

    Directory of Open Access Journals (Sweden)

    Al-Raee Mohammad B

    2012-11-01

    Full Text Available Abstract Coeliac disease is an important clinical disorder affecting the human gastrointestinal tract leading to multiple signs and symptoms in different body organs. This disease was the subject of a cross sectional descriptive-analytic study conducted in the Gaza Strip during 2010. Objectives were oriented to identify and verify several variables and attributes affecting the prognosis of coeliac disease in the patients. Ninety five children out of 113 patients were arranged into two groups according to age from 2 to 11 years and from 12 to 18 years old. Results showed the poor interest of health professionals regarding coeliac disease in the Gaza Strip. The mean age of study population was 5.47 years for males and 8.93 years for females. The lifestyle of coeliac patients was directly proportional with better nutritional indictors. Poor recognition of the emblem illustrating gluten in foods implicates effective health awareness or promotion. The more knowledgeable patients or mothers (P = 0.036 were the more compliant. The compliance to giving gluten free foods outside home was statistically significant (P = 0.037. Similarly, cautious approach when buying foods or detergents (P = 0.011. According to BMI 74.4%, 23.4% and 3.2% of all patients were normal, underweight and overweight respectively. Albumin blood level was normal in 32.6% and low in 67.4%. Meanwhile, blood calcium level was normal in 76.8%, low in 21.1% and high in 2.1% of all patients. Conclusion: The study showed that recreation and social activities for coeliac patients are substantially missing in the Gaza Strip. Moreover, the study proved that AEI is a reliable centre for care of coeliac disease patients and conducting relevant studies. Recommendation: There is a need for thorough and continuous community and institutional mobilization regarding coeliac disease in the Gaza Strip and in Palestine.

  4. A survey on the knowledge and attitudes among the students of Al-Azhar University to HIV/AIDS, the Gaza Strip-Palestine

    Directory of Open Access Journals (Sweden)

    Basil Jabber Kanoa

    2015-12-01

    Full Text Available Objective: The study assessed the knowledge and attitudes of students’ at a university in Gaza regarding HIV/AIDS and identified differences in knowledge about HIV, and attitudes by gender, locality, and social and economic status. Methods: This descriptive study targeted 492 students of Al-Azhar University-Gaza. The participants completed self-administered questionnaires that included the following dimensions: socio-demographic, measurements of student's knowledge level and measurement of student's attitudes towards HIV/AIDS. Results: Findings showed moderate level of knowledge regarding HIV/AIDS although there was a very low of perception regarding the acceptance and sharing of HIV/AIDS persons. It means that only one third of the study respondents are willingness to be in close touch with people living with HIV or even communication with them, and less than fifty percent thought that it is their right to be engaged in a public or governmental job, stigma and discriminatory attitudes toward HIV/AIDS persons is high only 48% of the students thought it right to employ people living with HIV (PLHIV and 35.5% refused to work in the same place with PLHIV. Conclusion: This study indicates the need for improving the level of knowledge as well as promoting the students' towards positive attitude.Key words: AIDS, Knowledge, attitude, students, HIV, Gaza

  5. Modeling HIV vaccines in Brazil: assessing the impact of a future HIV vaccine on reducing new infections, mortality and number of people receiving ARV.

    Directory of Open Access Journals (Sweden)

    Maria Goretti P Fonseca

    2010-07-01

    Full Text Available The AIDS epidemic in Brazil remains concentrated in populations with high vulnerability to HIV infection, and the development of an HIV vaccine could make an important contribution to prevention. This study modeled the HIV epidemic and estimated the potential impact of an HIV vaccine on the number of new infections, deaths due to AIDS and the number of people receiving ARV treatment, under various scenarios.The historical HIV prevalence was modeled using Spectrum and projections were made from 2010 to 2050 to study the impact of an HIV vaccine with 40% to 70% efficacy, and 80% coverage of adult population, specific groups such as MSM, IDU, commercial sex workers and their partners, and 15 year olds. The possibility of disinhibition after vaccination, neglecting medium- and high-risk groups, and a disease-modifying vaccine were also considered. The number of new infections and deaths were reduced by 73% and 30%, respectively, by 2050, when 80% of adult population aged 15-49 was vaccinated with a 40% efficacy vaccine. Vaccinating medium- and high-risk groups reduced new infections by 52% and deaths by 21%. A vaccine with 70% efficacy produced a great decline in new infections and deaths. Neglecting medium- and high-risk population groups as well as disinhibition of vaccinated population reduced the impact or even increased the number of new infections. Disease-modifying vaccine also contributed to reducing AIDS deaths, the need for ART and new HIV infections.Even in a country with a concentrated epidemic and high levels of ARV coverage, such as Brazil, moderate efficacy vaccines as part of a comprehensive package of treatment and prevention could have a major impact on preventing new HIV infections and AIDS deaths, as well as reducing the number of people on ARV. Targeted vaccination strategies may be highly effective and cost-beneficial.

  6. Assessing the impacts of climate change in Mediterranean catchments under conditions of data scarcity - The Gaza case study

    Science.gov (United States)

    Gampe, David; Ludwig, Ralf

    2013-04-01

    According to current climate projections, Mediterranean countries are at high risk for an even pronounced susceptibility to changes in the hydrological budget and extremes. While there is scientific consensus that climate induced changes on the hydrology of Mediterranean regions are presently occurring and are projected to amplify in the future, very little knowledge is available about the quantification of these changes, which is hampered by a lack of suitable and cost effective hydrological monitoring and modeling systems. The European FP7-project CLIMB is aiming to analyze climate induced changes on the hydrology of the Mediterranean Basins by investigating seven test sites located in the countries Italy, France, Turkey, Tunisia, Gaza and Egypt. CLIMB employs a combination of novel geophysical field monitoring concepts, remote sensing techniques and integrated hydrologic modeling to improve process descriptions and understanding and to quantify existing uncertainties in climate change impact analysis. One of those seven sites is the Gaza Strip, located in the Eastern Mediterranean and part of the Palestinian Autonomous Area, covers an area of 365km² with a length of 35km and 6 to 12km in width. Elevation ranges from sea level up to 104m in the East of the test site. Mean annual precipitation varies from 235mm in the South to 420mm in the North of the area. The inter annual variability of rainfall and the rapid population growth in an highly agricultural used area represent the major challenges in this area. The physically based Water Simulation Model WaSiM Vers. 2 (Schulla & Jasper (1999)) is setup to model current and projected future hydrological conditions. The availability of measured meteorological and hydrological data is poor as common to many Mediterranean catchments. The lack of available measured input data hampers the calibration of the model setup and the validation of model outputs. WaSiM was driven with meteorological forcing taken from 4

  7. (ARV) treatment training programme

    African Journals Online (AJOL)

    Winnie

    should be offered ART; strategies for HAART; comprehensive care .... There has been an increase in knowledge and improved clinical skills.The staff have a more positive attitude and better acceptance of HIV patients.They are also more enthusiastic ... provision of the training manual, a background reading document to ...

  8. Birinci Dünya Savaşı’nda Gazze Muharebeleri / The Battles of Gaza in World War I

    Directory of Open Access Journals (Sweden)

    Sami Ağaoğlu

    2017-04-01

    Full Text Available Abstract According to Germany’s demand, Ottoman Empire opened Canal Front which is one of the most important front lines of WWI to pass the Suez Canal and attack Egypt. There were two massive attacks between Ottoman and British. The first clash occured in 1915 and second took place in 1916. Result of Ottoman forces struggle with the British troops, Ottoman Empire were defeated but then Ottoman Empire counter attacked. They tried to prevent British attacks in the campaigns of Sinai and Palestine. The paper deals with the First and the Second Battle of Gaza that repelled English forces, the third Gaza Battle and its result, Yildirim Army Group (or Thunderbolt Army Group of the Ottoman Empire that was formed in order to prevent advance of attackers and siege and fall of Jerusalem. Therefore, subsequent failures of the campaign and retreating to the Anatolia started. The research paper was based on archival documents, primary&secondary sources and memoirs. Öz Osmanlı Devleti, Birinci Dünya Savaşı’nın önemli cephelerinden olan Kanal cephesini Almanların isteği doğrultusunda Süveyş kanalının geçmek ve Mısır’a taarruz etmek amacıyla açmıştı. Osmanlı Ordusunun I. Kanal Seferi ve II. Kanal Seferi başarısız olunca, karşı saldırıya geçen İngiliz birlikleri Sina ve Filistin cephesinde, Gazze muharebeleri ile durdurulmaya çalışılmıştır. Araştırmamızda, İngiliz birliklerinin püskürtüldüğü I. ve II. Gazze muharebeleri, Birüssebi ve Gazze’nin elden çıktığı III. Gazze muharebesi, Osmanlı Devleti’nin bu yenilgiyi durdurabilmek için kurduğu Yıldırım Orduları Gurup Komutanlığı ve Kudüs’ün elden çıkışı ele alınmıştır. Böylelikle birbiri ardına gelen yenilgiler zinciri ile Osmanlı Ordularının Anadolu’ya çekilişi arşiv belgeleri, birinci elden kaynaklar ve hatıratlardan yararlanılarak işlenmiştir.

  9. FACTORS INFLUENCING ADHERENCE TO ARVS AMONG PATIENTS ATTENDING COMPREHENSIVE CARE CLINIC WITHIN JOMO KENYATTA UNIVERSITY OF AGRICULTURE AND TECHNOLOGY, KIAMBU COUNTY, KENYA.

    Science.gov (United States)

    Mwangi, A N; Ng'ang'a, Z; Wanzala, P; Karanja, S M

    2014-04-01

    The efficacy of anti-retroviral Therapy (ART) depends on adherence to the prescribed regimen. However, lack of adherence leads to treatment failure and drug resistance among other negative outcomes. To determine factors influencing adherence to ARVS among patients attending the Comprehensive Care Clinic (CCC) within Jomo Kenyatta University of Agriculture and Technology (JKUAT). A descriptive cross sectional study. Comprehensive Care Clinic within JKUAT. Three hundred HIV positive patients, undergoing ART treatment and follow up at the JKUAT clinic for a minimum duration of one month before the study, were recruited. Of the 300 patients enrolled for the study (70% females and 30% males), 81% were adhering to ARV treatment. The factors that were significantly associated with adherence included; Support (encouragement and reminder to take drugs) (P = 0.025); the number of meals respondents took in a day (P = 0.001); pill burden (P = 0.002) and forgetfulness (P = 0.001). However, there was no significant relationship between adherence and age, marital status, education, employment status or time taken to travel to the clinic. This study concluded that, the observed level of sub-optimal adherence to ART (19%) is of public health concern. These patients are vulnerable to treatment failure and development of resistant viral strains. Consequently the modifiable factors (Support, Number of meals taken, pill burden, and forgetfulness, should be addressed to change the current tread.

  10. A simulation/optimization study to assess seawater intrusion management strategies for the Gaza Strip coastal aquifer (Palestine)

    Science.gov (United States)

    Dentoni, Marta; Deidda, Roberto; Paniconi, Claudio; Qahman, Khalid; Lecca, Giuditta

    2015-03-01

    Seawater intrusion is one of the major threats to freshwater resources in coastal areas, often exacerbated by groundwater overexploitation. Mitigation measures are needed to properly manage aquifers, and to restore groundwater quality. This study integrates three computational tools into a unified framework to investigate seawater intrusion in coastal areas and to assess strategies for managing groundwater resources under natural and human-induced stresses. The three components are a three-dimensional hydrogeological model for density-dependent variably saturated flow and miscible salt transport, an automatic calibration procedure that uses state variable outputs from the model to estimate selected model parameters, and an optimization module that couples a genetic algorithm with the simulation model. The computational system is used to rank alternative strategies for mitigation of seawater intrusion, taking into account conflicting objectives and problem constraints. It is applied to the Gaza Strip (Palestine) coastal aquifer to identify a feasible groundwater management strategy for the period 2011-2020. The optimized solution is able to: (1) keep overall future abstraction from municipal groundwater wells close to the user-defined maximum level, (2) increase the average groundwater heads, and (3) lower both the total mass of salt extracted and the extent of the areas affected by seawater intrusion.

  11. How to assess solid waste management in armed conflicts? A new methodology applied to the Gaza Strip, Palestine.

    Science.gov (United States)

    Caniato, Marco; Vaccari, Mentore

    2014-09-01

    We have developed a new methodology for assessing solid waste management in a situation of armed conflict. This methodology is composed of six phases with specific activities, and suggested methods and tools. The collection, haulage, and disposal of waste in low- and middle-income countries is so complicated and expensive task for municipalities, owing to several challenges involved, that some waste is left in illegal dumps. Armed conflicts bring further constraints, such as instability, the sudden increase in violence, and difficulty in supplying equipment and spare parts: planning is very difficult and several projects aimed at improving the situation have failed. The methodology was validated in the Gaza Strip, where the geopolitical situation heavily affects natural resources. We collected information in a holistic way, crosschecked, and discussed it with local experts, practitioners, and authorities. We estimated that in 2011 only 1300 tonne day(-1) were transported to the three disposal sites, out of a production exceeding 1700. Recycling was very limited, while the composting capacity was 3.5 tonnes day(-1), but increasing. We carefully assessed system elements and their interaction. We identified the challenges, and developed possible solutions to increase system effectiveness and robustness. The case study demonstrated that our methodology is flexible and adaptable to the context, thus it could be applied in other areas to improve the humanitarian response in similar situations. © The Author(s) 2014.

  12. A Functional, Genome-wide Evaluation of Liposensitive Yeast Identifies the “ARE2 Required for Viability” (ARV1) Gene Product as a Major Component of Eukaryotic Fatty Acid Resistance*

    Science.gov (United States)

    Ruggles, Kelly V.; Garbarino, Jeanne; Liu, Ying; Moon, James; Schneider, Kerry; Henneberry, Annette; Billheimer, Jeff; Millar, John S.; Marchadier, Dawn; Valasek, Mark A.; Joblin-Mills, Aidan; Gulati, Sonia; Munkacsi, Andrew B.; Repa, Joyce J.; Rader, Dan; Sturley, Stephen L.

    2014-01-01

    The toxic subcellular accumulation of lipids predisposes several human metabolic syndromes, including obesity, type 2 diabetes, and some forms of neurodegeneration. To identify pathways that prevent lipid-induced cell death, we performed a genome-wide fatty acid sensitivity screen in Saccharomyces cerevisiae. We identified 167 yeast mutants as sensitive to 0.5 mm palmitoleate, 45% of which define pathways that were conserved in humans. 63 lesions also impacted the status of the lipid droplet; however, this was not correlated to the degree of fatty acid sensitivity. The most liposensitive yeast strain arose due to deletion of the “ARE2 required for viability” (ARV1) gene, encoding an evolutionarily conserved, potential lipid transporter that localizes to the endoplasmic reticulum membrane. Down-regulation of mammalian ARV1 in MIN6 pancreatic β-cells or HEK293 cells resulted in decreased neutral lipid synthesis, increased fatty acid sensitivity, and lipoapoptosis. Conversely, elevated expression of human ARV1 in HEK293 cells or mouse liver significantly increased triglyceride mass and lipid droplet number. The ARV1-induced hepatic triglyceride accumulation was accompanied by up-regulation of DGAT1, a triglyceride synthesis gene, and the fatty acid transporter, CD36. Furthermore, ARV1 was identified as a transcriptional of the protein peroxisome proliferator-activated receptor α (PPARα), a key regulator of lipid homeostasis whose transcriptional targets include DGAT1 and CD36. These results implicate ARV1 as a protective factor in lipotoxic diseases due to modulation of fatty acid metabolism. In conclusion, a lipotoxicity-based genetic screen in a model microorganism has identified 75 human genes that may play key roles in neutral lipid metabolism and disease. PMID:24273168

  13. A functional, genome-wide evaluation of liposensitive yeast identifies the "ARE2 required for viability" (ARV1) gene product as a major component of eukaryotic fatty acid resistance.

    Science.gov (United States)

    Ruggles, Kelly V; Garbarino, Jeanne; Liu, Ying; Moon, James; Schneider, Kerry; Henneberry, Annette; Billheimer, Jeff; Millar, John S; Marchadier, Dawn; Valasek, Mark A; Joblin-Mills, Aidan; Gulati, Sonia; Munkacsi, Andrew B; Repa, Joyce J; Rader, Dan; Sturley, Stephen L

    2014-02-14

    The toxic subcellular accumulation of lipids predisposes several human metabolic syndromes, including obesity, type 2 diabetes, and some forms of neurodegeneration. To identify pathways that prevent lipid-induced cell death, we performed a genome-wide fatty acid sensitivity screen in Saccharomyces cerevisiae. We identified 167 yeast mutants as sensitive to 0.5 mm palmitoleate, 45% of which define pathways that were conserved in humans. 63 lesions also impacted the status of the lipid droplet; however, this was not correlated to the degree of fatty acid sensitivity. The most liposensitive yeast strain arose due to deletion of the "ARE2 required for viability" (ARV1) gene, encoding an evolutionarily conserved, potential lipid transporter that localizes to the endoplasmic reticulum membrane. Down-regulation of mammalian ARV1 in MIN6 pancreatic β-cells or HEK293 cells resulted in decreased neutral lipid synthesis, increased fatty acid sensitivity, and lipoapoptosis. Conversely, elevated expression of human ARV1 in HEK293 cells or mouse liver significantly increased triglyceride mass and lipid droplet number. The ARV1-induced hepatic triglyceride accumulation was accompanied by up-regulation of DGAT1, a triglyceride synthesis gene, and the fatty acid transporter, CD36. Furthermore, ARV1 was identified as a transcriptional of the protein peroxisome proliferator-activated receptor α (PPARα), a key regulator of lipid homeostasis whose transcriptional targets include DGAT1 and CD36. These results implicate ARV1 as a protective factor in lipotoxic diseases due to modulation of fatty acid metabolism. In conclusion, a lipotoxicity-based genetic screen in a model microorganism has identified 75 human genes that may play key roles in neutral lipid metabolism and disease.

  14. Post-Traumatic Stress Disorder Among Health Care Providers Following the Israeli Attacks Against Gaza Strip in 2014: A Call for Immediate Policy Actions.

    Science.gov (United States)

    Abu-El-Noor, Nasser Ibrahim; Aljeesh, Yousef Ibrahim; Radwan, AbdalKarim Said; Abu-El-Noor, Mysoon Khalil; Qddura, Ibrahim Abdel-Ilhady; Khadoura, Khalid Jamal; Alnawajha, Samer Khader

    2016-04-01

    This study aimed to assess the level of posttraumatic stress disorder and to examine the relationship between exposure to war stress and posttraumatic symptoms among health care providers following Israeli offensives against Gaza Strip in 2014. A cross-sectional design was used for this study. We targeted all nurses and doctors working in three governmental hospitals in the Gaza Strip and worked with victims of the last war, more specifically, those who were working in emergency departments, intensive care units, operating rooms, surgical departments, and burn units. A demographic sheet and Impact Event Scale-Revised were used in this study. The Impact Event Scale-Revised has three sub-scales; intrusion, avoidance, and hyper-arousal. The results showed that 291 (89.8%) of 324 participants had scores more than 35 (threshold cut-off point) on the Impact Event Scale-Revised. Scores ranged from zero to 80 with a mean of 52.13. Females had higher levels of stress (55.79) than males (51.63) and nurses (54.85) had more stress than physicians (47.38). The most frequent symptoms of trauma subscales was "avoidance" (mean=20.04), followed by "intrusion" (mean=17.83), and then "hyper-arousal" (mean=14.27). Levels of trauma symptoms were not affected by place of living, hospital of work, while level of education had impacted level of trauma. The findings showed that health care providers suffered from severe posttraumatic symptoms after exposure to prolonged war stress. This level of trauma among health care providers warrants intervention programs to reduce stress and trauma among Gaza health care providers after the war. Copyright © 2015 Elsevier Inc. All rights reserved.

  15. Microbial contamination of the drinking water distribution system and its impact on human health in Khan Yunis Governorate, Gaza Strip: seven years of monitoring (2000-2006).

    Science.gov (United States)

    Abu Amr, S S; Yassin, M M

    2008-11-01

    To assess total and faecal coliform contamination in water wells and distribution networks over the past 7 years, and their association with human health in Khan Yunis Governorate, Gaza Strip. Historical data and interview questionnaire. Data were obtained from the Palestinian Ministry of Health on total and faecal coliform contamination in water wells and distribution networks, and on the incidence of water-related diseases in Khan Yunis Governorate. An interview questionnaire was conducted with 210 residents of Khan Yunis Governorate. Total and faecal coliform contamination exceeded the World Health Organization's limit for water wells and networks. However, the contamination percentages were higher in networks than in wells. Diarrhoeal diseases were strongly correlated with faecal coliform contamination in water networks (r=0.98). This is consistent with the finding that diarrhoeal diseases were the most common self-reported diseases among the interviewees. Such diseases were more prevalent among subjects who drank municipal water than subjects who drank desalinated or home-filtered water (odds ratio=2.03). Intermittent water supply, insufficient chlorination and sewage flooding seem to be associated with self-reported diseases. Residents in the Gaza Strip have a good level of knowledge about drinking water contamination, and this is reflected in good practice. Water quality has deteriorated in the Gaza Strip, and this may contribute to the prevalence of water-related diseases. Self-reported diseases among interviewees in Khan Yunis Governorate were associated with source of drinking water, intermittent water supply, insufficient chlorination, sewage flooding and age of water networks.

  16. Analysis of Multi Temporal Satellite Imagery for Total Suspended Sediments in a Wave-Active Coastal Area-Gaza Strip Coastal Water, Palestine

    Directory of Open Access Journals (Sweden)

    Midyan D.I. Aldabash

    2016-03-01

    Full Text Available Sediment load materials is one of the key factors that determine the surface water quality, both of oceanic and river water, and it specifies water optical properties. Thus it provides a background for a plenty of applications and projects in the water and oceanography community. Landsat detects and classifies reflected solar energy from bodies on the earth's surface. Suspended sediments existing in water column have an optical influences. So that, Landsat images could detect suspended sediments concentration in such a water surface. In this study we have three main objectives to be achieved as; TSS Concentration maps generation in the Gaza Strip coastal zone, achieving analysis processes on TSS trend itself and TSS related coastal phenomenon, and investigation of the ability of Landsat images to detect TSS comprehensively in a wavy coastal zone. For this purpose two landsat TM5 images acquired in 1999 and 2010, one Landsat TM7 images acquired in 2003, and 2 Landsat Oli 8 images acquired in 2014 and 2015 were used for TSS mapping. In addition, 64 TSS in-situ tested samples were also to calculate a correlation equation between Digital Numbers - DN in each image pixels and TSS values in the ground data. All image analysis and remote sensing steps have been done in this study using Integrated Land and Water Information System - ILWIS software version ILWIS academic 3.3. Green and Red bands in all used Landsat images contained the highest linear correlation factors -R- for the images acquired in 1999, 2003, 2010, 2014, and 2015. Resulted correlation factors were higher by reducing time difference between acquisition time and sampling time. Generated maps showed that circulation in Gaza coastal area are counterclockwise, and it brings the sediments from Nile River Delta toward Gaza Strip.

  17. From flood-event to climate in an alpine context (Arve valley, France): methodological issues toward the confrontation of historical documentation and geological records

    Science.gov (United States)

    Mélo, Alain; Ployon, Estelle; Wilhelm, Bruno; Arnaud, Fabien

    2014-05-01

    Floods are complex multifactor events. As it can occur randomly on a given region, a given singular event does not clearly inform about climate variations. On the contrary, long-time series of well documented events, each one being replaced in its historical and geographical context, should bring valuable information. Such successions can be built-up using heterogeneous historical documentation taken from various social contexts. This is the case of small drainage basin of river Arve and its tributaries (Northern French Alps), on which this paper will focus. We used a plentiful and rich documentation which was elaborated quite exclusively to report damages in the aim of claiming tax abatement. As a consequence each text requires a hard critic to reach the necessary objectivity. The analysis of 18th century treasury archives led first to a geographical reconstruction of floods impacts and second to an unambiguous chronology of events. The contrasted morphology of river Arve drainage basin generates various types of floods, depending on geographical situations: summer flash-floods in the higher parts of valleys (Chamonix, Sixt) or torrential tributaries (Borne); autumn large floods in lower parts (Bonneville); some unusual events concern the whole basin (1733, 1778...). The constitution of long continuous series was thus possible. However, this does not allow evidencing any trend because most of the events are randomly-distributed flash-floods. In return, meteorological contextualization of each event replaces it in a larger climatic perception. Using this way (meteorological archives, comparisons with recently well-documented event) led us to corroborate connections between flood events and changing patterns. In order to go a step further, we led a pilot-study aiming at representing our data in space-time information system using concepts and tools of time geography. This study was limited to year 1930 AD which was rich in various meteorological events leading to

  18. Medications Adherence and Associated Factors among Patients with Type 2 Diabetes Mellitus in the Gaza Strip, Palestine.

    Science.gov (United States)

    Elsous, Aymen; Radwan, Mahmoud; Al-Sharif, Hasnaa; Abu Mustafa, Ayman

    2017-01-01

    The aim of this study was to evaluate the adherence to anti-diabetic medications among patients with type 2 diabetes mellitus (DM) seeking medical care in the Gaza Strip, Palestine. A cross-sectional study was conducted among 369 primary care patients with type 2 DM from October to December 2016. Adherence to medications was measured using the Morisky Medication Adherence Scale (MMAS-4). Socio-demographic and clinical variables, provider-patient relationship, health literacy, and health belief were examined for each patient. Univariate, binary logistic regression and multiple linear regression were applied to determine the independent factors influencing adherence to anti-diabetic medications using SPSS version 22. Of all the respondents, 214 (58%), 146 (39.5%), and nine (2.5%) had high (MMAS score = 0), medium (MMAS score = 1 + 2), and low (MMAS score ≥ 3) adherence to anti-diabetic medications, respectively. Factors that were independently associated with adherence to anti-diabetic medications were as follows: female gender [odds ratio (OR): 1.657, 95% confidence interval (CI): 1.065-2.578] and perception of disease's severity (OR: 1.510, 95% CI: 0.410-5.560). Elderly ( t  = 1.345) and longer duration of DM ( t  = 0.899) were also predictors of adherence but showed no statistical significance ( p  > 0.05). The level of complete adherence to anti-diabetic medications was sub-optimal. New strategies that aim to improve patients' adherence to their therapies are necessary taking into consideration the influencing factors and the importance of having diabetes educators in the primary care centers.

  19. Can people remain engaged and vigorous in the face of trauma? Palestinians in the West Bank and Gaza.

    Science.gov (United States)

    Hobfoll, Stevan E; Johnson, Robert J; Canetti, Daphna; Palmieri, Patrick A; Hall, Brian J; Lavi, Iris; Galea, Sandro

    2012-01-01

    This is the first study to investigate how actively engaged and vigorous people remain in their life tasks in the midst of chronic exposure to significant traumatic events. We sought to identify risk and protective factors for engagement within the context of ongoing exposure to political violence and social upheaval. We randomly identified and interviewed 1,196 adult residents of the West Bank and Gaza during a period of violent conflict on 3 occasions: (1) September-October 2007, (2) April-May 2008, and (3) October-November 2008. Participants were asked about their exposure to political violence, symptoms of depression, and posttraumatic stress (PTS) symptoms, their level of social support, psychosocial resource loss, and positive engagement in life tasks. Path modeling revealed that trauma exposure indirectly affected engagement through its impact on resource loss and PTS and depression symptoms. PTS symptoms at Wave 2 were modestly related to greater engagement at Wave 3, and depression symptoms did not independently predict engagement at Wave 3. Psychosocial resource loss at Wave 1 and Wave 2 was the best overall predictor of engagement at Wave 3, through its direct and indirect effects via PTS symptoms. Greater engagement was also predicted by greater social support, being more educated, being younger, and being more religious. The relative independence of psychological distress and engagement was noted as a critical finding supporting a key tenet of positive psychology. The relationship of resource loss and social support with engagement suggests that bolstering psychosocial resources may offer a route for primary and secondary prevention amidst chronic traumatic conditions. © 2012 Guilford Publications, Inc.

  20. HLA-DQ2 and -DQ8 haplotypes frequency and diagnostic utility in celiac disease patients of Gaza strip, Palestine.

    Science.gov (United States)

    Ayesh, Basim M; Zaqout, Eman Kh; Yassin, Maged M

    2017-11-15

    Celiac disease (CD) diagnosis can be established by serological and small bowel biopsy (SBB), while absence of HLA-DQ2 and -DQ8 haplotypes excludes the disease. The present study aims at evaluating the diagnosis of a representative sample of pediatric and adult CD patients of Gaza strip in light of DQ2 and DQ8 haplotypes expression. Unrelated CD patients (n = 101) and matched healthy controls (n = 97) were genotyped for DQA1*05, DQB1*02 and DQB1*03:02 alleles by allele-specific real-time PCR. The diagnosis was re-evaluated according to the patient laboratory tests and HLA-DQ genotype. The diagnosis of 35 patients who have been managed for CD could not be confirmed. Twenty-five of them were diagnosed upon their clinical presentation only. The remaining were either negative for serological and SBB tests or negative for HLA-DQ haplotypes. The HLA-DQ alleles were negative in 4 SBB and one Anti-EMA positive patients. The frequency of DQ2 and DQ8 haplotypes among the remaining 65 confirmed cases was 70.8 and 15.4%, respectively, compared to 17.5 and 27.8% in the controls. The DQB1*02 allele was the most common in the cases (84.6%) followed by DQA1*05 allele (80%) and DQB1*03:02 allele (20%). The DQA1*05 allele was commonest in the control group (54.6%) followed by DQB1*02 allele (42.3%) and DQB1*03:02 allele (28.9%). Absence of HLA-DQ2 and HLA-DQ8 genotyping in the workup of patients may result in CD misdiagnosis, particularly in a setting with poor histopathological diagnostic capacity.

  1. Homocysteine and vitamin B 12 status and iron deficiency anemia in female university students from Gaza Strip, Palestine

    Directory of Open Access Journals (Sweden)

    Mahmoud Mohammed Sirdah

    2014-06-01

    Full Text Available OBJECTIVE: Nutritional deficiencies are very significant to the overall health of humans at all ages and for both genders, yet in infants, children and women of childbearing age these deficiencies can seriously affect growth and development. The present work is aimed to assess homocysteine and vitamin B12 status in females with iron deficiency anemia from the Gaza Strip.METHODS: Venous blood samples were randomly collected from 240 female university students (18-22 years old and parameters of the complete blood count, serum ferritin, homocysteine and vitamin B12 were measured. Statistical analysis included the t-test and analysis of variance (ANOVA using the IBM SPSS software (version 18. Statistical significance was set for p-values <0.05.RESULTS: The results revealed that 20.4% of the students have iron deficiency anemia. The mean serum vitamin B12 level in females with iron deficiency anemia (212.9 ± 62.8 pg/mL was significantly lower than in normal controls (286.9 ± 57.1 pg/mL and subjects with microcytic anemia and normal ferritin (256.7 ± 71.1 pg/mL. Significantly higher serum homocysteine levels were reported in the iron deficiency anemia group (27.0 ± 4.6 µmol/L compared to normal controls (15.5 ± 2.9 µmol/L and in subjects with microcytic anemia and normal ferritin (18.1 ± 2.7 µmol/L. Statistically significant negative correlations were reported for serum homocysteine with serum ferritin, vitamin B12, hemoglobin, and hematocrit levels.CONCLUSION: Important associations were found between serum homocysteine and markers of iron deficiency. Monitoring homocysteine levels might be essential to understand the development of different clinical conditions including anemia. It seems necessary to conduct prospective trials to determine whether treating anemia ameliorates homocysteine levels.

  2. Twelve years of follow-up for patients treated with ARVs in Senegal (ANRS Cohort 1215): description of population and methodology.

    Science.gov (United States)

    Ndoye, I; Taverne, B

    2014-10-01

    The ANRS Cohort 1215 brought together the first 400 patients receiving antiretroviral treatments through the government program for ARV treatment in Senegal. These people, infected with HIV-1, began their treatment between 1998 and 2002; they were treated with 2 NRTI + 1 PI or NNRTI. This prospective observational cohort received follow-up over the course of 12 years, from 1999 to 2010, and was one of the earliest established cohorts in Africa and providing the longest duration of ART follow-up. A series of interdisciplinary studies was conducted among these patients to assess the medical and social as well as the individual and collective impact of these treatments over the long term. This article presents the cohort's key methodological characteristics.

  3. Contribution of rainfall, snow and ice melt to the hydrological regime of the Arve upper catchment and to severe flood events

    Science.gov (United States)

    Lecourt, Grégoire; Revuelto, Jesús; Morin, Samuel; Zin, Isabella; Lafaysse, Matthieu; Condom, Thomas; Six, Delphine; Vionnet, Vincent; Charrois, Luc; Dumont, Marie; Gottardi, Frédéric; Laarman, Olivier; Coulaud, Catherine; Esteves, Michel; Lebel, Thierry; Vincent, Christian

    2016-04-01

    In Alpine catchments, the hydrological response to meteorological events is highly influenced by the precipitation phase (liquid or solid) and by snow and ice melt. It is thus necessary to simulate accurately the snowpack evolution and its spatial distribution to perform relevant hydrological simulations. This work is focused on the upper Arve Valley (Western Alps). This 205 km2 catchment has large glaciated areas (roughly 32% of the study area) and covers a large range of elevations (1000-4500 m a.s.l.). Snow presence is significant year-round. The area is also characterized by steep terrain and strong vegetation heterogeneity. Modelling hydrological processes in such a complex catchment is therefore challenging. The detailed ISBA land surface model (including the Crocus snowpack scheme) has been applied to the study area using a topography based discretization (classifying terrain by aspect, elevation, slope and presence of glacier). The meteorological forcing used to run the simulations is the reanalysis issued from the SAFRAN model which assimilates meteorological observations from the Meteo-France networks. Conceptual reservoirs with calibrated values of emptying parameters are used to represent the underground water storage. This approach has been tested to simulate the discharge on the Arve catchment and three sub-catchments over 1990-2015. The simulations were evaluated with respect to observed water discharges for several headwaters with varying glaciated areas. They allow to quantify the relative contribution of rainfall, snow and ice melt to the hydrological regime of the basin. Additionally, we present a detailed analysis of several particular flood events. For these events, the ability of the model to correctly represent the catchment behaviour is investigated, looking particularly to the relevance of the simulated snowpack. Particularly, its spatial distribution is evaluated using MODIS snow cover maps, punctual snowpack observations and summer

  4. Theoretical evaluation of electromagnetic emissions from GSM900 mobile telephony base stations in the West Bank and Gaza Strip-Palestine

    International Nuclear Information System (INIS)

    Lahham, Adnan; Abu Alkbash, Jehad; ALMasri, Hussien

    2017-01-01

    Theoretical assessments of power density in far-field conditions were used to evaluate the levels of environmental electromagnetic frequencies from selected GSM900 macrocell base stations in the West Bank and Gaza Strip. Assessments were based on calculating the power densities using commercially available software (RF-Map from Telstra Research Laboratories-Australia). Calculations were carried out for single base stations with multi-antenna systems and also for multiple base stations with multi-antenna systems at 1.7 m above the ground level. More than 100 power density levels were calculated at different locations around the investigated base stations. These locations include areas accessible to the general public (schools, parks, residential areas, streets and areas around kindergartens). The maximum calculated electromagnetic emission level resulted from a single site was 0.413 μW cm -2 and found at Hizma town near Jerusalem. Average maximum power density from all single sites was 0.16 μW cm -2 . The results of all calculated power density levels in 100 locations distributed over the West Bank and Gaza were nearly normally distributed with a peak value of ∼0.01% of the International Commission on Non-Ionizing Radiation Protection's limit recommended for general public. Comparison between calculated and experimentally measured value of maximum power density from a base station showed that calculations overestimate the actual measured power density by ∼27%. (authors)

  5. The reliability of the National Cholesterol Education Program's Adult Treatment Panel III (NCEP/ATP III) and the International Diabetes Federation (IDF) definitions in diagnosing metabolic syndrome (MetS) among Gaza Strip Palestinians.

    Science.gov (United States)

    Sirdah, Mahmoud M; Abu Ghali, Asmaa S; Al Laham, Nahed A

    2012-01-01

    Metabolic syndrome (MetS) which is a multifaceted syndrome, has been demonstrated as a common precursor for developing cardiovascular diseases and/or type 2 diabetes mellitus. Different diagnostic definitions for MetS have been proposed and recommended. We set up to evaluate the reliabilities of the National Cholesterol Education Program's Adult Treatment Panel III (NCEP/ATP III) and the International Diabetes Federation (IDF) definitions in diagnosing MetS among Gaza Strip Palestinians. This cross sectional study involved a randomly selected two hundred and thirty apparently healthy adults from the Gaza Strip. Anthropometric measurements, blood pressure, fasting plasma glucose, lipid profile, and questionnaire interviews were performed. The overall prevalence of MetS in our Gaza Strip cohort was 23.0% and 39.5% according to NCEP/ATP III and IDF definitions respectively (pdefinition (mean 3.42 ± 0.63 vs 3.52 ± 0.69 respectively, p=0.865). Both IDF and NCEP/ATP III showed an increased prevalence of MetS with age, and body mass index (BMI), however they revealed different prevalence trends with sex. Except for BMI, there were no significant differences in the general and metabolic related characteristics between subjects with MetS of IDF and NCEP/ATP III definitions. Independently of the definition used, MetS is highly prevalent in Gaza Strip population, with a steady increase in MetS prevalence through age and BMI. The IDF definition tends to give higher values for MetS prevalence, and therefore could be more appropriate for diagnosing MetS in Gaza Strip cohort. Copyright © 2012 Diabetes India. Published by Elsevier Ltd. All rights reserved.

  6. Analysis of recurring sinking events of armored tracked vehicles along dirt roads in the agricultural periphery of the Gaza Strip

    Science.gov (United States)

    Roskin, Joel

    2013-04-01

    The second (Al-Aqsa) intifada (Arab violent uprising) which erupted across Israel in 2000 eventually led the Israel Defense Forces to deploy armored tracked vehicles (ATVs) (tanks, armored personal carriers, and D-9 bulldozers) within Israel's agricultural periphery of the Gaza Strip, following daily attempts by Arab terrorists and guerillas to penetrate Israel. Combat movement of the ATVs was mainly concentrated to dirt roads, between agricultural fields, wherever possible. As a result of semi-arid Mediterranean (climate) winter rains, annually averaging 250 - 350 mm, it was reported that ATVs often sank in muddy terrain. This study investigated what caused ATVs to sink. The main data collected concerning the types of vehicles that sank related to: land-use characteristics, soil type, and daily rainfall. Interviews with commanders were also conducted for additional details. Between the fall and spring, surveys and weekly / bi-weekly field soil cone penetrometer tests were conducted at ten sites with different pedological and land-use characteristics. The loess soils, especially in agricultural fields, were generally found to be conducive to ATV traffic, even shortly after rainstorms of 10-30 mm. However, following several rainfall events exceeding 10 mm, ATVs and tanks regularly sank into local topographic depressions in the undulating landscape. These consisted of short segments of dirt roads where runoff and suspended sediment collected. After the early rains in late fall, tank ruts fossilize and become conduits of concentrated runoff and fine particles eroded by ATV activity during the summer months. Tank track ruts that formed in mud, compacted the soil, drastically altered drainage patterns by directing significant surface flow, and suspended sediment into these depressions, creating "tank-traps" whose trafficability ranged from "untrafficable" to "trafficable with constraints." This study shows that intense, routine, defensive military activity operated

  7. Shoulder Pain among Rehabilitated Spinal Cord Injured Persons Using Manually Propelled Wheelchairs in the Gaza Strip: A Survey

    Directory of Open Access Journals (Sweden)

    Ziad Al Hawamdah

    2012-08-01

    Full Text Available Shoulder pain among paraplegic persons has negative effects on their lives. The prevalence of shoulder pain among persons with spinal cord injury (SCI varies from 30% to 70% in different studies and may be related to repetitive use of the shoulder during self-care and wheelchair-related activities. Purpose: This study focused on the prevalence of shoulder pain and examined its effects on activities of daily living and social participation, and on functional, work and recreational or athletic activities. It also aimed to detect the degree of satisfaction with shoulder functioning wheelchair users who were paraplegic due to  spinal cord injury, in the Gaza strip.  Methods: Cross sectional study design was used to collect data from 80 persons with paraplegia, post rehabilitation, who were still using manual wheelchairs (MWC for ambulation. After giving informed consent, the selected persons were interviewed directly in their homes, and filled questionnaires which included the demographic data, Wheelchair User’s Shoulder Pain Index (WUSPI and Shoulder Rating Questionnaire (SRQ.Results: The prevalence rate of shoulder pain among paraplegics who use manual wheelchairs was 62%. Pushing a wheelchair for 10 minutes or more, and propulsion up ramps or inclines outdoors were the most common activities that caused and exacerbated shoulder pain. Sixty four percent from among the study sample mentioned that they had no limitation in shoulder-using ability during daily personal and household activities, while the rest experienced different degrees of limitation. Seventy-four percent reported no limitation during recreational or athletic activities, while the rest (26% agreed that pain has variably limited their participation in these activities. Fourteen percent from the sample rated the overall degree of satisfaction with their shoulder functioning as fair, and the rest rated their satisfaction from good to excellent.Conclusion: Shoulder pain, ranging

  8. Obesity and overweight: prevalence and associated socio demographic factors among mothers in three different areas in the Gaza Strip-Palestine: a cross-sectional study.

    Science.gov (United States)

    El Kishawi, Rima Rafiq; Soo, Kah Leng; Abed, Yehia Awad; Muda, Wan Abdul Manan Wan

    2014-01-01

    The increasing number of obesity and overweight cases in developing countries, especially among women, requires serious attention because of its effects on the health care system and the quality of life. Few studies have been conducted in the Gaza Strip to determine obesity and overweight prevalence and the associated factors. This study aimed at determining the prevalence of obesity and overweight cases in relation to socio-demographic factors among mothers aged 18-50 years in the Gaza Strip-Palestine from June 2012 to September 2012. Mothers childbearing age 18-50 years (n = 357) were selected using a cross-sectional multistage sampling methodology from three different geographical locations, namely, El Remal urban area, Jabalia refugee camp, and Al Qarrara rural area. The weight and height of the mothers were measured, and their body mass indexes (BMI) were computed. The mothers were categorized according to the criteria of World Health Organization (WHO) for BMI. The criteria categorize mothers as overweight if they have a BMI 25-29.9 kg/m(2) and obese if their BMI ≥ 30.0 kg/m(2). Obesity and overweight rates in urban area, refugee camp, and rural area were found to be 57.0%, 66.8%, and 67.5%, respectively. Moreover, BMI increased with age, adjusted b = 0.39; 95% CI (0.31, 0.48); p = < 0.001, whereas BMI was lower in low-income subjects, adjusted b = -1.59, 95% CI (-2.74,-0.44), p = 0.007. Housewives were more susceptible to obesity than employed woman, adjusted b = -2.76, 95% CI (-5.33,-0.19), p = 0.036. However, the study found no association among BMI level and household size, geographical location, educational level, and family assistance. The results showed that obesity and being overweight are highly prevalent among women in the Gaza Strip. Independent predictors of obesity in the population studied were increasing age, high income, and housewives. This finding is an important baseline for the monitoring of obesity and

  9. Health expectancy in the occupied Palestinian territory: estimates from the Gaza Strip and the West Bank: based on surveys from 2006 and 2010

    DEFF Research Database (Denmark)

    Qlalweh, Khaled; Duraidi, Mohammed; Brønnum-Hansen, Henrik

    2012-01-01

    estimated using the Sullivan method on the basis of mortality data and data on the prevalence of chronic disease. Results: Life expectancy at the age of 20 increased from 52.8 years in 2006 to 53.3 years in 2010 for men and from 55.1 years to 55.7 years for women. In 2006, expected lifetime without...... and diabetes has increased. For women, the gain in life expectancy consisted partly of years with and partly of years without the most prevalent diseases. Conclusions: Health expectancy for men and women diverged, which could to some extent be due to gender-specific exposures related to lifestyle factors......Objectives: The purpose of the study was to estimate health expectancy for the Palestinian population and to evaluate changes that have taken place over the past 5 years. Design: Mortality data and population-based health surveys. Setting: The Israeli-occupied Palestinian territory of the Gaza...

  10. Applying the Triangle Method for the parameterization of irrigated areas as input for spatially distributed hydrological modeling - Assessing future drought risk in the Gaza Strip (Palestine).

    Science.gov (United States)

    Gampe, David; Ludwig, Ralf; Qahman, Khalid; Afifi, Samir

    2016-02-01

    In the Mediterranean region, particularly in the Gaza strip, an increased risk of drought is among the major concerns related to climate change. The impacts of climate change on water availability, drought risk and food security can be assessed by means of hydro-climatological modeling. However, the region is prone to severe observation data scarcity, which limits the potential for robust model parameterization, calibration and validation. In this study, the physically based, spatially distributed hydrological model WaSiM is parameterized and evaluated using satellite imagery to assess hydrological quantities. The Triangle Method estimates actual evapotranspiration (ETR) through the Normalized Difference Vegetation Index (NDVI) and land surface temperature (LST) provided by Landsat TM imagery. So-derived spatially distributed evapotranspiration is then used in two ways: first a subset of the imagery is used to parameterize the irrigation module of WaSiM and second, withheld scenes are applied to evaluate the performance of the hydrological model in the data scarce study area. The results show acceptable overall correlation with the validation scenes (r=0.53) and an improvement over the usual irrigation parameterization scheme using land use information exclusively. This model setup is then applied for future drought risk assessment in the Gaza Strip using a small ensemble of four regional climate projections for the period 2041-2070. Hydrological modeling reveals an increased risk of drought, assessed with an evapotranspiration index, compared to the reference period 1971-2000. Current irrigation procedures cannot maintain the agricultural productivity under future conditions without adaptation. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Short and longer-term psychological consequences of Operation Cast Lead: documentation from a mental health program in the Gaza Strip

    Directory of Open Access Journals (Sweden)

    Llosa Augusto E

    2012-10-01

    Full Text Available Abstract Background There is growing recognition of the psychological impact of adversity associated with armed conflict on exposed civilian populations. Yet there is a paucity of evidence on the value of mental health programs in these contexts, and of the chronology of psychological sequelae, especially in prolonged conflicts with repeated cycles of extreme violence. Here, we describe changes in the psychological profile of new patients in a mental health program after the military offensive Cast Lead, in the context of the prolonged armed conflict involving the Gaza Strip. Methods This study analyses routinely collected program data from a Médecins Sans Frontières mental health program in the Gaza Strip spanning 2007–2011. Data consist of socio-demographic as well as clinical baseline and follow-up data on new patients entering the program. Comparisons were made through Chi square and Fisher’s exact tests, univariate and multivariate logistic and linear regression. Results PTSD, depression and other anxiety disorders were the most frequent psychopathologies, with 21% having multiple diagnoses. With a median of nine sessions, clinical improvement was recorded for 83% (1122/1357, and more common for those with separation anxiety, acute and posttraumatic disorders as principal diagnosis (855/1005, compared to depression (141/183, p Conclusion Evolving changes in patient volume, diagnoses and recall period to triggering events suggest a lengthy and durable effect of an intensified exposure to violence in a context of prolonged conflict. Our findings suggest that mental health related humanitarian relief in protracted conflicts might need to prepare for an increase in patients with changing profiles over an extended period following an acute flare-up in violence.

  12. Análisis de Minimización de Costo e Impacto Presupuestario del Tratamiento ARV con Abacavir/Lamivudina para el VIH/SIDA en México.

    Science.gov (United States)

    Rely, Kely; Martínez Valverde, Silvia; Salinas Escudero, Guillermo

    2013-12-01

    In Mexico, health authorities have raised reach the total of people living with HIV/ AIDS who need treatment have access to it, with the proper use of the best ARV therapies. Evaluate health spending would mean the management of patients with HIV/AIDS with the first-line therapy of abacavir/lamivudine with respect to tenofovir/emtricitabine and lamivudine-zidovudine. A literature review was conducted to seek evidence from clinical studies that demonstrated similar efficacy of ARV treatment between abacavir-lamivudine medications compared with other options. To calculate the incremental cost between these treatments, there was a Budget Impact Analysis and a pharmacoeconomic model was constructed to estimate the economic benefits by increasing its market share. Increased market penetration of abacavir/lamivudine represent a save of $ 44.8 million for the National Health System in Mexico during the years 2012-2017, without compromising the quality and effectiveness of treatment. Furthermore, this increase in market share with abacavir-lamivudine, the National Health System could get an additional benefit to deal on average 5.197 with HIV patients by 5 years with ARV therapies in Mexico. The use of abacavir/lamivudine in ARV treatment of patients with HIV/AIDS is a cost saving for the Mexican health System, which leads to a potential reduction in resources of US$44.8 million in treatment costs in the five projected years. Copyright © 2013 International Society for Pharmacoeconomics and Outcomes Research (ISPOR). Published by Elsevier Inc. All rights reserved.

  13. Zapahh gaza / Mark Ostanin

    Index Scriptorium Estoniae

    Ostanin, Mark

    2005-01-01

    Tallinnas kogunenud Balti Assamblee võttis vastu resolutsiooni seoses Läänemere põhja kavandatava Saksa-Vene gaasijuhtmega. Vt. samas: Ilja Nikoforovi intervjuud Leedu Seimi spiikri Arturas Paulauskasega. Baltimaad ei või kõrvale jääda

  14. Gaza - tur retur

    DEFF Research Database (Denmark)

    Mosdal, Anders Glosimodt

    Formålet med dette brief er at skabe et overblik over den komplekse situation i Israel og de palæstinensiske selvstyreområder efter Hamas’ magtovertagelse. Briefet fokuserer på nogle af de faktorer, som i øjeblikket vanskeliggør en løsning af konflikten i området.......Formålet med dette brief er at skabe et overblik over den komplekse situation i Israel og de palæstinensiske selvstyreområder efter Hamas’ magtovertagelse. Briefet fokuserer på nogle af de faktorer, som i øjeblikket vanskeliggør en løsning af konflikten i området....

  15. Cisjordanie et Gaza

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cathy Egan

    domaines : la gestion des ressources (et plus particulièrement de l'eau), les poli- tiques économiques et la consolidation de la paix et la reconstruction (domaine où étaient concentrés la majorité des projets). Différents projets sur la paix et sur les conflits se sont intéressés au phénomène de l'intifada, à l'absence de.

  16. Effectiveness and tolerability of abacavir-lamivudine-nevirapine (ABC/3TC/NVP) in a multicentre cohort of HIV-infected, ARV-naïve patients.

    Science.gov (United States)

    Podzamczer, Daniel; Rojas, Jhon Fredy; Neves, Isabel; Ferrer, Elena; Llibre, Josep M; Leal, Manuel; Gorgolas, Miguel; Jose, Crusells M; Gatell, Josep M; Abreu, Ricardo Correia; Curto, Jordi; Domingo, Pere; Pilar, Barrufet M; Rozas, Nerea

    2014-01-01

    Very scarce information has been published to date with the combination of ABC/3TC/NVP but it is currently being used in clinical practice in Spain and Portugal. Our aim was to present the clinical experience with this regimen in a cohort of adult HIV-infected antiretroviral (ARV)-naïve patients. Retrospective, multicentre, cohort study. Consecutive adult HIV-infected ARV-naïve HLA-B*5701-negative patients, who started ABC/3TC/NVP between 2005-2013, with at least one follow-up visit, were included. Demographic, clinical and laboratory variables were assessed at baseline, month 1, and every three-four months thereafter. The primary end point was HIV-1 viral load (VL)<40 c/mL at 48 weeks. Data were analyzed by intent-to-treat (ITT) (switch=failure, and missing=failure) and on treatment (OT) analyses. 78 patients were included. Median follow up was 26 (0.1-84) months. 86% were male, median age 41 (23-69) years, 9% had AIDS, 8% were HCV+, baseline CD4 was 275 (10-724) cells/µL and median VL 4.58 (3.02-6.92) log. After 48 weeks, VL was<40 c/mL in 89.8% (OT), 79.7% (M=F) and 65.4% (S=F) and at 96 weeks in 88.5%, 78.9% and 61.6%, respectively. CD4 increased +246 (p<0.001) and +292 (p<0.001) cells/uL after 48 and 96 weeks, respectively. One or more drugs of the regimen were discontinued in 33 (42.3%) patients. In 15 (19.2%) patients (13 NVP, 2 ABC/3TC) therapy was stopped due to toxicity after a median of one month (in only two cases after six months of follow up): 80% of them had rash/liver toxicity. Six (7.7%) patients discontinued ART due to virologic failure, five (6.4%) because of other reasons and seven (9%) were lost to follow-up. ALT but not AST significantly increased (+0.07 ukat/L at 96 weeks, p=0.033). A significant increase of 25%, 26% and 42% in total cholesterol, LDLc and HDLc, respectively, and a significant decrease in TC/HDL ratio (6%, p=0.008) was observed after 96 weeks. Despite a considerable proportion of patients had to stop therapy due to toxicity

  17. Patients' satisfaction with the non-communicable diseases services provided at UNRWA health centres in Gaza governorates: a cross-sectional study.

    Science.gov (United States)

    Elkahtib, Zoheir

    2018-02-21

    Most health-care organisations are increasingly interested in assessing the quality of their services. Patient satisfaction has a central role in the quality assessment in health care because it reflects the appropriateness of services from the clients' perspectives. The aim of this study was to assess the level of satisfaction in patients with non-communicable diseases (mainly diabetes and hypertension) who receive services from UNRWA health centres in Gaza governorates. In this cross-sectional study we chose a random sample of participants who presented to the randomly selected six health centres for treatment of non-communicable diseases. Through an exit interviewing technique, participants were chosen according to the study eligibility criteria and were requested to complete a questionnaire. The total instrument reliability (Cronbach's Alpha) was very high (0·936). To examine construct validity, we used Factor Analysis Principal Component Extraction with Varimax Rotation and Kaiser Normalisation with a cutoff point of 0·4. The reported variance was 42·28%, indicating high validity. Ethical approval from the Palestinian Ministry of Health (the Helsinki committee) was obtained, and verbal consent was obtained from the participants. 327 (82%) of 400 eligible patients completed the questionnaire. The reported overall satisfaction level with services for non-communicable diseases was moderately high (72%). The study extracted six domains that could constitute a framework for patient satisfaction with services at UNRWA clinics for non-communicable diseases. Elicited satisfaction scores about these domains varied and ranged from 57% to 84%. Although high satisfaction levels were found with general impressions, accessibility, communication, and interpersonal relationships, patients had a low level of satisfaction with the technical quality of services, clinic environment, and convenience of the services. People who were unmarried, working, living in the southern

  18. Impacto cultural de los proyectos de desarrollo. Parque Regional Ecoturístico Arví. Corregimiento de Santa Elena, municipio de Medellín: Propuesta de evaluación

    OpenAIRE

    Ocampo Madrigal, John Jader

    2015-01-01

    Resumen: se analiza la alteración de la dinámica cultural con la inclusión del proyecto de desarrollo Parque Regional Ecoturístico Arví en el corregimiento de Santa Elena – Medellín, en el marco de entendimiento del concepto de configuración cultural, a través de cuatro indicadores cualitativos relacionados con la comprensión del territorio, las redes culturales, la actitud social frente a los espacios públicos y la percepción patrimonial. Los resultados de esta tarea, fueron evaluados a la l...

  19. Integrating an artificial intelligence approach with k-means clustering to model groundwater salinity: the case of Gaza coastal aquifer (Palestine)

    Science.gov (United States)

    Alagha, Jawad S.; Seyam, Mohammed; Md Said, Md Azlin; Mogheir, Yunes

    2017-12-01

    Artificial intelligence (AI) techniques have increasingly become efficient alternative modeling tools in the water resources field, particularly when the modeled process is influenced by complex and interrelated variables. In this study, two AI techniques—artificial neural networks (ANNs) and support vector machine (SVM)—were employed to achieve deeper understanding of the salinization process (represented by chloride concentration) in complex coastal aquifers influenced by various salinity sources. Both models were trained using 11 years of groundwater quality data from 22 municipal wells in Khan Younis Governorate, Gaza, Palestine. Both techniques showed satisfactory prediction performance, where the mean absolute percentage error (MAPE) and correlation coefficient ( R) for the test data set were, respectively, about 4.5 and 99.8% for the ANNs model, and 4.6 and 99.7% for SVM model. The performances of the developed models were further noticeably improved through preprocessing the wells data set using a k-means clustering method, then conducting AI techniques separately for each cluster. The developed models with clustered data were associated with higher performance, easiness and simplicity. They can be employed as an analytical tool to investigate the influence of input variables on coastal aquifer salinity, which is of great importance for understanding salinization processes, leading to more effective water-resources-related planning and decision making.

  20. Factors affecting adherence to short-course ARV prophylaxis for preventing mother-to-child transmission of HIV in sub-Saharan Africa: a review and lessons for future elimination.

    Science.gov (United States)

    Colombini, Manuela; Stöckl, Heidi; Watts, Charlotte; Zimmerman, Cathy; Agamasu, Enyonam; Mayhew, Susannah H

    2014-01-01

    Despite the biomedical potential to eliminate vertical HIV transmission, drug adherence to short regimens is often sub-optimal. To inform future programmes, we reviewed evidence on the factors influencing maternal and infant drug adherence to preventing MTCT drug regimens at delivery in sub-Saharan Africa. A literature review yielding 14 studies on adherence to drug regimes among HIV-positive pregnant women and mothers in sub-Saharan Africa was conducted. Rates of maternal adherence to preventive drug regimens at time of delivery varied widely across sites between 35 and 93.5%. Factors most commonly associated with low adherence to antiretroviral therapy (ARV) prophylaxis for preventing MTCT at the health system level include giving birth at home, quality and timing of HIV testing and counselling, and late distribution of nevirapine (NVP). Socio-demographic and demand-side factors include fear of stigma, lack of male involvement, fear of partner's reaction to disclosure, few antenatal (ANC) visits, young age and lack of education. With the implementation of the newly published WHO guidelines recommending triple-drug ARV regimen during pregnancy and breastfeeding for all women with HIV, it is important that women are able to adhere to recommended drug regimens. Service improvements should include clear and timely communication with women about the benefits of combined regimens and greater emphasis on patient confidentiality. Efforts must be made to help women overcome barriers that reduce adherence, such as financial logistical challenges, social stigma and women's fear of violence.

  1. The Legal Implication of Palestine's Ad Hoc Declaration and Accession to the ICC's Jurisdiction Based on the Rome Statute 1998 (Case Study of Israeli Attacks on Gaza Strip from January 2009 to December 2014

    Directory of Open Access Journals (Sweden)

    Nabilla Utami Dhiya Rahmani

    2016-12-01

    Full Text Available Abstract The conflict between Israel and Palestine on Gaza Strip has caused not only military casualties but also civilian casualties which are protected by the international law. The protection of civilians in armed conflict is basically set in the Geneva Convention of 1949 which has been ratified by Israel and Palestine, in which violations of its provisions constitute war crimes. This paper discusses the mechanism of the International Criminal Court based on the Rome Statute 1998 in enforcing the law against war crimes on Gaza Strip. Articles 13 and 15 of Rome Statute 1998 provide jurisdiction for the settlement of an international criminal case. Palestine has made several attempts in accepting the jurisdiction of the ICC in 2009 and 2015, namely through their declaration and accession which further gave legal implication on the implementation of the international law. Based on these studies, this paper will further discuss the legal implication of the Palestine's declaration in 2009 and 2015, as well as its accession in 2015. Abstrak Konflik yang telah terjadi bertahun-tahun antara Israel dan Palestina di jalur Gaza telah memakan tidak hanya korban militer namun juga korban sipil yang dilindungi oleh hukum internasional. Perlindungan terhadap penduduk sipil dalam konflik bersenjata pada dasarnya diatur dalam Konvensi Jenewa IV tahun 1949 yang telah diratifikasi oleh Israel dan Palestina di mana pelanggaran terhadap ketentuannya merupakan kejahatan perang. Penulis dalam tulisan ini membahas mengenai mekanisme International Criminal Court berdasarkan Statuta Roma 1998 dalam menegakkan hukum terhadap kejahatan perang di jalur Gaza. Berdasarkan Statuta Roma 1998 Pasal 13 dan 15, ICC memiliki yurisdiksi atas penyelesaian suatu kasus pidana internasional yang diajukan negara anggota, rekomendasi Dewan Keamanan PBB, investigasi mandiri yang dilakukan oleh jaksa Mahkamah Pidana Internasional, atau deklarasi ad hoc yang dilakukan bagi negara bukan

  2. Understanding the perceptions, roles and interactions of stakeholder networks managing health-care waste: A case study of the Gaza Strip.

    Science.gov (United States)

    Caniato, M; Tudor, T; Vaccari, M

    2015-01-01

    The sustainable management of waste requires a holistic approach involving a range of stakeholders. What can often be difficult is to understand the manner in which different types of stakeholder networks are composed and work, and how best to enhance their effectiveness. Using social network analysis and stakeholder analysis of healthcare waste management stakeholders in the case study region of the Gaza Strip, this study aimed to understand and examine the manner in which the networks functioned. The Ministry of Health was found to be the most important stakeholder, followed by municipalities and solid waste management councils. Some international agencies were also mentioned, with specific roles, while other local institutions had a limited influence. Finally while health-care facilities had a strong interest in waste management, they were generally poorly informed and had limited links to each other. The manner in which the networks operated was complicated and influenced by differences in perception, sharing of information, access to finance and levels of awareness. The lack of a clear legal framework generated various mistakes about roles and responsibilities in the system, and evidently regulation was not an effective driver for improvement. Finally stakeholders had different priorities according to the waste management issues they were involved with, however segregation at the source was identified as a key requirement by most. Areas for improving the effectiveness of the networks are suggested. The analysis utilized an innovative methodology, which involved a large number of stakeholders. Such an approach served to raise interest and awareness at different levels (public authorities, health providers, supporting actors, others), stimulate the discussion about the adoption of specific policies, and identify the effective way forward. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Low birth weight and prenatal exposure to indoor pollution from tobacco smoke and wood fuel smoke: a matched case-control study in Gaza Strip.

    Science.gov (United States)

    Abusalah, Akram; Gavana, Magda; Haidich, Anna-Bettina; Smyrnakis, Emmanouil; Papadakis, Nikos; Papanikolaou, Alexis; Benos, Alexis

    2012-11-01

    Maternal exposure to environmental tobacco smoke (ETS) is a major health hazard as it contains lower doses of the toxins that smokers' inhale. Prenatal exposure to wood fuel smoke has been linked to delivering low birth weight (LBW) infants. The study aims to assess the association between prenatal exposure to ETS and wood fuel smoke and LBW. A case-control study in ratio 1:1 was conducted in two hospitals with obstetric services in Gaza Strip. Subjects were selected during May-June and July-August 2007 from attenders of Mbarak Hospital and Shifa Medical Centre, respectively. 184 (41.2%), and 79 (17.7%) out of 446 participants were exposed to environmental tobacco smoke and wood fuel smoke, respectively. Adjusted maternal exposure to ETS (especially the number of cigarettes smoked, water pipe and wood fuel smoke) was associated with LBW infants. Cigarette smoke exhibits an independent dose-response risk of LBW after adjusting for confounders. Prenatal exposure to cigarette smoke indoors is related to a reduction in birth weight of infants of -237 g (95% CI: -415, -58) for pregnant women exposed to 1-20 cigarettes per day and -391 g (95% CI: -642, -140) for exposure to more than 20 cigarettes per day. Exposure to wood fuel smoke exhibits a reduction of infants' adjusted mean birth weight by -186 g (95% CI: -354, -19). Prenatal exposure to passive smoking and wood fuel smoke are independently associated with LBW. Both these factors are modifiable exposures that could possibly lead to a reduction of delivering LBW infants.

  4. Understanding the perceptions, roles and interactions of stakeholder networks managing health-care waste: A case study of the Gaza Strip

    International Nuclear Information System (INIS)

    Caniato, M.; Tudor, T.; Vaccari, M.

    2015-01-01

    Highlights: • We systematically review scientific literature about health-care waste management. • We identify and discuss gaps, trends, efforts, and key-factors. • We suggest areas for improvement and best practices reported in literature. • We include recommendations for policy makers, practitioners and researchers. • We promote a holistic and harmonized approach to health-care waste management. - Abstract: The sustainable management of waste requires a holistic approach involving a range of stakeholders. What can often be difficult is to understand the manner in which different types of stakeholder networks are composed and work, and how best to enhance their effectiveness. Using social network analysis and stakeholder analysis of healthcare waste management stakeholders in the case study region of the Gaza Strip, this study aimed to understand and examine the manner in which the networks functioned. The Ministry of Health was found to be the most important stakeholder, followed by municipalities and solid waste management councils. Some international agencies were also mentioned, with specific roles, while other local institutions had a limited influence. Finally while health-care facilities had a strong interest in waste management, they were generally poorly informed and had limited links to each other. The manner in which the networks operated was complicated and influenced by differences in perception, sharing of information, access to finance and levels of awareness. The lack of a clear legal framework generated various mistakes about roles and responsibilities in the system, and evidently regulation was not an effective driver for improvement. Finally stakeholders had different priorities according to the waste management issues they were involved with, however segregation at the source was identified as a key requirement by most. Areas for improving the effectiveness of the networks are suggested. The analysis utilized an innovative methodology

  5. A contrução do canal de Suez e a formação do conflito: a força de paz brasileira na Faixa de Gaza

    Directory of Open Access Journals (Sweden)

    Francisca Carla Santos Ferrer

    2006-04-01

    Full Text Available Apesar de ocorrerem ainda inúmeros conflitos, após 1945 as nações uniram-se em busca de paz. A ONU passou a intervir em conflitos armados sempre que achasse necessário para a manutenção da paz. Entretanto, o imperialismo havia deixado suas marcas em diversos países da África, que após a Segunda Guerra Mundial se lançaram na luta por independência. Este foi o caso de Suez. No presente artigo apresentamos nossa análise sobre a formação do conflito árabe-israelense na Faixa de Gaza e da efetiva participação brasileira, como força de paz enviada pela ONU, na Guerra dos Seis Dias.

  6. Teel turvalisema liikluskultuuri suunas / Jüri Pihl

    Index Scriptorium Estoniae

    Pihl, Jüri, 1954-

    2008-01-01

    Ilmunud ka: Pärnu Postimees 31. juuli, lk. 15, Oma Saar 31. juuli, lk. 5, Meie Maa 31. juuli lk. 2, Harju Ekspress 1. aug, lk. 6, Võrumaa Teataja 2. aug. lk. 2, Vooremaa 5. aug., lk. 2, Koit 5. aug. lk. 6, Virumaa Teataja 6. aug., lk. 15, Sõnumitooja 6. aug. lk. 2, Järva Teataja, Valgamaalane 7. aug. lk. 2. Liiklusõnnetustes hukkunute ja vigastatute arv on vähenenud, tänu intensiivsemale ja mõtestatumale liiklusjärelevalvele on hukkunuid kolmandiku võrra vähem. Riigikogu menetluses olevast nn. liikluspaketist

  7. Preferences for ARV-based HIV prevention methods among men and women, adolescent girls and female sex workers in Gauteng Province, South Africa: a protocol for a discrete choice experiment.

    Science.gov (United States)

    Quaife, Matthew; Eakle, Robyn; Cabrera, Maria; Vickerman, Peter; Tsepe, Motlalepule; Cianci, Fiona; Delany-Moretlwe, Sinead; Terris-Prestholt, Fern

    2016-06-27

    For the past few decades, condoms have been the main method of HIV prevention. Recent advances in antiretroviral (ARV)-based prevention products have substantially changed the prevention landscape, yet little is known about how popular these products will be among potential users, or whether new methods might be used in conjunction with, or instead of, condoms. This study will use a discrete choice experiment (DCE) to (1) explore potential users' preferences regarding HIV prevention products, (2) quantify the importance of product attributes and (3) predict the uptake of products to inform estimates of their potential impact on the HIV epidemic in South Africa. We consider preferences for oral pre-exposure prophylaxis; a vaginal microbicide gel; a long-acting vaginal ring; a SILCS diaphragm used in concert with gel; and a long-acting ARV-based injectable. This study will gather data from 4 populations: 200 women, 200 men, 200 adolescent girls (aged 16-17 years) and 200 female sex workers. The DCE attributes and design will be developed through a literature review, supplemented by a thematic analysis of qualitative focus group discussions. Extensive piloting will be carried out in each population through semistructured interviews. The final survey will be conducted using computer tablets via a household sample (for women, men and adolescents) and respondent-driven sampling (for female sex workers), and DCE data analysed using a range of multinomial logit models. This study has been approved by the University of the Witwatersrand Human Research Ethics Committee and the Research Ethics Committee at the London School of Hygiene and Tropical Medicine. Findings will be presented to international conferences and peer-reviewed journals. Meetings will be held with opinion leaders in South Africa, while results will be disseminated to participants in Ekurhuleni through a public meeting or newsletter. Published by the BMJ Publishing Group Limited. For permission to use (where

  8. Eyeless in Gaza, Part I.

    Science.gov (United States)

    Gatto, John Taylor

    1997-01-01

    Suggests that school books present a hidden curriculum that restricts the thinking and learning of students, that the high rate of U.S. illiteracy can be attributed to the method by which reading has been taught since World War II, and that encouraging students to read "real" books will ultimately improve the quality of education. (LP)

  9. The effect of prolonged exposure to war-related stress among hospital personnel with different affect types: lessons from the Second Lebanon War and the Gaza "Cast Lead" operation.

    Science.gov (United States)

    Palgi, Yuval; Ben-Ezra, Menachem; Shrira, Amit

    2012-01-01

    Two studies examined peritraumatic symptoms due to war-related stress among hospital personnel with different affect types. In Study 1, we examined 80 Israeli hospital personnel during the period they were exposed to frequent missile attacks in the Second Lebanon War. In Study 2, we examined 67 and 74 Israeli hospital personnel during the time they were exposed and were not exposed, respectively, to missile attacks in the Gaza "Cast Lead" operation. In both studies, hospital personnel completed measures of posttraumatic stress disorder symptoms as well as of positive- and negative-affect items (PA and NA, respectively). Exposed personnel with a positive congruent (high PA and low NA) or a deflated incongruent (low PA and low NA) affective types had a lower level of peritraumatic symptoms compared to those with a negative congruent (low PA and high NA) or an inflated incongruent (high PA and NA) affective types. Study 2 further showed that among non-exposed personnel, only personnel with a negative congruent affective type had a higher level of peritraumatic symptoms compared to personnel with other affective types. Clinical implications and required future studies are discussed.

  10. Treatment seeking for posttraumatic stress in Israel Defense Forces veterans deployed in the Second Lebanon War (2006) and "Operation Cast Lead" in the Gaza Strip (2009): a comparative study.

    Science.gov (United States)

    Levi, Ofir; Lubin, Gadi

    2018-01-04

    The goal of the study was to determine the long-term prevalence of combat-related treatment seeking and posttraumatic stress disorder (PTSD) in Israel's veterans deployed to the Second Lebanon War (2006) and "Operation Cast Lead" in the Gaza Strip (2009). The prevalence of treatment seeking and DSM-IV-TR diagnoses among Israel Defense Force (IDF) veterans was assessed using seven and five year's surveillance and records. The whereabouts and combat exposure of veterans during the war was determined based on the IDF's Operations Directorate records. Overall prevalence of treatment seeking was 1.32% and 0.38% in the Second Lebanon War and "Operation Cast Lead", respectively. The prevalence of treatment-seeking veterans from the Second Lebanon War and in "Operation Cast Lead" was significantly higher in soldiers deployed to high combat-exposure zones (2.19% and 3.1%, respectively), relative to low combat-exposure zones (0.24% and 0.06%, respectively), and relative to soldiers deployed elsewhere (0.26% and 0.02%, respectively). PTSD prevalence was similar among treatment-seeking veterans deployed in high combat-exposure zones in both combats. There is a gap of anywhere between 3% and 11% between treatment seeking by IDF veterans following war deployment and the actual prevalence of PTSD in this soldier population.

  11. Kriminaalpolitsei tulevikust / Arved Ant, Rauno Võsaste

    Index Scriptorium Estoniae

    Ant, Arved

    2006-01-01

    Kriminaalpolitsei hetkeolukorrast ja arenguvõimalustest, töökorralduse muutmisest, probleemikesksest tegutsemisest ning kriminaalpolitseinike motiveerimisest. Tabel: Politsei, kaitsepolitsei ja prokuratuuri palgaastmete võrdlustabel

  12. Problems associated with substandard and counterfeit drugs in developing countries: a review article on global implications of counterfeit drugs in the era of antiretroviral (ARVs) drugs in a free market economy.

    Science.gov (United States)

    Nsimba, Stephen E D

    2008-12-01

    To review the global implications associated with the use of substandard and or counterfeit drugs in developing and may be developed countries. The focus of this review is particularly on antiretroviral (ARVs), antimalarials and other drugs. Review of various literatures through Pub-Med, Medline, Google and Internet search to retrieve and download published materials was done by the author of this review paper. When patients receive a counterfeit medicines, they are subjected to multiple risks. They often suffer more than just an inconvenience; as they become victims of fraud medicines and are all put at risk of adverse effects from unprescribed medicines or substandard ingredients. Additionally, patients may lose confidence in health care professionals including their physician and pharmacist, and potentially modern medicine or the pharmaceutical industry in general. Counterfeit or substandard (poor quality) drugs pose threats to society; not only to the individual in terms of the health side effects experienced, but also to the public in terms of trade relations, economic implications, and the effects on global pandemics. It is vital for suppliers, providers, and patients to be aware of current trends in counterfeiting in order to best prepare for encounters with suspicious products. Furthermore, this is an issue that needs to be continually dealt with on national and international policy levels. Developing countries should try their level best to establish good laboratories for monitoring and checking quality of all pharmaceuticals manufactured locally and those imported or donated to these countries. The Ministries of Health and all stakeholders involved in this issue must ensure that all drugs meet the set or established international standards and national standards. Failure to do so will be to misuse the hard earned forex that is normally borrowed from banks for the procurement and distribution of drugs to its people. Indeed sub-standard medications do more

  13. Partner Vetting System - Gaza & West Bank

    Data.gov (United States)

    US Agency for International Development — The PVS WB system supports the vetting of NGOs, their employees, and individuals who apply for USAID contracts, grants, cooperative agreements, or other funding...

  14. Militarism's Killing Fields: From Gaza to Ferguson

    Science.gov (United States)

    Giroux, Henry

    2014-01-01

    Militarization and a military definition of life and culture have become normalized in the United States. This article explores the ways in which a military metaphysics has become the new normal for a nation not only at war abroad but also at home, especially with regards to the ongoing assaults waged by the state against youth, immigrants, and…

  15. IDRC in the West Bank and Gaza

    International Development Research Centre (IDRC) Digital Library (Canada)

    Teenage stress under conflict. Research to promote positive coping mechanisms among Palestinian youth is another way of building peace. Prolonged conflict and political violence have exacerbated normal teenage stress in the West Bank, where adolescents make up nearly half the population. Researchers from.

  16. Le CRDI en Cisjordanie et à Gaza

    International Development Research Centre (IDRC) Digital Library (Canada)

    Stress des adolescents et conflit qui perdure. En Cisjordanie, la violence politique et le conflit qui perdure ont aggravé le stress chez les adolescents, qui constituent près de la moitié de la population. À Ramallah, plus de 3 000 adolescents de 15 à 17 ans ont été interrogés par des chercheurs de l'Université de Birzeit et de ...

  17. Ne boitess nefti i gaza / Andris Piebalgs

    Index Scriptorium Estoniae

    Piebalgs, Andris, 1957-

    2008-01-01

    Euroopa Komisjoni energiapoliitika volinik avaldab veendumust, et ei maksa karta tehinguid Venemaaga energeetika valdkonnas ja arvab, et Vene energiakandjad toovad rohkem kasu kui kahju. Venemaa energiaprojektidest ja -lepingutest Serbia ja Bulgaariaga

  18. Avangardist Lapini arved Nõukogude võimuga / Ants Juske

    Index Scriptorium Estoniae

    Juske, Ants, 1956-2016

    2006-01-01

    Mitmekülgse kunstniku Leonhard Lapini tegemistest 1960-1970. aastatel. Illustratsiooniks iroonilised, vana režiimiga arveid õiendavad tööd sarjast "Märkide konversatsioon: "Suprematism ja sotsialism", "Sõna ja tegu" ja "Molotov-Ribbentrop I"". Siiditrükk, 1990. Eesti Kunstimuuseum

  19. Daginstitutioner som instrument til at bryde social arv

    DEFF Research Database (Denmark)

    Jensen, Bente; Barrett, Barbara Ann; Christoffersen, Mogens

    risikoen for marginalisering mindskes. Samfundets institutioner og tidlig social indsats kan betragtes som steder at sætte ind for at afhjælpe social ulighed, som består i forskelle på adgang til livsmuligheder. Kan vi gennem en bevidst fokusering på tidlig indsats og dagtilbud være med til at bryde ind i...

  20. Influence of Arvs on Some Biochemical Changes in Liver Non ...

    African Journals Online (AJOL)

    Dr. K.J. Umar

    patients as well as the new antiretroviral medications resulted in negative impacts on the clinical outcome of ... with liver disease include old age (Campos et al.,. 2002), female gender (Martín-Carbonero et al., 2003), .... the higher HIV infection in the middle age people among which include their physical strength and high.

  1. Mentaliseringsbegrebet og dets arv fra Freuds begreb om binding

    DEFF Research Database (Denmark)

    Pedersen, Signe Holm

    2011-01-01

    Artiklen undersøger og diskuterer forskelle og ligheder mellem mentaliseringsbegrebet og Freuds bindingsbegreb. Begrebet mentalisering, som betegner en evne til at forholde sig refleksivt til egne og andres mentale tilstande, har indenfor de sidste fem- ti år vundet en central placering i klinisk...... psykologiske teoridannelser. Dets ophavsmænd Fonagy et al. forsøger imidlertid ikke at tage patent på begrebet, men peger på, at en række teoretikere har understreget betydningen af en refleksiv funktion. Alle disse begreber kan ifølge Fonagygruppen føres tilbage til Freuds begreb om binding. På baggrund af en...... udlægning af det oprindelige bindingsbegreb hos Freud, ønskes det i denne artikel at tydeliggøre den grundlæggende forskel på Freuds – og Fonagys subjektopfattelse....

  2. Optical delivery of ARV drugs into HIV-1 permissive cells

    CSIR Research Space (South Africa)

    Khanyile, T

    2013-10-01

    Full Text Available into HIV-1 permissive cells Thulile Khanyile1,2, Maria Papathanasopoulos2, Andrew Forbes1 and Patience Mthunzi1* 1. National Laser Centre, Council for Scientific and Industrial Research, PO Box 395, Pretoria, 0001, South Africa 2. HIV Pathogenesis... perspectives Dr Patience Mthunzi (NLC-CSIR) Prof Maria Papathanasopoulos (Wits) Prof Andrew Forbes (NLC-CSIR) Dr Hazel Mufhandu (Biosciences – CSIR) Dr Dalu Ncama (Biosciences – CSIR) Acknowledgements Thank you ...

  3. hiv testing and arv prophylaxis for newborns without their mothers

    African Journals Online (AJOL)

    2008-06-19

    Jun 19, 2008 ... assault under South African common law as well as an invasion of personal rights.11,12. 2. It therefore follows that the mother could lay a charge of assault on behalf of her child against the doctor who tested and provided medical treatment to the infant without the mother's consent. 3. The mother would ...

  4. factors influencing adherence to arvs among patients attending ...

    African Journals Online (AJOL)

    2014-04-01

    7). Over time, the pandemic ... from three classes: Nucleoside Reverse Transcriptase. Inhibitor (NRTIs), Non- Nucleoside Reverse ... estimated using multiple logistic regression analysis. The dependent outcome variable was ...

  5. Õiglasem ja moodsam ELi arve / Jack Straw

    Index Scriptorium Estoniae

    Straw, Jack

    2005-01-01

    Suurbritannia välisminister selgitab Suurbritannia kui Euroopa Liidu eesistujamaa poolt esitatud ettepanekuid Euroopa Liidu järgmise, 2007.-2013. aasta eelarveperioodi rahastamiskava kohta ning kinnitab, et Suurbritannia on valmis maksma oma osa ühenduse eelarvesse, kuid ainult oma õiglase osa

  6. Anti-retroviral (ARV) rationing schemes in developing countries: a ...

    African Journals Online (AJOL)

    Indeed counterfeit drugs pose many threats to society; not only to the individual in terms of the health side effects experienced, but also to the public in terms of trade relations, economic implications, and the effects on global pandemics. Apart from the pharmaceutical aspect in producing substandard drugs, there area also ...

  7. President Ilves väisas metsapealinna / Arved Breidaks

    Index Scriptorium Estoniae

    Breidaks, Arved, 1975-

    2007-01-01

    President Toomas Hendrik Ilvese lühivisiidist Võrru. President lõunastas Roosisaarel Kuninga talus, külastas Sõmerpalu vallas puidutöötlusettevõtet GM Panels, osales laste metsateemaliste joonistuste näituse avamisel ning istutas Koreli oja äärsele puhkealale kuuse

  8. Debate: HIV testing and ARV prophylaxis for newborns without their ...

    African Journals Online (AJOL)

    Criminal law, constitutional rights and medical ethics (not forgetting common sense) can at times contradict each other, putting medical professionals on the spot. This article is based on a case study discussed on the HIV Policy & Ethics Discussion Forum: http://groups.google. com/group/policy-ethics. Southern African ...

  9. Maksuvõlglaste arv kahanes aastaga protsendi võrra

    Index Scriptorium Estoniae

    2004-01-01

    Maksu- ja tolliameti maksuvõlgade sissenõudmise osakonna juht Raul Siem teeb ülevaate eraisikutest maksumaksjate ja ettevõtete maksuvõlgadest 2004. aastal ning selgitab maksuvõlgade ennetamise ja sissenõudmise protseduuri

  10. Development research in West Bank and Gaza | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-01-11

    Jan 11, 2011 ... Palestinians have been beset by violence, poverty, and social dislocation for more than half a century. At times, imagining transition toward a prosperous peace has seemed fancifully optimistic. Yet change has occurred; progress sometimes follows reversals. And Palestinians have proven themselves ...

  11. West Bank and Gaza | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Besoins en matière de santé reproductive des adolescentes des camps de réfugiés palestiniens : des données aux politiques. Le projet vise à produire des connaissances sur les perceptions et les besoins en matière de services de santé sexuelle et reproductive des adolescentes dans les camps de réfugiés palestiniens ...

  12. Cisjordanie et Gaza | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le conflit qui perdure et la violence politique ont aggravé le stress chez les adolescents, qui constituent près de la moitié de la population de la Cisjordanie. La violence politique et le conflit qui perdure ont aggravé le stress chez les adolescents. Le problème a été analysé dans le cadre de travaux menés en collaboration ...

  13. Hepatitis B and C co-infections in HIV/AIDS patients attending ARV ...

    African Journals Online (AJOL)

    Background: Co-infections of HIV/AIDS with HBV and HCV are emerging as an added burden to the already chaotic protocols of managing HIV/AIDS mono- infection. Objectives: To determine the prevalence of Hepatitis B and C co infections among HIV/AIDS patients in Zaria. Methods: A cross sectional study by which ...

  14. Behavioral Economics Matters for HIV Research: The Impact of Behavioral Biases on Adherence to Antiretrovirals (ARVs)

    Science.gov (United States)

    Stecher, Chad

    2016-01-01

    Behavioral economics (BE) has been used to study a number of health behaviors such as smoking and drug use, but there is little knowledge of how these insights relate to HIV prevention and care. We present novel evidence on the prevalence of the common behavioral decision-making errors of present-bias, overoptimism, and information salience among 155 Ugandan HIV patients, and analyze their association with subsequent medication adherence. 36 % of study participants are classified as present-biased, 21 % as overoptimistic, and 34 % as having salient HIV information. Patients displaying present-bias were 13 % points (p = 0.006) less likely to have adherence rates above 90 %, overoptimistic clients were 9 % points (p = 0.04) less likely, and those not having salient HIV information were 17 % points (p < 0.001) less likely. These findings indicate that BE may be used to screen for future adherence problems and to better design and target interventions addressing these behavioral biases and the associated suboptimal adherence. PMID:25987190

  15. Audiitor kaebas Alta Capitali arve pärast Läti kohtusse / Henrik Ilves

    Index Scriptorium Estoniae

    Ilves, Henrik

    2008-01-01

    Eesti Päevalehe andmetel kaebas rahvusvaheline audiitorfirma Ernst & Young Lätis kohtusse investeerimisfirma Alta Capital, kuna firma ei ole maksnud esitatud arvet. Nõude suuruseks on 4,69 miljonit krooni

  16. Riik võinuks tšehhidele arve saata / Dannar Leitmaa

    Index Scriptorium Estoniae

    Leitmaa, Dannar, 1982-

    2010-01-01

    Eesti kaitseministeeriumi ja Vabadussõja võidusamba püstitanud Tšehhi firma San Souci vahelise esialgse lepingu kohaselt oleks kaitseministeerium võinud firmalt küsida 18 mln. krooni hüvitist, kui firma ei täida oma kohustusi

  17. Social arv, ulighed og dagtilbuds betydning med henblik på mønsterbrydning

    DEFF Research Database (Denmark)

    Jensen, Bente

    i 120 dagtilbud. Programmet har udviklet innovative strategier for professionelles kompetenceudvikling, dvs. et kompetenceudviklingsprogram, der tilbyder deltagerne muligheder for selv at arbejde eksperimenterende med viden om kvalitetsudvikling i dagtilbud, samt værktøjer til at omsætte denne viden...... (uddannelse), og her planlægges innovative strategier for implementering gennem eksperimenter (i praksis). Antagelsen bag programmet er, at en længerevarende og dybtgående tilgang til professionel kompetenceudvikling med fokus på et innovativt perspektiv vil kunne føre til varige fornyelser i dagtilbud og...... undersøgelse af, om modellen for forandring og fornyelse opnår effekt. Resultater viser, at der opnås positive virkninger af professionelles kompetenceudvikling målt på implementering af nye innovative strategier i det pædagogiske arbejde. Teoretisk diskuteres resultaterne i lyset af en begrebsliggørelse om...

  18. Reformierakonna varjatud arved / Kadri Jakobson, Kadrin Karner, Koit Brinkmann ; kommenteerinud Carol Merzin

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2009-01-01

    Riigiprokuratuur leidis, et Jaanus Rahumägi ja Robert Antropov rahastasid oma valimiskampaaniat ise ning tegu ei olnud Reformierakonna kampaaniga. Tabel: Reformierakonna riigikogu valimiskampaaniaga seotud kulud, mida erakond pole deklareerinud

  19. "All I eat is ARVs": the paradox of AIDS treatment interventions in central Mozambique.

    Science.gov (United States)

    Kalofonos, Ippolytos Andreas

    2010-09-01

    The number of people on antiretroviral treatment in Mozambique has increased by over 1,500 percent since it first became free and publicly available in 2004. The rising count of "lives saved" seems to portray a success story of high-tech treatment being provided in one of the poorest contexts in the world, as people with AIDS experience dramatic recoveries and live longer. The "scale-up" has had significant social effects, however, as it unfolds in a region with a complicated history and persistent problems related to poverty. Hunger is the principal complaint of people on antiretroviral treatment. The inability of current interventions to adequately address this issue leads to intense competition among people living with HIV/AIDS for the scarce resources available, undermining social solidarity and the potential for further community action around HIV/AIDS issues. Discourses of hunger serve as a critique of these shortcomings, and of the wider political economy underlying the HIV/AIDS epidemic.

  20. Effect of Antiretroviral Drug (arved) on the Kidney in Albino Rat ...

    African Journals Online (AJOL)

    A total of fifty two (52) albino rats were randomly divided into four groups labeled A, B, C and D and kept in a well ventilated room. All experimental groups shared the same environmental conditions. Group A served as the control and rats were treated with distil water. Rats in groups B, C and D were, respectively treated ...

  1. Behavioral Economics Matters for HIV Research: The Impact of Behavioral Biases on Adherence to Antiretrovirals (ARVs).

    Science.gov (United States)

    Linnemayr, Sebastian; Stecher, Chad

    2015-11-01

    Behavioral economics (BE) has been used to study a number of health behaviors such as smoking and drug use, but there is little knowledge of how these insights relate to HIV prevention and care. We present novel evidence on the prevalence of the common behavioral decision-making errors of present-bias, overoptimism, and information salience among 155 Ugandan HIV patients, and analyze their association with subsequent medication adherence. 36 % of study participants are classified as present-biased, 21 % as overoptimistic, and 34 % as having salient HIV information. Patients displaying present-bias were 13 % points (p = 0.006) less likely to have adherence rates above 90 %, overoptimistic clients were 9 % points (p = 0.04) less likely, and those not having salient HIV information were 17 % points (p behavioral biases and the associated suboptimal adherence.

  2. Lapse saamise ajastamine ja laste arv : sündimustrendid Euroopas / Mare Ainsaar

    Index Scriptorium Estoniae

    Ainsaar, Mare, 1966-

    2011-01-01

    Artiklis näidatakse kuidas sündimuse analüüsiks kasutatavad teooriad aitavad seletada väärtuste, normide ja ressursside mõju sündimuskäitumisele. Aluseks empiirilised andmed Euroopa riikides 2006. a. sündimuse kohta läbi viidud Eurobaromeetri uuringust (Testa 2006)

  3. Serum lipid profile of anti-retroviral (ARV) naïve human ...

    African Journals Online (AJOL)

    Background: Human immunodeficiency virus infection has become pandemic in Nigeria and affects the immune system. Most HIV/ AIDS patients develop multiple metabolic abnormalities including insulin resistance, lipodystrophy and dyslipidemia leading to increased risk of cardiovascular disease (CVD). Objective: To ...

  4. “I will take ARVs once my body deteriorates”: an analysis of Swazi ...

    African Journals Online (AJOL)

    Swaziland has the highest HIV prevalence in the world. To mitigate the spread and devastation caused by HIV and to improve the wellbeing of people living with HIV, the country has adopted the latest available HIV prevention campaigns, including “Test and Start”. Because evidence from randomised controlled trials has ...

  5. Padari määrus tõi maksmata arved ja tigedad ametnikud / Mirko Ojakivi

    Index Scriptorium Estoniae

    Ojakivi, Mirko

    2009-01-01

    Presidendi kantseleil, ministeeriumidel ja teistel riigieelarvest väljamakseid tegevatel asutustel on probleeme seoses väljamaksete piiramisega. Selgitab rahandusministeeriumi pressiesindaja Piret Seeman. Lisatud karikatuur president Toomas Hendrik Ilvesest

  6. Nutrition and health status of HIV-infected adults on ARVs at AMREF ...

    African Journals Online (AJOL)

    A descriptive case study design was used to sample 120 HIV-infected patients using systematic sampling procedure. These patients sought health care from an urban slum, Kibera AMREF clinic. Data were collected by anthropometric measurements, bio-chemical analysis, semi-structured questionnaire and secondary data.

  7. Töötute arv vähenes aastaga viiendiku võrra / Gerli Romanovitsh

    Index Scriptorium Estoniae

    Romanovitš, Gerli, 1977-

    2005-01-01

    Ilmunud ka: Severnoje Poberezhje 8. nov. lk 1. 1. novembri seisuga on tööhõiveametis registreeritud 22 700 töötut, mis moodustab 2,8% tööealisest elanikkonnast. Ida-Virumaal on registreeritud 7178 töötut

  8. Counselling clients to follow 'the rules' of safe sex and ARV treatment

    DEFF Research Database (Denmark)

    Mubanda Rasmussen, Louise

    2013-01-01

    with counsellors. The paper illustrates how counsellors concentrate on giving general behavioural instructions, while clients tend to demonstrate their compliance to these ‘rules’ rather than sharing their more intimate thoughts. This is especially the case in the contested terrain of sexual and reproductive...... of counsellors and the clients' challenges to following the rules....

  9. The Free Provision of ARV Therapy: Is it a Golden Opportunity on a ...

    African Journals Online (AJOL)

    2008-10-07

    Oct 7, 2008 ... evolving over time (Floyd and Gilks, 1998). The lack of political commitment by industrialised nations is another impediment to the ... has money, better infrastructure and a sounder health system; therefore, it has been able to overcome, for instance, its shortage in trained staff, by setting up a training ...

  10. At sælge eller beholde arvesølvet?

    DEFF Research Database (Denmark)

    Karmark, Esben; Beckmann, Suzanne C.

    2009-01-01

    mellem 2003 og 2008 gennemgik det traditionsrige georg Jensen en omfattende og udfordrende corporate re-branding proces. Et case-studie af processen viser, hvordan georg Jensen mødte denne udfordring, som for luksusbrands især består i at balancere mellem historie og fornyelse......mellem 2003 og 2008 gennemgik det traditionsrige georg Jensen en omfattende og udfordrende corporate re-branding proces. Et case-studie af processen viser, hvordan georg Jensen mødte denne udfordring, som for luksusbrands især består i at balancere mellem historie og fornyelse...

  11. Prevalence Of Anaemia In Hiv-Infected Patients At Arv Treatment ...

    African Journals Online (AJOL)

    This is cross sectional descriptive study of HIV- patients receiving treatment at ABUTH treatment center from March 2002 to September 2005. Study process included documenting patients' bio-data, standardized medical history, hematocrit, reticulocyte counts, bone marrow aspirations and biopsy and CD4+T cell counts.

  12. Katkenud liin Tallinnas, katkenud ring Peterburis / Toomas Shalda

    Index Scriptorium Estoniae

    Šalda, Toomas, 1972-

    1999-01-01

    "Estonial" hukkunute mälestuseks püstitatud Villu Jaansoo ja Jorma Mukala mälestusmärk "Katkenud liin" sarnaneb Leningradi blokaadi monumendiga "Katkenud ring" Laadoga kaldal. Küsimuse on tõstatanud Mark Soosaar.

  13. Popkontsert terroriohvrite toetuseks

    Index Scriptorium Estoniae

    2001-01-01

    Muusikakanal VH1, Cablevision ja Miramix Film korraldavad 20.oktoobril televisioonis otse ülekantava kontserdi Madison Square Gardenis New Yorgi terroriaktis hukkunute mälestuseks ja kannatada saanute toetuseks

  14. 15 aasta pärast tapab liiklus enam kui aids / Küllike Rooväli

    Index Scriptorium Estoniae

    Rooväli, Küllike, 1969-

    2004-01-01

    Maailma Terviseorganisatsiooni (WHO) ennustusel on liiklusõnnetustes hukkumine 15 aasta pärast maailmas kolme kõige sagedasema surmapõhjuse hulgas. Eesti on avariides hukkunute arvult maailmas esirinnas. Lisa: Surma põhjused maailmas

  15. Kirik keset küla : Viimsi Püha Jaakobi kirik = Community and Congregation : St. Jacob's Church in Viimsi / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2008-01-01

    Luterlik pühakoda on ühtlasi kõigi merel hukkunute mälestuskirik ja pääsenute tänukirik. Maja ette on paigutatud graniitplaat parvlaeval Estonia hukkunute nimedega. Saal toimib ka galeriipinnana. Autor Martin Aunin, kaasautor Erkki Ristoja. Konstruktor Kristjan Kaares. Interjööri valgustid: Tarmo Luisk. Projekt: 1998, valmis: 2007. Asendi- ja I korruse plaan, 3 värv. välis- ja 2 sisevaadet

  16. GAZA~A .'~ ~UWE HA'~!E VIR [)IE - "RA~SKEI

    African Journals Online (AJOL)

    The Transkeian government plans to build a port at the mouth of the Mngazana river. This new port will be controlled and operated by the government and will handle both imports and exports. It has also been announced that this harbour will be a free port. In this article the author points out why Port St John's was not ...

  17. The Diseased "Terror Tunnels" in Gaza: Israeli Surveillance and the Autoimmunization of an Illiberal Democracy

    Directory of Open Access Journals (Sweden)

    Marouf Hasian, Jr.

    2017-02-01

    Full Text Available This essay provides an ideological critique of the media tropes that have been used by Israeli militarists, politicians, diplomats, and members of the public to characterize Gazan “terror tunnels” as existential threats. The author extends the work of Butler, Derrida, Esposito, and other scholars to illustrate the ways that autoimmunizing rhetorics are used to render precarious the lives of Israelis while erasing the non-combat status of Gazan civilians who are accused of aiding and abetting those who build smuggling tunnels. This focus on the alleged existential danger of the tunnels is used to ward off international criticism of those who accused the Israel Defense Forces (IDF of violating the international humanitarian law principles of distinction, proportionality, necessity, and humanity.

  18. Geology and geochemistry of petroleum and gas. Geologiya i geokhimiya nefti i gaza

    Energy Technology Data Exchange (ETDEWEB)

    Bakirova, A.A.; Tabasaranskii, Z.A.; Bordovskaya, M.V.; Mal' tseva, A.K.

    1982-01-01

    An examination is made of the theoretical and practical aspects of petroleum and gas geology. Information is given on the formation, migration, and accumulation of hydrocarbons in the earth crust as well as the characteristics of their spatial distribution. Also presented are problems in petroleum and gas geochemistry and the characteristics of their compositional change under various geological-geochemical conditions. 23 references, 99 figures, 219 tables.

  19. Child Protection Assessment in Humanitarian Emergencies: Case Studies from Georgia, Gaza, Haiti and Yemen

    Science.gov (United States)

    Ager, Alastair; Blake, Courtney; Stark, Lindsay; Daniel, Tsufit

    2011-01-01

    Objectives: The paper reviews the experiences of conducting child protection assessments across four humanitarian emergencies where violence and insecurity, directly or indirectly, posed a major threat to children. We seek to identify common themes emerging from these experiences and propose ways to guide the planning and implementation of…

  20. Recherche pour le développement — Cisjordanie et Gaza | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    11 janv. 2011 ... Violence, pauvreté et bouleversements sociaux ont été le lot des Palestiniens pendant plus d'un demi-siècle. Au cours de certaines périodes, imaginer que la transition vers un climat de paix et de prospérité puisse être possible semblait relever d'un optimisme illusoire.

  1. How Personality Affects Vulnerability among Israelis and Palestinians following the 2009 Gaza Conflict.

    Science.gov (United States)

    Canetti, Daphna; Kimhi, Shaul; Hanoun, Rasmiyah; Rocha, Gabriel A; Galea, Sandro; Morgan, Charles A

    2016-01-01

    Can the onset of PTSD symptoms and depression be predicted by personality factors and thought control strategies? A logical explanation for the different mental health outcomes of individuals exposed to trauma would seem to be personality factors and thought control strategies. Trauma exposure is necessary but not sufficient for the development of PTSD. To this end, we assess the role of personality traits and coping styles in PTSD vulnerability among Israeli and Palestinian students amid conflict. We also determine whether gender and exposure level to trauma impact the likelihood of the onset of PTSD symptoms. Five questionnaires assess previous trauma, PTSD symptoms, demographics, personality factors and thought control strategies, which are analyzed using path analysis. Findings show that the importance of personality factors and thought control strategies in predicting vulnerability increases in the face of political violence: the higher stress, the more important the roles of personality and thought control strategies. Thought control strategies associated with introverted and less emotionally stable personality-types correlate positively with higher levels of PTSD symptoms and depression, particularly among Palestinians. By extension, because mental health is key to reducing violence in the region, PTSD reduction in conflict zones warrants rethinking.

  2. How Personality Affects Vulnerability among Israelis and Palestinians following the 2009 Gaza Conflict.

    Directory of Open Access Journals (Sweden)

    Daphna Canetti

    Full Text Available Can the onset of PTSD symptoms and depression be predicted by personality factors and thought control strategies? A logical explanation for the different mental health outcomes of individuals exposed to trauma would seem to be personality factors and thought control strategies. Trauma exposure is necessary but not sufficient for the development of PTSD. To this end, we assess the role of personality traits and coping styles in PTSD vulnerability among Israeli and Palestinian students amid conflict. We also determine whether gender and exposure level to trauma impact the likelihood of the onset of PTSD symptoms. Five questionnaires assess previous trauma, PTSD symptoms, demographics, personality factors and thought control strategies, which are analyzed using path analysis. Findings show that the importance of personality factors and thought control strategies in predicting vulnerability increases in the face of political violence: the higher stress, the more important the roles of personality and thought control strategies. Thought control strategies associated with introverted and less emotionally stable personality-types correlate positively with higher levels of PTSD symptoms and depression, particularly among Palestinians. By extension, because mental health is key to reducing violence in the region, PTSD reduction in conflict zones warrants rethinking.

  3. Engineering soya bean seeds as a scalable platform to produce cyanovirin-N, a non-ARV microbicide against HIV.

    Science.gov (United States)

    O'Keefe, Barry R; Murad, André M; Vianna, Giovanni R; Ramessar, Koreen; Saucedo, Carrie J; Wilson, Jennifer; Buckheit, Karen W; da Cunha, Nicolau B; Araújo, Ana Claudia G; Lacorte, Cristiano C; Madeira, Luisa; McMahon, James B; Rech, Elibio L

    2015-09-01

    There is an urgent need to provide effective anti-HIV microbicides to resource-poor areas worldwide. Some of the most promising microbicide candidates are biotherapeutics targeting viral entry. To provide biotherapeutics to poorer areas, it is vital to reduce the cost. Here, we report the production of biologically active recombinant cyanovirin-N (rCV-N), an antiviral protein, in genetically engineered soya bean seeds. Pure, biologically active rCV-N was isolated with a yield of 350 μg/g of dry seed weight. The observed amino acid sequence of rCV-N matched the expected sequence of native CV-N, as did the mass of rCV-N (11 009 Da). Purified rCV-N from soya is active in anti-HIV assays with an EC50 of 0.82-2.7 nM (compared to 0.45-1.8 nM for E. coli-produced CV-N). Standard industrial processing of soya bean seeds to harvest soya bean oil does not diminish the antiviral activity of recovered rCV-N, allowing the use of industrial soya bean processing to generate both soya bean oil and a recombinant protein for anti-HIV microbicide development. © 2015 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  4. Aastaga kasvas töötute arv ametliku statistika järgi 45% / Agnes Ojala

    Index Scriptorium Estoniae

    Ojala, Agnes

    2008-01-01

    Tööturuametis on registreeritud 18 775 töötut, s.o. 2,9% tööealistest inimestest. Hoolimata töötute arvu kasvust on neid praegu vähem kui 2003. või 2004. aastal. Konjunktuuriinstituudi direktor Marje Josing peab 2,9% töötuse määra marginaalseks. Lisa: Töötukassas veelgi enam abivajajaid

  5. Fastklemt nerve som årsag til svære postoperative smerter fra arvæv

    DEFF Research Database (Denmark)

    Møller, Michael; Venzo, Alessandro

    2014-01-01

    Entrapment of a cutaneous nerve in a surgical scar may cause chronic post-operative pain. The condition presents with similar symptoms as a traumatic neuroma or as an anterior cutaneous nerve entrapment syndrome, which, however, is often idiopathic. We present a case, where entrapment of a cutane...... of a cutaneous nerve in a laparotomy scar caused chronic pain. The symptoms were immediately relieved after selective neurectomy....

  6. Genetic variability of Candida albicans in HIV/AIDS patient with and without ARV therapy and non HIV/AIDS

    OpenAIRE

    Rahayu, Retno Puji; P, Widiyanti; M, Arfijanto

    2012-01-01

    Background: Oral candidiasis is the mostly found oral manifestation in HIV/AIDS infected patient caused by immunocompromised especially immunodeficiency. Clinical symptoms is severe pain in oral cavity and dry mouth because of xerostomia which cause the loss of appetite. Candida albicans (C. albicans) is normal flora in oral cavity which plays as opportunistic pathogen and also the cause of oral candidiasis. Almost 90% of HIV–infected patient have oral candidiasis. This condition is clinical ...

  7. Pharmaceutical Equivalence of Distributed Generic Antiretroviral (ARV) in Asian Settings: The Cross-Sectional Surveillance Study - PEDA Study

    NARCIS (Netherlands)

    Sapsirisavat, Vorapot; Vongsutilers, Vorasit; Thammajaruk, Narukjaporn; Pussadee, Kanitta; Riyaten, Prakit; Kerr, Stephen; Avihingsanon, Anchalee; Phanuphak, Praphan; Ruxrungtham, Kiat

    2016-01-01

    Ensuring that medicines meet quality standards is mandatory for ensuring safety and efficacy. There have been occasional reports of substandard generic medicines, especially in resource-limiting settings where policies to control quality may be less rigorous. As HIV treatment in Thailand depends

  8. Genome sequences of SAT 2 foot-and-mouth disease viruses from Egypt and Palestinian Autonomous Territories (Gaza Strip).

    Science.gov (United States)

    Valdazo-González, Begoña; Knowles, Nick J; Hammond, Jef; King, Donald P

    2012-08-01

    Two foot-and-mouth disease virus (FMDV) genome sequences have been determined for isolates collected from recent field outbreaks in North Africa (Egypt) and the Middle East (Palestinian Autonomous Territories). These data represent the first examples of complete genomic sequences for the FMDV SAT 2 topotype VII, which is thought to be endemic in countries immediately to the south of the Sahara desert. Further studies are now urgently required to provide insights into the epidemiological links between these outbreaks and to define the pathogenicity of this emerging lineage.

  9. Air Operations in Israel’s War Against Hezbollah: Learning from Lebanon and Getting It Right in Gaza

    Science.gov (United States)

    2011-01-01

    Lebanon, as well as hidden away in metal-lined underground tunnels and bunkers with entrances covered by metal lids and disguised with leaves and...event and milked the errant attack for every ounce of propaganda value. To cite just two examples, the Arab News in Saudi Arabia ran a headline that

  10. HLA-G and HLA-E Gene polymorphisms in idiopathic recurrent spontaneous abortion women in Gaza strip-Palestine

    OpenAIRE

    Tamam F. Matter; Fadel A. Sharif

    2013-01-01

    Human leukocyte antigens (HLA)-G and HLA-E are non-classical HLA class I antigens expressed on extravillous cytotrophoblast that invades decidua in the uterus during pregnancy and are postulated to help in maternal immunotolerance of the fetus. Published results on the relation between HLA-G and HLA-E polymorphisms and unexplained recurrent spontaneous abortion (RSA) are, however, controversial. This study was initiated in order to investigate whether HLA-G (G*0103, G*0104 and G0105N) and HLA...

  11. Shoulder Pain among Rehabilitated Spinal Cord Injured Persons Using Manually Propelled Wheelchairs in the Gaza Strip: A Survey

    OpenAIRE

    Ziad Al Hawamdah; Jadallah M El-Shafie; Khamis El Essi; Sami I Zaqout

    2012-01-01

    Shoulder pain among paraplegic persons has negative effects on their lives. The prevalence of shoulder pain among persons with spinal cord injury (SCI) varies from 30% to 70% in different studies and may be related to repetitive use of the shoulder during self-care and wheelchair-related activities. Purpose: This study focused on the prevalence of shoulder pain and examined its effects on activities of daily living and social participation, and on functional, work and recreational or athletic...

  12. Attitudes of Palestinian Health-Care Professionals in Gaza to Clinical Practice Guideline for Diagnosis and Treatment of Diabetes Mellitus

    Directory of Open Access Journals (Sweden)

    Mahmoud Radwan

    2017-10-01

    Full Text Available BackgroundDespite the huge numbers of the internationally produced and implemented Clinical Practice Guidelines (CPGs, the compliance with them is still low in health care. This study aimed at assessing the attitudes of Palestinian health-care professionals toward the most perceived factors influencing the adherence to the CPG for Diabetes Mellitus in the Primary Health-care centers of the Ministry of Health (PHC-MoH and the Primary Health-care centers of the United Nations Relief and Works Agency for Palestine Refugees (PHC-UNRWA using a validated questionnaire.MethodsA cross-sectional design was employed with a census sample of all Palestinian family doctors and nurses (n = 323. The Cabana theoretical framework was used to develop a study questionnaire. A cross cultural adaptation framework was followed to develop the Arabic version questionnaire. The psychometric properties of Arabic version were finally assessed.ResultsThe Arabic version questionnaire showed a good construct validity and internal consistency reliability. The overall adherence level to the diabetic guideline was disappointingly suboptimal 51.5% (47.3% in the PHC-MoH and 55.5% in the PHC-UNRWA P = 0.000. The most frequently perceived barriers in the PHC-MoH were lack of incentives, lack of resources, and lack of guideline trustworthiness, whereas the lack of time and the lack of guideline trustworthiness were the most prominent barriers in the PHC-UNRWA. In spite of the lack of trustworthiness of the diabetic guideline, most respondents in both settings had a positive attitude toward guidelines in general, but this attitude was not a predictor of guideline adherence.ConclusionThe good validity and reliability of our questionnaire can provide support for the accuracy of our findings. Multifaceted implementation strategies targeting the main barriers elicited from this study are required for addressing the lack of incentives, organizational resources, lack of confidence in the guideline, and time constraints.

  13. Correlation of Adherence by Pill Count, Self-report, MEMS and Plasma Drug Levels to Treatment Response Among Women Receiving ARV Therapy for PMTCT in Kenya.

    Science.gov (United States)

    Mudhune, Victor; Gvetadze, Roman; Girde, Sonali; Ndivo, Richard; Angira, Frank; Zeh, Clement; Thomas, Timothy; Lecher, Shirley Lee

    2018-03-01

    Success of antiretroviral therapy depends on adherence to effective treatment. We evaluated four adherence methods and their correlation with immunological and virologic response among women receiving PMTCT. Univariable and multivariable analyses were used to assess how adherence by pill count (n = 463), self-report (n = 463), MEMS (n = 129) and plasma drug level (n = 89) was associated with viral load suppression within a 6 months period. Longitudinal analysis was performed to determine the correlation of CD4 cell count with each measure of adherence. For all measures of adherence, sustained viral suppression was less likely for participants in the lowest category of adherence. Although CD4 cell count increased substantially over time, there was no significant association with adherence by the methods. Multiple strategies can be used successfully to monitor treatment adherence. Persons with ≥95% adherence by any method used in this study were more likely to have a favorable treatment outcome.

  14. Pharmacogenetic & pharmacokinetic biomarker for efavirenz based ARV and rifampicin based anti-TB drug induced liver injury in TB-HIV infected patients.

    Directory of Open Access Journals (Sweden)

    Getnet Yimer

    Full Text Available BACKGROUND: Implication of pharmacogenetic variations and efavirenz pharmacokinetics in concomitant efavirenz based antiviral therapy and anti-tubercular drug induced liver injury (DILI has not been yet studied. We performed a prospective case-control association study to identify the incidence, pharmacogenetic, pharmacokinetic and biochemical predictors for anti-tubercular and antiretroviral drugs induced liver injury (DILI in HIV and tuberculosis (TB co-infected patients. METHODS AND FINDINGS: Newly diagnosed treatment naïve TB-HIV co-infected patients (n = 353 were enrolled to receive efavirenz based ART and rifampicin based anti-TB therapy, and assessed clinically and biochemically for DILI up to 56 weeks. Quantification of plasma efavirenz and 8-hydroxyefaviernz levels and genotyping for NAT2, CYP2B6, CYP3A5, ABCB1, UGT2B7 and SLCO1B1 genes were done. The incidence of DILI and identification of predictors was evaluated using survival analysis and the Cox Proportional Hazards Model. The incidence of DILI was 30.0%, or 14.5 per 1000 person-week, and that of severe was 18.4%, or 7.49 per 1000 person-week. A statistically significant association of DILI with being of the female sex (p = 0.001, higher plasma efavirenz level (p = 0.009, efavirenz/8-hydroxyefavirenz ratio (p = 0.036, baseline AST (p = 0.022, ALT (p = 0.014, lower hemoglobin (p = 0.008, and serum albumin (p = 0.007, NAT2 slow-acetylator genotype (p = 0.039 and ABCB1 3435TT genotype (p = 0.001. CONCLUSION: We report high incidence of anti-tubercular and antiretroviral DILI in Ethiopian patients. Between patient variability in systemic efavirenz exposure and pharmacogenetic variations in NAT2, CYP2B6 and ABCB1 genes determines susceptibility to DILI in TB-HIV co-infected patients. Close monitoring of plasma efavirenz level and liver enzymes during early therapy and/or genotyping practice in HIV clinics is recommended for early identification of patients at risk of DILI.

  15. Absence of XMRV in Peripheral Blood Mononuclear Cells of ARV-Treatment Naïve HIV-1 Infected and HIV-1/HCV Coinfected Individuals and Blood Donors

    Science.gov (United States)

    Vigil, Karen J.; Vey, Elana; Arduino, Roberto C.; Kimata, Jason T.

    2012-01-01

    Background Xenotropic murine leukemia virus-related virus (XMRV) has been found in the prostatic tissue of prostate cancer patients and in the blood of chronic fatigue syndrome patients. However, numerous studies have found little to no trace of XMRV in different human cohorts. Based on evidence suggesting common transmission routes between XMRV and HIV-1, HIV-1 infected individuals may represent a high-risk group for XMRV infection and spread. Methodology/Principal Findings DNA was isolated from the peripheral blood mononuclear cells (PBMCs) of 179 HIV-1 infected treatment naïve patients, 86 of which were coinfected with HCV, and 54 healthy blood donors. DNA was screened for XMRV provirus with two sensitive, published PCR assays targeting XMRV gag and env and one sensitive, published nested PCR assay targeting env. Detection of XMRV was confirmed by DNA sequencing. One of the 179 HIV-1 infected patients tested positive for gag by non-nested PCR whereas the two other assays did not detect XMRV in any specimen. All healthy blood donors were negative for XMRV proviral sequences. Sera from 23 HIV-1 infected patients (15 HCV+) and 12 healthy donors were screened for the presence of XMRV-reactive antibodies by Western blot. Thirteen sera (57%) from HIV-1+ patients and 6 sera (50%) from healthy donors showed reactivity to XMRV-infected cell lysate. Conclusions/Significance The virtual absence of XMRV in PBMCs suggests that XMRV is not associated with HIV-1 infected or HIV-1/HCV coinfected patients, or blood donors. Although we noted isolated incidents of serum reactivity to XMRV, we are unable to verify the antibodies as XMRV specific. PMID:22348082

  16. 1. mail avaneb Saksamaa ja Austria tööturg idaeurooplastele. Uute tulijate arv jääb tagasihoidlikuks / Katri Soe-Surén

    Index Scriptorium Estoniae

    Soe-Surén, Katri

    2011-01-01

    Saksa tööturueksperdi Kaus F. Zimmermanni hinnangul on 1. maist Saksamaale tööd otsima tulevate idaeurooplaste hulk väike - need, kes on tahtnud piiri taha tööle minna, on seda juba teinud. Tema arvates tegi Saksamaa vea, sulgedes idaeurooplastele 2004. a. tööturu

  17. The Napoleon Graves / Michael Tarm

    Index Scriptorium Estoniae

    Tarm, Michael

    2002-01-01

    Vilniuse lähedal leiti 1812. a. Isamaasõjas hukkunud prantsuse sõdurite matmispaik. Säilmete antropoloogilised uuringud võimaldavad kindlaks määrata hukkunute vanuse, soo ja tõenäolise surma põhjuse

  18. Hollywood lõikab filmidest purunenud torne välja / Malle Pajula

    Index Scriptorium Estoniae

    Pajula, Malle, 1971-

    2001-01-01

    Seoses 11. septembri terrorirünnakuga lõigatakse ekraanile tulevatest filmidest välja lõike, mis kujutavad tänaseks kokku varisenud Kaubanduskeskuse torne ning hoitakse kinni esilinastusi, mis võiksid olla liiga valusad hukkunute omastele

  19. Suvemuusika : Oramo ja Kaljuste / Igor Garshnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    1999-01-01

    25. augustil Estonia kontserdisaalis toimunud Birmingami SO kontserdist. Kavas G. Benjamini "Sudden Times", Sibeliuse Viiulikontsert ja Brahmsi 2. sümfoonia. 26. augustil Tallinnas endise tselluloosivabriku katlamajas toimunud kontserdist ja videosalvestusest, kus kanti ette Mozarti "Reekviem" Kosovos hukkunute mälestuseks

  20. Juudi sõduri aitas vabadusse sakslaste "härra Hezbollah" / Kadri Veermäe

    Index Scriptorium Estoniae

    Veermäe, Kadri

    2011-01-01

    Iisrael sõlmis Gaza sektorit kontrolliva rühmitusega Hamas leppe, mille raames Iisrael vabastab 1000 Palestiina vangi kui Hamas vabastab 2006. aastal Gaza mässuliste poolt vangistatud Gilad Shaliti. Noore miinipilduri pikaajaline vangistus

  1. Socioeconomic status and chronic disease in Palestinians living in and outside refugee camps in the West Bank and the Gaza Strip

    DEFF Research Database (Denmark)

    Jonassen, Marie; Shaheen, Amira; Duraidi, Mohammed

    2018-01-01

    Background: People living in the occupied Palestinian territory have high levels of poverty and unemployment and low educational level. The aim of this study was to investigate the association between socioeconomic status and self-reported chronic disease and to determine whether this association...... and 2010. Educational level, wealth, and employment status were used as measures of socioeconomic status. Participants reporting a diagnosis and treatment for at least one chronic disease were categorised as having a chronic disease. We used logistic regression models to estimate the association between...... socioeconomic status and chronic disease and to compare the prevalence of chronic disease between Palestinians living in or outside refugee camps adjusted by socioeconomic status. Findings: The sample included 38 888 participants. Associations between all measures of socioeconomic status and chronic disease...

  2. The Demand for Antiretroviral Drugs in the Illicit Marketplace: Implications for HIV Disease Management Among Vulnerable Populations.

    Science.gov (United States)

    Tsuyuki, Kiyomi; Surratt, Hilary L; Levi-Minzi, Maria A; O'Grady, Catherine L; Kurtz, Steven P

    2015-05-01

    The diversion of antiretroviral medications (ARVs) has implications for the integrity and success of HIV care, however little is known about the ARV illicit market. This paper aimed to identify the motivations for buying illicit ARVs and to describe market dynamics. Semi-structured interviews (n = 44) were conducted with substance-involved individuals living with HIV who have a history of purchasing ARVs on the street. Grounded theory was used to code and analyze interviews. Motivations for buying ARVs on the illicit market were: to repurchase ARVs after having diverted them for money or drugs; having limited access or low quality health care; to replace lost or ruined ARVs; and to buy a back-up stock of ARVs. This study identified various structural barriers to HIV treatment and ARV adherence that incentivized ARV diversion. Findings highlight the need to improve patient-provider relationships, ensure continuity of care, and integrate services to engage and retain high-needs populations.

  3. Iraak sihikul : veriste rusude kohal kerkib teistsugune riik / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2006-01-01

    Iraagis kujunenud olukorrast. Autori väitel ei usu enam peaaegu keegi võimalusse purustada mässulisi Iraagis sõjalise jõuga, vastupanuvõitlus USA okupatsiooni vastu on laienenud kahe kogukonna vaheliseks verevalamiseks. Hukkunute arvust. Vt. samas: Shiiitide sõjakas juht al-Sadri suurendab Iraagis oma võimu; Rahukolle Kurdistan ei rutta iseseisvuma. Lisad: Sunniitide vägivaldne kolmnurk; Iraagi naabrid kaitsevad kiivalt oma huve

  4. Etat nutritionnel des enfants âgés de 6 à 59 mois infectés par le VIH mais non traités aux ARV à Lubumbashi

    Science.gov (United States)

    Mwadianvita, Costa Kazadi; Kanyenze, Faustin Ngoy; Wembonyama, Cecile Watu; Mutomb, Florence Mujing A; Mupoya, Kalombo; Nkoy, Albert Mwembo–Tambwe A; Mwenze, Prosper Kalenga

    2014-01-01

    Introduction L'infection par le VIH provoque et/ou aggrave les déficits nutritionnels de l'enfant. Ce travail avait pour objectif d'analyser l’état nutritionnel des enfants infectés par le VIH à Lubumbashi. Méthodes Une étude transversale portant sur 83 enfants âgés de 6 à 60 mois s'est déroulée de mai 2010 à mai 2011 dans trois(3) centres de prise en charge des Personnes Vivant avec le VIH(PVV), notamment le Centre d'Excellence(CE) de l'hôpital Sendwe, le Centre Amo-Congo de la Kenya et le Centre de Référence de la Kenya. Les statistiques descriptives usuelles ont été utilisées. Résultats La prévalence de la malnutrition globale était de 60,2% (n = 50) dont 8,4% de malnutrition sévère. Le poids moyen était de 11,6±4,1 kg avec un minimum de 5 kg et un maximum de 22 kg. Le taux d'hémoglobine moyen était d'environ 9,8± 2,0 g/dl avec une prévalence globale de l'anémie (hémoglobine VIH. La survenue de l'anémie n’était pas associée au déficit nutritionnel (p = 0,6). Conclusion Ces résultats révèlent que l'infection à VIH modifie l’état nutritionnel des enfants à Lubumbashi avec 60,2% de malnutrition globale et 8,4% de retard de croissance. Les enfants au stade avancé de l'infection à VIH en sont plus affectés. PMID:25574336

  5. Evaluation des indicateurs d’alerte précoce de la résistance du VIH aux ARV en Côte d’Ivoire en 2011

    Science.gov (United States)

    Yao, Kouadio Jean; Damey, Néto Florence; Konan, Diby Jean Paul; Aka, Joseph; Aka-Konan, Sandrine; Ani, Alex; Bonle, Marguerite Te; Kouassi, Dinard

    2016-01-01

    Introduction En 2001, l'Organisation des Nations Unies recommandait de rendre disponible les médicaments antirétroviraux dans les pays à ressources limitées. Cependant, l'utilisation de ces médicaments à grande échelle s'accompagne du développement de résistance du virus. En Côte d'Ivoire, plusieurs sites prescrivent les antirétroviraux. Cette étude avait pour objectif d'évaluer les facteurs programmatiques associés à un risque élevé d'émergence de résistance du VIH aux antirétroviraux. Méthodes Il s'agit d'une cohorte rétrospective sur 20 sites de prise en charge des personnes vivant avec le VIH. La population d'étude était constituée des personnes ayant initié leur traitement antirétroviral sur les sites en 2008-2009. L'estimation de la taille de l'échantillon a été faite à partir de la stratégie d'échantillonnage de l'OMS. Résultats Sur 20 sites, 98% des prescriptions initiales étaient conformes aux directives nationales et 20% des sites avaient 100% de prescriptions conformes. Au total, 33% des patients étaient perdus de vue au cours des 12 premiers mois de traitement antirétroviral et 20% des sites avaient moins de 20% de perdus de vue. A 12 mois, 51% des patients demeuraient sous traitement de première intention approprié et 11% des sites ont atteint le seuil d'au moins 70% de patients sous traitement de première intention approprié. Un seul site n'a pas connu de rupture d'antirétroviraux sur les 12 mois. Conclusion Des insuffisances relevées dans la prise en charge des personnes vivant avec le VIH traduisent l'existence d'un risque important de résistance du virus aux antirétroviraux en 2008-2009. Pour minimiser ce risque les pratiques de prescription devraient être améliorées, un système de recherche des absents aux rendez-vous devrait être mis en place et la disponibilité constante des antirétroviraux devraient être assurée. PMID:28250876

  6. Üle poolte tööõnnetuste salatakse maha / Gert D. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D.

    2008-01-01

    Tööõnnetuste tegelik arv võib olla üle kahe korra suurem ametlikust statistikast. Vt. samas: Diagramm: Tööõnnetuste arv; Tööõnnetused erinevates riikides; Sotsiaalministeeriumi kommentaar; Põhjuseks liigne utsitamine ja stress

  7. Eesti maksusüsteem liitumisel Euroopa Liiduga / Olev Raju

    Index Scriptorium Estoniae

    Raju, Olev, 1948-

    2004-01-01

    Ülevaade Eesti maksusüsteemi kujunemisest ja makromajanduslikust toimest alates 1993. aastast. Tabelid: Eesti majanduse arengut iseloomustavaid arve 1998-2003; Ettevõtte tulumaksu iseloomustavaid arve Ida-Euroopa maades (2002)

  8. Vene turist tooks raha meeleldi Eestisse / Aivar Reinap, Helve Laasik

    Index Scriptorium Estoniae

    Reinap, Aivar, 1968-

    2000-01-01

    Keerulised viisatingimused peletavad Vene turiste Eestist eemale. Tabelid: Eestit külastanud turistide arv, s.h. Soome ja Vene turistide arv, venelaste reisisihid. Kommenteerivad: J. Ligi, Y. Vanhanen, H. Tiido. Parlamendisaadik (J. Ligi)

  9. Nutritional status of HIV-infected adults on antiretroviral therapy and ...

    African Journals Online (AJOL)

    2010-05-04

    infected adults older than 18 years of age, on ARV therapy at ARV roll-out centres in Kimberley, Upington, Kuruman, Prieska and Springbok, who gave ... Patients with active tuberculosis, known allergy to soy protein, those refusing.

  10. V semju - po rebjonku i grazhdanstvo za zaslugi / Anna Litvinjuk

    Index Scriptorium Estoniae

    Litvinjuk, Anna

    2005-01-01

    Rahvastikuminister Paul-Eerik Rummo tegi kokkuvõtteid möödunud aastast. Perekond traditsioonilises mõistes ja vabaabielus sündinud lapsed, kasvab Eestist lahkuvate noorte naiste arv, suureneb naturalisatsiooni kaudu kodakondsuse saanute arv

  11. Tasulise autoveo tegevusluba ja sõidukikaart : [nõuded, vastutavad isikud, kehtivusaeg

    Index Scriptorium Estoniae

    2005-01-01

    Nõuded, vastutavad isikud, kehtivusaeg. Lisa: Tegevusloa ja sõidukikaardita korraldatavate vedude loetelu ; Kehtivate sõidukikaartide ja veoseveo ettevõtete arv maakonniti seisuga november 2005 ; Sõidukikaartide (SK) arv sõitjate- ja veoseveol maakonniti seisuga november 2005

  12. A clinical assessment of antiretroviral-treated patients Referred from ...

    African Journals Online (AJOL)

    HAART) on the immunological, virological and clinical status of two groups of patients in the South African government antiretroviral (ARV) programme in KwaZulu-Natal, viz. patients previously treated with ARVs in the private sector and then ...

  13. Evolving Human Rights and the Science of Antiretroviral Medicine

    OpenAIRE

    Kavanagh, Matthew; Cohn, Jennifer; Mabote, Lynette; Meier, Benjamin Mason; Williams, Brian; Russell, Asia; Sikwese, Kenly; Baker, Brook

    2015-01-01

    Recent years have seen significant advances in the science of using antiretroviral medicines (ARVs) to fight HIV. Where not long ago ARVs were used late in disease to prevent sick people from dying, today people living with HIV can use ARVs to achieve viral suppression early in the course of disease. This article reviews the mounting new scientific evidence of major clinical and prevention ARV benefits. This has changed the logic of the AIDS response, eliminating competition between "treatmen...

  14. Antiretroviral drug resistance: A guide for the southern African clinician

    African Journals Online (AJOL)

    Both private and public sector see a bewildering clinical array of patients taking failing antiretroviral (ARV) regimens. We intend this article to provide a practical guide to help clinicians understand and manage ARV drug resistance in an African context. ARV resistance is a rapidly evolving field, requiring expertise in dealing ...

  15. The Keiskamma AIDS treatment programme: evaluation of a ...

    African Journals Online (AJOL)

    This paper documents the outcomes of the first 174 patients enrolled in a recently established community-based antiretroviral (ARV) treatment programme. Many people are living with HIV/AIDS and are in need of ARVs. Access to ARVs can pose many logistical difficulties for poor and sick persons, particularly in rural areas.

  16. Do national drug policies influence antiretroviral drug prices? Evidence from the Southern African Development community.

    Science.gov (United States)

    Liu, Yao; Galárraga, Omar

    2017-03-01

    The efficacy of low- and middle-income countries’ (LMIC) national drug policies in managing antiretroviral (ARV) pharmaceutical prices is not well understood. Though ARV drug prices have been declining in LMIC over the past decade, little research has been done on the role of their national drug policies. This study aims to (i) analyse global ARV prices from 2004 to 2013 and (ii) examine the relationship of national drug policies to ARV prices. Analysis of ARV drug prices utilized data from the Global Price Reporting Mechanism from the World Health Organization (WHO). Ten of the most common ARV drugs (first-line and second-line) were selected. National drug policies were also assessed for 12 countries in the South African Development Community (SADC), which self-reported their policies through WHO surveys. The best predictor of ARV drug price was generic status—the generic versions of 8 out of 10 ARV drugs were priced lower than branded versions. However, other factors such as transaction volume, HIV prevalence, national drug policies and PEPFAR/CHAI involvement were either not associated with ARV drug price or were not consistent predictors of price across different ARV drugs. In the context of emerging international trade agreements, which aim to strengthen patent protections internationally and potentially delay the sale of generic drugs in LMIC, this study shines a spotlight on the importance of generic drugs in controlling ARV prices. Further research is needed to understand the impact of national drug policies on ARV prices.

  17. Euroopa panganduse arengusuunad / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2000-01-01

    Euroopa Liidu liikmesriikides on pankade arv ajavahemikus 1994-1997 10% võrra vähenenud, kuid samaaegselt on krediidiinstitutsioonide kohalike allüksuste arv 8% võrra kasvanud ja teenistujate arv suhteliselt muutumatuks jäänud. Tabel: Ülevaade Euroopa Majandusruumi finantsinstitutsioonide arvust, filiaalidest ja töötajatest

  18. Kümnendik Euroopa pankadest kadunud / Lembo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2000-01-01

    EL-15-riikides on pankade arv ajavahemikus 1994 kuni 1997 vähenenud 10%, kuid samal ajal on krediidiinstitutsioonide kohalike allüksuste arv kasvanud 8% ja teenistujate arv jäänud suhteliselt muutumatuks. Tabel: ülevaade Eesti pangandusmaastikust

  19. Improving access to antiretrovirals in rural South Africa – a call to ...

    African Journals Online (AJOL)

    Improving access to antiretrovirals in rural South Africa – a call to action. South Africa (SA) already has the world's biggest antiretroviral (ARV) programme. With the introduction of extended criteria for initiating ARVs, the National Department of Health (NDoH) wishes to increase the number of people on ARVs by around.

  20. Masu peletas teatritest külastajad / Mirko Ojakivi

    Index Scriptorium Estoniae

    Ojakivi, Mirko

    2011-01-01

    Kultuuriministeeriumi 2010. a. tegevusülevaatest selgub, et teatrikülastuste arv on kahanenud, kinokülastuste arv kasvanud. Teatrid on olnud sunnitud tõstma piletite hindu, keskmine kinopileti hind aga langes. Kasvanud on raamatukogukülastajate arv, eestikeelsete trükiste tiraažid vähenevad

  1. Palvetaks õige president Bushi eest? / Hans H. Luik

    Index Scriptorium Estoniae

    Luik, Hans H., 1961-

    2008-01-01

    USA kohtus pole arutusele võetud ühtegi 2001. aasta 11. septembril hukkunute lähedaste hagi. Kui kohus hakkaks asja sisuliselt arutama, peaks valitsus esitama tõendeid, mida katastroofi kohta on kogutud. Muuhulgas on juttu ka artikli autori nelja aasta tagusest kihlveost Toomas Hendrik Ilvesega, kes oli tollal Euroopa Parlamendi väliskomisjoni aseesimees. T. H. Ilves vedas kihla, et suudab leida liikuva pildi või foto sellest, kuidas Boeing 757 sõidab 11. septembril 2001 sisse USA sõjaministeeriumi hoonesse, kuid kaotas kihlveo

  2. Global strategies to reduce the price of antiretroviral medicines: evidence from transactional databases.

    Science.gov (United States)

    Waning, Brenda; Kaplan, Warren; King, Alexis C; Lawrence, Danielle A; Leufkens, Hubert G; Fox, Matthew P

    2009-07-01

    To estimate the impact of global strategies, such as pooled procurement arrangements, third-party price negotiation and differential pricing, on reducing the price of antiretrovirals (ARVs), which currently hinders universal access to HIV/AIDS treatment. We estimated the impact of global strategies to reduce ARV prices using data on 7253 procurement transactions (July 2002-October 2007) from databases hosted by WHO and the Global Fund to Fight AIDS, Tuberculosis and Malaria. For 19 of 24 ARV dosage forms, we detected no association between price and volume purchased. For the other five ARVs, high-volume purchases were 4-21% less expensive than medium- or low-volume purchases. Nine of 13 generic ARVs were priced 6-36% lower when purchased under the Clinton Foundation HIV/AIDS Initiative (CHAI). Fifteen of 18 branded ARVs were priced 23-498% higher for differentially priced purchases compared with non-CHAI generic purchases. However, two branded, differentially priced ARVs were priced 63% and 73% lower, respectively, than generic non-CHAI equivalents. Large purchase volumes did not necessarily result in lower ARV prices. Although current plans for pooled procurement will further increase purchase volumes, savings are uncertain and should be balanced against programmatic costs. Third-party negotiation by CHAI resulted in lower generic ARV prices. Generics were less expensive than differentially priced branded ARVs, except where little generic competition exists. Alternative strategies for reducing ARV prices, such as streamlining financial management systems, improving demand forecasting and removing barriers to generics, should be explored.

  3. Christian theology of life, death and healing in an era of antiretroviraltherapy: reflections on the responses of some Botswana churches.

    Science.gov (United States)

    Togarasei, Lovemore

    2010-12-01

    This article discusses Christian understandings of life, death and healing in the context of antiretroviral (ARV) therapy. The discussion is a response to the reactions of some Botswana Pentecostal and African Independent Churches to the availability of ARV therapy, as reflected in several media reports of churches discouraging church members' use of ARV drugs. The article argues that this negative attitude to ARVs is a result of the Christian churches' understandings of life, death and healing through traditional Bible-based interpretations. Based on this, some churches view the ability of ARVs to prolong life as challenging God who is the source of life and healing. The article argues that this attitude grows from an initial Christian understanding of HIV and AIDS as a form of God's punishment on humanity for its sins. The article thus argues for the development of 'a Christian theology of ARVs' that sees ARVs as a manifestation and not a contradiction of God's healing powers.

  4. Head lice infestation in school children of a low socio- economy ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-04

    Jul 4, 2008 ... In the old Gaza city and the rural village Jabalia within the Gaza Governorate the rate of infestation with lice was 14.1% in the primary school girls. (Al-Shawa, 2006). In a high socio-economy area in Izmir,. Turkey, 4.2% of the studied population of the secondary and elementary school children were infested ...

  5. Iisraeli väeüksused tungisid Gazasse palestiinlaste aladele / Liise Lehtsalu

    Index Scriptorium Estoniae

    Lehtsalu, Liise

    2006-01-01

    Iisraeli vägede rünnakust Gaza palestiinlaste aladele eesmärgiga vabastada Palestiina äärmusrühmituse poolt röövitud Iisraeli sõdur. Sissetungi ajendiks oli Palestiina rühmituste rünnak Iisraeli piiripunktile Gaza lõunaosas

  6. Iisraeli blokaadist nördinud gazalased tungisid Egiptusesse / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2008-01-01

    Iisrael lõpetas piiriületuse Gazaga karistuseks äärmusliku Hamasi rühmituse kontrollitud piirkonnast Iisraeli vastu suunatud raketi- ja suurtükitulele, mistõttu murdsid kümned tuhanded Gaza elanikud Egiptusesse. Kaart: Gaza maakitsus. Lisa: Kahe riigi vahel

  7. Asie centrale | Page 2 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Read more about Renforcement d'un cadre favorable à l'entrepreneuriat en Cisjordanie et à Gaza. Langue French. Read more about Enhancing the Framework for Entrepreneurship in the West Bank and Gaza. Langue English. Read more about Alternative Measure of Wellbeing: Bhutan's Gross National Happiness 2010.

  8. Sõjaraport õõnestab ÜRO usaldusväärsust / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2011-01-01

    ÜRO Gaza sõda puudutavas raportis kritiseeritakse nii Iisraeli kui ka Palestiina islamistlikku äärmusrühmitust Hamas. ÜRO inimõiguste uurija Richard Goldstone leiab, et raport on siiski puudulik, kuna praegu omab ÜRO juba rohkem infot Gaza sõja kohta

  9. Отчёт о войне в Газе подрывает доверие к ООН

    Index Scriptorium Estoniae

    2011-01-01

    ÜRO Gaza sõda puudutavas raportis kritiseeritakse nii Iisraeli kui ka Palestiina islamistlikku äärmusrühmitust Hamas. ÜRO inimõiguste uurija Richard Goldstone leiab, et raport on siiski puudulik, kuna praegu omab ÜRO juba rohkem infot Gaza sõja kohta

  10. What kind of state deserves to exist?

    NARCIS (Netherlands)

    Reinhart, T.

    2004-01-01

    Amidst the political storm in Israel regarding the "Gaza disengagement" plan, only one really meaningful fact emerges: Sharon received Bush's approval to proceed with his plan for the wall in the West Bank. With regard to the Gaza strip, the disengagement plan published in the Israeli papers on

  11. Functionalization of lambda-zirconium phosphate with ...

    Indian Academy of Sciences (India)

    HUDA HAMMOUDAa, ELENA RODRÍGUEZ PAYÁNb and. MARÍA DE VICTORIA RODRÍGUEZb. aDepartment of Chemistry, Faculty of Science, Al-Azhar University of Gaza, 1277 Gaza, Palestine. bDepartamento de Química Orgánica, Facultad de Ciencias C-I-602, Universidad Autónoma de Madrid,. 28049 Madrid, Spain.

  12. Far East Asia | Page 76 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Far East Asia. Extrême-Orient. Read more about Renforcement d'un cadre favorable à l'entrepreneuriat en Cisjordanie et à Gaza. Language French. Read more about Enhancing the Framework for Entrepreneurship in the West Bank and Gaza. Language English. Read more about Mekong Economic Research Network ...

  13. Enhancing the Framework for Entrepreneurship in the West Bank ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Enhancing the Framework for Entrepreneurship in the West Bank and Gaza. Economic problems facing the West Bank and Gaza include high unemployment, low productivity, and an underperforming private sector. Encouraging entrepreneurship and innovation among small businesses could result in more decent jobs ...

  14. Food insecurity as a barrier to sustained antiretroviral therapy adherence in Uganda.

    Directory of Open Access Journals (Sweden)

    Sheri D Weiser

    2010-04-01

    Full Text Available Food insecurity is emerging as an important barrier to antiretroviral (ARV adherence in sub-Saharan Africa and elsewhere, but little is known about the mechanisms through which food insecurity leads to ARV non-adherence and treatment interruptions.We conducted in-depth, open-ended interviews with 47 individuals (30 women, 17 men living with HIV/AIDS recruited from AIDS treatment programs in Mbarara and Kampala, Uganda to understand how food insecurity interferes with ARV therapy regimens. Interviews were transcribed, coded for key themes, and analyzed using grounded theory.Food insecurity was common and an important barrier to accessing medical care and ARV adherence. Five mechanisms emerged for how food insecurity can contribute to ARV non-adherence and treatment interruptions or to postponing ARV initiation: 1 ARVs increased appetite and led to intolerable hunger in the absence of food; 2 Side effects of ARVs were exacerbated in the absence of food; 3 Participants believed they should skip doses or not start on ARVs at all if they could not afford the added nutritional burden; 4 Competing demands between costs of food and medical expenses led people either to default from treatment, or to give up food and wages to get medications; 5 While working for food for long days in the fields, participants sometimes forgot medication doses. Despite these obstacles, many participants still reported high ARV adherence and exceptional motivation to continue therapy.While reports from sub-Saharan Africa show excellent adherence to ARVs, concerns remain that these successes are not sustainable in the presence of widespread poverty and food insecurity. We provide further evidence on how food insecurity can compromise sustained ARV therapy in a resource-limited setting. Addressing food insecurity as part of emerging ARV treatment programs is critical for their long-term success.

  15. Antiretroviral Drug Use in a Cross-Sectional Population Survey in Africa: NIMH Project Accept (HPTN 043).

    Science.gov (United States)

    Fogel, Jessica M; Clarke, William; Kulich, Michal; Piwowar-Manning, Estelle; Breaud, Autumn; Olson, Matthew T; Marzinke, Mark A; Laeyendecker, Oliver; Fiamma, Agnès; Donnell, Deborah; Mbwambo, Jessie K K; Richter, Linda; Gray, Glenda; Sweat, Michael; Coates, Thomas J; Eshleman, Susan H

    2017-02-01

    Antiretroviral (ARV) drug treatment benefits the treated individual and can prevent HIV transmission. We assessed ARV drug use in a community-randomized trial that evaluated the impact of behavioral interventions on HIV incidence. Samples were collected in a cross-sectional survey after a 3-year intervention period. ARV drug testing was performed using samples from HIV-infected adults at 4 study sites (Zimbabwe; Tanzania; KwaZulu-Natal and Soweto, South Africa; survey period 2009-2011) using an assay that detects 20 ARV drugs (6 nucleoside/nucleotide reverse transcriptase inhibitors, 3 nonnucleoside reverse transcriptase inhibitors, and 9 protease inhibitors; maraviroc; raltegravir). ARV drugs were detected in 2011 (27.4%) of 7347 samples; 88.1% had 1 nonnucleoside reverse transcriptase inhibitors ± 1-2 nucleoside/nucleotide reverse transcriptase inhibitors. ARV drug detection was associated with sex (women>men), pregnancy, older age (>24 years), and study site (P < 0.0001 for all 4 variables). ARV drugs were also more frequently detected in adults who were widowed (P = 0.006) or unemployed (P = 0.02). ARV drug use was more frequent in intervention versus control communities early in the survey (P = 0.01), with a significant increase in control (P = 0.004) but not in intervention communities during the survey period. In KwaZulu-Natal, a 1% increase in ARV drug use was associated with a 0.14% absolute decrease in HIV incidence (P = 0.018). This study used an objective, biomedical approach to assess ARV drug use on a population level. This analysis identified factors associated with ARV drug use and provided information on ARV drug use over time. ARV drug use was associated with lower HIV incidence at 1 study site.

  16. A MultiFactorial Risk Score to weigh toxicities and co-morbidities relative to costs of antiretrovirals in a cohort of HIV-infected patients

    OpenAIRE

    M Tontodonati; F Sozio; F Vadini; E Polilli; T Ursini; G Calella; P Di Stefano; E Mazzotta; A Costantini; C D'Amario; G Parruti

    2012-01-01

    Purpose of the study: Considering costs of antiretrovirals (ARVs) for HIV patients is increasingly needed. A simple and comprehensive tool weighing comorbidities and ARV-related toxicities could be useful to judge the appropriateness of use of more expensive drugs. We conceived a MultiFactorial Risk Score (MFRS) to evaluate the appropriateness of ARVs prescription relative to their costs. Methods: HIV patients were consecutively enrolled in 2010-2011. We considered socio-demographic character...

  17. Safety of in utero and neonatal antiretroviral exposure: cognitive and academic outcomes in HIV-exposed, uninfected children 5-13 years of age.

    Science.gov (United States)

    Nozyce, Molly L; Huo, Yanling; Williams, Paige L; Kapetanovic, Suad; Hazra, Rohan; Nichols, Sharon; Hunter, Scott; Smith, Renee; Seage, George R; Sirois, Patricia A

    2014-11-01

    Long-term effects of in utero and neonatal antiretroviral (ARV) exposure on cognitive and academic development in HIV-exposed, uninfected school-age children are unknown. HIV-exposed, uninfected children, ages 5-13 years, in Pediatric HIV/AIDS Cohort Study Surveillance Monitoring for Antiretroviral Treatment Toxicities, a US-based multisite cohort study, completed age-appropriate Wechsler intelligence and academic scales (WPPSI-III, WASI, WIAT-II-A). Associations between cognitive and academic outcomes and in utero ARV exposure by regimen, class and individual ARVs were evaluated, adjusting for potential confounders. Children completing WPPSI-IIIs (n = 350) were 49% male, 74% Black, 25% Hispanic; WASI (n = 337) and WIAT-II-A (n = 415) cohorts were similar. The percentage exposed to combination ARV (cARV) was 84% (WPPSI-III), 64% (WASI) and 67% (WIAT-II-A). Among ARV-exposed children, there were no significant associations between any ARV regimen or class and any cognitive or academic outcome. In addition, in both unadjusted models and after adjustment for caregiver IQ, sociodemographic factors and maternal health and substance use during pregnancy, no individual ARV drug was associated with significantly lower cognitive or academic scores. Factors typically associated with lower cognitive and academic scores in the general population, such as prematurity, small for gestational age, maternal alcohol use and lower maternal cognitive status, were also associated with lower scores in this study. Overall, the safety of prenatal and neonatal ARV use was supported.

  18. Treating AIDS

    DEFF Research Database (Denmark)

    Whyte, Susan Reynolds; Whyte, Michael A.; Meinert, Lotte

    2004-01-01

    reviews, we seek to map out the channels through which ARVs are being made available to people and to describe and assess the social implications of the present system of distribution. Four channels of access to ARV medicines were common in mid-2003: (i) Medicines were provided free in structured research...... regularly. Health workers must consider whether patients will be able to purchase the drugs or not. In a kind of popular social pharmacy, people assess who can and should and does get access to ARVs. Further research should examine the whole range of ARV access channels in different countries...

  19. Kuidas finantskriis kinnisvaraturgu pitsitab / Timo Tomson

    Index Scriptorium Estoniae

    Tomson, Timo

    2008-01-01

    Kinnisvaratehingute tagamaadest ning keskmise inimese võimalustest võtta finantskriisi tingimustes eluasemelaenu. Diagramm: Rike rahamasinas (Tallinna korteritehingute arv ja keskmine ruutmeetri hind)

  20. Sõdurid hakkasid Gazat jõuga tühjendama / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2005-01-01

    Paljud juudi asunikud keeldusid vabatahtlikult asundustest lahkumast ning avaldasid sõduritele vastupanu, üle kogu Iisraeli kokku sõitnud äärmuslased protestivad Gazas juudi asunduste likvideerimise vastu. Lisa: Lahkumine Gazast

  1. Hydropolitics and the Prospect for Peace in the Arab- Israeli Conflict

    National Research Council Canada - National Science Library

    Gombert, Gregory

    1998-01-01

    ... fundamental of all human needs, water. Since the Israeli occupation of the West Bank and Gaza Strip began after the 1967 Six Day War, Israeli military orders have denied Palestinian involvement in the management and development of water...

  2. Blair võib Lähis-Idas hakata rahu vahendama / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2007-01-01

    USA toetab Suurbritannia peaministri kohalt lahkuvat Tony Blairi Lähis-Ida rahuprotsessi uue juhina, kes aitaks Läänekaldale ja Gaza sektorisse rajada iseseisvat Palestiina riiki. Lisa: Lähis-Ida rahuprotsess

  3. Defense Against Rocket Attacks in the Presence of False Cues

    National Research Council Canada - National Science Library

    Harari, Lior

    2008-01-01

    Rocket attacks on civilian and military targets, from both Hezbollah (South Lebanon) and Hamas (Gaza strip) have been causing a major operational problem for the Israeli Defense Force for over two decades...

  4. Iisraeli ja Palestiina vaherahu algas vaenuga / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2006-01-01

    Palestiina president Mahmoud Abbas kinnitas Iisraeli peaministrile Ehud Olmertile, et Palestiina rühmitused on valmis lõpetama vägivalla Gazas, kuid siiski mõned Palestiina rühmitused ignoreerisid lepet. Kaart: Raketid Gazast

  5. ANALYSIS OF UNEMPLOYMENT CHALLENGES IN PALESTINE BETWEEN 2000 AND 2015

    Directory of Open Access Journals (Sweden)

    Ahmed SALAMA

    2017-12-01

    Full Text Available This paper discusses the challenges of unemployment in Palestine between 2000 and 2015. The study aims to understand the trends and sources of unemployment in Palestine. Using the Palestinian Central Bureau of Statistics (PCBS data, trend analysis was used to understand the trends of unemployment in both parts of Palestine (West Bank and Gaza Strip between 2000 and 2015. The Results showed that there is a downward trend in the unemployment rate in West Bank and an upward trend appears on the unemployment rate in Gaza Strip. The constraints during the second Intifada and the Siege on Gaza Strip are the main factors that affected on unemployment between 2000 and 2015. The economic growth difference in both parts of Palestine (West Bank and Gaza Strip can be one of the reasons that affecting on unemployment besides the other reasons. Some solutions are introduced for unemployment challenge in Palestine beside the solution of lack of independence issue.

  6. Army and Marine Corps Active Protection System (APS) Efforts

    Science.gov (United States)

    2016-08-30

    Lebanon War and the 2014 Gaza Conflict and growing concerns with Russian military capabilities and activities in Eastern Europe have possibly served...3 The 2006 Israel-Lebanon War ...16 ARTIS’s Iron Curtain System ................................................................................................. 16

  7. All projects related to | Page 397 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-22

    Economic problems facing the West Bank and Gaza include high unemployment, low productivity, and an underperforming private sector. Start Date: January 22, 2012. End Date: July 22, 2014. Topic: ECONOMIC POLICY, ECONOMIC RESEARCH, PALESTINE, SMALL ENTERPRISES, EMPLOYMENT, PRODUCTIVITY.

  8. Iisraeli valitsus haub sõjakäiku Gazasse / Igor Taro

    Index Scriptorium Estoniae

    Taro, Igor

    2007-01-01

    Iisraeli võimude plaanist lõpetada radikaalse islamiliikumise Hamas omavoli Gaza sektoris. Palestiina autonoomia uueks peaministriks nimetati Salam Fayyad. Vt. samas: Röövitud reporteril lootus vabaneda

  9. Lebanon

    National Research Council Canada - National Science Library

    Prados, Alfred B

    2007-01-01

    .... aid to Lebanon, and Lebanon's capacity to stop Hezbollah militia attacks on Israel. Regional tensions increased in mid-2006, however, as clashes between Israel and Palestinian militants in the Gaza territory spread to Lebanon...

  10. Vägivallalaine uputas Palestiina ühisvalitsuse

    Index Scriptorium Estoniae

    2007-01-01

    Radikaalne islami vastupanuliikumise Hamas ja palestiinlaste mõõdukamat osa esindava Fatah'i võitlejad pidasid Gaza linnaosades veriseid lahingud. Autonoomia presidendi Mahmoud Abbasi ja Iisraeli peaministri Ehud Olmerti hukkamõistvast suhtumisest

  11. Travelers' Health: MERS in the Arabian Peninsula

    Science.gov (United States)

    ... Iran; Israel, the West Bank, and Gaza; Jordan; Kuwait; Lebanon; Oman; Qatar; Saudi Arabia; Syria; the United ... Listen Watch YouTube About CDC Employment Newsroom Training/Education Funding CDC's Organization Mission and Vision Using this ...

  12. Concurrent use of Antiretroviral and African traditional medicines amongst people living with HIV/AIDS (PLWA) in the eThekwini Metropolitan area of KwaZulu Natal.

    Science.gov (United States)

    Mncengeli, Sibanda; Manimbulu, Nlooto M; Panjasaram, Naidoo

    2016-12-01

    People living with HIV/AIDS (PLWA) often use African Traditional Medicines (ATM) either alone or in combination with Western medicines including Antiretrovirals (ARV). To explore the prevalence of concurrent Antiretrovirals (ARV) and African Traditional medicines (ATM) use and determine the effects of any concurrent use on the CD4+ Lymphocyte count and Viral Load (VL) of PLWA in the eThekwini Metropolitan area. A descriptive and exploratory study was carried out on 360 patients. Information was gathered on patients socioeconomic characteristics, ATM usage, outcome measures of HIV disease progression (CD4+ Count, VL). The data was analysed using descriptive statistics, univariate and multivariate analyses. 4.98% (14/281) of the patients used ATM and ARV concurrently during the study period. Over 65% (185/281) reported ATM use before diagnosis with HIV whilst 77.6% (218/281) reported previous ATM use after their HIV diagnosis but before initiation with ARV. Place of residence (p=0.004), age (p<0.001) and education level (P=0.041) were found to be significantly and positively correlated with ATM use. There were no statistically significant changes in mean plasma CD4+ Count and inconclusive effects on VL during the period of the study in the group taking ARV alone when compared with the group using ARV and ATM concomitantly. Concurrent ARV and ATM use is quite low (4.98%) when compared to ATM use before HIV diagnosis and after HIV diagnosis but before initiation with ARV. This may point to efficient pre-counselling efforts before ARV initiation by health care professionals. This study also demonstrated that there were no significant differences in the CD4+ and inconclusive effects on VL, between patients taking both ARV and ATM concomitantly and those using ARV alone.

  13. Assessing Egyptian Public Support for Security Crackdowns in the Sinai

    Science.gov (United States)

    2015-02-01

    Leadership and Development contributes to the education of world class senior leaders, develops expert knowledge, and provides solutions to...and the mounting issues of overpopulation , poverty, and ter- rorism in the Gaza Strip, Morsi may not have wanted to take on this headache since he...proposal that has been bandied about is for the Pales- tinian Authority (under the domination of Fatah) to control Gaza.83 Such a solution would be

  14. Egypt: Background and U.S. Relations

    Science.gov (United States)

    2009-05-12

    Authority that followed the formation of a Hamas-led government in 2006 and Israel’s closure of the Gaza Strip following Hamas’s 2007 Gaza takeover ...Military Financing (FMF) toward the procurement of more advanced detection equipment, such as censors, remote-controlled robotic devices, seismic...equipment, such as censors and remote-controlled robotic devices. On June 16, 2008, U.S. Embassy in Cairo Spokesman Robert Greenan said that a U.S

  15. Iran: U.S. Concerns and Policy Responses

    Science.gov (United States)

    2013-11-04

    the Gaza Strip . Iran provided material support to Hamas during an earlier Israel-Hamas War in Gaza (December 27, 2008-January 17, 2009). In March 2011...sanctions implementation. Major Non-Oil Investments Renault (France) and Mercedes (Germany)— automobile production in Karaj, Iran— valued at $370...Qeshm Island, aluminum factory in Shirvan, cement plant in Hamadan; UAE financing Esfahan Steel Company; India— steel plant, petrochemical plant; S

  16. Renforcement d'un cadre favorable à l'entrepreneuriat en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Renforcement d'un cadre favorable à l'entrepreneuriat en Cisjordanie et à Gaza. Un chômage élevé, une faible productivité et un secteur privé anémique sont parmi les problèmes économiques auxquels se heurtent la Cisjordanie et Gaza. Favoriser l'entrepreneuriat et l'innovation chez les petites entreprises pourrait ...

  17. Vaesed tööloomad / Gert D. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D.

    2008-01-01

    Riikides, kus palgad ja elatustase on madalamad, tehakse rohkem ületunde, samas kui jõukates riikides on töötundide arv väiksem. Vt. samas: Neljapäevane töönädal ei tasunud ära. Diagramm: Reaalselt töötatud tundide arv nädalas riikide kaupa

  18. Enteropathogenicity of Dutch and German avian reoviruses in SPF white leghorn chickens and broilers.

    NARCIS (Netherlands)

    Songserm, T.; Roozelaar, van D.; Kant-Eenbergen, H.C.M.; Pol, J.; Pijpers, A.; Huurne, ter A.A.H.M.

    2003-01-01

    The enteropathogenicity of avian reoviruses (ARVs), isolated from chickens affected with malabsorption syndrome (MAS) from The Netherlands and Germany was studied. In the first trial seven different ARVs isolated from MAS cases were inoculated in 1-day-old specific pathogenic free (SPF) white

  19. The Attitudes toward Rape Victims Scale: Construction, Validation, and Cross-Cultural Applicability.

    Science.gov (United States)

    Ward, Colleen

    1988-01-01

    Constructed 25-item Attitudes toward Rape Victims Scale (ARVS) which emphasized victim blame, credibility, deservingness, denigration, and trivialization. Results from administration of ARVS to university students, social workers, psychologists, physicians, lawyers, and police officers in Singapore, and to university students in the United States…

  20. USA tudengid tõttavad välismaale / Markus Larsson

    Index Scriptorium Estoniae

    Larsson, Markus

    2003-01-01

    Rahvusvahelise hariduse instituudi (IIE) 2001. a. terrorirünnakute järel tehtud uurimuse kohaselt kasvas välisriikides õppivate ameeriklaste arv viimase aastaga 4%, alates 1991. aastast on välismaal õppivate USA üliõpilaste arv enam kui kahekordistunud

  1. Abuse of antiretroviral drugs combined with addictive drugs by ...

    African Journals Online (AJOL)

    Reports of the use of antiretroviral drugs (ARVs) to produce a highly addictive drug called nyaope or whoonga are of major concern as ARVs are easily accessible in sub-Saharan Africa, including to pregnant women. Use of illicit drugs by pregnant women may result in serious adverse effects in their infants. We have ...

  2. Adverse drug reactions associated with antiretroviral therapy during pregnancy.

    Science.gov (United States)

    Santini-Oliveira, Marilia; Grinsztejn, Beatriz

    2014-12-01

    Antiretroviral (ARV) drug use during pregnancy significantly reduces mother-to-child HIV transmission, delays disease progression in the women and reduces the risk of HIV transmission to HIV-serodiscordant partners. Pregnant women are susceptible to the same adverse reactions to ARVs as nonpregnant adults as well as to specific pregnancy-related reactions. In addition, we should consider adverse pregnancy outcomes and adverse reactions in children exposed to ARVs during intrauterine life. However, studies designed to assess the safety of ARV in pregnant women are rare, usually with few participants and short follow-up periods. In this review, we discuss studies reporting adverse reactions to ARV drugs, including maternal toxicity, adverse pregnancy outcomes and the consequences of exposure to ARV in infants. We included results of observational studies, both prospective and retrospective, as well as randomized clinical trials, systematic reviews and meta-analyses. The benefits of ARV use during pregnancy outweigh the risks of adverse reactions identified to date. More studies are needed to assess the adverse effects in the medium- and long term in children exposed to ARVs during pregnancy, as well as pregnant women using lifelong antiretroviral therapy and more recently available drugs.

  3. The pattern of hearing disorders in HIV positive patients on anti ...

    African Journals Online (AJOL)

    Objectives: To determine if patients on Anti - retroviral drugs (ARVs) develop hearing impairment. Design: The comprehensive care clinic (CCC), Kenyatta National Hospital (KNH), Nairobi. Setting: Case controlled study. Subjects: Two hundred and seventy one human immunodeficiency virus (HIV) positive patients on ARVs ...

  4. Safety and tolerability of depot medroxyprogesterone acetate among HIV-infected women on antiretroviral therapy: ACTG A5093.

    Science.gov (United States)

    Watts, D Heather; Park, Jeong-Gun; Cohn, Susan E; Yu, Song; Hitti, Jane; Stek, Alice; Clax, Pamela A; Muderspach, Laila; Lertora, Juan J L

    2008-02-01

    Concomitant use of antiretroviral (ARV) and hormonal contraceptives may change the metabolism of each and the resulting safety profiles. We evaluated the safety and tolerability of depot medroxyprogesterone acetate (DMPA) among women on ARV. HIV-infected women on selected ARV regimens or no ARV were administered DMPA 150 mg intramuscularly and evaluated for 12 weeks for adverse events, changes in CD4+ count and HIV RNA levels, and ovulation. Seventy evaluable subjects were included, 16 on nucleoside only or no ARV, 21 on nelfinavir-containing regimens, 17 on efavirenz-containing regimens and 16 on nevirapine-containing regimens. Nine Grade 3 or 4 adverse events occurred in seven subjects; none were judged related to DMPA. The most common findings possibly related to DMPA were abnormal vaginal bleeding (nine, 12.7%), headache (three, 4.2%), abdominal pain, mood changes, insomnia, anorexia and fatigue, each occurring in two (2.9%) subjects. No significant changes in CD4+ count or HIV RNA levels occurred with DMPA. No evidence of ovulation was detected, and no pregnancies occurred. The clinical profile associated with DMPA administration in HIV-infected women, most on ARV, appears similar to that seen in HIV-uninfected women. DMPA prevented ovulation and did not affect CD4+ counts or HIV RNA levels. In concert with previously published DMPA/ARV interaction data, these data suggest that DMPA can be used safely by HIV-infected women on the ARV studied.

  5. Struktuurireform muutis töö tõhusamaks = Structural reform makes work more effective / Aljona Mändlo

    Index Scriptorium Estoniae

    Mändlo, Aljona

    2006-01-01

    Tööturuameti ja tööhõiveametite haldussuutlikkuse tõstmiseks käivitatud projektist, struktuuri ja koosseisude muutustest. Vt lisad: Aktiivsed tööturumeetmed, toetuste saajate arv 1995-2005; Aktiivsed tööturumeetmed, koolitusel ja nõustamisel osalenute arv 1995-2005; Kõnekaid fakte

  6. Antiretrovirals, Fractures, and Osteonecrosis in a Large International HIV Cohort

    DEFF Research Database (Denmark)

    Borges, Álvaro H; Hoy, Jennifer; Florence, Eric

    2017-01-01

    Background: Antiretrovirals (ARVs) affect bone density and turnover, but their effect on risk of fractures and osteonecrosis of the femoral head is less understood. We investigated if exposure to ARVs increases the risk of both bone outcomes. Methods: EuroSIDA participants were followed to assess...

  7. Maxima: tarbimine elavneb alles kahe aasta pärast / Andres Reimer

    Index Scriptorium Estoniae

    Reimer, Andres

    2009-01-01

    Maxima grupi laienemine on peatatud, sh. ka Eestis. Maxima kaupluste arv vähenes Leedus kümne võrra, Eestis lisandus üks Maxima kauplus, Lätis jäi nende arv samaks. Prisma Peremarketi juhi Janne Tapio Lihavaineni hinnangul on Maxima poed liiga väikesed, et majanduskriisi ajal konkureerida

  8. Perceptions among Dutch men who have sex with men and their willingness to use rectal microbicides and oral pre-exposure prophylaxis to reduce HIV risk--a preliminary study

    NARCIS (Netherlands)

    Marra, Elske; Hankins, Catherine A.

    2015-01-01

    Oral pre-exposure prophylaxis (PrEP) with antiretroviral (ARV) tablets and topical PrEP or microbicides containing ARV drugs could help to reduce HIV incidence. These methods hold promise for men who have sex with men (MSM) who are at higher risk of acquiring HIV. This mixed-methods study in the

  9. Juhtimissüsteemide selgroog. Lean ning ISO - terviklahendused tootmise haldamiseks / Anton Ovsjankin

    Index Scriptorium Estoniae

    Ovsjankin, Anton

    2011-01-01

    Kasvanud on juurutatavate Lean ja ISO süsteemide arv, kuid on kasvanud ka nende juurutamise ja arendamisega seotud ebaõnnestumiste arv. Põhjustest, miks jäävad paljud Leani ja ISO juurutanud ettevõtted ilma lubatud tulemusteta. Leani ja ISO haldamiseks vajalikest teguritest

  10. On a never-ending waiting list: Toward equitable access to ...

    African Journals Online (AJOL)

    Universal access to antiretroviral (ARV) medication for HIV/AIDS is the clarion call of the WHO/UNAIDS 3 by 5 Initiative. Treatment coverage, however, remains highly uneven. This sharpens the question of who exactly is accessing ARVs and whether access is challenging inequality or reinforcing it. Issues of distributive ...

  11. New antiretroviral drugs: What\\'s on the horizon in 2005? | Wood ...

    African Journals Online (AJOL)

    Despite the present number of available antiretrovirals (ARVs), there continues to be a need for new medications with improved tolerability, and activity against resistant virus. This article will review three groups of ARVs: those available in North America and. Europe but not yet registered in South Africa; new formulations of ...

  12. 99 - 107_Jibril et al.

    African Journals Online (AJOL)

    User

    Subjects, vitamin A and C increased significantly (P<0.05) in the ARV treatment naïve sub group. Vitamin E, selenium and zinc increased significantly (P<0.05) in the ARV treated sub group, while. MDA decreased significantly (P<0.05) in this sub group. Micronutrient supplementation was therefore shown to reduce oxidative ...

  13. AcEST: DK953143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 35 0.21 sp|Q89904|VGLN_ARV Non-structural glycoprotein OS=Adelaide River... 32 1.... EADRQLQLSFGFRLVAVTQSNRKKDMAVSQLRRPATSNANSSNLHRYWVLRSTLPMELQK 195 >sp|Q89904|VGLN_ARV Non-structural glycoprotein OS=Adelaide River

  14. In-vitro photo-translocation of antiretroviral drug delivery into TZMbl cells

    CSIR Research Space (South Africa)

    Malabi, Rudzani

    2017-01-01

    Full Text Available The objectives of this study are to use femtosecond laser pulses in a photo-translocation system to deliver ARVs into HIV infected TZMbl cells, and to investigate the influence of ARVs and laser on cellular processes using different molecular...

  15. Perceptions of the benefits and affordability of antiretrovirals among ...

    African Journals Online (AJOL)

    To assess the affordability of antiretroviral drugs (ARVs) and accessibility to treatment for opportunistic infections (OIs) among HIV-1 seropositive persons, we used semi-structured interviewer-administered questionnaires to interview 154 individuals seeking ARV treatment at the Daughter of Charity German Leprosy and ...

  16. Antiretroviral therapy provided to HIV-infected Malawian women in a randomized trial diminishes the posiitive effect of lipid-based nutrient supplements on breast milk B-vitamins

    Science.gov (United States)

    Background: There is little information on B-vitamin concentrations in human milk or how they are affected by maternal B-vitamin deficiencies, antiretroviral (ARV) therapy or maternal supplementation. Objective: To evaluate effects of ARV therapy and/or lipid-based nutrient supplements (LNS) on B-v...

  17. Paljurahvuselisus ja eestlastest riigiametnikud Eestimaa kubermangus aastatel 1870-1917 / Bradley Woodworth

    Index Scriptorium Estoniae

    Woodworth, Bradley, 1963-

    2006-01-01

    Eestlastest riigiteenistujate arv kasvas 19. sajandi lõpus oluliselt : kogu Eestimaa kubermangus kasvas eestlastest riigiametnike arv 85-lt 1881. aastal 673-le 1897. aastal. 19. sajandi lõpus pidasid riigiteenistuses olevad eestlased alam- ja keskastme ameteid. Pärast 1905. aastat eestlaste osakaal ametnikkonnas üha suurenes, samuti kasvas eestlaste osakaal ka kõrgema astme riigiametnikkonnas

  18. PMTCT Programme reduced vertical transmission of HIV in Abuja ...

    African Journals Online (AJOL)

    2016-04-16

    Apr 16, 2016 ... Paediatric Clinical Trial Group (PACTG) protocol 0769 in the United States showed that maternal ARVs, opti- mal obstetric practice, appropriate infant feeding option and infant ARVs could reduce the rate of transmission from mother to child by two-thirds.9 Implementation of the PMTCT programme in ...

  19. ORIGINAL ARTICLES Prevalence of drug-drug interactions of ...

    African Journals Online (AJOL)

    2008-02-02

    Feb 2, 2008 ... Table II. Frequency of level 2 interactions between ARVs and the other drugs. Interacting ARVs and other drugs. N. %*. Didanosine + ketoconazole. 1. 0.91. Didanosine + ofloxacin. 1. 0.91. Didanosine + ciprofloxacin. 2. 1.82. Didanosine + iraconazole. 3. 2.73. Didanosine + ketoconazole. 2. 1.82. Efavirenz ...

  20. Christian theology of life, death and healing in an era of antiretroviral ...

    African Journals Online (AJOL)

    This article discusses Christian understandings of life, death and healing in context of antiretroviral (ARV) therapy. The discussion is a response to the reactions of some Botswana Pentecostal and African Independent Churches to the availability of ARV therapy, as reflected in several media reports of churches discouraging ...

  1. HIV antiretroviral medication stock-outs in Ghana: contributors and ...

    African Journals Online (AJOL)

    Although using ARVs produced in-country could reduce supply problems, the domestically-manufactured product currently does not meet World Health Organization (WHO) standards. We recommend focused efforts to produce WHO standard ARVs in Ghana, and a review of current supply chain management to identify and ...

  2. Thyroid function among HIV/AIDS patients on highly active anti-retroviral therapy.

    Science.gov (United States)

    Thaimuta, Z L; Sekadde-Kigondu, C; Makawiti, D W

    2010-12-01

    To assess the thyroid function among Human Immunodeficiency Virus (HIV)/Acquired Immunodeficiency Syndrome (AIDS) patients on anti-retroviral drugs: stavudine, lamivudine and nevirapine and to establish the prevalence of non-thyroid illness. Laboratory based comparative cross-sectional study. Comprehensive care clinics at KNH and Mbagathi District Hospital. Eighty four HIV-infected patients on treatment with ARVs (ARV +ve) and an ARV naive (ARV naive) group of 26 HIV-infected patients. Thyroid stimulating hormone levels were not altered following treatment whereas the levels of FT4 decreased. The frequency of those with low FT4 were increasing with continued ARV use. The prevalence of non-thyroidal illness state defined by TSH within reference ranges and low FT4 was comparable among the ARV +ve and ARV naive groups (44 and 46% respectively). Progressive use of HAART causes decline in FT4 hormone levels. It is debatable whether interventions for low FT4 is necessary in ARV treatment but a longitudinal study would explain the progressive trend of thyroid hormones and implications with HAART treatment. The prevalence of NTI is comparable to both HAART users and non-users. Low levels of thyroid hormone (FT 4) may be an adaptive response by thyroid gland to minimize calorie utilisation as in chronic diseases.

  3. Treating AIDS

    DEFF Research Database (Denmark)

    Whyte, Susan Reynolds; Whyte, Michael A.; Meinert, Lotte

    2004-01-01

    The price of antiretroviral (ARV) medicines in Uganda has fallen dramatically in recent years and more people are under treatment. By mid-2003 it was estimated that 10 000 people were taking ARVs. Drawing on participant observation, qualitative interviews, work with key informants and document re...

  4. Author Details

    African Journals Online (AJOL)

    Abstract · Vol 6, No 2 (2009) - Articles Anti-retroviral (ARV) rationing schemes in developing countries: a review article on strategies and ethical issues related to the successes and failures of ARV programmes. Abstract · Vol 7, No 1 (2010) - Articles Methadone maintenance therapy as evidence based drug abuse planning ...

  5. Lähikauplus toob täissortimendi kodu ligidale / Reimo Sildvee

    Index Scriptorium Estoniae

    Sildvee, Reimo

    2004-01-01

    AS OG Elektra nõukogu esimees Oleg Gross arvab, et hoolimata supermarketite juurdetulekust jäävad alles ka väikesed poed. OG Elektra laienemisplaanid, käive, kasum. Comarketi laienemine. Säästumarketite kaupluste arv, käive. Leedu ja Läti ühe juhtiva jaekaubandusketi VP Market investeering Eestis, avatavate kaupluste arv

  6. Maternal HIV-1 disease progression 18-24 months postdelivery according to antiretroviral prophylaxis regimen (triple-antiretroviral prophylaxis during pregnancy and breastfeeding vs zidovudine/single-dose nevirapine prophylaxis): The Kesho Bora randomized controlled trial.

    Science.gov (United States)

    2012-08-01

    Antiretroviral (ARV) prophylaxis effectively reduces mother-to-child transmission of human immunodeficiency virus type 1 (HIV). However, it is unclear whether stopping ARVs after breastfeeding cessation affects maternal HIV disease progression. We assessed 18-24-month postpartum disease progression risk among women in a randomized trial assessing efficacy and safety of prophylactic maternal ARVs. From 2005 to 2008, HIV-infected pregnant women with CD4(+) counts of 200-500/mm(3) were randomized to receive either triple ARV (zidovudine, lamivudine, and lopinavir/ritonavir during pregnancy and breastfeeding) or AZT/sdNVP (zidovudine until delivery with single-dose nevirapine without postpartum prophylaxis). Maternal disease progression was defined as the combined endpoint of death, World Health Organization clinical stage 4 disease, or CD4(+) counts of prolonged triple ARV prophylaxis had no effect on HIV progression following cessation (compared with AZT/sdNVP). However, women on triple ARV prophylaxis had lower progression risk during the time on triple ARV. Given the high rate of progression among women with CD4(+) cells of <350/mm(3), ARVs should not be discontinued in this group. ISRCTN71468410.

  7. Quality of antiretroviral drugs, stavudine and indinavir capsules ...

    African Journals Online (AJOL)

    Background: The number of antiretroviral drugs (ARVs) available to HIV/AIDS patients in Tanzania is increasing due to a number of intervention programs such as PEPFAR and the Clinton Foundation. These ARVs are imported from a number of countries. However, currently there are no reports on the quality of these ...

  8. Pharmacokinetic, Pharmacogenetic, and Other Factors Influencing CNS Penetration of Antiretrovirals

    Directory of Open Access Journals (Sweden)

    Jacinta Nwamaka Nwogu

    2016-01-01

    Full Text Available Neurological complications associated with the human immunodeficiency virus (HIV are a matter of great concern. While antiretroviral (ARV drugs are the cornerstone of HIV treatment and typically produce neurological benefit, some ARV drugs have limited CNS penetration while others have been associated with neurotoxicity. CNS penetration is a function of several factors including sieving role of blood-brain and blood-CSF barriers and activity of innate drug transporters. Other factors are related to pharmacokinetics and pharmacogenetics of the specific ARV agent or mediated by drug interactions, local inflammation, and blood flow. In this review, we provide an overview of the various factors influencing CNS penetration of ARV drugs with an emphasis on those commonly used in sub-Saharan Africa. We also summarize some key associations between ARV drug penetration, CNS efficacy, and neurotoxicity.

  9. Androgen receptor variant-7: an important predictive biomarker in castrate resistant prostate cancer

    Directory of Open Access Journals (Sweden)

    Oliver Sartor

    2015-06-01

    Full Text Available The recent manuscript in New England Journal of Medicine by Antonarakis et al. [1] has important clinical implications. This study evaluates mRNA expression of a particular androgen receptor splice variant-7 (AR-V7, in circulating tumor cells (CTCs from metastatic castrate-resistant prostate cancer (mCRPC patients receiving enzalutamide or abiraterone. The findings were striking, none of the 18 patients with detectable AR-V7 in CTCs had prostate-specific antigen (PSA responses. Further, the median time to PSA progression after enzalutamide or abiraterone treatment was only 1.3-1.4 months in AR-V7-positive patients as compared to 5.3-6.1 months in AR-V7 negative patients. AR-V7 in CTCs was also associated with shorter survival.

  10. Estimation of muscle fatigue by ratio of mean frequency to average rectified value from surface electromyography.

    Science.gov (United States)

    Fernando, Jeffry Bonar; Yoshioka, Mototaka; Ozawa, Jun

    2016-08-01

    A new method to estimate muscle fatigue quantitatively from surface electromyography (EMG) is proposed. The ratio of mean frequency (MNF) to average rectified value (ARV) is used as the index of muscle fatigue, and muscle fatigue is detected when MNF/ARV falls below a pre-determined or pre-calculated baseline. MNF/ARV gives larger distinction between fatigued muscle and non-fatigued muscle. Experiment results show the effectiveness of our method in estimating muscle fatigue more correctly compared to conventional methods. An early evaluation based on the initial value of MNF/ARV and the subjective time when the subjects start feeling the fatigue also indicates the possibility of calculating baseline from the initial value of MNF/ARV.

  11. Mobile phone use for a social strategy to improve antiretroviral refill experience at a low-resource HIV clinic: patient responses from Nigeria.

    Science.gov (United States)

    Adetunji, Adedotun A; Muyibi, Sufiyan A; Imhansoloeva, Martins; Ibraheem, Olusola M; Sunmola, Adegbenga; Kolawole, Olubunmi O; Akinrinsola, Oluwasina O; Ojo-Osagie, James O; Mosuro, Olusola A; Abiolu, Josephine O; Irabor, Achiaka E; Okonkwo, Prosper; Adewole, Isaac F; Taiwo, Babafemi O

    2017-05-01

    In sub-Saharan African areas where antiretroviral (ARV) drugs are not available through community pharmacies, clinic-based pharmacies are often the primary source of ARV drug refills. Social pressure is mounting on treatment providers to adjust ARV refill services towards user-friendly approaches which prioritize patients' convenience and engage their resourcefulness. By this demand, patients may be signalling dissatisfaction with the current provider-led model of monthly visits to facility-based pharmacies for ARV refill. Mobile phones are increasingly popular in sub-Saharan Africa, and have been used to support ARV treatment goals in this setting. A patient-centred response to on-going social pressure requires treatment providers to view ARV refill activities through the eyes of patients who are negotiating the challenges of day-to-day life while contemplating their next refill appointment. Using focus groups of five categories of adult patients receiving combination ARV therapy, we conducted this cross-sectional qualitative study to provide insight into modifiable gaps between patients' expectations and experiences of the use of mobile phones in facility-based ARV refill service at a public HIV clinic in Nigeria. A notable finding was patients' preference for harnessing informal social support (through intermediaries with mobile phones) to maintain adherence to ARV refill appointments when they could not present in person. This evolving social support strategy also has the potential to enhance defaulter tracking. Our study findings may inform the development of ARV refill strategies and the design of future qualitative studies on client-provider communication by mobile phones in under-resourced HIV treatment programmes.

  12. The constraints of antiretroviral uptake in rural areas: the case of Thamaga and surrounding villages, Botswana.

    Science.gov (United States)

    Bene, Matlhogonolo; Darkoh, Michael B K

    2014-01-01

    This article examines the constraints of antiretroviral (ARV) uptake in the villages of Thamaga, Kumakwane, Mankgodi and Gakgatla which are in the Kweneng District of Botswana. The social interactionist approach and theories of health behaviour provided the theoretical basis of the study. Data were obtained by using interviewer-administered questionnaires which were applied to a sample of 145 respondents and 61 people living with HIV/AIDS in the four villages. The results of the study showed that people aged 30-39 years represented the highest proportion of the persons on ARV treatment in the villages. Some of the people living with HIV believed that ARV therapy could better their lives during the initial stages of introduction, but with time, they lost hope and gave up the treatment. Culturally, parents and children in the villages do not discuss sexual matters at home and it was found in the study that there was little communication between parents and children on AIDS and ARV issues. Some churches in the area discouraged the use of ARV. There were also traditional doctors who made their patients mix traditional herbs treatment with ARV treatment. Distance, travel costs, cultural beliefs, stigma and discrimination among others were found to be important socio-economic factors inhibiting ARV uptake. Even though there were constraints on ARV uptake in the villages, efforts were being made by Government and non-governmental organizations to overcome them. The Ministry of Health provided information and education to the public using its strategy known as Information, Education and Communication. Nurses, doctors and chiefs taught people at kgotlas (traditional courts) in the villages about the dangers of the epidemic. Free HIV testing, ARVs and condoms were provided to the villagers. The outlook for ARV uptake looks generally promising for the future. However, if HIV/AIDS is to be contained, sexual behaviour of people in the villages needs to change.

  13. Antiretroviral Treatment Is Associated With Iron Deficiency in HIV-Infected Malawian Women That Is Mitigated With Supplementation, but Is Not Associated With Infant Iron Deficiency During 24 Weeks of Exclusive Breastfeeding.

    Science.gov (United States)

    Widen, Elizabeth M; Bentley, Margaret E; Chasela, Charles S; Kayira, Dumbani; Flax, Valerie L; Kourtis, Athena P; Ellington, Sascha R; Kacheche, Zebrone; Tegha, Gerald; Jamieson, Denise J; van der Horst, Charles M; Allen, Lindsay H; Shahab-Ferdows, Setareh; Adair, Linda S

    2015-07-01

    In resource-limited settings without safe alternatives to breastfeeding, the WHO recommends exclusive breastfeeding and antiretroviral (ARV) prophylaxis. Given the high prevalence of anemia among HIV-infected women, mothers and their infants (through fetal iron accretion) may be at risk of iron deficiency. We assessed the effects of maternal micronutrient-fortified lipid-based nutrient supplements (LNS) and maternal ARV treatment or infant ARV prophylaxis on maternal and infant iron status during exclusive breastfeeding from birth to 24 weeks. The Breastfeeding, Antiretrovirals, and Nutrition study was a randomized controlled trial conducted in Lilongwe, Malawi, from 2004 to 2010. HIV-infected mothers (CD4 >200 cells/μL) and their infants were randomly assigned to 28-week interventions: maternal LNS/maternal ARV (n = 424), maternal LNS/infant ARV (n = 426), maternal LNS (n = 334), maternal ARV (n = 425), infant ARV (n = 426), or control (n = 334). Longitudinal models tested intervention effects on hemoglobin (Hb). In a subsample (n = 537) with multiple iron indicators, intervention effects on Hb, transferrin receptors (TfR), and ferritin were tested with linear and Poisson regression. In longitudinal models, LNS effects on maternal and infant Hb were minimal. In subsample mothers, maternal ARVs were associated with tissue iron depletion (TfR >8.3 mg/L) (risk ratio: 3.1, P 0.1). In subsample infants, interventions were not associated with impaired iron status (all P > 0.1). Maternal ARV treatment with protease inhibitors is associated with maternal tissue iron depletion; but LNS mitigates adverse effects. ARVs do not seem to influence infant iron status; however, extended use needs to be evaluated.

  14. Antiretroviral procurement and supply chain management.

    Science.gov (United States)

    Ripin, David J; Jamieson, David; Meyers, Amy; Warty, Umesh; Dain, Mary; Khamsi, Cyril

    2014-01-01

    Procurement, the country-level process of ordering antiretrovirals (ARVs), and supply chain management, the mechanism by which they are delivered to health-care facilities, are critical processes required to move ARVs from manufacturers to patients. To provide a glimpse into the ARV procurement and supply chain, the following pages provide an overview of the primary stakeholders, principal operating models, and policies and regulations involved in ARV procurement. Also presented are key challenges that need to be addressed to ensure that the supply chain is not a barrier to the goal of universal coverage. This article will cover the steps necessary to order and distribute ARVs, including different models of delivery, key stakeholders involved, strategic considerations that vary depending on context and policies affecting them. The single drug examples given illustrate the complications inherent in fragmented supply and demand-driven models of procurement and supply chain management, and suggest tools for navigating these hurdles that will ultimately result in more secure and reliable ARV provision. Understanding the dynamics of ARV supply chain is important for the global health community, both to ensure full and efficient treatment of persons living with HIV as well as to inform the supply chain decisions for other public health products.

  15. Proteomics analysis of the DF-1 chicken fibroblasts infected with avian reovirus strain S1133.

    Directory of Open Access Journals (Sweden)

    Wen-Ting Chen

    Full Text Available BACKGROUND: Avian reovirus (ARV is a member of the Orthoreovirus genus in the Reoviridae family. It is the etiological agent of several diseases, among which viral arthritis and malabsorption syndrome are the most commercially important, causing considerable economic losses in the poultry industry. Although a small but increasing number of reports have characterized some aspects of ARV infection, global changes in protein expression in ARV-infected host cells have not been examined. The current study used a proteomics approach to obtain a comprehensive view of changes in protein levels in host cells upon infection by ARV. METHODOLOGY AND PRINCIPAL FINDINGS: The proteomics profiles of DF-1 chicken fibroblast cells infected with ARV strain S1133 were analyzed by two-dimensional differential-image gel electrophoresis. The majority of protein expression changes (≥ 1.5 fold, p<0.05 occurred at 72 h post-infection. Matrix-assisted laser desorption ionization time-of-flight mass spectrometry identified 51 proteins with differential expression levels, including 25 that were upregulated during ARV infection and 26 that were downregulated. These proteins were divided into eight groups according to biological function: signal transduction, stress response, RNA processing, the ubiquitin-proteasome pathway, lipid metabolism, carbohydrate metabolism, energy metabolism, and cytoskeleton organization. They were further examined by immunoblotting to validate the observed alterations in protein expression. CONCLUSION/SIGNIFICANCE: This is the first report of a time-course proteomic analysis of ARV-infected host cells. Notably, all identified proteins involved in signal transduction, RNA processing, and the ubiquitin-proteasome pathway were downregulated in infected cells, whereas proteins involved in DNA synthesis, apoptosis, and energy production pathways were upregulated. In addition, other differentially expressed proteins were linked with the cytoskeleton

  16. Antiretroviral drug supply challenges in the era of scaling up ART in Malawi.

    Science.gov (United States)

    Schouten, Erik J; Jahn, Andreas; Ben-Smith, Anne; Makombe, Simon D; Harries, Anthony D; Aboagye-Nyame, Francis; Chimbwandira, Frank

    2011-07-06

    The number of people receiving antiretroviral treatment (ART) has increased considerably in recent years and is expected to continue to grow in the coming years. A major challenge is to maintain uninterrupted supplies of antiretroviral (ARV) drugs and prevent stock outs. This article discusses issues around the management of ARVs and prevention of stock outs in Malawi, a low-income country with a high HIV/AIDS burden, and a weak procurement and supply chain management system. This system for ARVs, paid for by the Global Fund to Fight AIDS, Tuberculosis and Malaria, and bypassing the government Central Medical Stores, is in place, using the United Nations Children's Fund's (UNICEF's) procurement services. The system, managed by a handful of people who spend limited time on supply management, is characterized by a centrally coordinated quantification based on verified data from all national ART clinics, parallel procurement through UNICEF, and direct distribution to ART clinics. The model worked well in the first years of the ART programme with a single first-line ARV regimen, but with more regimens becoming available (e.g., alternative first-line, second-line and paediatric regimens), it has become more difficult to administer. Managing supplies through a parallel system has the advantage that weaknesses in the national system have limited influence on the ARV procurement and supply chain management system. However, as the current system operates without a central warehouse and national buffer stock capacity, it diminishes the ability to prevent ARV stock outs. The process of ordering ARVs, from the time that estimates are made to the arrival of supplies in health facilities, takes approximately one year. Addressing the challenges involved in maintaining ARVs through an efficient procurement and supply chain management system that prevents ARV stock outs through the establishment of a dedicated procurement team, a central warehouse and/or national buffer stock is a

  17. The occurrence of Orthoreovirus, Rotavirus and chicken anemia virus in chickens of the poultry industry in Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    R.L. Rios

    2012-12-01

    Full Text Available Fifty-four fecal samples taken from broiler chickens from 1 to 45 days of age, and of pullets from 10 to 13 weeks of age, original from eight different poultry regions in the state of Minas Gerais, Brazil, were collected from March 2008 to January 2010 for avian Orthoreovirus (ARV and avian Rotavirus (AvRV analyses. For the assay of ARV, RNA was immediately extracted (Trizolâ and transcribed into cDNA for assaying in a nested-PCR with ARV-specific primers. For AvRV, polyacrylamide gel electrophoresis (PAGE was performed with RNA extracts obtained by phenol-chloroform extraction. CAV was additionally investigated through a nested-PCR of thymus and spleen. Results found 5.55% positive for ARV and 9.25% for AvRV. Also, CAV and ARV genomes were detected in co-infection, in a highly prostrated and claudicating chicken flock. No ARV or AvRV infections were detected in pullets. Material of a clinically affected flock was inoculated into SPF embryos, resulting in embryonic hemorrhage, whitish foci in the chorio-allantoic membrane and death. Sequencing of ARV amplicons and isolate cDNA grouped local strains with the ARV S1133 strain, historically used in live vaccines, suggesting the continued circulation of this vaccine virus strain in intensive poultry regions. Detection rates for ARV and AvRV, as well as the presence of CAV, were additionally indicative of failing biosecurity strategies for the intensive poultry regions examined.

  18. Early infant feeding patterns and HIV-free survival: findings from the Kesho-Bora trial (Burkina Faso, Kenya, South Africa).

    Science.gov (United States)

    Cournil, Amandine; Van de Perre, Philippe; Cames, Cécile; de Vincenzi, Isabelle; Read, Jennifer S; Luchters, Stanley; Meda, Nicolas; Naidu, Kevi; Newell, Marie-Louise; Bork, Kirsten

    2015-02-01

    To investigate the association between feeding patterns and HIV-free survival in children born to HIV-infected mothers and to clarify whether antiretroviral (ARV) prophylaxis modifies the association. From June 2005 to August 2008, HIV-infected pregnant women were counseled regarding infant feeding options, and randomly assigned to triple-ARV prophylaxis (triple ARV) until breastfeeding cessation (BFC) before age 6 months or antenatal zidovudine with single-dose nevirapine (short-course ARV). Eighteen-month HIV-free survival of infants HIV-negative at 2 weeks of age was assessed by feeding patterns (replacement feeding from birth, BFC <3 months, BFC ≥3 months). Of the 753 infants alive and HIV-negative at 2 weeks, 28 acquired infection and 47 died by 18 months. Overall HIV-free survival at 18 months was 0.91 [95% confidence interval (CI): 0.88-0.93]. In the short-course ARV arm, HIV-free survival (0.88; CI: 0.84-0.91) did not differ by feeding patterns. In the triple ARV arm, overall HIV-free survival was 0.93 (CI: 0.90-0.95) and BFC <3 months was associated with lower HIV-free survival than BFC ≥3 months (adjusted hazard ratio: 0.36; CI: 0.15-0.83) and replacement feeding (adjusted hazard ratio: 0.20; CI: 0.04-0.94). In the triple ARV arm, 4 of 9 transmissions occurred after reported BFC (and 5 of 19 in the short-course arm), indicating that some women continued breastfeeding after interruption of ARV prophylaxis. In resource-constrained settings, early weaning has previously been associated with higher infant mortality. We show that, even with maternal triple-ARV prophylaxis during breastfeeding, early weaning remains associated with lower HIV-free survival, driven in particular by increased mortality.

  19. Clinical manifestations and treatment outcomes in HIV-1-infected children receiving antiretroviral therapy in Karachi, Pakistan.

    Science.gov (United States)

    Mir, Fatima; Qamar, Farah Naz; Baig-Ansari, Naila; Abro, Azra Ghayas; Abbas, Syed Qamar; Kazi, Mohammed Ahmed; Rizvi, Arjumand; Zaidi, Anita Kaniz Mehdi

    2014-04-15

    The impact of antiretroviral (ARV) therapy on immunological and growth parameters in HIV-positive children in Pakistan has not been reported to date. A retrospective chart review of children diagnosed with HIV at the Sindh AIDS Control Proigramme (SACP) and registered at the Aga Khan University, Karachi, between January 2005 and 2013 was conducted, evaluating clinical and laboratory profiles of HIV+ ARV+ children for ARV impact (serial height and weight CD4 and viral counts). Twenty-four children were diagnosed and registered as HIV positive over five years, and 20 were started on ARV. Six were excluded from analysis (ARV duration treatment failure at a median duration of 25 weeks (IQR 18-32) on ARV and underwent resistance genotyping. All nine had NNRTI resistance, two had high-grade NRTI resistance (≥ 4 thymidine analog mutations). Median age at start of ARV was 71.5 weeks (IQR 37.5-119). Median baseline weight for age (WAZ) and height for age (HAZ) z-scores changed from -1.94 to 1.69 and -1.99 to -1.59, respectively, after six months of therapy. Median CD4 percentage and viral load at baseline changed from 13.8 to 17.8, while viral load changed from 285 × 104 copies to zero at six months. ARV improved absolute CD4 and viral counts. Weight and height did not  improve significantly, highlighting the need for aggressive nutritional rehabilitation. Early development of ARV resistance in these children requires formal assessment.

  20. Confocal fluorescence microscopy: An ultra-sensitive tool used to evaluate intracellular antiretroviral nano-drug delivery in HeLa cells

    Science.gov (United States)

    Mandal, Subhra; Zhou, You; Shibata, Annemarie; Destache, Christopher J.

    2015-08-01

    In the last decade, confocal fluorescence microscopy has emerged as an ultra-sensitive tool for real-time study of nanoparticles (NPs) fate at the cellular-level. According to WHO 2007 report, Human Immunodeficiency Virus/Acquired Immunodeficiency Syndrome (HIV/AIDS) is still one of the world's major health threats by claiming approximately 7,000 new infections daily worldwide. Although combination antiretroviral drugs (cARV) therapy has improved the life-expectancy of HIV-infected patients, routine use of high doses of cARV has serious health consequences and requires complete adherence to the regimen for success. Thus, our research goal is to fabricate long-acting novel cARV loaded poly(lactide-co-glycolic acid) (PLGA) nanoparticles (cARV-NPs) as drug delivery system. However, important aspects of cARV-NPs that require special emphasis are their cellular-uptake, potency, and sustained drug release efficiency over-time. In this article, ultra-sensitive confocal microscopy is been used to evaluate the uptake and sustained drug release kinetics of cARV-NPs in HeLa cells. To evaluate with the above goal, instead of cARV-drug, Rhodamine6G dye (fluorescent dye) loaded NPs (Rho6G NPs) have been formulated. To correlate the Rhodamin6G release kinetics with the ARV release from NPs, a parallel HPLC study was also performed. The results obtained indicate that Rho6G NPs were efficiently taken up at low concentration (treatment. Therefore, high drug assimilation and sustained release properties of PLGA-NPs make them an attractive vehicle for cARV nano-drug delivery with the potential to reduce drug dosage as well as the number of drug administrations per month.

  1. Presence of Apis Rhabdovirus-1 in Populations of Pollinators and Their Parasites from Two Continents

    Directory of Open Access Journals (Sweden)

    Sofia Levin

    2017-12-01

    Full Text Available The viral ecology of bee communities is complex, where viruses are readily shared among co-foraging bee species. Additionally, in honey bees (Apis mellifera, many viruses are transmitted – and their impacts exacerbated – by the parasitic Varroa destructor mite. Thus far, the viruses found to be shared across bee species and transmitted by V. destructor mites are positive-sense single-stranded RNA viruses. Recently, a negative-sense RNA enveloped virus, Apis rhabdovirus-1 (ARV-1, was found in A. mellifera honey bees in Africa, Europe, and islands in the Pacific. Here, we describe the identification – using a metagenomics approach – of ARV-1 in two bee species (A. mellifera and Bombus impatiens and in V. destructor mites from populations collected in the United States and Israel. We confirmed the presence of ARV-1 in pools of A. mellifera, B. impatiens, and V. destructor from Israeli and U.S. populations by RT-PCR and found that it can reach high titers in individual honey bees and mites (107–108 viral genomic copies per individual. To estimate the prevalence of ARV-1 in honey bee populations, we screened 104 honey bee colonies across Israel, with 21 testing ARV-1-positive. Tagged-primer-mediated RT-PCR analysis detected the presence of the positive-sense ARV-1 RNA in A. mellifera and V. destructor, indicating that ARV-1 replicates in both hosts. This is the first report of the presence of ARV-1 in B. impatiens and of the replication of a rhabdovirus in A. mellifera and V. destructor. Our data suggest that Varroa mites could act as an ARV-1 vector; however, the presence of ARV-1 in B. impatiens (which are not parasitized by Varroa suggests that it may not require the mite for transmission and ARV-1 may be shared among co-foraging bee species. Given that ARV-1 is found in non-Apis bee species, and because “ARV” is used for the Adelaide River virus, we propose that this virus should be called bee rhabdovirus 1 and abbreviated BRV-1

  2. The PHACS SMARTT Study: Assessment of the Safety of In Utero Exposure to Antiretroviral Drugs

    Directory of Open Access Journals (Sweden)

    Russell Barrett Van Dyke

    2016-05-01

    Full Text Available The Surveillance Monitoring for ART Toxicities (SMARTT cohort of the Pediatric HIV/AIDS Cohort Study (PHACS includes over 3500 HIV-exposed but uninfected (HEU infants and children at 22 sites in the U.S. including Puerto Rico. The goal of the study is to determine the safety of in utero exposure to antiretrovirals (ARV and to estimate the incidence of adverse events. Domains being assessed include metabolic, growth and development, cardiac, neurological, neurodevelopmental, behavior, language, and hearing. SMARTT employs an innovative trigger-based design as an efficient means to identify and evaluate adverse events. Participants who met a predefined clinical or laboratory threshold (trigger undergo additional evaluations to define their case status. After adjusting for birth cohort and other factors, there was no significant increase in the likelihood of meeting overall case status (case in any domain with exposure to combination ARVs (cARV, any ARV class, or any specific ARV. However, several individual ARVs were significantly associated with case status in individual domains, including zidovudine for a metabolic case, first trimester stavudine for a language case, and didanosine plus stavudine for a neurodevelopmental case. We found an increased rate of preterm birth with first trimester exposure to protease inhibitor-based cARV. Although there was no overall increase in congenital anomalies with first trimester cARV, a significant increase was seen with exposure to atazanavir, ritonavir, and didanosine plus stavudine. Tenofovir exposure was associated with significantly lower mean whole-body bone mineral content in the newborn period and a lower length and head circumference at 1 year of age. With neurodevelopmental testing at 1 year of age, specific ARVs (atazanavir, ritonavir-boosted lopinavir, nelfinavir, and tenofovir were associated with lower performance, although all groups were within the normal range. No ARVs or classes were

  3. Open Communication and Discussion Facilitate Reconciliation: The Maimonides Approach to Publication of Manduca’s Letter in The Lancet

    Directory of Open Access Journals (Sweden)

    Shraga Blazer

    2015-01-01

    Full Text Available [Extract] Dear Friends and Colleagues, In August of 2014, Manduca P et al. published “An open letter for the people in Gaza” in The Lancet. This letter was the response of those authors to their perspective of what was happening in Gaza during the summer-long conflict between Israel and Gaza. Israel was finally responding to years of bombardment from Gaza into civilian areas in the south of Israel. Two of the authors of the letters were known anti-Semites, and held connections with David Duke, a former Ku Klux Klan Grand Wizard in Louisiana and advocate of Nazism. Both these authors expressed sympathy and support for Duke’s rabidly anti-Jewish positions. In their letter they accused Israel’s medical community of complicity in committing terrible atrocities and even implied that chemical warfare was being used by Israel. ...

  4. Eesti kõrgkoolilõpetajate toimetulek tööturul / Kerly Espenberg, Raul Eamets, Aivi Themas

    Index Scriptorium Estoniae

    Espenberg, Kerly, 1982-

    2011-01-01

    Tuginedes viimase vilistlasuuringu andmetele, otsitakse vastust küsimusele, miks hoolimata riigieelarveliste kohtade vähesusest on sotsiaalteaduste valdkonnas tudengite arv kõrgem kui loodus- ja täppisteadustes

  5. Safeguarding maternal and child health in South Africa by starting ...

    African Journals Online (AJOL)

    India, rows 4 and 5; Nepal, row 8), to women aged >19 ...... corruption risks. Use existing structures for CSG applications when transitioning pregnancy support to a CSG. ARVs = antiretrovirals; PMTCT = prevention of mother-to-child transmission of ...

  6. Evaluation of 4 weeks' neonatal antiretroviral prophylaxis as a component of a prevention of mother-to-child transmission program in a resource-rich setting.

    LENUS (Irish Health Repository)

    Ferguson, Wendy

    2011-05-01

    In resource-rich settings, universal adoption of a 4- rather than 6-week neonatal antiretroviral (ARV) prophylaxis regimen could reduce toxicity and results in cost savings, provided prevention of mother-to-child transmission program effectiveness is not compromised.

  7. HIV Resistance Testing

    Science.gov (United States)

    ... 14, 2016 Select a Language: Fact Sheet 126 HIV Resistance Testing WHAT IS RESISTANCE? HOW DOES RESISTANCE ... ARVs. If you miss doses of your medications, HIV will multiply more easily. More mutations will occur. ...

  8. Fatigue with HIV/AIDS

    Science.gov (United States)

    ... hormones such as DHEA (see Fact Sheet 724) , cortisol or thyroid can cause similar problems. Hormone levels ... fatigue and a lack of interest in daily activities. There is no blood test ... sexual functioning. Also, some antidepressants interact with some ARVs, ...

  9. Androgen Receptor Splice Variants and Resistance to Taxane Chemotherapy

    Science.gov (United States)

    2015-10-01

    were generated by subcloning the cDNAs from the TA plas- mids into the SalI and XhoI sites of the pBiFC-VN155 and pBiFC- VC155 vectors. Themutant... subcloning the AR-FL, AR-V7, and ARv567es cDNA from the respective TA plasmids into the BamHI and XbaI sites of the pcDNA3.1-RLuc8.6 and TurboFP635 vectors...24). The doxy- cycline-inducible ARv567es lentiviral construct was generated by subcloning the ARv567es cDNA from its TA plasmid first into the

  10. Problems Associated With Substandard And Counterfeit Drugs In ...

    African Journals Online (AJOL)

    Problems Associated With Substandard And Counterfeit Drugs In Developing Countries: A Review Article On Global Implications Of Counterfeit Drugs In The Era Of Anti-Retroviral (ARVS) Drugs In A Free Market Economy.

  11. The Trans Pacific Partnership Agreement and access to HIV treatment in Vietnam.

    Science.gov (United States)

    Moir, Hazel V J; Tenni, Brigitte; Gleeson, Deborah; Lopert, Ruth

    2018-04-01

    In the Trans Pacific Partnership (TPP) Agreement negotiations, the USA successfully pursued intellectual property (IP) provisions that will affect the affordability of medicines, including anti-retrovirals (ARV) for HIV. Vietnam has the lowest GDP per capita of the 12 TPP countries and in 2013 provided ARVs for only 68% of eligible people living with HIV. Using the current Vietnamese IP regime as our base case, we analysed the potential impact of a regime making full use of legal IP flexibilities, and one based on the IP provisions of the final, agreed TPP text. Results indicate that at current funding levels 82% of Vietnam's eligible people living with HIV would receive ARVs if legal flexibilities were fully utilised, while as few as 30% may have access to ARVs under the TPP Agreement - more than halving the proportion currently treated.

  12. Remarks on semantic peculiarities of numerals and on usage of numerals in several kinds of texts / Larissa Naiditch

    Index Scriptorium Estoniae

    Naiditch, Larissa

    2001-01-01

    Tähelepanu pööratakse juhtudele, kui arvsõna semantika ei piirdu objektide loendamise, järjestuse või arvu ideega. Analüüsitakse nende kasutamist folklooritekstides ja propagandistlikes tekstides

  13. Eesti toidukaupade positsioon siseturul 2007. aasta mais / V. Vähi, P. Liivaauk

    Index Scriptorium Estoniae

    Vähi, V.

    2007-01-01

    Kodumaise toidukauba osakaalust Eesti kauplustes kaubagruppide järgi 2007. aasta mais. Tabelid: Toidukaupade sortimendi laius (nimetuste arv keskmiselt turul); Kodumaiste ja importtoodete osakaal käibes

  14. Kvoodiäri remondib riigi dividendilehma kaunimaid maju / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2011-01-01

    CO₂ kvoodirahaga hoonete energiasäästvaks muutmise objektide valik: raha saavad RMK kontorid. Kirikud jäid rahata. Valikutingimused: CO₂ sääst, kasusaajate arv, regionaalsed piirsummad, järjekord

  15. Куда идут деньги от продажи квот на CO₂ / Нильс Нийтра

    Index Scriptorium Estoniae

    Нийтра, Нильс, 1975-

    2011-01-01

    CO₂ kvoodirahaga hoonete energiasäästvaks muutmise objektide valik: raha saavad RMK kontorid. Kirikud jäid rahata. Valikutingimused: CO₂ sääst, kasusaajate arv, regionaalsed piirsummad, järjekord

  16. Estonian spas trade in good feeling = SPAd müüvad head enesetunnet / Ulli Sats

    Index Scriptorium Estoniae

    Sats, Ulli

    2005-01-01

    Vee- ja tervisekeskuste rajamisest Eestis, mis pakuvad klientidele erinevaid lõõgastumise võimalusi. Lisad: Suuremad SPAd Eestis; Levinumate teenuste hinnad. Vt. samas: Eestit külastavate turistide arv suureneb

  17. Original Research

    African Journals Online (AJOL)

    2013-12-15

    Table 2). Table 2: HIV related characteristics of study participant attending ARV treatment units Nekemte, Ethiopia,. May 2012. Characteristics. Number. (%). Duration of HIV diagnosis (in year) (n=456). Less than or equal to 2.

  18. Business full of optimism

    Index Scriptorium Estoniae

    2004-01-01

    Ülevaade reklaamindusest Baltimaades - ideede leidmine, töötajate professionaalsus, turu kujunemine, integreeritud turunduse teenus jm. Tabelid: Eesti ja Leedu agentuuride reiting ; Töötajate arv reklaamiagentuurides 2003

  19. Koos saavutab Brüsselis rohkem / Tõnis Kõiv

    Index Scriptorium Estoniae

    Kõiv, Tõnis, 1970-

    2003-01-01

    Regioonide Komitee on Euroopa Liidu lepingu alusel loodud nõuandev organ, kuhu kuulus seni 222 kohalike omavalitsuste esindajat, seoses uute riikide lisandumisega see arv kasvab. Eesti esindajad regioonide Komitees

  20. Supply Chain Shipment Pricing Data

    Data.gov (United States)

    US Agency for International Development — This data set provides supply chain health commodity shipment and pricing data. Specifically, the data set identifies Antiretroviral (ARV) and HIV lab shipments to...

  1. Kolm murdepunkti Eesti sisepoliitikas 1918-1934 / Ago Pajur

    Index Scriptorium Estoniae

    Pajur, Ago, 1962-

    2008-01-01

    Parlamentaarse demokraatia perioodi murdepunktidest. Esimene murdepunkt : 1920. aasta põhiseadus. Teine murdepunkt : kommunistide putšikatse. Kolmas murdepunkt : Suur depressioon. Tabelid: Erakondade esindatus Riigikogu teises, kolmandas ja neljandas koosseisus ; V Riigikogu erakondliku koosseise muutumine (kohtade arv)

  2. Plaadid / Tiit Kusnets

    Index Scriptorium Estoniae

    Kusnets, Tiit

    2004-01-01

    Uutest plaatidest Luavrik Luavrik "Passioon & Fuuga", Arve Henriksen "Chiaroscuro", Bullfrog Brown "Mudhole Stories", "Scoonby-Doo 2", Bela fleck & Edgar Mayer "Music For Two", Christiana Milian "It's About Time"

  3. Statistika = Statistics

    Index Scriptorium Estoniae

    2004-01-01

    Andmeid maksuameti töötajate jagunemisest hariduse, soo, staazhi, vanuse järgi; koolitused 2001-2003, koolitusel osalejate arv; füüsilise isiku tuludeklaratsioon; tulu- ja sotsiaalmaksu maksudeklaratsioon; käibedeklaratsioon

  4. Indiast saab maailma rahvarohkeim riik / Tõnu Prei

    Index Scriptorium Estoniae

    Prei, Tõnu, 1950-

    2005-01-01

    ÜRO rahvastikuraporti andmeil on maakera elanike arv 2050. a. 9,1 miljardit, kusjuures poole 2,6-miljardilisest juurdekasvust annavad vaid 9 riiki - India, Pakistan, Nigeeria, Kongo, Bangladesh, Uganda, USA, Etioopia ja Hiina

  5. Download this PDF file

    African Journals Online (AJOL)

    abp

    2013-09-29

    %). ... and adolescents may refuse to take medication especially as the ... influencing adherence to ARV treatment in our paediatric population. Methods. This was a cross-sectional survey of children and adolescents aged.

  6. Eesti ettevõtete kaubavahetus tehnoloogilisuse vaatepunktist = Trade of Estonia's enterprises from point of view of technology / Riina Kerner

    Index Scriptorium Estoniae

    Kerner, Riina

    2011-01-01

    Tööstusharude jaotus tehnoloogilise intensiivsuse järgi. Töötleva tööstuse kaubavahetuse areng ja statistika, teadlaste ja inseneride arv. Eesti võrdlus teiste Euroopa Liidu riikidega. Tabelid

  7. Eesti loomakasvatus 2006. aastal / Matti Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Matti, 1947-

    2007-01-01

    Eesti Statistikaameti ning Põllumajandusministeeriumi koostatud 2006. aasta loomakasvatuse andmete analüüs. Tabelid: Loomade ja lindude arv seisuga 31. detsember; Lihatoodang elusmassis 2005. ja 2006. aastal; Prognoositav lihatoodang tapamassis 2005. ja 2006. aastal

  8. The size of second chambers and European assemblies / Rein Taagepera, Steven P Recchia

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2002-01-01

    Autorid võrdlevad eri maade esinduskogude kodade suurust ja elanike arvu neis maades ning arutlevad, kui suur kohtade arv peaks olema Euroopa Liidu Nõukogus ja Euroopa Parlamendis. Tabelid, diagrammid

  9. Riigikogu roll riigieelarve kujunemisel / Olev Raju

    Index Scriptorium Estoniae

    Raju, Olev, 1948-

    2003-01-01

    Lisatud tabelid: Eesti Vabariigi riigieelarve koostamist ja täitmist iseloomustavaid arve 1993-2003 (miljonites kroonides) ; muudatusettepanekud riigieelarve eelnõu menetlemisel Riigikogus aastail 1993-2003

  10. Sõdurid annavad politseile tööd / Toomas Herm

    Index Scriptorium Estoniae

    Herm, Toomas, 1961-

    2018-01-01

    Kokkuvõte eelmisel aastal Lääne-Virumaal toime pandud kuritegudest. Eelmisel aastal kasvas maakonnas narkootikumidega seotud väärtegude arv, milles suurt rolli mängis Tapal baseeruv 1. jalaväepataljon

  11. FAKTOR –FAKTOR PENDUKUNG KEPATUHAN ORANG DENGAN HIV AIDS (ODHA DALAM MINUM OBAT ANTIRETROVIRAL DI KOTA BANDUNG DAN CIMAHI

    Directory of Open Access Journals (Sweden)

    Yuyun Yuniar

    2013-08-01

    Full Text Available Abstract Adherence to ARV (antiretroviral was aimed to siginificantly prolong the life expectancy of people living with HIV AIDS (PLHIV. ARVs fight against the infection by slowing down the reproduction of HIV in human body. This research aimed to identify the internal and external factors that support adherence to ARV therapy.  Submit : 25-05-2012  Review : 26-06-2012 Review : 10-07-2012 revisi : 10–09-2012 This research was a qualitative research conducted in Bandung and Cimahi districts, West Java province from September to November 2011. Data collected by doing in depth interview with related stakeholders, they were district health office staffs in Bandung and Cimahi, Local AIDS Commission staffs in Bandung and Cimahi, Bungsu hospital in Bandung, Cibabat hospital in Cimahi, NGO staff, and 10 PLHIVs who ever or still consuming ARV. Data were analyzed descriptively by triangulation and content analysis methods. It was concluded that the internal supporting factors of adherence to ARV were the motivation to live longer, the eagerness to get cured and to be healthy, considering ARV as vitamin, and the faith in their own religion. Besides, the availability of ARV and social supports were other supporting factors. The social supports were support from family, responsibility and affection for their children, willingness to get married, support from peer groups, NGO staffs, and religion figures, and good relationship with health provider staffs. The internal factors should be improved by motivating PLHIVs while external factors should include family, peer groups, NGO staff and health provider, provide better accessibility and affordability to ARV, and educate the society. Keywords: PLHIV, Adherence, ARV Abstrak Kepatuhan Penggunaan ARV (antiretroviral merupakan salah satu faktor yang dapat memperpanjang umur harapan hidup ODHA (orang dengan HIV AIDS secara bermakna. ARV bekerja melawan infeksi dengan cara memperlambat reproduksi HIV dalam tubuh

  12. Robotic Technologies for the Future Force - The ART STO

    National Research Council Canada - National Science Library

    Jaster, Jeffrey F

    2005-01-01

    .... The US Army's ARV Robotic Technologies (ART) Science and Technology Objective (STO) will develop a surrogate platform that will be used as a technology demonstrator for such robotic technologies...

  13. Elutähtsatele teenustele koidab reform / Oliver Kund

    Index Scriptorium Estoniae

    Kund, Oliver

    2014-01-01

    Osana laiapindse riigikaitse ülesehitamisest on kavas elutähtsate teenuste arv praeguse 45ga võrreldes kokku tõmmata. Nii loodetakse tõsta teenuste olulisust ja nende tagamise nimel pingutataks rohkem

  14. RAK-i toetused põllumajandusele ja maaelule / Vivia Aunapuu

    Index Scriptorium Estoniae

    Aunapuu, Vivia

    2004-01-01

    Euroopa Liidu tõukefondide kaudu, läbi Eesti riikliku arengukava toetatakse põllumajandust ja maaelu aastatel 2004-2006 kokku 1,2 miljardi krooni suuruses summas. Diagramm: Esitatud taotluste arv maakonniti

  15. KARAKTERISTIK IBU RUMAH TANGGA DENGAN HIV AIDS DI RUMAH SAKIT UMUM

    Directory of Open Access Journals (Sweden)

    Tri Hastuti

    2017-07-01

    Full Text Available Abstract: The new paradigm of UNAIDS Global goal is Zero AIDS -related death, this can be achieved if patients come to HIV care and getARV therapy as soon as possible. The purpose of this study is to knowthe characteristics of housewives with HIV AIDS. This type of researchis descriptive. The sample of the study was housewives with HIV AIDSat Reproductive Health Center in Merauke with 30 respondents withtotal sampling. The majority of respondents were married (63.3%, aged< 35 years (60.0%, highly educated (60.0%, receiving family support(90.0% and complying with ARV (83.3%. Housewives with HIVAIDS at Merauke hospitals receive family support and are obedient totaking ARVs.Keywords: housewife, ARV, HIV / AIDS

  16. Care of HIV-exposed and HIV-infected neonates

    African Journals Online (AJOL)

    transmission. (PMTCT) intervention programme. Important milestones achieved in 2012 include: (1) an estimated 83% of all pregnant women living with HIV in South Africa received antiretrovirals. (ARVs) for PMTCT, (2) early vertical transmission of ...

  17. Kinnisvarafirmade kodulehed väärivad keskmiselt hinnet "4" / Monica Raud

    Index Scriptorium Estoniae

    Raud, Monica, 1981-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 24. aug. lk. 22. Hinnang Eesti tuntumate kinnisvarafirmade kodulehekülgedele. Tabel: Arco Vara kodulehekülg kogus kõige rohkem punkte. Lisa: Pakkumiste arv erineb suuresti

  18. Vabadusvõitleja Eerik Heine Teises maailmasõjas / Karl Hein

    Index Scriptorium Estoniae

    Hein, Karl

    2012-01-01

    Arved Viirlaidi romaanist "Ristideta hauad" (1952) ning Eerik Hormi romaanisarjast ("Vaim ja ahelad" (1961), "Kustuvad tuled" (1965), "Sadu jõkke" (1965), "Kes tappis Eerik Hormi?" (1974), "Surnud ei loe" (1975))

  19. Estonian universities struggle for students / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2005-01-01

    Haridus- ja teadusminister Mailis Reps usub, et ülikoolilõpetajate arv kahaneb 2015. aastaks praeguselt 11 000-lt 6000-ni. Kõrg- ja ülikoolid avavad välistudengite ligimeelitamiseks järjest rohkem inglisekeelseid õppevorme

  20. Virtuaalmaailmad ja suhtlemise sajand / Daniel Vaarik

    Index Scriptorium Estoniae

    Vaarik, Daniel, 1973-

    2007-01-01

    Virtuaalsed maailmad, tuntud kui "sünteetilised maailmad", on oma praeguse kuju saanud arvutimängude ning suhtlusprogrammide liitumisest. Iga 18 kuuga virtuaalmaailmade arv kahekordistub. Lisa: Virtuaalmaailmad

  1. Critical review of empirical research dealing with the relationship between optimistic tendencies and HIV related behaviors

    Directory of Open Access Journals (Sweden)

    Carolina Santillán Torres Torija

    2010-12-01

    Full Text Available Many variables related to risk of HIV infection, progression of the disease andadherence to antiretroviral drug therapy have been studied from different approaches.This review incorporates a group of studies including optimism as avariable related to Positive Psychology and HIV/AIDS, to explain how it interactswith: sexual risk behaviors, disease progression and adherence to antiretroviral(ARV therapy. Refereed academic journals published from 1994 to 2009, wereaccessed from the EBSCO database. Subject Terms were related both to HIVand optimism. Articles were arranged into three classifications: infection, diseaseprogression and ARV therapy adherence. The review included 32 articles carriedout mainly in the USA. Most articles showed significant relationships betweenoptimism and risk behaviors, disease progression and ARV adherence. This studyconcluded that more research in evaluation of optimism, and optimism relatedinterventions should be made to disentangle the complex relationship it has withsex risk behaviors, disease progression and adherence to ARV Therapy. Moderateoptimism appears to be a predictor to health related sexual behaviors.

  2. The Parliamentary Legislative Process in the Accession Countries of the Western Balkans / Zsolt Szabó

    Index Scriptorium Estoniae

    Szabó, Zsolt

    2015-01-01

    Õigusaktide menetlemisest ja vastuvõtmisest Balkani riikide parlamentides. Ka põhiandmed nende riikide parlamentide kohta (parlamendi ingliskeelne ja omakeelne nimetus, liikmete ja komiteede arv jne)

  3. Pensionisammaste menu kasvab hoogsalt / Hindrek Riikoja

    Index Scriptorium Estoniae

    Riikoja, Hindrek

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 20. juuli lk. 9. Igal aastal kahekordistub Eestis nende inimeste arv, kes paigutab oma raha kolmandasse pensionisambasse, koos teise sambaga on kogumispensioniga liitunud 497 000 eestimaalast. Diagramm: Kogumispension

  4. Suvekino pakub tummfilmi "Tartüff Live !" ja kontserti / Kristiina Vaarik

    Index Scriptorium Estoniae

    Vaarik, Kristiina

    2005-01-01

    8. septembril näidatakse Viljandi kultuurimaja hoovis saksa tummfilmi klassikasse kuuluvat Fr.W. Murnau filmi "Tartüff" (1925), mida saadab kohapeal Ardo Ran Varrese originaalmuusika "Tartüff live" ARV Ensemble esituses

  5. Rõnok polutshil signal / Kairi Teesalu

    Index Scriptorium Estoniae

    Teesalu, Kairi

    2008-01-01

    Eluasemeturul on müügipakkumiste arv hakanud sujuvalt langema, olles kahanenud sõltuvalt linnast kuni paarikümne protsendi võrra. Diagramm: Tartu ja Tallinna korteriturg. Kommenteerivad Tõnu Toompark ja Maia Daljajev

  6. Collaborative update of a rule-based expert system for HIV-1 genotypic resistance test interpretation.

    Science.gov (United States)

    Paredes, Roger; Tzou, Philip L; van Zyl, Gert; Barrow, Geoff; Camacho, Ricardo; Carmona, Sergio; Grant, Philip M; Gupta, Ravindra K; Hamers, Raph L; Harrigan, P Richard; Jordan, Michael R; Kantor, Rami; Katzenstein, David A; Kuritzkes, Daniel R; Maldarelli, Frank; Otelea, Dan; Wallis, Carole L; Schapiro, Jonathan M; Shafer, Robert W

    2017-01-01

    HIV-1 genotypic resistance test (GRT) interpretation systems (IS) require updates as new studies on HIV-1 drug resistance are published and as treatment guidelines evolve. An expert panel was created to provide recommendations for the update of the Stanford HIV Drug Resistance Database (HIVDB) GRT-IS. The panel was polled on the ARVs to be included in a GRT report, and the drug-resistance interpretations associated with 160 drug-resistance mutation (DRM) pattern-ARV combinations. The DRM pattern-ARV combinations included 52 nucleoside RT inhibitor (NRTI) DRM pattern-ARV combinations (13 patterns x 4 NRTIs), 27 nonnucleoside RT inhibitor (NNRTI) DRM pattern-ARV combinations (9 patterns x 3 NNRTIs), 39 protease inhibitor (PI) DRM pattern-ARV combinations (13 patterns x 3 PIs) and 42 integrase strand transfer inhibitor (INSTI) DRM pattern-ARV combinations (14 patterns x 3 INSTIs). There was universal agreement that a GRT report should include the NRTIs lamivudine, abacavir, zidovudine, emtricitabine, and tenofovir disoproxil fumarate; the NNRTIs efavirenz, etravirine, nevirapine, and rilpivirine; the PIs atazanavir/r, darunavir/r, and lopinavir/r (with "/r" indicating pharmacological boosting with ritonavir or cobicistat); and the INSTIs dolutegravir, elvitegravir, and raltegravir. There was a range of opinion as to whether the NRTIs stavudine and didanosine and the PIs nelfinavir, indinavir/r, saquinavir/r, fosamprenavir/r, and tipranavir/r should be included. The expert panel members provided highly concordant DRM pattern-ARV interpretations with only 6% of NRTI, 6% of NNRTI, 5% of PI, and 3% of INSTI individual expert interpretations differing from the expert panel median by more than one resistance level. The expert panel median differed from the HIVDB 7.0 GRT-IS for 20 (12.5%) of the 160 DRM pattern-ARV combinations including 12 NRTI, two NNRTI, and six INSTI pattern-ARV combinations. Eighteen of these differences were updated in HIVDB 8.1 GRT-IS to reflect the

  7. Collaborative update of a rule-based expert system for HIV-1 genotypic resistance test interpretation.

    Directory of Open Access Journals (Sweden)

    Roger Paredes

    Full Text Available HIV-1 genotypic resistance test (GRT interpretation systems (IS require updates as new studies on HIV-1 drug resistance are published and as treatment guidelines evolve.An expert panel was created to provide recommendations for the update of the Stanford HIV Drug Resistance Database (HIVDB GRT-IS. The panel was polled on the ARVs to be included in a GRT report, and the drug-resistance interpretations associated with 160 drug-resistance mutation (DRM pattern-ARV combinations. The DRM pattern-ARV combinations included 52 nucleoside RT inhibitor (NRTI DRM pattern-ARV combinations (13 patterns x 4 NRTIs, 27 nonnucleoside RT inhibitor (NNRTI DRM pattern-ARV combinations (9 patterns x 3 NNRTIs, 39 protease inhibitor (PI DRM pattern-ARV combinations (13 patterns x 3 PIs and 42 integrase strand transfer inhibitor (INSTI DRM pattern-ARV combinations (14 patterns x 3 INSTIs.There was universal agreement that a GRT report should include the NRTIs lamivudine, abacavir, zidovudine, emtricitabine, and tenofovir disoproxil fumarate; the NNRTIs efavirenz, etravirine, nevirapine, and rilpivirine; the PIs atazanavir/r, darunavir/r, and lopinavir/r (with "/r" indicating pharmacological boosting with ritonavir or cobicistat; and the INSTIs dolutegravir, elvitegravir, and raltegravir. There was a range of opinion as to whether the NRTIs stavudine and didanosine and the PIs nelfinavir, indinavir/r, saquinavir/r, fosamprenavir/r, and tipranavir/r should be included. The expert panel members provided highly concordant DRM pattern-ARV interpretations with only 6% of NRTI, 6% of NNRTI, 5% of PI, and 3% of INSTI individual expert interpretations differing from the expert panel median by more than one resistance level. The expert panel median differed from the HIVDB 7.0 GRT-IS for 20 (12.5% of the 160 DRM pattern-ARV combinations including 12 NRTI, two NNRTI, and six INSTI pattern-ARV combinations. Eighteen of these differences were updated in HIVDB 8.1 GRT-IS to reflect

  8. Evaluación de los impactos medioambientales de los proyectos de construcción

    OpenAIRE

    Adnan Enshassi; Bernd Kochendoerfer; Ehsan Rizq

    2014-01-01

    El sector de la construcción es considerado mundialmente como una de las principales fuentes de contaminación medioambiental, pues produce enormes efectos negativos en el medioambiente ya sea directa o indirectamente. La Franja de Gaza está experimentando un aumento de los proyectos de construcción, incrementando la presión sobre el ecosistema al introducir y generar diversos contaminantes. Los ecosistemas de la Franja de Gaza se están debilitando y deteriorando debido a sus limitados recurso...

  9. Modeling HIV/AIDS Drug Price Determinants in Brazil: Is Generic Competition a Myth?

    OpenAIRE

    Meiners, Constance; Sagaon-Teyssier, Luis; Hasenclever, Lia; Moatti, Jean-Paul

    2011-01-01

    BACKGROUND: Brazil became the first developing country to guarantee free and universal access to HIV/AIDS treatment, with antiretroviral drugs (ARVs) being delivered to nearly 190,000 patients. The analysis of ARV price evolution and market dynamics in Brazil can help anticipate issues soon to afflict other developing countries, as the 2010 revision of the World Health Organization guidelines shifts demand towards more expensive treatments, and, at the same time, current evolution of internat...

  10. Ühistranspordist / Aini Proos

    Index Scriptorium Estoniae

    Proos, Aini

    2011-01-01

    Maakonnaliinide korraldamisest. Tabelid: Maakonnaliinide läbisõit aastas (avalikud liinid, sh nn linnalähiliinid ja mõned avalikud kaugliinid. Linnaliinide läbisõit aastas (avalikud liinid). Maakonna- ja linnaliinide liinikilomeetrid 2008–2010. Sõitjate arvu muutus avalikel maakonnaliinidel 2008–2010. Avalike maakonnaliinide liinikilomeetrid, 2010. Maakondades avalike maakonnaliinidega teenindatud sõitjate arv 2008-2010. Avalike maakonnaliinidega kokku ja linnade liinidega teenindatud sõitjate arv 2008-2010

  11. Management of HIV During Pregnancy

    OpenAIRE

    Chamma JP; Monteleone VF; V dos Reis L; Bonafe SM; Panão M

    2016-01-01

    According to UNAIDS, in 2015, one hundred and fifty thousand children were infected by HIV worldwide, therefore the use of antiretroviral therapy (ARV) during pregnancy is an important development for the reduction of maternal-fetal transmission. The treatment of a pregnant woman is done by combining two different ARV classes. The combination of two nucleoside reverse transcriptase inhibitors (NRTIs) with one non-nucleoside reverse transcriptase inhibitor (NNRTI) or protease inhibitor (PI) is...

  12. Religion and HIV in Tanzania: influence of religious beliefs on HIV stigma, disclosure, and treatment attitudes.

    Science.gov (United States)

    Zou, James; Yamanaka, Yvonne; John, Muze; Watt, Melissa; Ostermann, Jan; Thielman, Nathan

    2009-03-04

    Religion shapes everyday beliefs and activities, but few studies have examined its associations with attitudes about HIV. This exploratory study in Tanzania probed associations between religious beliefs and HIV stigma, disclosure, and attitudes toward antiretroviral (ARV) treatment. A self-administered survey was distributed to a convenience sample of parishioners (n = 438) attending Catholic, Lutheran, and Pentecostal churches in both urban and rural areas. The survey included questions about religious beliefs, opinions about HIV, and knowledge and attitudes about ARVs. Multivariate logistic regression analysis was performed to assess how religion was associated with perceptions about HIV, HIV treatment, and people living with HIV/AIDS. Results indicate that shame-related HIV stigma is strongly associated with religious beliefs such as the belief that HIV is a punishment from God (p God (p < 0.001). Most participants (84.2%) said that they would disclose their HIV status to their pastor or congregation if they became infected. Although the majority of respondents (80.8%) believed that prayer could cure HIV, almost all (93.7%) said that they would begin ARV treatment if they became HIV-infected. The multivariate analysis found that respondents' hypothetical willingness to begin ARV treatme was not significantly associated with the belief that prayer could cure HIV or with other religious factors. Refusal of ARV treatment was instead correlated with lack of secondary schooling and lack of knowledge about ARVs. The decision to start ARVs hinged primarily on education-level and knowledge about ARVs rather than on religious factors. Research results highlight the influence of religious beliefs on HIV-related stigma and willingness to disclose, and should help to inform HIV-education outreach for religious groups.

  13. Religion and HIV in Tanzania: influence of religious beliefs on HIV stigma, disclosure, and treatment attitudes

    Science.gov (United States)

    Zou, James; Yamanaka, Yvonne; John, Muze; Watt, Melissa; Ostermann, Jan; Thielman, Nathan

    2009-01-01

    Background Religion shapes everyday beliefs and activities, but few studies have examined its associations with attitudes about HIV. This exploratory study in Tanzania probed associations between religious beliefs and HIV stigma, disclosure, and attitudes toward antiretroviral (ARV) treatment. Methods A self-administered survey was distributed to a convenience sample of parishioners (n = 438) attending Catholic, Lutheran, and Pentecostal churches in both urban and rural areas. The survey included questions about religious beliefs, opinions about HIV, and knowledge and attitudes about ARVs. Multivariate logistic regression analysis was performed to assess how religion was associated with perceptions about HIV, HIV treatment, and people living with HIV/AIDS. Results Results indicate that shame-related HIV stigma is strongly associated with religious beliefs such as the belief that HIV is a punishment from God (p God (p believed that prayer could cure HIV, almost all (93.7%) said that they would begin ARV treatment if they became HIV-infected. The multivariate analysis found that respondents' hypothetical willingness to begin ARV treatme was not significantly associated with the belief that prayer could cure HIV or with other religious factors. Refusal of ARV treatment was instead correlated with lack of secondary schooling and lack of knowledge about ARVs. Conclusion The decision to start ARVs hinged primarily on education-level and knowledge about ARVs rather than on religious factors. Research results highlight the influence of religious beliefs on HIV-related stigma and willingness to disclose, and should help to inform HIV-education outreach for religious groups. PMID:19261186

  14. Modeling HIV/AIDS drug price determinants in Brazil: is generic competition a myth?

    Science.gov (United States)

    Meiners, Constance; Sagaon-Teyssier, Luis; Hasenclever, Lia; Moatti, Jean-Paul

    2011-01-01

    Brazil became the first developing country to guarantee free and universal access to HIV/AIDS treatment, with antiretroviral drugs (ARVs) being delivered to nearly 190,000 patients. The analysis of ARV price evolution and market dynamics in Brazil can help anticipate issues soon to afflict other developing countries, as the 2010 revision of the World Health Organization guidelines shifts demand towards more expensive treatments, and, at the same time, current evolution of international legislation and trade agreements on intellectual property rights may reduce availability of generic drugs for HIV care. Our analyses are based on effective prices paid for ARV procurement in Brazil between 1996 and 2009. Data panel structure was exploited to gather ex-ante and ex-post information and address various sources of statistical bias. In-difference estimation offered in-depth information on ARV market characteristics which significantly influence prices. Although overall ARV prices follow a declining trend, changing characteristics in the generic segment help explain recent increase in generic ARV prices. Our results show that generic suppliers are more likely to respond to factors influencing demand size and market competition, while originator suppliers tend to set prices strategically to offset compulsory licensing threats and generic competition. In order to guarantee the long term sustainability of access to antiretroviral treatment, our findings highlight the importance of preserving and stimulating generic market dynamics to sustain developing countries' bargaining power in price negotiations undertaken with originator companies.

  15. Modeling HIV/AIDS drug price determinants in Brazil: is generic competition a myth?

    Directory of Open Access Journals (Sweden)

    Constance Meiners

    Full Text Available BACKGROUND: Brazil became the first developing country to guarantee free and universal access to HIV/AIDS treatment, with antiretroviral drugs (ARVs being delivered to nearly 190,000 patients. The analysis of ARV price evolution and market dynamics in Brazil can help anticipate issues soon to afflict other developing countries, as the 2010 revision of the World Health Organization guidelines shifts demand towards more expensive treatments, and, at the same time, current evolution of international legislation and trade agreements on intellectual property rights may reduce availability of generic drugs for HIV care. METHODS AND FINDINGS: Our analyses are based on effective prices paid for ARV procurement in Brazil between 1996 and 2009. Data panel structure was exploited to gather ex-ante and ex-post information and address various sources of statistical bias. In-difference estimation offered in-depth information on ARV market characteristics which significantly influence prices. Although overall ARV prices follow a declining trend, changing characteristics in the generic segment help explain recent increase in generic ARV prices. Our results show that generic suppliers are more likely to respond to factors influencing demand size and market competition, while originator suppliers tend to set prices strategically to offset compulsory licensing threats and generic competition. SIGNIFICANCE: In order to guarantee the long term sustainability of access to antiretroviral treatment, our findings highlight the importance of preserving and stimulating generic market dynamics to sustain developing countries' bargaining power in price negotiations undertaken with originator companies.

  16. HIV Drug Resistance-Associated Mutations in Antiretroviral Naïve HIV-1-Infected Latin American Children

    Directory of Open Access Journals (Sweden)

    Luis E. Soto-Ramirez

    2010-01-01

    Full Text Available Our goal was to describe the presence of HIV drug resistance among HIV-1-infected, antiretroviral (ARV naïve children and adolescents in Latin America and to examine resistance in these children in relation to drug exposure in the mother. Genotyping was performed on plasma samples obtained at baseline from HIV-1-infected participants in a prospective cohort study in Brazil, Argentina, and Mexico (NISDI Pediatric Study. Of 713 HIV-infected children enrolled, 69 were ARV naïve and eligible for the analysis. At enrollment, mean age was 7.3 years; 81.2% were infected with HIV perinatally. Drug resistance mutations (DRMs were detected in 6 (8.7%; 95% confidence interval 3.1–18.2% ARV-naïve subjects; none of the mothers of these 6 received ARVs during their pregnancies and none of the children received ARV prophylaxis. Reverse transcriptase mutations K70R and K70E were detected in 3 and 2 subjects, respectively; protease mutation I50 V was detected in 1 subject. Three of the 6 children with DRMs initiated ARV therapy during followup, with a good response in 2. The overall rate of primary drug resistance in this pediatric HIV-infected population was low, and no subjects had more than 1 DRM. Mutations associated with resistance to nucleoside reverse transcriptase inhibitors were the most prevalent.

  17. An analysis of volumes, prices and pricing trends of the pediatric antiretroviral market in developing countries from 2004 to 2012.

    Science.gov (United States)

    Lee, Janice Soo Fern; Sagaon Teyssier, Luis; Dongmo Nguimfack, Boniface; Collins, Intira Jeannie; Lallemant, Marc; Perriens, Joseph; Moatti, Jean-Paul

    2016-03-15

    The pediatric antiretroviral (ARV) market is poorly described in the literature, resulting in gaps in understanding treatment access. We analyzed the pediatric ARV market from 2004 to 2012 and assessed pricing trends and associated factors. Data on donor funded procurements of pediatric ARV formulations reported to the Global Price Reporting Mechanism database from 2004 to 2012 were analyzed. Outcomes of interest were the volume and mean price per patient-year ARV formulation based on WHO ARV dosing recommendations for a 10 kg child. Factors associated with the price of formulations were assessed using linear regression; potential predictors included: country income classification, geographical region, market segment (originator versus generic ARVs), and number of manufacturers per formulation. All analyses were adjusted for type of formulations (single, dual or triple fixed-dose combinations (FDCs)) Data from 111 countries from 2004 to 2012 were included, with procurement of 33 formulations at a total value of USD 204 million. Use of dual and triple FDC formulations increased substantially over time, but with limited changes in price. Upon multivariate analysis, prices of originator formulations were found to be on average 72 % higher than generics (p market as represented by the GPRM database is small, and lacks price competition. It is dominated by generic drugs due to the lower prices offered and the practicality of FDC formulations. This market requires continued donor support and the current initiatives to protect it are important to ensure market viability, especially if new formulations are to be introduced in the future.

  18. Antiretroviral purchasing and prescription practices in Mexico: constraints, challenges and opportunities.

    Science.gov (United States)

    Chaumont, Claire; Bautista-Arredondo, Sergio; Calva, Juan José; Bahena-González, Roberto Isaac; Sánchez-Juárez, Gerda Hitz; González de Araujo-Muriel, Arturo; Magis-Rodríguez, Carlos; Hernández-Ávila, Mauricio

    2015-01-01

    This study examines the antiretroviral (ARV) market characteristics for drugs procured and prescribed to Mexico's Social Protection System in Health beneficiaries between 2008 and 2013, and compares them with international data. Procurement information from the National Center for the Prevention and the Control of HIV/AIDS was analyzed to estimate volumes and prices of key ARV. Annual costs were compared with data from the World Health Organization's Global Price Reporting Mechanism for similar countries. Finally, regimens reported in the ARV Drug Management, Logistics and Surveillance System database were reviewed to identify prescription trends and model ARV expenditures until 2018. Results show that the first-line ARV market is concentrated among a small number of patented treatments, in which prescription is clinically adequate, but which prices are higher than those paid by similar countries. The current set of legal and structural options available to policy makers to bring prices down is extremely limited. Different negotiation policies were not successful to decrease ARV high prices in the public health market. The closed list approach had a good impact on prescription quality but was ineffective in reducing prices. The Coordinating Commission for Negotiating the Price of Medicines and other Health Supplies also failed to obtain adequate prices. To maximize purchase efficiency, policy makers should focus on finding long-term legal and political safeguards to counter the high prices imposed by pharmaceutical companies.

  19. The Decline in HIV-1 Drug Resistance in Heavily Antiretroviral-Experienced Patients Is Associated with Optimized Prescriptions in a Treatment Roll-Out Program in Mexico.

    Science.gov (United States)

    Calva, Juan J; Larrea, Silvana; Tapia-Maltos, Marco A; Ostrosky-Frid, Mauricio; Lara, Carolina; Aguilar-Salinas, Pedro; Rivera, Héctor; Ramírez, Juan P

    2017-07-01

    A decrease in the rate of acquired antiretroviral (ARV) drug resistance (ADR) over time has been documented in high-income settings, but data on the determinants of this phenomenon are lacking. We tested the hypothesis that in heavily ARV-experienced patients in the Mexican ARV therapy (ART) roll-out program, the drop in ADR would be associated with changes in ARV drug usage. Genotypic resistance tests obtained from 974 HIV-infected patients with virological failure and at least 2 previously failed ARV regimens from throughout the country were analyzed for the presence of nucleos(t)ide reverse transcriptase inhibitors, non-nucleoside reverse transcriptase inhibitors, and protease inhibitor (PI) resistance-associated mutations (RAMs). Patients were divided into two groups according to their first ART start date: 488 patients initiated ART before mid-2003 (group 1) and 486 after mid-2003 (group 2). The rate of RAMs, median resistance score of several sentinel ARVs, and composition of ART drugs in patient's entire treatment history were compared between both groups. Patients in group 2 were less likely to have >3 thymidine analogue-associated mutations (TAMs) and >3 PI-mRAMs [adjusted odds ratio (aOR) = 0.37; 95% confidence interval (95% CI) = 0.25-0.54; p mRAM has significantly declined over time. This can be explained by treatment optimization in the national ART roll-out program in recent years.

  20. Development and assessment of an innovative culturally sensitive educational videotape to improve adherence to highly active antiretroviral therapy in Soweto, South Africa.

    Science.gov (United States)

    Wong, Ilene Y; Lawrence, Nicholas V; Struthers, Helen; McIntyre, James; Friedland, Gerald H

    2006-12-01

    The increasing availability of antiretroviral medication (ARV) therapy in the face of limited chronic medication-taking experience among resource-poor South Africans has raised concerns about adequate adherence to these medications. We hypothesized that a culturally sensitive audiovisual patient education program would be of substantial and measurable benefit in increasing patient understanding of the concepts of ARV resistance risk and medication-taking skills. To identify potential barriers to adherence and successful strategies to promote adherence, 6 focus groups with health care providers and HIV-positive adherence counselors were held, resulting in the production of a 17-minute culturally sensitive educational videotape. Basic drug-taking concepts and practical advice on how to improve adherence were presented in the videotape. Thirty-four HIV-positive patients (including 11 ARV-naive patients and 23 ARV-experienced patients) were shown the educational videotape, and their knowledge about medication taking was evaluated by a 24-point pre- and postvideotape questionnaire. On average, the 34 patients gained 2.2 knowledge points (P = 0.021). ARV-naive patients had an average improvement of 3.0 points (P = 0.0028), with most significant gains in the areas of understanding medication-taking strategies and side effects. These preliminary findings indicate that a culturally sensitive educational videotape can improve medication-taking knowledge in South Africa and that further study of the potential efficacy of using media technology to improve individuals' adherence to ARV therapy is warranted.

  1. HIV Prophylaxis in High Risk Newborns: An Examination of Sociodemographic Factors in an Inner City Context

    Directory of Open Access Journals (Sweden)

    Zenita Alidina

    2016-01-01

    Full Text Available Background. Perinatal HIV transmission is less than 1% with antiretroviral (ARV prophylaxis. Transmission risk appears higher in “high risk” dyads, yet this is not well defined, possibly exposing more infants to combination ARV compared with standard care. Objective. To describe characteristics of mother-infant dyads where infants received ARVs and how these characteristics relate to specific ARV regimens. Methods. Retrospective chart review of ARV-receiving newborns at St. Michael’s Hospital from 2007 to 2012 (and their mothers. Numerical and categorical variables were analyzed using t-tests/ANOVA F-tests and Fisher’s exact tests, respectively. Results. Maternal HIV status at delivery was as follows: 69% positive and 24% unknown. Maternal factors significantly associated with newborn-triple therapy are Canadian origin, substance abuse, unstable housing, lost custody of previous children, and sex work. Neonatal factors are child protective services involvement, NICU, and lengthier admission. Maternal factors associated with monotherapy are African origin, HIV-positive, employment, and education. Further analysis based on maternal presentation at delivery demonstrated unequal distribution of many aforementioned factors. Discussion. This cohort revealed associations between particular factors and newborn-monotherapy or triple therapy that exist, suggesting that sociodemographic factors may influence the choice of ARV regimen. Canadian perinatal HIV transmission guidelines should qualify how to risk stratify newborns and consider use of rapid HIV antibody testing.

  2. Avian reovirus L2 genome segment sequences and predicted structure/function of the encoded RNA-dependent RNA polymerase protein

    Directory of Open Access Journals (Sweden)

    Xu Wanhong

    2008-12-01

    Full Text Available Abstract Background The orthoreoviruses are infectious agents that possess a genome comprised of 10 double-stranded RNA segments encased in two concentric protein capsids. Like virtually all RNA viruses, an RNA-dependent RNA polymerase (RdRp enzyme is required for viral propagation. RdRp sequences have been determined for the prototype mammalian orthoreoviruses and for several other closely-related reoviruses, including aquareoviruses, but have not yet been reported for any avian orthoreoviruses. Results We determined the L2 genome segment nucleotide sequences, which encode the RdRp proteins, of two different avian reoviruses, strains ARV138 and ARV176 in order to define conserved and variable regions within reovirus RdRp proteins and to better delineate structure/function of this important enzyme. The ARV138 L2 genome segment was 3829 base pairs long, whereas the ARV176 L2 segment was 3830 nucleotides long. Both segments were predicted to encode λB RdRp proteins 1259 amino acids in length. Alignments of these newly-determined ARV genome segments, and their corresponding proteins, were performed with all currently available homologous mammalian reovirus (MRV and aquareovirus (AqRV genome segment and protein sequences. There was ~55% amino acid identity between ARV λB and MRV λ3 proteins, making the RdRp protein the most highly conserved of currently known orthoreovirus proteins, and there was ~28% identity between ARV λB and homologous MRV and AqRV RdRp proteins. Predictive structure/function mapping of identical and conserved residues within the known MRV λ3 atomic structure indicated most identical amino acids and conservative substitutions were located near and within predicted catalytic domains and lining RdRp channels, whereas non-identical amino acids were generally located on the molecule's surfaces. Conclusion The ARV λB and MRV λ3 proteins showed the highest ARV:MRV identity values (~55% amongst all currently known ARV and MRV

  3. Possible Hematological Changes Associated with Acute ...

    African Journals Online (AJOL)

    Blood samples were collected for estimation of complete blood count and for determination of serum iron, total iron binding capacity (TIBC), and transferrin ... could be considered as a common health problem in kindergarten children in Gaza, and it is possibly associated with changes in hemoglobin concentration and TIBC.

  4. Surveying Public Attitudes of Security Sector Reforms in the Arab ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through applied survey research, this project will measure public response to security services changes in Egypt, Iraq, Tunisia, Yemen, and West Bank and Gaza. ... The surveys will focus on the sector's performance, capacity, response to developments on-the-ground, and its effectiveness in working with the justice sector.

  5. Création d'un contexte concurrentiel et propice aux entreprises en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Création d'un contexte concurrentiel et propice aux entreprises en Cisjordanie et à Gaza. Certains facteurs - la durée indéterminée de l'occupation des ... governance in Palestine [Arabic language]. 45572. Papers. Impact of the draft company law on the performance of the private sector in Palestine [Arabic language].

  6. Strengthening the Economic Committee of the National Assembly in ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Leading policy researchers in Vietnam will collaborate with the ECNA in researching the impacts of economic restructuring on the performance of small and medium-sized enterprises and on labour market outcomes. They will ... Création d'un contexte concurrentiel et propice aux entreprises en Cisjordanie et à Gaza.

  7. Temperament-Based Learning Styles of Palestinian and US Children

    Science.gov (United States)

    Oakland, Thomas; Alghorani, Mohammed Adnan; Lee, Dong Hun

    2007-01-01

    Temperament styles of 400 Palestinian children living in Gaza are described, examined for possible gender and age differences, and compared with those of 3,200 US children in light of Jung's theory of temperament as modified by Myers and Briggs. The results show that Palestinian children generally prefer practical to imaginative, feeling to…

  8. What we do | Page 170 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Creating an Economically Enabling and Competitive Business Environment in the West Bank and Gaza Strip. The prospect of indefinite Israeli occupation of the ... The Zambian health care system has been negatively affected by globalization and faces severe resource constraints. Zambia, North Of Sahara, South Of Sahara.

  9. What we do | Page 176 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Creating an Economically Enabling and Competitive Business Environment in the West Bank and Gaza Strip. The prospect of indefinite Israeli occupation of the ... The Zambian health care system has been negatively affected by globalization and faces severe resource constraints. Zambia, North Of Sahara, South Of Sahara.

  10. What we do | Page 170 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This knowledge can be used as a tool for addressing pressing global challenges. We share ... Creating an Economically Enabling and Competitive Business Environment in the West Bank and Gaza Strip ... The Zambian health care system has been negatively affected by globalization and faces severe resource constraints.

  11. The Ends of Revolution

    DEFF Research Database (Denmark)

    Haugbolle, Sune; Bandak, Andreas

    2017-01-01

    It is difficult to believe the level of disruption and despair that we are witnessing in the Middle East, from a broken Gaza, to a ruined Syria, a Yemen being bombed, a Libya in disintegration, and an Egypt on the slide toward state-centric fascism. These developments seem to be distantly removed...

  12. Information and Communication Technologies for Development in ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This project seeks to foster an inclusive knowledge society by building capacity to apply information and communication technology (ICT) to human, social and economic development in the Middle East, specifically Jordan, Lebanon, Palestine (West Bank and Gaza), Syria and Yemen. The project will focus on the areas of ...

  13. Z. ASTAL

    African Journals Online (AJOL)

    6(20C3) 9- 14. The Inhibitory Action of Aqueous Garlic Extract -oh the Growth of Certain Pathogenic Bacteria. Z. ASTAL. Khan Younis Hospital Laboratory, Khan Younis, Gaza-Palestinian Authority. This work reports the antibacterial effect of aqueous garlic (Allium sativum) extract on certain pathogenic Gram positive bacteria ...

  14. Crumbling UNESCO and aggregating archaeology

    Czech Academy of Sciences Publication Activity Database

    Carman, J.; Turek, Jan

    2017-01-01

    Roč. 13, č. 3 (2017), s. 387-391 ISSN 1555-8622 Institutional support: RVO:67985912 Keywords : indigenous people of Amazonia * Canaanite site in Gaza * UNESCO * world archaeology * European Association of Archaeologists Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Hukkamõist, õigustused, blokaad / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Iisraeli merevägi on valmis hõivama veel ühe Gaza sektorisse suunduva humanitaarabiga laeva, kuigi kuue abilaeva ülevõtmise operatsioonis hukkus mitu aktivisti. Iisrael kuulab üle kinnipeetud aktiviste. USA, ÜRO reageeringust seoses intsidendiga

  16. Creating an Economically Enabling and Competitive Business ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Creating an Economically Enabling and Competitive Business Environment in the West Bank and Gaza Strip. The prospect of indefinite Israeli occupation of the ... Impact of implementing the Palestinian banking law on the performance of the private sector [Arabic language]. Documents. Impact of the commercial agents law ...

  17. Negotiating Custody Rights in Islamic Family Law

    NARCIS (Netherlands)

    N.Y. Shehada (Nahda)

    2009-01-01

    textabstractIntroduction The following examines the application of Islamic family law with regard to custody and custody rights in the Gaza city sharī‘a courts.1 Four objectives are pursued in the paper. First, it identifies areas of gender asymmetry in the legal code, which distinguishes

  18. Creating an Economically Enabling and Competitive Business ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Creating an Economically Enabling and Competitive Business Environment in the West Bank and Gaza Strip. The prospect of indefinite Israeli occupation of the Palestinian territories, and their extreme dependence on foreign assistance and Israeli-controlled customs revenues, had led to the conclusion that the Palestinian ...

  19. Clinical and Biochemical Features of Type 2 Diabetic Patients in ...

    African Journals Online (AJOL)

    ... obesity and micro- or macroalbuminuria. HbA1c%, ALP, cholesterol, triglycerides and LDLC were higher in diabetics than controls. In contrast, urea, creatinine and HDLC were lower in diabetics. Keywords: Clinical and Biochemical Features, Gaza Strip, Type 2 Diabetes, Lipids, albuminuria, Family history, complications.

  20. Kenya

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cathy Egan

    Algeria, Burma, Cambodia, Kenya,. South Africa, the Southern Cone,. Vietnam, and the West Bank and. Gaza. Together, with an introductory brief, these eight cases show that. IDRC has long been prepared to work in high-risk contexts before and in early transition periods, has played a distinct role in supporting research.

  1. World Epidemiology Review, Number 110.

    Science.gov (United States)

    1978-10-18

    17a. Descriptors Worldwide Clinical Medicine Environmental Biology Hygiene and Sanitation Microbiology 17b. Identifiers/Open-Ended Terms 17e...the communal village " Marien N’ Gouabi" and in the Inhamissa Teachers’ College, and 52,948 more were vaccinated in Xai-Xai, capital of Gaza province

  2. Effect of Knowledge of Patients' HIV Positive Status on the ... - Lusaka

    African Journals Online (AJOL)

    Sitwala

    Al-Afifi MF, Al-Afifi RS. Attitudes of health staff in Gaza Strip-Palestine towards HIV/AIDS patients. 15th International Conference on. AIDS: 2004: Bangkok, Thailand. 8. Sylvia Bolanle Adebajo, Abisola O. Bamgbala and Muriel A. Oyediran. Attitudes of Health. Care Providers to Persons Living with. HIV/AIDS in Lagos State, ...

  3. Contextualized Emotional Images in Children's Dreams: Psychological Adjustment in Conditions of Military Trauma

    Science.gov (United States)

    Helminen, Elisa; Punamaki, Raija-Leena

    2008-01-01

    This study examines the impact of military trauma on contextualized emotional images in children's dreams, and the function of the intensity and valence of the emotional images in protecting mental health from negative trauma impact. Participants were 345 Palestinian children and adolescents (aged 5-16 years) belonging to high trauma (Gaza) and…

  4. The Awareness of Health Professionals in Diagnostic Techniques ...

    African Journals Online (AJOL)

    ... to evaluate the opinion and the practice of physicians and medical laboratories technologists towards the diagnosis of intestinal parasites in Gaza strip. Subjects and Methods: The study was carried out during the period from August 2006 to December 2006. All the subjects during this period were eligible for the interview.

  5. Dialogue on Solutions to the Palestinian Refugee Problem | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    It will do so by supporting a series of meetings informed by technical documents prepared by experts that focus on the following: policy options such as compensation, absorption and acknowledgement; design options for a claims mechanism; the future of refugee camps in the West Bank and Gaza and various host ...

  6. Enhancing participatory evaluation in a humanitarian aid project

    NARCIS (Netherlands)

    Rossignoli, Cristiano M.; Giani, Alberto; Iacovo, Di Francesco; Moruzzo, Roberta; Scarpellini, Paola

    2017-01-01

    This article examines participatory evaluation of humanitarian aid projects in post-conflict contexts, through the presentation of a particular case: the evaluation of a project supporting herders and Bedouin communities breeding small ruminants in the Gaza Strip. The article analyses the current

  7. Réduction de la pauvreté par le truchement du développement du ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The prospect of indefinite Israeli occupation of the Palestinian territories, and their extreme dependence on foreign assistance and Israeli-controlled customs revenues, had led to the conclusion... View moreCreating an Economically Enabling and Competitive Business Environment in the West Bank and Gaza Strip ...

  8. Rift Valley Fever Outbreak in Livestock, Mozambique, 2014

    Science.gov (United States)

    Coetzee, Peter; Mubemba, Benjamin; Nhambirre, Ofélia; Neves, Luis; Coetzer, J.A.W.; Venter, Estelle H.

    2016-01-01

    In early 2014, abortions and death of ruminants were reported on farms in Maputo and Gaza Provinces, Mozambique. Serologic analysis and quantitative and conventional reverse transcription PCR confirmed the presence of Rift Valley fever virus. The viruses belonged to lineage C, which is prevalent among Rift Valley fever viruses in southern Africa. PMID:27869589

  9. Israel Fires But “Palestinian Claim to Citizenship Has Never Been Stronger”

    DEFF Research Database (Denmark)

    Pace, Michelle

    2018-01-01

    On March 30, which happened to be Good Friday – a Christian holiday commemorating the crucifixion of Jesus and His death at Calvary — Palestinians in the Gaza Strip set off for their “Great March of Return”. Their plan: walk, chant, and sit meters from an electric fence surrounding the greatest p...

  10. Journal for Islamic Studies: Submissions

    African Journals Online (AJOL)

    A. Sheridan (New York: Pantheon, 1977). Chapter in an edited book. Shehada, Nahda Younis. “Justice without Drama: Observations from Gaza City Sharia Court,” in Inger Marie Okkenhaug and Ingvild Flaskerud (eds.), Gender, Religion and Change in the Middle East, 13-28 (Oxford: Berg, 2005). Encyclopaedia article.

  11. Jejak Pemikiran Al-Gazali dalam Tradisi Pendidikan Pesantren

    Directory of Open Access Journals (Sweden)

    A Washil

    2016-06-01

    Full Text Available Pesantren (Islamic boarding school tradition can not be separated from the influence of Abu> Ha>mid al-Gaza>li>. This thought became the foundation to see the traces left by this hujjatul Isla>m in pesantren’s scientific tradition; what have became tradition, and what have changed and developed  in the tradition itself. This study shows that the thought of al-Gaza>li> influence several aspects (1 ontology about the nature and origin of science, it’s quality and position, which is linked to the learning process, (2 classification of science that is read sub-ordinatively, classificatively, even dichotomous, (3 the orientation and development of science in the education process that oriented to the hereafter life and worldly benefit. But in education process, every pesantren has their own interpretation. It is caused by differences in readings and adjustments to local circumstances. Therefore the thought of al-Gaza>li> is not always intact in education process. Most actually showed irregularities. It is caused by the dynamics of the social history, cultural and political of Indonesian. Readings and interpretation of al-Gaza>li> thought in pesantren tradition is also dynamic, in the sense of showing the progress from period to period.

  12. 31 CFR 594.510 - Official activities of certain international organizations; U.S. person employees of certain...

    Science.gov (United States)

    2010-07-01

    ... governments of states bordering the West Bank or Gaza are authorized to engage in all transactions and... and other entities of the Security Council, General Assembly, Economic and Social Council and Secretariat, specifically including, among others, the World Bank, the International Monetary Fund, the World...

  13. 31 CFR 595.508 - Official activities of certain international organizations; U.S. person employees of certain...

    Science.gov (United States)

    2010-07-01

    ... governments of states bordering the West Bank or Gaza are authorized to engage in all transactions and... and other entities of the Security Council, General Assembly, Economic and Social Council and Secretariat, specifically including, among others, the World Bank, the International Monetary Fund, the World...

  14. Iisraeli jõuvõte Jeeriko vanglas riivas isegi palestiina koolilapsi / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 17. märts lk. 8. Iisraeli vägede tungimine 14. märtsil Jeeriko vanglasse on Palestiina presidendi Mahmoud Abbasi sõnul andestamatu kuritegu, palestiinlased kuulutasid Gaza sektoris ja Läänekaldal välja streigi Iisraeli sõjalise operatsiooni vastu. Kaart: Haarang

  15. Stressors, Family Environment and Coping Styles as Predictors of Educational and Psychosocial Adjustment in Palestinian Children

    Science.gov (United States)

    Khamis, Vivian

    2013-01-01

    This study investigated the contributions of child and parents' sociodemographics, daily stressors, family environment, and coping strategies, to academic achievement, cognitive functioning and aggression in a sample of 600 children at the intermediate grade levels from Gaza Strip. Each of the predictor variables exhibited a different pattern of…

  16. 75 FR 11976 - Bureau of Educational and Cultural Affairs (ECA) Request for Grant Proposals: Global Connections...

    Science.gov (United States)

    2010-03-12

    ... Exempt From Income Tax,'' must include a copy of relevant portions of this form. (2) Those who do not... (Egypt, Jordan, Israel, West Bank/Gaza and Lebanon), East Asia/Pacific (Indonesia, Malaysia, and Vietnam... their choices in their proposals. East Asia/Pacific Regional Project--Indonesia, Malaysia, and Vietnam...

  17. : tous les projets | Page 357 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    End Date: 23 mars 2010. Sujet: INSTITUTION BUILDING, Capacity building, RESEARCH CENTRES, RESEARCH RESULTS, POLICY MAKING. Région: India, Central Asia, Far East Asia, South Asia. Financement total : CA$ 100,000.00. Renforcement d'un cadre favorable à l'entrepreneuriat en Cisjordanie et à Gaza. Projet.

  18. All projects related to | Page 580 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2007-03-31

    This project seeks to foster an inclusive knowledge society by building capacity to apply information and communication technology (ICT) to human, social and economic development in the Middle East, specifically Jordan, Lebanon, Palestine (West Bank and Gaza), Syria and Yemen. Start Date: March 31, 2007. End Date: ...

  19. The Awareness of Health Professionals in Diagnostic Techniques ...

    African Journals Online (AJOL)

    hanumantp

    Conclusion: Low awareness was found among both physicians and MLT regarding the diagnostic techniques used in the examination of intestinal parasites in Gaza Strip. Prescription of medicine by physicians sometimes depends on the clinical picture without laboratory confirmation. Advanced techniques were less used ...

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 551 - 600 of 633 ... Vol 27, No 3 (2017), The association between physical activity and the metabolic syndrome among type 2 diabetes patients in Gaza strip, Palestine ... The Relationship Between Life Course Factors, Parental Demographics, Dental Coping Beliefs and Its Influence on Adolescents Dental Visit: a Cross ...

  1. Increasing disability-free life expectancy among older adults in Palestine from 2006 to 2010

    DEFF Research Database (Denmark)

    Brønnum-Hansen, Henrik; Duraidi, Mohammed; Qalalwa, Khaled

    2015-01-01

    BACKGROUND: The population of Palestine comprises almost 200 000 Palestinians aged 60 or older. The purpose of the study was to estimate disability-free life expectancy for Palestinians living in the West Bank and Gaza Strip and to evaluate changes from 2006 to 2010. METHODS: The study combined...

  2. European aid to vulnerable Palestinians

    Directory of Open Access Journals (Sweden)

    Daniela Cavini

    2006-08-01

    Full Text Available Funds from the European Commission’s HumanitarianDepartment (ECHO alleviate the suffering ofPalestinians in the West Bank and Gaza Strip andsupport projects for the three million refugees in Jordan,Lebanon and Syria whose humanitarian needs areoften neglected by the international community.

  3. Lähis-Ida võitlus ägeneb

    Index Scriptorium Estoniae

    2006-01-01

    Iisraeli valitsus otsustas 19. juulil toimunud istungil, et jätkab operatsioone Gaza sektoris ja Liibanonis. Lähis-Itta konflikti lahendama saabunud Euroopa Liidu välisasjade koordinaator Javier Solana kutsus Iisraeli ja Liibanoni äärmusrühmitust Hezbollah vaenutegevust lõpetama

  4. Near East and South Asia.

    Science.gov (United States)

    1988-12-27

    they succeed in connecting the nationalistic motive to the religious motive. In recent months in the Gaza Strip, two people were killed and one girl ...forms of ethical corruption, the spread of unveiled and ostentatious attire among women in public gatherings and places, the showing of sexy films in

  5. Preliminary investigations on the Ichthyodiversity of Kilifi Creek, Kenya

    African Journals Online (AJOL)

    Acan bloc. Cara igno. Cyna gilc. Gaza mina. Gerrfila. H ils kele. Leia equu. Leia sp. Leth mahs. Lutj sang. Oxyu papa. Poma multi. Scorn lysa. Tera jarb. Tera ther. Upen sulp. Upen vitt. PRELIMINARY INVESTIGATIONS ON THE ICHTHYODIVERSITY OF KILIFI CREEK 19 irregular use of hand—nets besides literally hitting.

  6. Justification, Perception of Severity and Harm, and Criminalization of Wife Abuse in the Palestinian Society

    Science.gov (United States)

    Haj-Yahia, Muhammad M.; Wilson, Rula M.; Naqvi, Syed Agha M.

    2012-01-01

    The purpose of this study was to examine the perceptions of Palestinian adults toward different dimensions of wife abuse. A cross-sectional survey, using a combination of self-administered questionnaires and interviews, was conducted among a systematic random sample of 624 adult Palestinian men and women from the West Bank and Gaza Strip (18 years…

  7. House of Obedience: Social Norms, Individual Agency and Historical Contingency

    NARCIS (Netherlands)

    N.Y. Shehada (Nahda)

    2009-01-01

    textabstractBased on 14 months of fieldwork, this paper examines the influence of social norms, individual agency, and historical contingency on the practice of House of Obedience (bayt al-ta‘a) in the shari‘a courts of the Gaza Strip. It argues that the text of Islamic family law is only one

  8. Financial Barriers and Lapses in Treatment and Care of HIV-Infected Adults in a Southern State in the United States.

    Science.gov (United States)

    Wohl, David A; Kuwahara, Rita K; Javadi, Kamran; Kirby, Christine; Rosen, David L; Napravnik, Sonia; Farel, Claire

    2017-11-01

    Antiretroviral (ARV) adherence has largely been considered from the perspective of an individual's behavior with less attention given to potential structural causes for lapses in treatment, such as the cost of medications and care. HIV medication expense is typically covered by third party payers. However, private insurance premiums and deductibles may rise, or policies terminated such as with a change in employment. Likewise, a patient's eligibility for publicly funded coverage like state AIDS Drug Assistance Programs (ADAP) or Medicaid can also be lost. We conducted a one-time survey of a sample of 300 patients receiving HIV care at a single large academic center in the south of United States to examine lapses in HIV therapy due to financial reasons. We found that during the prior year, financial issues including medication cost or coverage led to a lapse in ARVs in 10% (n = 31) of participants. However, of the 42% (n = 125) participants who had been enrolled in ADAP at any time during the prior year, 21% (n = 26) reported an ARV lapse due to problems with ADAP or medication cost. Respondents cited ADAP's required semi-annual renewal process and other administrative issues as the cause of ARV lapses. The median duration of missed ARVs was 2 weeks (range of financial burdens to care by respondents. In conclusion, although conducted at a single medical center and one state, this study suggests that a significant minority of HIV-infected patients encounter financial barriers to ARV access, and this is paradoxically more common among those enrolled in the state ADAP. Streamlining, supporting, and simplifying ADAP renewal procedures will likely reduce lapses in ARV adherence and persistence.

  9. The contribution of family planning towards the prevention of vertical HIV transmission in Uganda.

    Directory of Open Access Journals (Sweden)

    Wolfgang Hladik

    Full Text Available BACKGROUND: Uganda has one of the highest total fertility rates (TFR worldwide. We compared the effects of antiretroviral (ARV prophylaxis for the prevention of mother-to-child HIV transmission (PMTCT to that of existing family planning (FP use and estimated the burden of pediatric HIV disease due to unwanted fertility. METHODOLOGY/PRINCIPAL FINDINGS: Using the demographic software Spectrum, a baseline mathematical projection to estimate the current pediatric HIV burden in Uganda was compared to three hypothetical projections: 1 without ARV-PMTCT (to estimate the effect of ARV-PMTCT, 2 without contraception (effect of existing FP use, 3 without unwanted fertility (effect of unmet FP needs. Key input parameters included HIV prevalence, ARV-PMTCT uptake, MTCT probabilities, and TFR. We estimate that in 2007, an estimated 25,000 vertical infections and 17,000 pediatric AIDS deaths occurred (baseline projection. Existing ARV-PMTCT likely averted 8.1% of infections and 8.5% of deaths. FP use likely averted 19.7% of infections and 13.1% of deaths. Unwanted fertility accounted for 21.3% of infections and 13.4% of deaths. During 2008-2012, an estimated 131,000 vertical infections and 71,000 pediatric AIDS deaths will occur. The projected scale up of ARV-PMTCT (from 39%-57% may avert 18.1% of infections and 24.5% of deaths. Projected FP use may avert 21.6% of infections and 18.5% of deaths. Unwanted fertility will account for 24.5% of infections and 19.8% of deaths. CONCLUSIONS: Existing FP use contributes as much or more than ARV-PMTCT in mitigating pediatric HIV in Uganda. Expanding FP services can substantially contribute towards PMTCT.

  10. Safety and effectiveness of antiretroviral drugs during pregnancy, delivery and breastfeeding for prevention of mother-to-child transmission of HIV-1: the Kesho Bora Multicentre Collaborative Study rationale, design, and implementation challenges.

    Science.gov (United States)

    2011-01-01

    To evaluate strategies to reduce HIV-1 transmission through breastfeeding, a multicentre study including a nested randomized controlled trial was implemented in five research sites in West, East and South Africa (The Kesho Bora Study). The aim was to optimize the use of antiretroviral (ARV) drugs during pregnancy, delivery and breastfeeding to prevent mother-to-child transmission of HIV-1 (PMTCT) and to preserve the health of the HIV-1-infected mother. The study included long-term ARV treatment for women with advanced disease, and short-course ARV prophylaxis stopped at delivery for women with early disease. Women with intermediate disease participated in a randomized controlled trial to compare safety and efficacy of triple-ARV prophylaxis prolonged during breastfeeding with short-course ARV prophylaxis stopped at delivery. Between January 2005 and August 2008 a total of 1140 women were enrolled. This paper describes the study design, interventions and protocol amendments introduced to adapt to evolving scientific knowledge, international guidelines and availability of ARV treatment. The paper highlights the successes and challenges during the conduct of the trial. The Kesho Bora Study included one of the few randomized controlled trials to assess safety and efficacy of ARV prophylaxis continued during breastfeeding and the only randomized trial to assess maternal prophylaxis started during pregnancy. The findings have been important for informing international and national guidelines on MTCT prevention in developing countries where, due to poverty, lack of reliable and affordable supply of replacement feed and stigma associated with HIV/AIDS, HIV-infected women have little or no option other than to breastfeed their infants. (ISRCTN71468401). Copyright © 2010 Elsevier Inc. All rights reserved.

  11. Factors contributing to antiretroviral drug adherence among adults living with HIV or AIDS in a Kenyan rural community

    Directory of Open Access Journals (Sweden)

    Mary T. Kioko

    2017-01-01

    Full Text Available Background: Antiretroviral (ARV adherence of ≥ 95% is recommended for suppressing HIV. However, studies have shown that the ≥ 95% recommended level is rarely achieved.Objective: This cross-sectional community-based study sought to assess factors contributing to ARV drug adherence among adults living with HIV or AIDS.Setting: The study was conducted in a rural community in Machakos County, Kenya.Methods: The questions used for the study were adapted from the Patient Medicine Adherence Questionnaire (PMAQ, a tool grounded in the Health Belief Model. Adherence to ARV was measured using self-reports and pill counts. The perception social support was measured with a 5-point Likert scale, whereas the type and the number of side effects experienced were recorded using ‘yes’ and ‘no’ questions. We used the chi-square test to test associations and binary logistic regression to assess factors explaining dose adherence to ARV.Results: The levels of adherence of 86% using self-reports were significantly higher (p < 0.001 than the pill count of 58.6%. The immediate family was rated high in providing social support (3.7 ± 0.6 followed by social support groups (3.1 ± 0.8. A binary logistic regression analysis was conducted to predict ARV adherence (adherent, non-adherent using social support, side effects and marital status as explanatory variables. The Wald criterion demonstrated that marital status (p = 0.019 and burden of side effects (p ≤ 0.001 made a significant contribution to the prediction of ARV adherence.Conclusion: The burden of side effects and being a divorcee are primary predictors of ARV adherence.

  12. The global pediatric antiretroviral market: analyses of product availability and utilization reveal challenges for development of pediatric formulations and HIV/AIDS treatment in children

    Directory of Open Access Journals (Sweden)

    Jambert Elodie

    2010-10-01

    Full Text Available Abstract Background Important advances in the development and production of quality-certified pediatric antiretroviral (ARV formulations have recently been made despite significant market disincentives for manufacturers. This progress resulted from lobbying and innovative interventions from HIV/AIDS activists, civil society organizations, and international organizations. Research on uptake and dispersion of these improved products across countries and international organizations has not been conducted but is needed to inform next steps towards improving child health. Methods We used information from the World Health Organization Prequalification Programme and the United States Food and Drug Administration to describe trends in quality-certification of pediatric formulations and used 7,989 donor-funded, pediatric ARV purchase transactions from 2002-2009 to measure uptake and dispersion of new pediatric ARV formulations across countries and programs. Prices for new pediatric ARV formulations were compared to alternative dosage forms. Results Fewer ARV options exist for HIV/AIDS treatment in children than adults. Before 2005, most pediatric ARVs were produced by innovator companies in single-component solid and liquid forms. Five 2-in1 and four 3-in-1 generic pediatric fixed-dose combinations (FDCs in solid and dispersible forms have been quality-certified since 2005. Most (67% of these were produced by one quality-certified manufacturer. Uptake of new pediatric FDCs outside of UNITAID is low. UNITAID accounted for 97-100% of 2008-2009 market volume. In total, 33 and 34 countries reported solid or dispersible FDC purchases in 2008 and 2009, respectively, but most purchases were made through UNITAID. Only three Global Fund country recipients reported purchase of these FDCs in 2008. Prices for pediatric FDCs were considerably lower than liquids but typically higher than half of an adult FDC. Conclusion Pediatric ARV markets are more fragile than

  13. The global pediatric antiretroviral market: analyses of product availability and utilization reveal challenges for development of pediatric formulations and HIV/AIDS treatment in children.

    Science.gov (United States)

    Waning, Brenda; Diedrichsen, Ellen; Jambert, Elodie; Bärnighausen, Till; Li, Yun; Pouw, Mieke; Moon, Suerie

    2010-10-17

    Important advances in the development and production of quality-certified pediatric antiretroviral (ARV) formulations have recently been made despite significant market disincentives for manufacturers. This progress resulted from lobbying and innovative interventions from HIV/AIDS activists, civil society organizations, and international organizations. Research on uptake and dispersion of these improved products across countries and international organizations has not been conducted but is needed to inform next steps towards improving child health. We used information from the World Health Organization Prequalification Programme and the United States Food and Drug Administration to describe trends in quality-certification of pediatric formulations and used 7,989 donor-funded, pediatric ARV purchase transactions from 2002-2009 to measure uptake and dispersion of new pediatric ARV formulations across countries and programs. Prices for new pediatric ARV formulations were compared to alternative dosage forms. Fewer ARV options exist for HIV/AIDS treatment in children than adults. Before 2005, most pediatric ARVs were produced by innovator companies in single-component solid and liquid forms. Five 2-in1 and four 3-in-1 generic pediatric fixed-dose combinations (FDCs) in solid and dispersible forms have been quality-certified since 2005. Most (67%) of these were produced by one quality-certified manufacturer. Uptake of new pediatric FDCs outside of UNITAID is low. UNITAID accounted for 97-100% of 2008-2009 market volume. In total, 33 and 34 countries reported solid or dispersible FDC purchases in 2008 and 2009, respectively, but most purchases were made through UNITAID. Only three Global Fund country recipients reported purchase of these FDCs in 2008. Prices for pediatric FDCs were considerably lower than liquids but typically higher than half of an adult FDC. Pediatric ARV markets are more fragile than adult markets. Ensuring a long-term supply of quality, well

  14. Antiretroviral therapy supply chain quality control and assurance in improving people living with HIV therapeutic outcomes in Cameroon.

    Science.gov (United States)

    Djobet, M P Ngogang; Singhe, David; Lohoue, Julienne; Kuaban, Christopher; Ngogang, Jeanne; Tambo, Ernest

    2017-04-04

    Evaluation of medication efficacy and safety is an essential guarantee to successful therapeutic outcome in public health practices. However, larger distribution chain supply in developing countries such as Cameroon is often challenged by counterfeit drugs, poor manufacturing, storage and degradation leading to health and patient adverse consequences. Yet, access to supply chain management in strengthening ARVs quality assurance and outcomes remains poorly documented. More than 53,000 patients have been enrolled on free ARVs medications, but little is documented on quality assurance and validity of safety for affected populations along the supply chain management since 2008. The cross sectional study was conducted in ARVs distribution units and centers in central, littoral and south west regions of Cameroon. ARVs drugs samples included Nevirapine, Efavirenz, and fixed dose combinations of Zidovudine + Lamivudine, Lamivudine + Stavudine and Zidovudine + Lamivudine + Nevirapine. Drugs packaging and labeling was assessed and galenic assays were performed at National Laboratory of quality Control of Medications and Expertise (LANACOME), Yaoundé, Cameroon. The study covered 16 structures located in eight different towns including the central ARVs store, two regional pharmaceutical procurement centers and thirteen HIV approved treatment centers and management units. A total of 35 ARVs products were collected. Only eight ARVs drugs containing Lamivudine and Stavudine presented with white stains on tablets, however these drugs were standard for all other tests performed. The others 28 ARVs products were standards to all assays performed. We concluded that ARVs drugs freely accessible and distributed to PLWHA are of good quality in Cameroon. However, with the increase number of patients under HAART since 2013, adoption of "Test and Treat" approach to reach the 90-90-90 goals and with the implementation of new national antiretroviral regimen guidelines and molecules

  15. Castration resistance in human prostate cancer is conferred by a frequently occurring androgen receptor splice variant

    Science.gov (United States)

    Sun, Shihua; Sprenger, Cynthia C.T.; Vessella, Robert L.; Haugk, Kathleen; Soriano, Kathryn; Mostaghel, Elahe A.; Page, Stephanie T.; Coleman, Ilsa M.; Nguyen, Holly M.; Sun, Huiying; Nelson, Peter S.; Plymate, Stephen R.

    2010-01-01

    Progression of prostate cancer following castration is associated with increased androgen receptor (AR) expression and signaling despite AR blockade. Recent studies suggest that these activities are due to the generation of constitutively active AR splice variants, but the mechanisms by which these splice variants could mediate such effects are not fully understood. Here we have identified what we believe to be a novel human AR splice variant in which exons 5, 6, and 7 are deleted (ARv567es) and demonstrated that this variant can contribute to cancer progression in human prostate cancer xenograft models in mice following castration. We determined that, in human prostate cancer cell lines, ARv567es functioned as a constitutively active receptor, increased expression of full-length AR (ARfl), and enhanced the transcriptional activity of AR. In human xenografts, human prostate cancer cells transfected with ARv567es cDNA formed tumors that were resistant to castration. Furthermore, the ratio of ARv567es to ARfl expression within the xenografts positively correlated with resistance to castration. Importantly, we also detected ARv567es frequently in human prostate cancer metastases. In summary, these data indicate that constitutively active AR splice variants can contribute to the development of castration-resistant prostate cancers and may serve as biomarkers for patients who are likely to suffer from early recurrence and are candidates for therapies directly targeting the AR rather than ligand. PMID:20644256

  16. Preventing and managing antiretroviral drug resistance.

    Science.gov (United States)

    Kuritzkes, Daniel R

    2004-05-01

    Development of resistance to antiretroviral drugs (ARVs) is a major impediment to optimum treatment of HIV-1 infection. Although resistance testing can help to select subsequent regimens when virologic failure occurs, cross-resistance, which affects all classes of ARVs, may make it more difficult to achieve optimum control of HIV. We have known for some time that our first choice of antiretroviral therapy offers the best chance to control HIV replication and that initial therapy should be selected with an eye on future options. Potency is the first line of defense against the development of resistance. Other factors that affect resistance development include: tolerability, potential for optimum adherence, and genetic and pharmacologic barriers to development of resistance. If resistance emerges, only a single drug may be affected initially, and a rapid change in ARVs may preserve the efficacy of other components. One cautionary note is that we can no longer assume that a patient's HIV is fully susceptible to all ARVs even in the initial regimen. Transmission of drug-resistant HIV means that the genetic composition may be that of an "experienced" virus with reduced susceptibility to ARVs. Resistance testing at the time of transmission is most likely to reveal this resistance, but over time the dominant genetic pattern may revert to wild-type, and be missed by resistance testing. Because "archived" resistant HIV may emerge quickly once treatment is initiated, we need to keep this in mind when selecting initial therapy.

  17. The impact of stressful life events, symptom status, and adherence concerns on quality of life in people living with HIV.

    Science.gov (United States)

    Corless, Inge B; Voss, Joachim; Guarino, A J; Wantland, Dean; Holzemer, William; Jane Hamilton, Mary; Sefcik, Elizabeth; Willard, Suzanne; Kirksey, Kenn; Portillo, Carmen; Rivero Mendez, Marta; Rosa, Maria E; Nicholas, Patrice K; Human, Sarie; Maryland, Mary; Moezzi, Shahnaz; Robinson, Linda; Cuca, Yvette

    2013-01-01

    Studies concerning persons living with HIV (PLWH) report that stressful life events (SLEs) contribute to an exacerbation of symptoms and reduced antiretroviral (ARV) adherence and quality of life (QOL). Little is known about whether these findings are site-specific. Our study's aims were to characterize the type and frequency of SLEs for PLWH in Puerto Rico, South Africa, and the United States, and to assess the impact of SLEs by national site, symptoms, and ARV adherence concerns on QOL. The sample consisted of 704 participants. The total number of SLEs correlated significantly with the total number of symptoms, adherence concerns, and QOL (p ≤ .001). Overall, 27.2% of the variance in QOL was explained by the aforementioned variables. Although SLEs were of concern to PLWH, worries about ARV adherence were of even greater concern. Routine assessment of ARV concerns and SLEs can promote ongoing ARV adherence and improved QOL. Copyright © 2013 Association of Nurses in AIDS Care. Published by Elsevier Inc. All rights reserved.

  18. Scaling up nano-milling of poorly water soluble compounds using a rotation/revolution pulverizer.

    Science.gov (United States)

    Yuminoki, K; Tachibana, S; Nishimura, Y; Mori, H; Takatsuka, T; Hashimoto, N

    2016-02-01

    We previously reported that a rotation/revolution pulverizer (NP-100) could mill a small amount of a drug (0.1 g) into nanoparticles in several minutes. In this investigation, scale up from the milligram to the kilogram scale of the nano-milling process by the rotation/revolution pulverizer was studied. Phenytoin was used as a model drug with low solubility in water. After confirming the improvement of the phenytoin bioavailability by milling to nanoparticles using NP-100, scaling parameters were evaluated using NP-100 and the middle scale model of NP-100 (ARV-3000T). A theoretical equation for the specific collisional energy was adapted for wet milling; this suggested that the relative centrifugal acceleration of revolution (revolution G) and the drug concentration in the suspension were the two most important parameters. The results obtained using NP-100 and ARV-3000T correlated well when these two parameters were identical. These results were applied to the large scale model of NP-100 (ARV-10KT), where 2 kg (1 kg x 2) of phenytoin nanoparticles were obtained in 60 min. The results from PXRD and DSC indicated that the milled phenytoin by ARV-3000T and ARV-10KT maintained its crystallinity. These results suggest nano-milling using a rotation/revolution pulverizer will be widely applicable to the development of nano-medicine.

  19. Modifying Antiretroviral Therapy in Virologically Suppressed HIV-1-Infected Patients.

    Science.gov (United States)

    Collins, Sean E; Grant, Philip M; Shafer, Robert W

    2016-01-01

    HIV-1-infected patients with suppressed plasma viral loads often require changes to their antiretroviral (ARV) therapy to manage drug toxicity and intolerance, to improve adherence, and to avoid drug interactions. In patients who have never experienced virologic failure while receiving ARV therapy and who have no evidence of drug resistance, switching to any of the acceptable US Department of Health and Human Services first-line therapies is expected to maintain virologic suppression. However, in virologically suppressed patients with a history of virologic failure or drug resistance, it can be more challenging to change therapy while still maintaining virologic suppression. In these patients, it may be difficult to know whether the discontinuation of one of the ARVs in a suppressive regimen constitutes the removal of a key regimen component that will not be adequately supplanted by one or more substituted ARVs. In this article, we review many of the clinical scenarios requiring ARV therapy modification in patients with stable virologic suppression and outline the strategies for modifying therapy while maintaining long-term virologic suppression.

  20. Avian reovirus S1133-induced apoptosis is associated with Bip/GRP79-mediated Bim translocation to the endoplasmic reticulum.

    Science.gov (United States)

    Lin, Ping-Yuan; Liu, Hung-Jen; Chang, Ching-Dong; Chen, Yo-Chia; Chang, Chi-I; Shih, Wen-Ling

    2015-04-01

    In this study the mechanism of avian reovirus (ARV) S1133-induced pathogenesis was investigated, with a focus on the contribution of ER stress to apoptosis. Our results showed that upregulation of the ER stress response protein, as well as caspase-3 activation, occurred in ARV S1133-infected cultured cells and in SPF White Leghorn chicks organs. Upon infection, Bim was translocated specifically to the ER, but not mitochondria, in the middle to late infectious stages. In addition, ARV S1133 induced JNK phosphorylation and promoted JNK-Bim complex formation, which correlated with the Bim translocation and apoptosis induction that was observed at the same time point. Knockdown of BiP/GRP78 by siRNA and inhibition of BiP/GRP78 using EGCG both abolished the formation of the JNK-Bim complex, caspase-3 activation, and subsequent apoptosis induction by ARV S1133 efficiently. These results suggest that BiP/GRP78 played critical roles and works upstream of JNK-Bim in response to the ARV S1133-mediated apoptosis process.

  1. Patients’ knowledge and beliefs about antiretroviral treatment and factors associated with adherence in Mpumalanga Province, South Africa

    Directory of Open Access Journals (Sweden)

    Thuli G. Mthembu

    2014-07-01

    Doelwitte: Hierdie studie ondersoek pasiënte se kennis, houdings en ander faktore wat die navolging van ARV behandeling beïnvloed by Shongwe-hospitaal in die Nkomazi distrik in Mpumalanga. Metode: ‘n Bestekopname van 184 pasiënte, tussen die ouderdomme van 15 en 65 jaar, wat ARV behandeling ontvang is gedoen. Hulle is lukraak gekies en het ‘n vraelys voltooi rakende hul kennis en oortuigings ten opsigte van ARV-middels, asook die faktore wat die stiptelike gebruik van die middels beïnvloed. Resultate: Die steekproef het hoofsaaklik uit vroue (71.2% bestaan, en die meerderheid was werkloos (83.7%. Die meeste van die deelnemers het aangedui dat hulle hul ARV-medikasie die vorige twee dae (92.4% en sewe dae (84.2% grotendeels (ten minste 95% van medikasie volgens voorskrif geneem het. Die meerderheid van die studie deelnemers het redelike kennis van en positiewe houdings teenoor ARV-behandeling getoon. Vergeetagtigheid, die besigheid van normale daaglikse roetine, die ontvang van besoekers, besoeke aan kroeë asook uitslaap was die redes wat aangevoer is vir vernalating om medisyne te neem. Gevolgtrekking: Alhoewel, die meeste pasiënte in hierdie studie aanvanklik redelik goed gevaar het met die navolging van die behandelingsplan, moet die probleme wat ervaar is met die neem van medikasie aangespreek word om lang-termyn navolging van behandeling en retensie te bewerkstellig.

  2. Impact of the trade-related aspects of intellectual property rights (TRIPS) agreement on India as a supplier of generic antiretrovirals.

    Science.gov (United States)

    Babovic, Sonja; Wasan, Kishor M

    2011-03-01

    This is a commentary on how the trade-related aspects of intellectual property rights (TRIPS) agreement has impacted India as a supplier of generic antiretrovirals (ARVs). We provide a systematic review of the issues related to the TRIPS agreement that affects India. This includes discussion around (a) the legal landscape underpinning India as a supplier of generic ARVs; (b) supply of second-line ARVs; and (c) the future of generic drug production in India. The proclamation into force of TRIPS-compliant intellectual property law in India is likely to affect its position as a supplier of affordable ARVs, especially drugs brought to market after 2005. Currently, mechanisms exist for the generic production of almost all ARVs in India, including second-line drugs; however, the manufacture of these drugs by generic pharmaceutical companies may require additional market incentives. Compulsory licensing may emerge as an additional mechanism by which India can provide affordable versions of patented drugs to Least Developed Countries (LDCs). Copyright © 2010 Wiley-Liss, Inc.

  3. A comparison of self-report and antiretroviral detection to inform estimates of antiretroviral therapy coverage, viral load suppression and HIV incidence in Kwazulu-Natal, South Africa.

    Science.gov (United States)

    Huerga, Helena; Shiferie, Fisseha; Grebe, Eduard; Giuliani, Ruggero; Farhat, Jihane Ben; Van-Cutsem, Gilles; Cohen, Karen

    2017-09-29

    Accurately identifying individuals who are on antiretroviral therapy (ART) is important to determine ART coverage and proportion on ART who are virally suppressed. ART is also included in recent infection testing algorithms used to estimate incidence. We compared estimates of ART coverage, viral load suppression rates and HIV incidence using ART self-report and detection of antiretroviral (ARV) drugs and we identified factors associated with discordance between the methods. Cross-sectional population-based survey in KwaZulu-Natal, South Africa. Individuals 15-59 years were eligible. Interviews included questions about ARV use. Rapid HIV testing was performed at the participants' home. Blood specimens were collected for ARV detection, LAg-Avidity HIV incidence testing and viral load quantification in HIV-positive individuals. Multivariate logistic regression models were used to identify socio-demographic covariates associated with discordance between self-reported ART and ARV detection. Of the 5649 individuals surveyed, 1423 were HIV-positive. Median age was 34 years and 76.3% were women. ART coverage was estimated at 51.4% (95%CI:48.5-54.3), 53.1% (95%CI:50.2-55.9) and 56.1% (95%CI:53.5-58.8) using self-reported ART, ARV detection and both methods combined (classified as ART exposed if ARV detected and/or ART reported) respectively. ART coverage estimates using the 3 methods were fairly similar within sex and age categories except in individuals aged 15-19 years: 33.3% (95%CI:23.3-45.2), 33.8% (95%CI:23.9-45.4%) and 44.3% (95%CI:39.3-46.7) using self-reported ART, ARV detection and both methods combined. Viral suppression below 1000cp/mL in individuals on ART was estimated at 89.8% (95%CI:87.3-91.9), 93.1% (95%CI:91.0-94.8) and 88.7% (95%CI:86.2-90.7) using self-reported ART, ARV detection and both methods combined respectively. HIV incidence was estimated at 1.4 (95%CI:0.8-2.0) new cases/100 person-years when employing no measure of ARV use, 1.1/100PY (95%CI:0

  4. Strategies for equilibrium maintenance during single leg standing on a wobble board

    DEFF Research Database (Denmark)

    Silva, Priscila de Brito; Oliveira, Anderson Souza; Mrachacz-Kersting, Natalie

    2016-01-01

    (p CoP and WB angular movement measures were weakly and not significantly correlated between tasks. This lack of correlation indicates that WB balance maintenance...... to calculate trunk and contralateral-leg excursion (EXC) and velocity (VEL), and center of pressure (CoP) EXC and VEL during FS on a force platform. From the WB test, standing time (WBTIME) was determined and the board's angular EXC and VEL were calculated from four markers on the WB as surrogate measures...... for CoP dynamics. Electromyographic average rectified values (ARV) from eight leg and thigh muscles of the supporting limb were calculated for both tasks. WB ARV amplitudes were normalized with respect to the value of FS ARV and presented significantly higher peroneus longus and biceps femoris activity...

  5. Association between antiretroviral exposure and renal impairment among HIV-positive persons with normal baseline renal function

    DEFF Research Database (Denmark)

    Nielsen, Lene Ryom; Mocroft, A.; Kirk, O.

    2013-01-01

    Background. Several antiretroviral agents (ARVs) are associated with chronic renal impairment, but the extent of such adverse events among human immunodeficiency virus (HIV)-positive persons with initially normal renal function is unknown.Methods. D:A:D study participants with an estimated...... glomerular filtration rate (eGFR) of ≥90 mL/min after 1 January 2004 were followed until they had a confirmed eGFR of ≤70 mL/min (the threshold below which we hypothesized that renal interventions may begin to occur) or ≤60 mL/min (a value indicative of moderately severe chronic kidney disease [CKD...... [95% CI, 1.16-1.28], respectively). Associations were unaffected by censoring for concomitant ARV use but diminished after discontinuation of these ARVs.Conclusions. Tenofovir, ritonavir-boosted atazanavir, and ritonavir-boosted lopinavir use were independent predictors of chronic renal impairment...

  6. Access to water and morbidity in children in the occupied Palestinian territory, 2000-14: a repeated cross-sectional study.

    Science.gov (United States)

    Legge, Hugo; Shaheen, Amira; Shakhshir, Ghassan; Milojevic, Ai

    2018-02-21

    Water insecurity is an important risk factor for disease. In recent years, Palestinians have seen access to drinking water increasingly restricted. The aim of this study was to describe such changes over time and examine the association between drinking water sources and the health of children younger than 5 years in the occupied Palestinian territory in 2000-14. For this repeated cross-sectional study we used data from five Demographic and Health Surveys conducted between 2000 and 2014. Change over time was quantified by comparison between the first (n=6155) and final survey (n=7893). For regression analysis, data were aggregated by year, locality (urban vs rural vs camp), and governorate area (n=218). Multiple regression models were applied to examine associations between access to improved drinking water sources (according to Joint Monitoring Programme definitions) and the prevalence of diarrhoea and stunting. Ethical approval was obtained from Al-Najah University and London School of Hygiene & Tropical Medicine. Children's access to an improved water source decreased from 98% in 2000 to 11% in 2014 in the Gaza Strip, whereas it remained stable in the West Bank (94% in 2000 to 94% in 2014). The prevalence of diarrhoea increased in both areas (7% in 2000 to 11% in 2014 in the Gaza Strip; 6% in 2000 to 11% in 2014 in the West Bank), whereas the prevalence of stunting decreased in both (12% in 2000 to 8% in 2014 in the Gaza Strip; 11% in 2000 to 8% in 2014 in the West Bank). Pooled analysis adjusted for socioeconomic status and survey year suggested that prevalence of diarrhoea decreased in areas by 6% (95% CI -12 to 0) for every 1% increase in the use of an improved water source in the Gaza Strip. This was not the case in the West Bank. Limited access to improved water sources was associated with higher prevalence of diarrhoea in the Gaza Strip between 2000 and 2014. Our results suggest policies to increase access to improved water sources should remain a priority

  7. Growth inhibitory and apoptosis-inducing effects of allergen-free Rhus verniciflua Stokes extract on A549 human lung cancer cells.

    Science.gov (United States)

    Jang, Ik-Soon; Park, Jae-Woo; Jo, Eun-Bi; Cho, Chong-Kwan; Lee, Yeon-Weol; Yoo, Hwa-Seung; Park, Junsoo; Kim, Jihye; Jang, Byeong-Churl; Choi, Jong-Soon

    2016-11-01

    Evidence suggests that Rhus verniciflua Stokes (RVS) or its extract has the potential to be used for the treatment of inflammatory and neoplastic diseases. However, direct use of RVS or its extract as a herbal medicine has been limited due to the presence of urushiol, an allergenic toxin. In the present study, we prepared an extract of the allergen‑removed RVS (aRVS) based on a traditional method and investigated its inhibitory effect on the growth of various types of human cancer cells, including lung (A549), breast (MCF-7) and prostate (DU-145) cancer cell lines. Notably, among the cell lines tested, treatment with the aRVS extract strongly inhibited proliferation of the A549 cells at a 0.5 mg/ml concentration for 24 h that was not cytotoxic to normal human dermal fibroblasts. Furthermore, aRVS extract treatment largely reduced the survival and induced apoptosis of the A549 cells. At the mechanistic levels, treatment with the aRVS extract led to the downregulation of Bcl-2 and Mcl-1 proteins, the activation of caspase-9/-3 proteins, an increase in cytosolic cytochrome c levels, the upregulation of Bax protein, an increase in phosphorylated p53 protein but a decrease in phosphorylated S6 protein in the A549 cells. Importantly, treatment with z-VAD‑fmk, a pan-caspase inhibitor attenuated aRVS extract-induced apoptosis in the A549 cells. These results demonstrate firstly that aRVS extract has growth inhibitory and apoptosis-inducing effects on A549 human lung cancer cells through modulation of the expression levels and/or activities of caspases, Bcl-2, Mcl-1, Bax, p53 and S6.

  8. Effectiveness of multidrug antiretroviral regimens to prevent mother-to-child transmission of HIV-1 in routine public health services in Cameroon.

    Directory of Open Access Journals (Sweden)

    Patrice Tchendjou

    Full Text Available BACKGROUND: Multidrug antiretroviral (ARV regimens including HAART and short-course dual antiretroviral (sc-dARV regimens were introduced in 2004 to improve Prevention of Mother-to-Child Transmission (PMTCT in Cameroon. We assessed the effectiveness of these regimens from 6-10 weeks and 12 months of age, respectively. METHODOLOGY/FINDINGS: We conducted a retrospective cohort study covering the period from October 2004 to March 2008 in a reference hospital in Cameroon. HIV-positive pregnant women with CD4 or = 37 weeks, women received sd-NVP during labour [regimen 4]. Infants received sd-NVP plus ZDV and 3TC for 7 days or 30 days. Early diagnosis (6-10 weeks was done, using b-DNA and subsequently RT-PCR. We determined early MTCT rate and associated risk factors using logistic regression. The 12-month HIV-free survival was assessed using Cox regression. Among 418 mothers, 335 (80% received multidrug ARV regimens (1, 2, and 3 and MTCT rate with multidrug regimens was 6.6% [95%CI: 4.3-9.6] at 6 weeks, without any significant difference between regimens. Duration of mother's ARV regimen < 4 weeks [OR = 4.7, 95%CI: 1.3-17.6], mother's CD4 < 350 cells/mm(3 [OR = 6.4, 95%CI: 1.8-22.5] and low birth weight [OR = 4.0, 95%CI: 1.4-11.3] were associated with early MTCT. By 12 months, mixed feeding [HR = 8.7, 95%CI: 3.6-20.6], prematurity [HR = 2.3, 95%CI: 1.2-4.3] and low birth weight were associated with children's risk of progressing to infection or death. CONCLUSIONS: Multidrug ARV regimens for PMTCT are feasible and effective in routine reference hospital. Early initiation of ARV during pregnancy and proper obstetrical care are essential to improve PMTCT.

  9. A retrospective PCR investigation of avian Orthoreovirus, chicken infectious anemia and fowl Aviadenovirus genomes contamination in commercial poultry vaccines in Brazil

    Directory of Open Access Journals (Sweden)

    P.R. Barrios

    2012-02-01

    Full Text Available Vacinas avícolas vivas comerciais produzidas entre 1991 e 2005 foram examinadas para a presença de genomas dos vírus da anemia infecciosa das galinhas (Gyrovirus CAV, da hepatite por corpúsculo de inclusão (Aviadenovirus FAdV e da artrite viral/síndrome da má absorção (Orthoreovirus aviário ARV. Vinte e seis partidas de vacinas vivas liofilizadas de oito fabricantes com lacre original foram examinadas. As extrações de DNA e PCR de CAV e FAdV, e de RNA e RT-PCR para ARV, foram descritas previamente. Contaminações triplas de ARV, CAV e FAdV foram detectadas em vacinas de mesmo fabricante, produzidas em 1991 e 1992 contra a doença de Newcastle (DN, e para a encefalomielite aviária, produzida em 1994. ARV e CAV em co-infecção foram encontrados em vacinas contra a doença de Marek liofilizadas produzidas em 1996 por dois fabricantes diferentes. Genoma de ARV foi detectado em vacinas contra a bronquite infecciosa de setembro e dezembro de 1998, doença infecciosa bursal, de dezembro de 1998 e DN de janeiro de 1998. Três dos oito fabricantes apresentaram vacinas com contaminação e cinco nunca apresentaram vacinas contaminadas. Nenhuma vacina produzida a partir de 2001 apresentou contaminação. Cogita-se um papel epidemiológico para vacinas vivas, como fonte de infecção para ARV, CAV e FAdV e, potencialmente determinante da atual alta disseminação destes.

  10. Prevention of mother-to-child HIV-1 transmission in Burkina Faso: evaluation of vertical transmission by PCR, molecular characterization of subtypes and determination of antiretroviral drugs resistance.

    Science.gov (United States)

    Sagna, Tani; Bisseye, Cyrille; Compaore, Tegewende R; Kagone, Therese S; Djigma, Florencia W; Ouermi, Djeneba; Pirkle, Catherine M; Zeba, Moctar T A; Bazie, Valerie J T; Douamba, Zoenabo; Moret, Remy; Pietra, Virginio; Koama, Adjirita; Gnoula, Charlemagne; Sia, Joseph D; Nikiema, Jean-Baptiste; Simpore, Jacques

    2015-01-01

    Vertical human immunodeficiency virus (HIV) transmission is a public health problem in Burkina Faso. The main objective of this study on the prevention of mother-to-child HIV-1 transmission was to determine the residual risk of HIV transmission in infants born to mothers receiving highly active antiretroviral therapy (HAART). Moreover, we detect HIV antiretroviral (ARV) drug resistance among mother-infant pairs and identify subtypes and circulating recombinant forms (CRF) in Burkina Faso. In this study, 3,215 samples of pregnant women were analyzed for HIV using rapid tests. Vertical transmission was estimated by polymerase chain reaction in 6-month-old infants born to women who tested HIV positive. HIV-1 resistance to ARV, subtypes, and CRFs was determined through ViroSeq kit using the ABI PRISM 3,130 sequencer. In this study, 12.26% (394/3,215) of the pregnant women were diagnosed HIV positive. There was 0.52% (2/388) overall vertical transmission of HIV, with rates of 1.75% (2/114) among mothers under prophylaxis and 0.00% (0/274) for those under HAART. Genetic mutations were also isolated that induce resistance to ARV such as M184V, Y115F, K103N, Y181C, V179E, and G190A. There were subtypes and CRF of HIV-1 present, the most common being: CRF06_CPX (58.8%), CRF02_AG (35.3%), and subtype G (5.9%). ARV drugs reduce the residual rate of HIV vertical transmission. However, the virus has developed resistance to ARV, which could limit future therapeutic options when treatment is needed. Resistance to ARV therefore requires a permanent interaction between researchers, physicians, and pharmacists, to strengthen the network of monitoring and surveillance of drug resistance in Burkina Faso.

  11. The outcome of prevention of mother to child transmission (PMTCT) of HIV infection programme in Nnewi, southeast Nigeria.

    Science.gov (United States)

    Ikechebelu, J I; Ugboaja, J O; Kalu, S O; Ugochukwu, E F

    2011-01-01

    A lot of challenges face the current efforts at reducing Mother to Child transmission of HIV infection (MTCT) in Sub Saharan Africa due to limited access to Highly active antiretroviral therapy (HAART) and breast feeding practices. A regular review of progress is necessary in order to identify areas of need. This is a one year prospective descriptive study of seven hundred and twenty six mother-infant pairs managed in the PMTCT programme in Nnamdi Azikiwe University Teaching Hospital, Nnewi Southeast Nigeria. The babies HIV status was tested with PCR for HIV DNA while the mothers provided information on infant feeding pattern and the use of antiretroviral (ARV) drugs including prophylaxis for the baby. Information was augmented from the antenatal records. The transmission rate was 2.8% for mothers, who were on HAART, did not breastfeed and whose babies received ARV prophylactic therapy. But for mothers who did not receive HAART, did breastfeed and whose babies did not received ARV prophylactic therapy, the transmission rate was 37.5%. When both the mother and child received ARV drugs, the transmission rate was significantly lower in those who did not breastfeed (2.8%) than in those who breastfed (12.5%)(P < 0.001). When both the mother and child did not receive ARV drugs, the transmission rate significantly lower in those who did not breastfeed (21.1%)than in those who breastfed (37.5%) (P < 0.02). The use of HAART in PMTCT programme in the under resourced areas can achieve similar success rates to that in the industrialized countries. Breastfeeding reduces the efficacy achieved by the use of ARV drugs. Provision of wider access to HAART as well as adequate counselling and support for safer infant feeding practices is recommended.

  12. [Prevalence of primary antiretroviral resistance among HIV infected patients in Chile].

    Science.gov (United States)

    Afani, Alejandro; Beltrán, Carlos; María Gallardo, Ana; Roessler, Patricia; Acevedo, William; Vásquez, Patricia

    2010-06-01

    The main cause of virological failure during AIDS treatment is the resistance to antiretroviral medications (ARV). To search for mutations associated with ARV resistance in recently HIV-1 infected patients naïve to treatment, in Chile. Patients over 18 years old with HIV-1 infection, naïve to anti-retroviral drugs before the study were included. Patients with CD4 cell counts less than 200 cells/mm3, viral load below 2000 copies/mL or any condition indicative of advanced AIDS were excluded. Criteria for diagnosis of recent infection (Chile. Therefore, a genotyping test before starting antiretroviral therapy is not necessary.

  13. Determinants of non-adherence to subsidized anti-retroviral treatment in southeast Nigeria.

    Science.gov (United States)

    Uzochukwu, B S C; Onwujekwe, O E; Onoka, A C; Okoli, C; Uguru, N P; Chukwuogo, O I

    2009-05-01

    The anti-retroviral (ARV) treatment programme in Nigeria is delivered through selected teaching and mission hospitals at a free/subsidized rate. The government aims to scale up ARV treatment in the country. However, non-adherence to ARV medication can lead to viral resistance, treatment failure, toxicities and waste of financial resources. This study examined the factors responsible for non-adherence to free/subsidized ARV treatment in south-east Nigeria. The study was cross-sectional and descriptive. Information was collected from 174 patients selected by simple random sampling from the register of all patients who had been on anti-retroviral therapy (ART) for at least 12 months at the beginning of the study period. Patients were identified during their clinic visits. Information on their socio-demographic profile, ARV treatment and determinants of non-adherence to ARV treatment was obtained from those who gave consent, using pre-tested interviewer-administered questionnaires. All patients clearly understood the need to take ARV drugs throughout their lives, and what the costs entailed. They understood the need for periodic testing, the probability that complications would develop, cost of transportation to treatment site and the daily treatment regimen. Seventy-five per cent of respondents were not adhering fully to their drug regimen; the mean number of days that respondents had been off drugs was 3.57 days the preceding month. Reasons for non-adherence included: physical discomfort (side effects); non-availability of drugs at treatment site; forgetting to carry drugs during the day; fear of social rejection; treatment being a reminder of HIV status; and selling of own drugs to those unable to enrol in the projects. Being female, under 35 years, single, and having higher educational status were significantly associated with non-adherence. It is important that policy makers and programme managers address the factors responsible for non-adherence when scaling up

  14. Prediction of phenotypic susceptibility to antiretroviral drugs using physiochemical properties of the primary enzymatic structure combined with artificial neural networks

    DEFF Research Database (Denmark)

    Kjaer, J; Høj, L; Fox, Z

    2008-01-01

    of physiochemical properties for mutations in HIV-1 protease (PR) and reverse transcriptase (RT) to predict phenotypic susceptibility to all currently approved ARVs. METHOD: We extracted pairs of PR and RT gene sequences (n=1507; 98.5% sub-type B) and their corresponding exact phenotype values (PhenoSense only, n...... coefficient was 0.89. CONCLUSIONS: ANNs, based on the physiochemical properties of the PR and RT amino-acid sequences, predict phenotypic susceptibility to ARVs inhibiting these enzymes to an extent that is comparable to routine phenotypic susceptibility testing. These ANNs can also be used to predict...

  15. Sådan skaber vi mønsterbrydere

    DEFF Research Database (Denmark)

    Jensen, Bente

    2017-01-01

    Treårigt forskningsprojekt viser, at pædagoger og medhjælpere kan undersøtte alle børns trivsel og udvikling og dermed styrke udsatte børns ressourcer. det vil kjælpe med at bryde den sociale arv og forhindre, at vi reproducerer ulighed.......Treårigt forskningsprojekt viser, at pædagoger og medhjælpere kan undersøtte alle børns trivsel og udvikling og dermed styrke udsatte børns ressourcer. det vil kjælpe med at bryde den sociale arv og forhindre, at vi reproducerer ulighed....

  16. Matematikkens historie

    DEFF Research Database (Denmark)

    Hansen, Vagn Lundsgaard

    2009-01-01

    Matematikkens historie i syv kapitler: 1. Matematik i støbeskeen; 2. Matematikkens græske arv; 3. Den gyldne tidsalder for hinduer og arabere; 4. Matematik i Kina; 5. Renæssancens matematik; 6. Regning med infinitesimaler ser dagens lys; 7. Matematik i det tyvende århundrede.......Matematikkens historie i syv kapitler: 1. Matematik i støbeskeen; 2. Matematikkens græske arv; 3. Den gyldne tidsalder for hinduer og arabere; 4. Matematik i Kina; 5. Renæssancens matematik; 6. Regning med infinitesimaler ser dagens lys; 7. Matematik i det tyvende århundrede....

  17. Multi-Level Scenario Module 1: 7th Division

    Science.gov (United States)

    2009-03-01

    2076 km), and Brazos River (2060 km). Populated areas in Attica are well supplied with useable water and have several water treatment and...DOC# D786-11183-1 30 MARCH 2006 REV A Range: 70 km Loiter time: 30 min FCS Armed Robotic Vehicle – Assault Variant (ARV-A) PAM MK 44 30 mm...Range LOS: 0-2 km Range BLOS: 2-12 km Speed: 78 kph road 44 kph cross country Armed Robotic Vehicle – Assault Variant, Light (ARV-A (L

  18. Vietnamese Women's Struggle to Access Antiretroviral Drugs in a Context of Free Treatment

    DEFF Research Database (Denmark)

    Nguyen, Nam Thi Thu; Rasch, Vibeke; Bygbjerg, Ib Christian

    2013-01-01

    This qualitative study aims to explore how HIV positive women living in a northern province of Vietnam experience seeking antiretroviral (ARV) treatment in the public health system, and how they address obstacles encountered along the way. Despite the fact that antiretroviral drugs were freely...... provided, they were not always accessible for women in need. A variety of factors at the population and health system level interacted in ways that often made access to ARV drugs a complicated and time-consuming process. We have suggested changes that could be made at the health system level that may help...

  19. The Role of Antioxidants in Antiretroviral Therapy in Patients ...

    African Journals Online (AJOL)

    Les sujets, qui ont été recrutés comme ils ont évalué le traitement à l'Hôpital général de Lagos, au Nigeria, 166 PVVIH qui avaient été sous HAART depuis au moins un an. Les sujets étaient constitués de deux groupes, les patients sous ARV avec la prise régulière d'anti-oxydants et ceux sur les ARV sans antioxydants.

  20. Hvad betyder Holocaust i dag?

    DEFF Research Database (Denmark)

    Wæhrens, Anne

    2013-01-01

    Holocaust er del af europæernes fælles arv, men hvilken betydning har folkedrabet i dag? Hvorfor bliver Holocaust stadig mindet, og er der andre dele af historiens skyggesider, som også bør blive mindet?......Holocaust er del af europæernes fælles arv, men hvilken betydning har folkedrabet i dag? Hvorfor bliver Holocaust stadig mindet, og er der andre dele af historiens skyggesider, som også bør blive mindet?...