The effects of 2 levels of supplemental dietary poultry fat (PF) and the combination of PF, phytase (PHY) and 25-hydroxycholecalciferol (D3) on the performance of commercial layers inoculated with F-strain Mycoplasma gallisepticum (FMG) were investigated in 2 trials. Sham and FMG inoculations were ...
The effects of 2 supplemental levels of dietary poultry fat (PF) and the combination of PF, phytase (PHY) and 25-hydroxycholecalciferol [25(OH)D] on the blood characteristics of commercial layers inoculated with F-strain Mycoplasma gallisepticum (FMG) were investigated in 2 trials. Sham and FMG ino...
The effects of 2 supplemental levels of dietary poultry fat (PF) and the combination of PF, phytase (PHY) and 25-hydroxycholecalciferol (D3) on the egg characteristics of commercial layers inoculated with F-strain Mycoplasma gallisepticum (FMG) were investigated in 2 trials. Sham and FMG inoculatio...
In a previous study, it was shown to occur in response to an F-strain Mycoplasma gallisepticum (FMG) inoculation layers from our laboratory a significant increase in arterial partial pressure of oxygen (pO2), which is generally associated with an oxygen-dependent improvement in tissue oxygenation to...
ABSTRACT Effects of 2 supplemental concentrations of dietary poultry fat (PF) and the combination of PF, phytase (PHY) and 25-hydroxycholecalciferol [25(OH)D] on the gross digestive and reproductive organ characteristics of commercial layers inoculated with F-strain Mycoplasma gallisepticum (FMG) w...
Polymerase chain reaction-based discrimination of viable from non-viable Mycoplasma gallisepticum
Directory of Open Access Journals (Sweden)
Ching Giap Tan
2014-09-01
Full Text Available The present study was based on the reverse transcription polymerase chain reaction (RT-PCR of the 16S ribosomal nucleic acid (rRNA of Mycoplasma for detection of viable Mycoplasma gallisepticum. To determine the stability of M. gallisepticum 16S rRNA in vitro, three inactivation methods were used and the suspensions were stored at different temperatures. The 16S rRNA of M. gallisepticum was detected up to approximately 20–25 h at 37 °C, 22–25 h at 16 °C, and 23–27 h at 4 °C. The test, therefore, could detect viable or recently dead M. gallisepticum (< 20 h. The RT-PCR method was applied during an in vivo study of drug efficacy under experimental conditions, where commercial broiler-breeder eggs were inoculated with M. gallisepticum into the yolk. Hatched chicks that had been inoculated in ovo were treated with Macrolide 1. The method was then applied in a flock of day 0 chicks with naturally acquired vertical transmission of M. gallisepticum, treated with Macrolide 2. Swabs of the respiratory tract were obtained for PCR and RT-PCR evaluations to determine the viability of M. gallisepticum. This study proved that the combination of both PCR and RT-PCR enables detection and differentiation of viable from non-viable M. gallisepticum.
Mycoplasma gallisepticum in pheasants and the efficacy of tylvalosin to treat the disease.
Forrester, C Anne; Bradbury, Janet M; Dare, Cynthia M; Domangue, Rickie J; Windsor, Helena; Tasker, John B; Mockett, A P Adrian
2011-12-01
Infectious sinusitis, a common condition seen in adult pheasants, is primarily caused by Mycoplasma gallisepticum. The aims of the present study were to investigate the pathogenicity of M. gallisepticum in 14-day-old pheasants and evaluate the macrolide antibiotic tylvalosin (TVN) as a treatment for infectious sinusitis. The minimum inhibitory concentration of TVN for five isolates of M. gallisepticum taken from pheasants confirmed their susceptibility to TVN (range: 0.002 to 0.008 µg/ml). One of the isolates (G87/02) was inoculated intranasally into 72 pheasants (two groups of 36) at 14 days of age. Eight days later, when 18/72 (25%) of the pheasants showed clinical signs, one group was treated with 25 mg TVN/kg bodyweight daily in drinking water for three consecutive days. An uninfected, unmedicated control group (n=12) was also included. In contrast to the uninfected control group, a range of clinical signs typical of infectious sinusitis with varying severity was observed in challenged birds and M. gallisepticum was re-isolated from the infraorbital sinus and the eye/conjunctiva at necropsy, 22 days post challenge. In comparison with untreated birds, medication with TVN significantly reduced clinical signs and the re-isolation/detection of M. gallisepticum (P≤0.0021). The daily liveweight gain of treated birds was significantly increased in comparison with untreated birds (P=0.0002), and similar to daily liveweight gains observed in the uninfected control group. In conclusion, TVN at 25 mg/kg bodyweight daily for three consecutive days in drinking water was efficacious in the treatment of M. gallisepticum infection induced by challenging 14-day-old pheasants.
Armour, Natalie K; Ferguson-Noel, Naola
2015-01-01
Live Mycoplasma gallisepticum vaccines are used for the control of respiratory disease, egg production losses and egg transmission associated with M. gallisepticum infection in long-lived poultry. The first field case of apparent increased virulence and vertical transmission of ts-11, a live M. gallisepticum vaccine, has been reported. In that study a M. gallisepticum isolate from the broiler progeny of ts-11-vaccinated breeders was genotyped as ts-11 by sequence analysis of four different genetic targets and Random Amplified Polymorphic DNA and found to be significantly more virulent than ts-11 vaccine. The objective of the current study was to evaluate the rate of egg transmission and pathogenicity of ts-11 vaccine and isolates recovered from ts-11-vaccinated breeders (K6222B) and their broiler progeny (K6216D) which had been genotyped as ts-11. Groups of 28-week-old specific pathogen-free chickens at 87% average weekly egg production were inoculated with sterile broth media (negative controls), ts-11 vaccine, K6222B, K6216D or R strain (positive controls) by eye-drop and aerosol. K6216D transmitted via the egg at an average rate of 4.0% in the third and fourth weeks post-infection, while egg transmission of K6222B and ts-11 vaccine was not detected. M. gallisepticum was isolated from the air sacs, ovaries and oviducts of hens infected with K6216D and K6222B, but not from those infected with ts-11 vaccine. K6216D and K6222B both induced respiratory signs and significantly more tracheal colonization and more severe tracheal and air sac lesions than ts-11 vaccine (P ≤ 0.05). There were no substantial differences in the egg production of ts-11, K6216D and K6222B infected groups. These results provide the first conclusive evidence of transovarian transmission of an isolate genotyped as ts-11 and indicate that isolates genotyed as ts-11 vary in their virulence and ability to transmit via the egg.
The development and application of a Mycoplasma gallisepticum sequence database.
Armour, Natalie K; Laibinis, Victoria A; Collett, Stephen R; Ferguson-Noel, Naola
2013-01-01
Molecular analysis was conducted on 36 Mycoplasma gallisepticum DNA extracts from tracheal swab samples of commercial poultry in seven South African provinces between 2009 and 2012. Twelve unique M. gallisepticum genotypes were identified by polymerase chain reaction and sequence analysis of the 16S-23S rRNA intergenic spacer region (IGSR), M. gallisepticum cytadhesin 2 (mgc2), MGA_0319 and gapA genetic regions. The DNA sequences of these genotypes were distinct from those of M. gallisepticum isolates in a database composed of sequences from other countries, vaccine and reference strains. The most prevalent genotype (SA-WT#7) was detected in samples from commercial broilers, broiler breeders and layers in five provinces. South African M. gallisepticum sequences were more similar to those of the live vaccines commercially available in South Africa, but were distinct from that of F strain vaccine, which is not registered for use in South Africa. The IGSR, mgc2 or MGA_0319 sequences of three South African genotypes were identical to those of the ts-11 vaccine strain, necessitating a combination of mgc2 and IGSR targeted sequencing to differentiate South African wild-type genotypes from ts-11 vaccine. To identify and differentiate all 12 wild-types, mgc2, IGSR and MGA_0319 sequencing was required. Sequencing of gapA was least effective at strain differentiation. This research serves as a model for the development of an M. gallisepticum sequence database, and illustrates its application to characterize M. gallisepticum genotypes, select diagnostic tests and better understand the epidemiology of M. gallisepticum.
Olanrewaju, H A; Collier, S D; Branton, S L
2011-02-01
A previous study from our laboratory on F-strain Mycoplasma gallisepticum-inoculated layers showed a significant increase in arterial partial pressure of oxygen (pO(2)), which is generally associated with an oxygen-dependent improvement in tissue oxygenation. The aim of this study was to determine whether a killed (bacterin) and live TS-11-strain M. gallisepticum (TS-11-MG) vaccine treatment combination could further enhance the arterial pO(2) levels in layer chickens. The experiment was conducted in 2 trials and arranged in a completely randomized experimental design with 4 treatments. The treatments consisted of a control M. gallisepticum, bacterin, TS-11-MG, and bacterin + TS-11-MG combined, with all treatments receiving the R low strain of MG at 30 wk of age (WOA). In each of the 2 trials, 160 one-day-old MG-free pullets were raised to 10 WOA and were transported to a poultry disease isolation facility. Sixteen isolation units were divided into 4 treatment groups, and each of the 4 treatment groups had 4 replication units, with 10 birds/unit (40 birds/treatment). Venous blood samples were collected at the termination of the study at 56 WOA. The TS-11-MG-vaccinated chickens had a higher (P ≤ 0.05) blood pO(2) and a lower (P ≤ 0.05) partial pressure of CO(2) when compared with the control and combined MG-vaccinated groups. However, no significant blood pO(2) differences were observed between the bacterin and TS-11-MG treatment groups. Hematocrit and blood concentrations of hemoglobin were not statistically different among treatments, but were numerically higher in the TS-11-MG treatment group. There was a significant (P ≤ 0.05) treatment effect on blood concentrations of Na(+), Ca(2+), and anion, but no significant effect on glucose, cholesterol, triglyceride, or osmolality. These data suggest that the inoculation of layers with TS-11-MG was more effective in elevating pO(2) than was inoculation with TS-11-MG + bacterin combined.
Xiao, Xia; Sun, Jian; Yang, Tao; Fang, Xi; Cheng, Jie; Xiong, Yan Q; Liu, Ya-Hong
2016-01-01
Mycoplasma gallisepticum is the most important pathogen in poultry among four pathogenic Mycoplasma species. Tiamulin is a pleuromutilin antibiotic that shows a great activity against M. gallisepticum and has been approved for use in veterinary medicine particularly for poultry. However, the pharmacokinetic/pharmacodynamics (PK/PD) profiles of tiamulin against M. gallisepticum are not well understood. Therefore, in the current studies, we investigated the in vivo PK/PD profiles of tiamulin using a well-established experimental intratracheal infection model of M. gallisepticum. The efficacy of tiamulin against M. gallisepticum was studied in 8-day-old chickens after intramuscular (i.m.) administration at 10 doses between 0-80 mg/kg. Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was used to evaluate the PK parameters of tiamulin following i.m. administration at doses of 5, 40, and 80 mg/kg in Mycoplasma gallisepticum-infected neutropenic chickens. Real-time PCR (RT-PCR) was used for quantitative detection of M. gallisepticum. The MIC of tiamulin against M. gallisepticum strain S6 was 0.03 μg/mL. The PK/PD index, AUC24h/MIC, correlated well with the in vivo antibacterial efficacy. The in vivo data suggest that animal dosage regimens should supply AUC24h/MIC of tiamulin of 382.68 h for 2 log10 ccu equivalents M. gallisepticum reduction. To attain that goal, the administered dose is expected to be 45 mg/kg b.w. for treatment of M. gallisepticum infection with an MIC90 of 0.03 μg/mL.
Directory of Open Access Journals (Sweden)
Xia Xiao
2016-09-01
Full Text Available Mycoplasma gallisepticum is the most important pathogen in poultry among four pathogenic Mycoplasma species. Tiamulin is a pleuromutilin antibiotic that shows a great activity against M. gallisepticum and has been approved for use in veterinary medicine particularly for poultry. However, the Pharmacokinetic/Pharmacodynamics (PK/PD profiles of tiamulin against M. gallisepticum are not well understood. Therefore, in the current studies, we investigated the in vivo PK/PD profiles of tiamulin using a well-established experimental intratracheal infection model of M. gallisepticum. The efficacy of tiamulin against M. gallisepticum was studied in 8-day-old chickens after intramuscular (i.m. administration at 10 doses between 0-80 mg/kg. Liquid chromatography-tandem mass spectrometry (LC-MS/MS was used to evaluate the PK parameters of tiamulin following i.m. administration at doses of 5, 40 and 80 mg/kg in Mycoplasma gallisepticum infected neutropenic chickens. Real time PCR (RT-PCR was used for quantitative detection of M. gallisepticum. The MIC of tiamulin against M. gallisepticum strain S6 was 0.03 μg/mL. The PK/PD index, AUC24h/MIC, correlated well with the in vivo antibacterial efficacy. The in vivo data suggest that animal dosage regimens should supply AUC24h/MIC of tiamulin of 382.68 h for 2 log10 ccu equivalents M. gallisepticum reduction. To attain that goal, the administered dose is expected to be 45 mg/kg b.w. for treatment of M. gallisepticum infection with an MIC90 of 0.03 μg/mL.
Mycoplasma gallisepticum in pheasants and the efficacy of tylvalosin to treat the disease
Tasker , John B; Forrester , C Anne; Bradbury , Janet M; Dare , Cynthia M; Domangue , Rickie J; Windsor , Helena; Mockett , A P Adrian
2011-01-01
Abstract Infectious sinusitis, a common condition seen in adult pheasants, is primarily caused by Mycoplasma gallisepticum. The aims of this study were to investigate the pathogenicity of M. gallisepticum in 14 day old pheasants and evaluate the macrolide antibiotic, tylvalosin (TVN), as a treatment for infectious sinusitis. The minimum inhibitory concentration (MIC) of TVN for five isolates of M. gallisepticum taken from pheasants confirmed their susceptibility to TVN (MIC range...
Xiao, Xia; Sun, Jian; Yang, Tao; Fang, Xi; Cheng, Jie; Xiong, Yan Q.; Liu, Ya-Hong
2016-01-01
Mycoplasma gallisepticum is the most important pathogen in poultry among four pathogenic Mycoplasma species. Tiamulin is a pleuromutilin antibiotic that shows a great activity against M. gallisepticum and has been approved for use in veterinary medicine particularly for poultry. However, the pharmacokinetic/pharmacodynamics (PK/PD) profiles of tiamulin against M. gallisepticum are not well understood. Therefore, in the current studies, we investigated the in vivo PK/PD profiles of tiamulin us...
Xia Xiao; Xia Xiao; Jian Sun; Tao Yang; Xi Fang; Jie Cheng; Yan Q. Xiong; Yan Q. Xiong; Ya-Hong Liu; Ya-Hong Liu
2016-01-01
Mycoplasma gallisepticum is the most important pathogen in poultry among four pathogenic Mycoplasma species. Tiamulin is a pleuromutilin antibiotic that shows a great activity against M. gallisepticum and has been approved for use in veterinary medicine particularly for poultry. However, the Pharmacokinetic/Pharmacodynamics (PK/PD) profiles of tiamulin against M. gallisepticum are not well understood. Therefore, in the current studies, we investigated the in vivo PK/PD profiles of tiamulin us...
Garmyn, A; Vereecken, M; Degussem, K; Depondt, W; Haesebrouck, F; Martel, A
2017-09-01
Mycoplasma gallisepticum (M. gallisepticum) remains one of the most important diseases in poultry production. Controlling the impact of the disease is done by eradication of positive breeder flocks or by vaccination and medication. A widely used molecule in medication programs is tiamulin, a pleuromutilin antibiotic. Since recent data on the in vivo efficacy of this molecule are scarce, 2 challenge studies were conducted using a recently isolated M. gallisepticum strain belonging to the wildtype population with regard to its tiamulin and tetracycline minimum inhibitory concentration (MIC). In the first challenge study, the dose rate of tiamulin was tested. For this, broilers were infected with M. gallisepticum and treated with 10 mg or 25 mg tiamulin hydrogen fumarate (hf)/kg body weight (BW) for 5 successive days. In a second challenge study, the dose rate of tiamulin combined with chlortetracycline was tested. For this, broilers were infected with M. gallisepticum and treated with 6.25 mg tiamulin hf/18.75 mg chlortetracycline hydrochloride (hcl)/kg BW or 12.5 mg tiamulin hf/37.5 mg chlortetracycline hcl/kg BW for 5 successive days. Clinical scoring of respiratory signs, macroscopic scoring of respiratory tract lesions, M. gallisepticum isolation from the respiratory organs, weight gain, and mortality were the monitored efficacy parameters. The first study demonstrated that a 5-day 10 mg/kg BW tiamulin hf treatment provided significant protection against the M. gallisepticum infection. However, since the 5-day 25 mg/kg BW group was significantly better than the 10 mg/kg BW for reducing the post-treatment clinical signs and the M. gallisepticum numbers in the respiratory organs, the 25 mg/kg BW treatment is recommended for clinical M. gallisepticum infections. In the second study, the combined 12.5 mg tiamulin hf/37.5 mg chlortetracycline hcl/kg BW resulted in a significant reduction of the severity of clinical respiratory disease post treatment and a
Stipkovits, Laszlo; Egyed, Laszlo; Palfi, Vilmos; Beres, Andrea; Pitlik, Ervin; Somogyi, Maria; Szathmary, Susan; Denes, Bela
2012-01-01
Mycoplasma infection is still very common in chicken and turkey flocks. Several low-pathogenicity avian influenza (LPAI) viruses are circulating in wild birds that can be easily transmitted to poultry flocks. However, the effect of LPAI on mycoplasma infection is not well understood. The aim of the present study was to investigate the infection of LPAI virus H3N8 (A/mallard/Hungary/19616/07) in chickens challenged with Mycoplasma gallisepticum. Two groups of chickens were aerosol challenged with M. gallisepticum. Later one of these groups and one mycoplasma-free group were aerosol challenged with the LPAI H3N8 virus. The birds were observed for clinical signs for 8 days, then euthanized, and examined for the presence of M. gallisepticum in the trachea, lung, air sac, liver, spleen, kidney and heart, and for developing anti-mycoplasma and anti-viral antibodies. The LPAI H3N8 virus did not cause any clinical signs but M. gallisepticum infection caused clinical signs, reduction of body weight gain and colonization of the inner organs. These parameters were more severe in the birds co-infected with M. gallisepticum and LPAI H3N8 virus than in the group challenged with M. gallisepticum alone. In addition, in the birds infected with both M. gallisepticum and LPAI H3N8 virus, the anti-mycoplasma antibody response was reduced significantly when compared with the group challenged with M. gallisepticum alone. Co-infection with LPAI H3N8 virus thus enhanced pathogenesis of M. gallisepticum infection significantly.
Directory of Open Access Journals (Sweden)
Min Rahminiwati
2016-01-01
Full Text Available Betle and ginger juice extracts have been reported to have antibacterial activity against E. coliand M. gallisepticum. However, fractionation analysis showed the have differences in their antibacterialpotency which appeared to be associated with the nature of the solvent polarity. This study wasconducted to obtain information about antibacterial activity of Piper betles and gingers extract againstE. coli and M. gallisepticum. Three types of betle, P. betle, P. betle var nigra, P. crocatum, wereexamined for their antibacterial activity using disc method and three types of ginger, Zingiber officinale,Z. officinale Linn var rubrum, and Z. majus rumph which were extracted by soxhletation using ethanol30%, 60% and 90% as well as distestillation for three and five hours. Piper betle and P. crocatumconsistently have antibacterial effect against E. coli whereas Z. officinale consistently has antibacterialeffect against M. gallisepticum, either extracted by distillation or soxhletation. Piper betle is potentialyield of distillate and extract that has the highest antibacterial activity against E. coli, and M.gallisepticum with inhibitory zone were 9.76 mm and 22 mm respectively.
Zhang, Nan; Ye, Xiaomei; Wu, Yuzhi; Huang, Zilong; Gu, Xiaoyan; Cai, Qinren; Shen, Xiangguang; Jiang, Hongxia; Ding, Huanzhong
2017-01-01
Mycoplasma gallisepticum is a common etiological cause of a chronic respiratory disease in chickens; its increasing antimicrobial resistance compromises the use of tetracyclines, macrolides and quinolones in the farm environment. Mutant selection window (MSW) determination was used to investigate the propensity for future resistance induction by danofloxacin, doxycycline, tilmicosin, tylvalosin and valnemulin. Killing of M. gallisepticum strain S6 by these antimicrobials was also studied by incubating M. gallisepticum into medium containing the compounds at the minimal concentration that inhibits colony formation by 99% (MIC99) and the mutant prevention concentration (MPC). Based on the morphology and colony numbers of M. gallisepticum on agar plates, the four kinds of sera in the order of the applicability for culturing M. gallisepticum were swine serum > horse serum > bovine serum > mixed serum. The MPC/MIC99 values for each agent were as follows: danofloxacin > tilmicosin > tylvalosin > doxycycline > valnemulin. MPC generated more rapid and greater magnitude killing than MIC99 against M. gallisepticum. Under exposure of 105-109 CFU/mL at MPC drug levels, valnemulin had the slowest rate of reduction in viable organisms and danofloxacin had the highest rate of reduction.
Directory of Open Access Journals (Sweden)
Nan Zhang
Full Text Available Mycoplasma gallisepticum is a common etiological cause of a chronic respiratory disease in chickens; its increasing antimicrobial resistance compromises the use of tetracyclines, macrolides and quinolones in the farm environment. Mutant selection window (MSW determination was used to investigate the propensity for future resistance induction by danofloxacin, doxycycline, tilmicosin, tylvalosin and valnemulin. Killing of M. gallisepticum strain S6 by these antimicrobials was also studied by incubating M. gallisepticum into medium containing the compounds at the minimal concentration that inhibits colony formation by 99% (MIC99 and the mutant prevention concentration (MPC. Based on the morphology and colony numbers of M. gallisepticum on agar plates, the four kinds of sera in the order of the applicability for culturing M. gallisepticum were swine serum > horse serum > bovine serum > mixed serum. The MPC/MIC99 values for each agent were as follows: danofloxacin > tilmicosin > tylvalosin > doxycycline > valnemulin. MPC generated more rapid and greater magnitude killing than MIC99 against M. gallisepticum. Under exposure of 105-109 CFU/mL at MPC drug levels, valnemulin had the slowest rate of reduction in viable organisms and danofloxacin had the highest rate of reduction.
Li, Bei-Bei; Shen, Jian-Zhong; Cao, Xing-Yuan; Wang, Yang; Dai, Lei; Huang, Si-Yang; Wu, Cong-Ming
2010-07-01
Mycoplasma gallisepticum is a major etiological agent of chronic respiratory disease (CRD) in chickens and sinusitis in turkeys. The pleuromutilin antibiotics tiamulin and valnemulin are currently used in the treatment of M. gallisepticum infection. We studied the in vitro development of pleuromutilin resistance in M. gallisepticum and investigated the molecular mechanisms involved in this process. Pleuromutilin-resistant mutants were selected by serial passages of M. gallisepticum strains PG31 and S6 in broth medium containing subinhibitory concentrations of tiamulin or valnemulin. A portion of the gene encoding 23S rRNA gene (domain V) and the gene encoding ribosome protein L3 were amplified and sequenced. No mutation could be detected in ribosome protein L3. Mutations were found at nucleotide positions 2058, 2059, 2061, 2447 and 2503 of 23S rRNA gene (Escherichia coli numbering). Although a single mutation could cause elevation of tiamulin and valnemulin MICs, combinations of two or three mutations were necessary to produce high-level resistance. All the mutants were cross-resistant to lincomycin, chloramphenicol and florfenicol. Mutants with the A2058G or the A2059G mutation exhibited cross-resistance to macrolide antibiotics erythromycin, tilmicosin and tylosin.
International Nuclear Information System (INIS)
Billaux, D.; Peterson, J.; Bodea, S.; Long, J.
1989-01-01
The purpose of this report is to provide the user with sufficient information to run the programs FMG, RENUM, LINEL, and ELLFMG. A previous report explained the theory and the design of these programs, so that by using the two reports, a thorough understanding of the codes is possible. This report should familiarize the user with program options and modes of operation, input variables, input and output files. Information not strictly needed to run the programs, but useful in understanding their internal structure is provided in appendices. The appendices cover program variables and arrays, subroutine outlines, a short description of each subroutine, and finally listings of codes. The additional information on FMG, RENUM, LINEL, and ELLFMG is in Appendices A, C, E, G respectively, and the listings are in Appendices B, D, F, and H
Sanei, B; Barnes, H J; Vaillancourt, J P; Leyc, D H
2007-03-01
During an epidemic of mycoplasmosis in chicken and turkey flocks in North Carolina between 1999 and 2001, isolates of Mycoplasma gallisepticum (MG) from affected flocks were characterized by random amplification of polymorphic DNA (RAPD), and eight distinct RAPD types were identified. MG RAPD type B accounted for more than 90% of the isolates and was associated with moderate-to-severe clinical signs and mortality. The virulence of MG RAPD type B for chickens and turkeys was compared with sham-inoculated negative controls and MG S6 (a virulent strain)-inoculated positive controls. Clinical signs occurred in chickens and turkeys inoculated with either MG RAPD type B or MG S6. However, they were not as frequent or severe as those seen in naturally affected flocks, and there was no mortality in the experimental groups. Based on gross and microscopic findings, MG RAPD type B was equal to or more virulent than MG S6. All MG-inoculated birds were culture and PCR positive at 7 and 14 days postinoculation (PI). Among serological tests, the serum plate agglutination test was positive for the majority of chickens and turkeys (58%-100%) infected with either strain of MG at both 7 and 14 days PI. The hemagglutination inhibition test was negative for all birds at 7 days PI and positive for a few chickens (8%-17%) and several turkey sera (40%-60%) at 14 days PI. Only a single serum was positive by enzyme-linked immunosorbent assay (an MG S6-infected turkey) at 14 days PI.
Cobb, D T; Ley, D H; Doerr, P D
1992-01-01
Serum samples and choanal cleft swabs were collected from livetrapped and hunter killed wild turkeys (Meleagris gallopavo) from Martin and Bertie counties, North Carolina (USA). Sera were tested for antibodies to Mycoplasma gallisepticum, Mycoplasma synoviae and Mycoplasma meleagridis by hemagglutination inhibition (HI). Sera from 33% (five of 15) of livetrapped turkeys were positive for antibodies to M. gallisepticum by HI, and all were negative for antibodies to M. synoviae and M. meleagridis. Choanal cleft swabs from 22 livertrapped and five hunter killed wild turkeys cultured in Frey's broth medium resulted in 23 mycoplasma isolations. Using direct immunofluorescence, 74% (17/23) were M. gallopavonis, and 26% (six of 23) were unidentified; no isolate was identified as M. gallisepticum, M. synoviae or M. meleagridis.
Zhang, Nan; Ye, Xiaomei; Wu, Yuzhi; Huang, Zilong; Gu, Xiaoyan; Cai, Qinren; Shen, Xiangguang; Jiang, Hongxia; Ding, Huanzhong
2017-01-01
Mycoplasma gallisepticum is a common etiological cause of a chronic respiratory disease in chickens; its increasing antimicrobial resistance compromises the use of tetracyclines, macrolides and quinolones in the farm environment. Mutant selection window (MSW) determination was used to investigate the propensity for future resistance induction by danofloxacin, doxycycline, tilmicosin, tylvalosin and valnemulin. Killing of M. gallisepticum strain S6 by these antimicrobials was also studied by i...
Directory of Open Access Journals (Sweden)
Eddy J Bautista
Full Text Available Primarily used for metabolic engineering and synthetic biology, genome-scale metabolic modeling shows tremendous potential as a tool for fundamental research and curation of metabolism. Through a novel integration of flux balance analysis and genetic algorithms, a strategy to curate metabolic networks and facilitate identification of metabolic pathways that may not be directly inferable solely from genome annotation was developed. Specifically, metabolites involved in unknown reactions can be determined, and potentially erroneous pathways can be identified. The procedure developed allows for new fundamental insight into metabolism, as well as acting as a semi-automated curation methodology for genome-scale metabolic modeling. To validate the methodology, a genome-scale metabolic model for the bacterium Mycoplasma gallisepticum was created. Several reactions not predicted by the genome annotation were postulated and validated via the literature. The model predicted an average growth rate of 0.358±0.12[Formula: see text], closely matching the experimentally determined growth rate of M. gallisepticum of 0.244±0.03[Formula: see text]. This work presents a powerful algorithm for facilitating the identification and curation of previously known and new metabolic pathways, as well as presenting the first genome-scale reconstruction of M. gallisepticum.
Sensitivity of some local isolates of Mycoplasma gallisepticum against antibiotics
Directory of Open Access Journals (Sweden)
Sutiastuti Wahyuwardani
1998-03-01
Full Text Available Sensitivity of five local isolates ofMycoplasma gallisepticum (MG strain and two standard MG isolates obtained from Australia were tested against antibiotics of oxytetracycline, doxycycline, erythromycin, bacitracin, vancomycin, methicillin and penicillin using antibiogram disc method. The result showed that one, 2 and 3 local MG isolates were resistent to doxycycline, erythromycin and oxytetracycline respectively . MG isolate of ADA7 from Australia was found to be resistent to all antibiotics tested. None ofthe local MG isolates were sensitive against bacitracin, vancomycin, methicillin and penicillin.
Directory of Open Access Journals (Sweden)
Marco Tamba
2010-01-01
Full Text Available The prevalence of Mycoplasma gallisepticum infection in commercial layers was established by the presence of antibodies in eggs. Saline-extracted yolks were used with a commercial enzyme-linked immunosorbent assay kit. For the prevalence study, yolks from 30 eggs were obtained from each of 66 flocks coming from 36 layer farms. The prevalence of egg antibodies to Mycoplasma gallisepticum was 33.3% in single-age farms and 77.8% in multi-age farms. In 27 flocks, antibody titers were compared with results obtained from blood samples taken in the same flock and in the same period and analyzed with the same kit. This study has confirmed that egg yolk enzyme-linked immunosorbent assay antibody test is a suitable and practical approach for assessing the flock prevalence of Mycoplasma gallisepticum infection in layer hens.
Vinkler, Michal; Leon, Ariel E; Kirkpatrick, Laila; Dalloul, Rami A; Hawley, Dana M
2018-01-01
The recent emergence of the poultry bacterial pathogen Mycoplasma gallisepticum (MG) in free-living house finches ( Haemorhous mexicanus ), which causes mycoplasmal conjunctivitis in this passerine bird species, resulted in a rapid coevolutionary arms-race between MG and its novel avian host. Despite extensive research on the ecological and evolutionary dynamics of this host-pathogen system over the past two decades, the immunological responses of house finches to MG infection remain poorly understood. We developed seven new probe-based one-step quantitative reverse transcription polymerase chain reaction assays to investigate mRNA expression of house finch cytokine genes ( IL1B, IL6, IL10, IL18, TGFB2, TNFSF15 , and CXCLi2 , syn. IL8L ). These assays were then used to describe cytokine transcription profiles in a panel of 15 house finch tissues collected at three distinct time points during MG infection. Based on initial screening that indicated strong pro-inflammatory cytokine expression during MG infection at the periorbital sites in particular, we selected two key house finch tissues for further characterization: the nictitating membrane, i.e., the internal eyelid in direct contact with MG, and the Harderian gland, the secondary lymphoid tissue responsible for regulation of periorbital immunity. We characterized cytokine responses in these two tissues for 60 house finches experimentally inoculated either with media alone (sham) or one of two MG isolates: the earliest known pathogen isolate from house finches (VA1994) or an evolutionarily more derived isolate collected in 2006 (NC2006), which is known to be more virulent. We show that the more derived and virulent isolate NC2006, relative to VA1994, triggers stronger local inflammatory cytokine signaling, with peak cytokine expression generally occurring 3-6 days following MG inoculation. We also found that the extent of pro-inflammatory interleukin 1 beta signaling was correlated with conjunctival MG loads
Directory of Open Access Journals (Sweden)
Michal Vinkler
2018-01-01
Full Text Available The recent emergence of the poultry bacterial pathogen Mycoplasma gallisepticum (MG in free-living house finches (Haemorhous mexicanus, which causes mycoplasmal conjunctivitis in this passerine bird species, resulted in a rapid coevolutionary arms-race between MG and its novel avian host. Despite extensive research on the ecological and evolutionary dynamics of this host–pathogen system over the past two decades, the immunological responses of house finches to MG infection remain poorly understood. We developed seven new probe-based one-step quantitative reverse transcription polymerase chain reaction assays to investigate mRNA expression of house finch cytokine genes (IL1B, IL6, IL10, IL18, TGFB2, TNFSF15, and CXCLi2, syn. IL8L. These assays were then used to describe cytokine transcription profiles in a panel of 15 house finch tissues collected at three distinct time points during MG infection. Based on initial screening that indicated strong pro-inflammatory cytokine expression during MG infection at the periorbital sites in particular, we selected two key house finch tissues for further characterization: the nictitating membrane, i.e., the internal eyelid in direct contact with MG, and the Harderian gland, the secondary lymphoid tissue responsible for regulation of periorbital immunity. We characterized cytokine responses in these two tissues for 60 house finches experimentally inoculated either with media alone (sham or one of two MG isolates: the earliest known pathogen isolate from house finches (VA1994 or an evolutionarily more derived isolate collected in 2006 (NC2006, which is known to be more virulent. We show that the more derived and virulent isolate NC2006, relative to VA1994, triggers stronger local inflammatory cytokine signaling, with peak cytokine expression generally occurring 3–6 days following MG inoculation. We also found that the extent of pro-inflammatory interleukin 1 beta signaling was correlated with conjunctival
Directory of Open Access Journals (Sweden)
Elena Mettifogo
2015-01-01
Full Text Available Mycoplasma gallisepticum (MG and Mycoplasma synoviae (MS are the mycoplasma infections of most concern for commercial poultry industry. MG infection is commonly designated as chronic respiratory disease (CRD of chickens and infections sinusitis of turkeys. MS causes sub clinical upper respiratory infection and tenosynovitis or bursitis in chickens and turkeys. The multiplex PCR was standardized to detect simultaneously the MS, MG field strains and MG F-vaccine strain specific. The generic PCR for detection of any species of Mollicutes Class was performed and compared to the multiplex PCR and to PCR using species-specific primers. A total of 129 avian tracheal swabs were collected from broiler-breeders, layer hens and broilers in seven different farms and were examined by multiplex PCR methods. The system (multiplex PCR demonstrated to be very rapid, sensitive, and specific. Therefore, the results showed a high prevalence of MS in the flocks examined (27.9%, and indicate that the MS is a recurrent pathogen in Brazilian commercial poultry flocks.
Takahashi, I; Yoshida, T
1989-05-01
In vitro activities of ofloxacin (OFLX), a new quinolone derivative, against 29 strains of Mycoplasma gallisepticum was compared with those of 4 commonly used antimicrobial agents, doxycycline (DOXY), tylosin (TS), spectinomycin (SPCM) and thiamphenicol (TP). Antimycoplasmal activities of the drugs were evaluated on the MIC (final MIC) and MPC (minimum mycoplasmacidal concentration) values which were determined by a broth dilution procedure. The following results were obtained. 1. The MIC90s of OFLX and DOXY were both 0.20 micrograms/ml. The MICs of TS were distributed through a wide range (less than or equal to 0.006 - 0.78 micrograms/ml), and its MIC90 was 0.78 micrograms/ml. Of 29 M. gallisepticum strains, 27.6% were recognized as TS-resistant. The MIC90 values of SPCM and TP were 1.56 micrograms/ml and 3.13 micrograms/ml, respectively. The MIC90 of OFLX was equal to that of DOXY and 4- to 16-fold smaller than the values of the other 3 antibiotics. 2. The MPC of OFLX was the lowest among the antibiotics tested, its MPC90 value was 0.39 micrograms/ml and was followed by DOXY (1.56 micrograms/ml). The MPCs of TS were distributed in a wide range (0.012 - 3.13 micrograms/ml), and its MPC90 was 3.13 micrograms/ml. The MPC90 values of SPCM and TP were both 6.25 micrograms/ml. Therefore, the mycoplasmacidal activity of OFLX evaluated with MPC90 values was 4- to 16-fold greater than those of the other 4 antibiotics.
Pflaum, K; Tulman, E R; Beaudet, J; Liao, X; Dhondt, K V; Dhondt, A A; Hawley, D M; Ley, D H; Kerr, K M; Geary, S J
2017-06-01
Mycoplasma gallisepticum , known primarily as a respiratory pathogen of domestic poultry, has emerged since 1994 as a significant pathogen of the house finch ( Haemorhous mexicanus ) causing severe conjunctivitis and mortality. House finch-associated M. gallisepticum (HFMG) spread rapidly and increased in virulence for the finch host in the eastern United States. In the current study, we assessed virulence in domestic poultry with two temporally distant, and yet geographically consistent, HFMG isolates which differ in virulence for house finches-Virginia 1994 (VA1994), the index isolate of the epidemic, and Virginia 2013 (VA2013), a recent isolate of increased house finch virulence. Here we report a significant difference between VA1994 and VA2013 in their levels of virulence for chickens; notably, this difference correlated inversely to the difference in their levels of virulence for house finches. VA1994, while moderately virulent in house finches, displayed significant virulence in the chicken respiratory tract. VA2013, while highly virulent in the house finch, was significantly attenuated in chickens relative to VA1994, displaying less-severe pathological lesions in, and reduced bacterial recovery from, the respiratory tract. Overall, these data indicate that a recent isolate of HFMG is greatly attenuated in the chicken host relative to the index isolate, notably demonstrating a virulence phenotype in chickens inversely related to that in the finch host. Copyright © 2017 American Society for Microbiology.
Directory of Open Access Journals (Sweden)
Nouzha Heleili
Full Text Available Aim: The present study was undertaken to know the seroprevalence of Mycoplasma synoviae (MS and Mycoplasma gallisepticum (MG in broiler and layer chickens in the area of Batna, eastern Algeria. This investigation was conducted during the period from 2008 to 2011. Materials and Methods: A total of 505 sera samples were collected and tested by serum plate agglutination (SPA test using Mycoplasma gallisepticum and Mycoplasma synoviae antigens (Soleil Diagnostic to detect the presence of antibodies against MS and MG. Results: The overall prevalence of MS and MG infection in the 27 flocks visited in this investigation were recorded as 66.33% and 69.90% respectively. Seroprevalence of MG infection was found significantly (p<0.05 higher during winter season (61.48% than in summer (47.74% while MS infection is more dominant in summer (91.25% against 46.69%. Again this was recorded in different age groups, with significantly higher occurrence in young compared to adult with 85.14% in layer hens and 90.73% in broiler chickens. On the other hand, the seroprevalence of MG and MS infection was found little (p>0.05 higher in large flocks (76.97% in comparison to small flocks (63.63%. The highest prevalence (76.59% of mycoplasmal infection in layer hens was found in Lohman strain. Conclusion: It has been found that MG and MS infections are still important disease problems in poultry farms in Algeria. [Vet World 2012; 5(12.000: 709-712
Spray application is a commonly used time- and labor-efficient means to deliver live Mycoplasma gallisepticum (MG) vaccine to laying hens in commercial production facilities. The dosage of vaccine received by spray vaccinated birds can vary due to variation in the spray plume and vaccine suspension...
Gerchman, Irina; Lysnyansky, Inna; Perk, Shimon; Levisohn, Sharon
2008-10-15
Monitoring of susceptibility to antibiotics in field isolates of pathogenic avian mycoplasmas is important for appropriate choice of treatment. Our study compared in vitro susceptibility to enrofloxacin and difloxacin in recent (2005-2006) isolates of Mycoplasma gallisepticum and Mycoplasma synoviae from meat-type turkey flocks with archived (1997-2003) isolates and reference strains. Comparison of minimal inhibitory concentration (MIC) values determined by microtest, agar dilution and commercial Etest showed good agreement, but underscored the need for standardized methods for testing. Notably, while the commercial Etest was convenient and accurate for determining MICs for enrofloxacin in the range 0.002-0.094microg/ml, the endpoint of inhibition for M. gallisepticum and M. synoviae strains with MIC values > or =1.0microg/ml could not be determined. A decrease in susceptibility to both fluoroquinolones was detected in archived strains but to a greater degree in recent isolates, most of which had MICs above the NCCLS susceptibility breakpoint for these antibiotics (meat-type turkeys suggests that these strains have become established in Israel, necessitating a reevaluation of antibiotic therapy. Periodic survey of MICs in field isolates of avian mycoplasmas to monitor for the possible appearance of resistant strains is recommended.
Gautier-Bouchardon, A V; Reinhardt, A K; Kobisch, M; Kempf, I
2002-08-02
The in vitro emergence of resistance to enrofloxacin, erythromycin, tylosin, tiamulin, and oxytetracycline in three avian Mycoplasma species, Mycoplasma gallisepticum, Mycoplasma synoviae and Mycoplasma iowae was studied. Mutants were selected stepwise and their MICs were determined after 10 passages in subinhibitory concentrations of antibiotic. High-level resistance to erythromycin and tylosin developed within 2-6 passages in the three Mycoplasma species. Resistance to enrofloxacin developed more gradually. No resistance to tiamulin or oxytetracycline could be evidenced in M. gallisepticum or M. synoviae after 10 passages whereas, resistant mutants were obtained with M. iowae. Cross-sensitivity tests performed on mutants demonstrated that mycoplasmas made resistant to tylosin were also resistant to erythromycin, whereas mutants made resistant to erythromycin were not always resistant to tylosin. Some M. iowae tiamulin-resistant mutants were also resistant to both macrolide antibiotics. Enrofloxacin and oxytetracycline did not induce any cross-resistance to the other antibiotics tested. These results show that Mycoplasma resistance to macrolides can be quickly selected in vitro, and thus, providing that similar results could be obtained under field conditions, that development of resistance to these antibiotics in vivo might also be a relatively frequent event.
Experimental Mycoplasma gallisepticum infections in captive-reared wild turkeys
Rocke, Tonie E.; Yuill, Thomas M.; Amundson, Terry E.
1988-01-01
The effects of Mycoplasma gallisepticum (MG) infections on egg production, fertility, and hatchability were studied in captive-reared wild turkeys (Meleagris gallopavo). Three groups of adult birds, each consisting of four hens and two toms, were exposed to MG by the respiratory route at the beginning of their breeding season. Fourteen control birds received sterile growth medium. Although no mortality of infected or control birds occurred, egg production during the first breeding season after infection was reduced. The mean number of eggs/hen/day produced by infected groups the first breeding season postexposure (PE) was significantly lower than the control value. The mean number of eggs produced daily by the same hens 1 yr later was unaffected by MG infection. The pecentage of fertile eggs produced by infected groups was slightly reduced in both the first and second breeding seasons PE. Hatchability of fertile eggs from infected hens was significantly lower than eggs from control hens. Productivity may be impaired if MG infections occur in free-ranging wild turkey populations.
Limsatanun, A; Sasipreeyajan, J; Pakpinyo, S
2018-06-01
Mycoplasma gallisepticum (MG) causes respiratory signs and economic losses in the poultry industry. MG vaccination is one of the effective prevention and control measures that have been used around the world. Our previous study demonstrated that chitosan-adjuvanted MG bacterin could effectively reduce pathological lesions induced by MG and that chitosan could be used as an adjuvant in MG bacterin. The present study determining the efficacy of MG bacterins against the Thai MG strain was based on vaccine programs. Seven groups (25 layers/group) were received MG bacterins containing 0.5% chitosan or a commercial bacterin via intramuscular (IM) or intraocular (IO) route at 6 and 10 wk of age. Sham-negative and sham-positive controls were groups 1 and 2, respectively. Group 3: IM route of chitosan bacterin followed by IM route of chitosan bacterin; group 4: commercial bacterin via IM route followed by chitosan bacterin via IO route; group 5: commercial bacterin via IM route followed by commercial bacterin via IM route; group 6: chitosan bacterin via IM followed by chitosan bacterin via IO route; and group 7: chitosan bacterin via IO route followed by chitosan bacterin via IO route were determined. At 16 wk of age, all groups, excluding group 1, were challenged intratracheally with 0.1 mL containing Thai MG strain 107 colony-forming unit. At 17, 18, and 20 wk of age, 5 birds in each group were bled for serological testing and swabbed at the choanal cleft for the quantitative real-time PCR assay, the euthanized and necropsied. The results showed that birds vaccinated with a commercial intramuscular bacterin followed by an intraocularly chitosan adjuvant bacterin showed the best protection against the MG challenge. The study indicated that chitosan could be the effective mucosal adjuvant and increased the effectiveness of MG bacterin.
Krak, Karol; Vosátka, Miroslav; Püschel, David; Štorchová, Helena
2017-01-01
Inoculation with arbuscular mycorrhizal fungi (AMF) may improve plant performance at disturbed sites, but inoculation may also suppress root colonization by native AMF and decrease the diversity of the root-colonizing AMF community. This has been shown for the roots of directly inoculated plants, but little is known about the stability of inoculation effects, and to which degree the inoculant and the inoculation-induced changes in AMF community composition spread into newly emerging seedlings that were not in direct contact with the introduced propagules. We addressed this topic in a greenhouse experiment based on the soil and native AMF community of a post-mining site. Plants were cultivated in compartmented pots with substrate containing the native AMF community, where AMF extraradical mycelium radiating from directly inoculated plants was allowed to inoculate neighboring plants. The abundances of the inoculated isolate and of native AMF taxa were monitored in the roots of the directly inoculated plants and the neighboring plants by quantitative real-time PCR. As expected, inoculation suppressed root colonization of the directly inoculated plants by other AMF taxa of the native AMF community and also by native genotypes of the same species as used for inoculation. In the neighboring plants, high abundance of the inoculant and the suppression of native AMF were maintained. Thus, we demonstrate that inoculation effects on native AMF propagate into plants that were not in direct contact with the introduced inoculum, and are therefore likely to persist at the site of inoculation. PMID:28738069
Directory of Open Access Journals (Sweden)
Martina Janoušková
Full Text Available Inoculation with arbuscular mycorrhizal fungi (AMF may improve plant performance at disturbed sites, but inoculation may also suppress root colonization by native AMF and decrease the diversity of the root-colonizing AMF community. This has been shown for the roots of directly inoculated plants, but little is known about the stability of inoculation effects, and to which degree the inoculant and the inoculation-induced changes in AMF community composition spread into newly emerging seedlings that were not in direct contact with the introduced propagules. We addressed this topic in a greenhouse experiment based on the soil and native AMF community of a post-mining site. Plants were cultivated in compartmented pots with substrate containing the native AMF community, where AMF extraradical mycelium radiating from directly inoculated plants was allowed to inoculate neighboring plants. The abundances of the inoculated isolate and of native AMF taxa were monitored in the roots of the directly inoculated plants and the neighboring plants by quantitative real-time PCR. As expected, inoculation suppressed root colonization of the directly inoculated plants by other AMF taxa of the native AMF community and also by native genotypes of the same species as used for inoculation. In the neighboring plants, high abundance of the inoculant and the suppression of native AMF were maintained. Thus, we demonstrate that inoculation effects on native AMF propagate into plants that were not in direct contact with the introduced inoculum, and are therefore likely to persist at the site of inoculation.
Change in antimicrobial susceptibility of Mycoplasma gallisepticum field isolates.
Gharaibeh, Saad; Al-Rashdan, Mohammad
2011-06-02
This study compares the antimicrobial susceptibility over time between two groups of Mycoplasma gallisepticum (MG) isolates from the same geographical area. Minimum inhibitory concentration of 13 antimicrobials was determined against two groups of MG isolates from chickens. Group 1 strains (n=22) were isolated in 2004-2005 while group 2 strains (n=7) were isolated in 2007-2008. Minimum inhibitory concentration 50 for group 1 versus group 2 was 4/4, 0.5/0.5, ≤ 0.031/≥ 64, ≤ 0.031/2, ≤ 0.031/0.125, 1/0.5, 1/1, ≤ 0.031/≤ 0.031, ≤ 0.031/2, ≤ 0.031/2, 1/4, ≤ 0.031/0.062, and 0.062/2 μg/ml against gentamicin, spectinomycin, erythromycin, tilmicosin, tylosin, florfenicol, thiamphenicol, tiamulin, ciprofloxacin, enrofloxacin, chlortetracycline, doxycycline, and oxytetracycline, respectively. There was a statistically significant increase in resistance of group 2 to erythromycin, tilmicosin, tylosin, ciprofloxacin, enrofloxacin, chlortetracycline, doxycycline, and oxytetracycline. This dramatic increase in resistance against 8 antimicrobials belonging to three different families of antimicrobials in a relatively short period of time appears to be rare and of concern. The cause of this increased resistance observed in group 2 of MG isolates was not determined and should be further investigated. Monitoring of MG field strain susceptibility is highly recommended to implement successful treatment and prophylaxis programs in endemic areas. Copyright © 2011 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Marcos Roberto Buim
2009-07-01
Full Text Available Mycoplasmas are important avian pathogens, which cause respiratory and joint diseases that result in large economic losses in Brazilian and world-wide poultry industry. This investigation regarding the main species of mycoplasmas, Mycoplasma gallisepticum (MG and M. synoviae (MS, responsible for the above mentioned conditions, was carried out through PCR Multiplex analysis. One thousand and forty-six (1,046 samples of tracheal swabs and piped embryos were collected from 33 farms with laying hens, breeders, broilers or hatchery, located in the Brazilian states of São Paulo, Paraná and Pernambuco, where respiratory problems or drops in egg production had occurred. The MG and MS prevalence on the farms was 72.7%. These results indicated (1 high dissemination of mycoplasmas in the evaluated farms, with predominance of MS, either as single infectious agent or associated with other mycoplasmas in 20 farms (60.6%, and (2 an increase of MS and decrease of MG infection in Brazilian commercial poultry.Os Micoplasmas são importantes patógenos aviários que causam doenças respiratórias e de articulações que resultam em grandes perdas econômicas para a indústria avícola brasileira e mundial. O estudo das principais espécies de Mycoplasma, Mycoplasma gallisepticum (MG e M. synoviae (MS, responsáveis pelas doenças mencionadas acima, foram analisadas pela técnica de PCR Multiplex. Foram colhidas 1046 amostras de suabe traqueal e embriões bicados de 33 estabelecimentos de aves de postura, matrizes, frangos de corte e um incubatório, localizados nos Estados brasileiros de São Paulo, Paraná e Pernambuco, as quais apresentavam problemas respiratórios ou queda na produção de ovos. A prevalência de MS e MG nas granjas foi de 72,7%. Os resultados indicaram uma alta disseminação de Mycoplasma nas granjas avaliadas, com predominância de MS, como um único agente infeccioso ou associado com outros micoplasmas em 20 granjas (60,6%. Assim, este
Shil, Pollob K; Kanci, Anna; Browning, Glenn F; Markham, Philip F
2011-04-12
Mycoplasma gallisepticum (MG) is a major pathogen of poultry that causes chronic respiratory disease in chickens and infectious sinusitis in turkeys. A live attenuated vaccine, ts-11, has been used for the control of MG in several countries. The efficacy of this vaccine is highly dose dependent and the flock antibody response is weak. To improve the functionality of the vaccine and investigate its potential as a delivery vector for foreign antigens and immunomodulatory proteins, we developed a derivative of ts-11 expressing infectious bronchitis virus-S1 glycoprotein (IBV-S1) and releasing chicken interleukin-6 into the extracellular milieu (MG ts-11 C3 (+CS)) using a transposon-based delivery vector. Following administration of MG ts-11 C3 (+CS) to chickens by eye-drop, an antibody response to MG and IBV-S1, as determined by the rapid serum agglutination test (RSA) and Western blotting, respectively, could be detected. Birds inoculated with the recombinant vaccine had significantly enhanced weight gain and were partially protected against damage by pathogenic IBV. These results indicate that the ChIL-6 released by MG ts-11 C3 (+CS) may have had a non-specific effect on growth rate. They also suggest that ts-11 is a promising vaccine vector, capable of delivering heterologous protective antigens, and may also provide non-specific benefits when engineered to express immunomodulatory proteins. With some improvements in the expression system, it could be used to induce a targeted immune response against specific mucosal pathogens, and co-expression of several antigens would allow development of a novel multivalent vaccine. Copyright © 2011 Elsevier Ltd. All rights reserved.
Comparison of Inoculation with the InoqulA and WASP Automated Systems with Manual Inoculation
Croxatto, Antony; Dijkstra, Klaas; Prod'hom, Guy
2015-01-01
The quality of sample inoculation is critical for achieving an optimal yield of discrete colonies in both monomicrobial and polymicrobial samples to perform identification and antibiotic susceptibility testing. Consequently, we compared the performance between the InoqulA (BD Kiestra), the WASP (Copan), and manual inoculation methods. Defined mono- and polymicrobial samples of 4 bacterial species and cloudy urine specimens were inoculated on chromogenic agar by the InoqulA, the WASP, and manual methods. Images taken with ImagA (BD Kiestra) were analyzed with the VisionLab version 3.43 image analysis software to assess the quality of growth and to prevent subjective interpretation of the data. A 3- to 10-fold higher yield of discrete colonies was observed following automated inoculation with both the InoqulA and WASP systems than that with manual inoculation. The difference in performance between automated and manual inoculation was mainly observed at concentrations of >106 bacteria/ml. Inoculation with the InoqulA system allowed us to obtain significantly more discrete colonies than the WASP system at concentrations of >107 bacteria/ml. However, the level of difference observed was bacterial species dependent. Discrete colonies of bacteria present in 100- to 1,000-fold lower concentrations than the most concentrated populations in defined polymicrobial samples were not reproducibly recovered, even with the automated systems. The analysis of cloudy urine specimens showed that InoqulA inoculation provided a statistically significantly higher number of discrete colonies than that with WASP and manual inoculation. Consequently, the automated InoqulA inoculation greatly decreased the requirement for bacterial subculture and thus resulted in a significant reduction in the time to results, laboratory workload, and laboratory costs. PMID:25972424
Bennett, R M; McClement, I; McFarlane, I D; Parker, C D
2013-12-01
Mycoplasma gallisepticum (MG) is a bacterium that causes respiratory disease in chickens, leading to reduced egg production. A dynamic simulation model was developed that can be used to assess the costs and benefits of control using antimicrobials or vaccination in caged or free range systems. The intended users are veterinarians and egg producers. A user interface is provided for input of flock specific parameters. The economic consequence of an MG outbreak is expressed as a reduction in expected egg output. The model predicts that either vaccination or microbial treatment can approximately halve potential losses from MG in some circumstances. Sensitivity analysis is used to test assumptions about infection rate and timing of an outbreak. Feedback from veterinarians points to the value of the model as a discussion tool with producers. Copyright © 2013 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Billaux, D.; Bodea, S.; Long, J.
1988-02-01
This report describes some of the programs developed at Lawrence Berkeley Laboratory for network modelling. By themselves, these programs form a complete chain for the study of the equivalent permeability of two-dimensional fracture networks. FMG generates the fractures considered as line discontinuities, with any desired distribution of aperture, length, and orientation. The locations of these fractures on a plane can be either specified or generated randomly. The intersections of these fractures with each other, and with the boundaries of a specified flow region, are determined, and a finite element line network is output. RENUM is a line network optimizer. Nodes very close to each other are merged, dead-ends are removed, and the nodes are then renumbered in order to minimize the bandwidth of the corresponding linear system of equations. LINEL computes the steady state flux through a mesh of line elements previously processed by program RENUM. Equivalent directional permeabilities are output. ELLFMG determines the three components of the permeability tensor which best fits the directional permeabilities output by LINEL. A measure of the goodness fit is also computed. Two plotting programs, DIMES and ELLP, help visualize the outputs of these programs. DIMES plots the line network at various stages of the process. ELLP plots the equivalent permeability results. 14 refs., 25 figs
[Design of SCM inoculation device].
Qian, Mingli; Xie, Haiyuan
2014-01-01
The first step of bacilli culture is inoculation bacteria on culture medium. Designing a device to increase efficiency of inoculation is significative. The new device is controlled by SCM. The stepper motor can drive the culture medium rotating, accelerating, decelerating, overturn and suspending. The device is high practicability and efficient, let inoculation easy for operator.
Directory of Open Access Journals (Sweden)
Chandra Sekhar Reddy Chilamakuri
2011-01-01
Full Text Available Accurate functional annotation of protein sequences is hampered by important factors such as the failure of sequence search methods to identify relationships and the inherent diversity in function of proteins related at low sequence similarities. Earlier, we had employed intermediate sequence search approach to establish new domain relationships in the unassigned regions of gene products at the whole genome level by taking Mycoplasma gallisepticum as a specific example and established new domain relationships. In this paper, we report a detailed comparison of the conservation status of the domain and domain architectures of the gene products that bear our newly predicted domains amongst 14 other Mycoplasma genomes and reported the probable implications for the organisms. Some of the domain associations, observed in Mycoplasma that afflict humans and other non-human primates, are involved in regulation of solute transport and DNA binding suggesting specific modes of host-pathogen interactions.
Directory of Open Access Journals (Sweden)
Jaime Enrique Simó González
2016-07-01
Full Text Available From being the banana, a mycotrophic crop and previous results on the potential of green manure inoculated as a way to mycorrhizal economic crops, this work was developed in order to assess whether a precedent Canavalia ensiformis cultivation, inoculated with efficient strains of arbuscular mycorrhizal fungi (AMF inoculation, it is necessary the banana inoculation, ‘FHIA-18’ (AAAB cultivar in the transplant field. Four treatments were evaluated: a control without application of fertilizers and other organic-mineral fertilizers (100% FOM, both without canavalia and two other treatments that are used above canavalia inoculated AMF and half also received organic-mineral fertilizer applications: (50% FOM, one of which, the banana was reinoculated in the transplant field and the other one not. The experimental design used, was randomized blocks, with four replications. The experiment ended after three productive cycles (mother plant, stems 1 and 2. Canavalia inoculated treatments and 50 % of FOM, guaranteed high yields and satisfactory nutritional content similar to that received 100 % of FOM and significantly higher than those obtained with the control treatment. This together with the values of colonization percentages and pores at both high and inoculated treatments were no significant differences between them, indicated not only the effectiveness of mycorrhizal inoculation but rather green manure inoculation was successful to inoculate bananas and re-inoculation of the same was not needed on the transplant.
Afzal, Muhammad; Yousaf, Sohail; Reichenauer, Thomas G; Sessitsch, Angela
2012-01-01
Plants in combination with microorganisms can remediate soils, which are contaminated with organic pollutants such as petroleum hydrocarbons. Inoculation of plants with degrading bacteria is one approach to improve remediation processes, but is often not successful due to the competition with resident microorganisms. It is therefore of high importance to address the persistence and colonization behavior of inoculant strains. The objective of this study was to determine whether the inoculation method (seed imbibement and soil inoculation) influences bacterial colonization, plant growth promotion and hydrocarbon degradation. Italian ryegrass was grown in non-sterilized soil polluted with diesel and inoculated with different alkane-degrading strains Pantoea sp. ITSI10, Pantoea sp. BTRH79 and Pseudomonas sp. MixRI75 individually as well as in combination. Inoculation generally had a beneficial effect on plant biomass production and hydrocarbon degradation, however, strains inoculated in soil performed better than applied by seed imbibement. Performance correlated with the colonization efficiency of the inoculated strains. The highest hydrocarbon degradation was observed in the treatment, in which all three strains were inoculated in combination into soil. Our study revealed that besides the degradation potential and competitive ability of inoculant strains the inoculation method plays an important role in determining the success of microbial inoculation.
Directory of Open Access Journals (Sweden)
MB Guimarães
Full Text Available ABSTRACT The geographic overlap between areas of Atlantic rainforest and human activities allows interactions to occur between humans and wild and domestic animals. Despite the great importance of the domestic animal-wildlife-human interface that occurs at poultry farms in terms of public health, economic production and wildlife conservation, there are few studies in Brazil examining the distribution and health of wild birds that interact with poultry farms. From January to December 2010, mist nets were used to capture 166 free-ranging birds that were within close proximity to three poultry farms in Atlantic rainforest remnants in south-eastern Brazil. The species composition was examined, and molecular methods were used to test for avian influenza virus, Newcastle disease virus, and Mycoplasma gallisepticum. The avian communities near the poultry farms were dominated by three synanthropic species, which corresponded to 70% of all captured individuals: house sparrows Passer domesticus (33%, saffron finches (Sicalis flaveola (22%, and ruddy ground-doves (Columbina talpacoti (15%. These predominant bird species were in poor body condition (27%, were infested with feather mites (43%, or presented both conditions (23%. No evidence of infection by avian influenza virus, Newcastle disease virus or M. gallisepticum was identified in any of the studied birds. Although no evidence of the studied pathogens was, our findings demonstrate that differences in the environmental characteristics and biosecurity practices influence the wild bird community near poultry farms, which in turn may affect the health status of these synanthropic birds and strengthen their role in the transmission of pathogens.
Inoculation of sugarcane with diazotrophic bacteria
Directory of Open Access Journals (Sweden)
Nivaldo Schultz
2014-04-01
Full Text Available The sugarcane industry, a strategic crop in Brazil, requires technological improvements in production efficiency to increase the crop energy balance. Among the various currently studied alternatives, inoculation with diazotrophic bacteria proved to be a technology with great potential. In this context, the efficiency of a mixture of bacterial inoculant was evaluated with regard to the agronomic performance and N nutrition of sugarcane. The experiment was carried out on an experimental field of Embrapa Agrobiologia, in Seropédica, Rio de Janeiro, using a randomized block, 2 × 3 factorial design (two varieties and three treatments with four replications, totaling 24 plots. The varieties RB867515 and RB72454 were tested in treatments consisting of: inoculation with diazotrophic bacteria, N-fertilized control with 120 kg ha-1 N and absolute control (no inoculation and no N fertilizer. The inoculum was composed of five strains of five diazotrophic species. The yield, dry matter accumulation, total N in the shoot dry matter and the contribution of N by biological fixation were evaluated, using the natural 15N abundance in non-inoculated sugarcane as reference. The bacterial inoculant increased the stalk yield of variety RB72454 similarly to fertilization with 120 kg ha-1 N in the harvests of plant-cane and first ratoon crops, however the contribution of biological N fixation was unchanged by inoculation, indicating that the benefits of the inoculant in sugarcane may have resulted from plant growth promotion.
Evaluation of Pure Aluminium Inoculated with Varying Grain Sizes of an Agro-waste based Inoculant
Directory of Open Access Journals (Sweden)
Adeyemi I. Olabisi
2017-04-01
Full Text Available Pure Aluminium and its alloy are widely utilized in Engineering and Industrial applications due to certain significant properties such as softness, ductility, corrosion resistance, and high electrical conductivity which it possesses. Addition of an agro-waste based grain refiner to the melt can alter the characteristics positively or negatively. Therefore, the aim of this paper is to investigate the inoculating capability of an agro-waste based inoculant and the effect of adding varying sizes of its grains on some of the properties of pure aluminium after solidification. The beneficial outcome of this investigation would enhance the economic value of the selected agro-waste and also broaden the applications of aluminium in Engineering. The assessed properties include; microstructure, micro hardness, ductility, and tensile strength. The agro-waste used as the grain refiner is pulverised cocoa bean shells (CBS. Three sets of test samples were produced using dry sand moulding process, with each melt having a specified grain size of the inoculant added to it (150, 225 and 300microns respectively. Ladle inoculation method was adopted. The cast samples after solidification were machined to obtain various shapes/sizes for the different analysis. The microstructural examination showed that the mechanical properties are dependent on the matrix as the aluminium grains became more refined with increasing grain size of the inoculant. I.e. Due to increasing grain size of the inoculant, the micro hardness increased (56, 61, 72HB as the aluminium crystal size became finer. Meanwhile, the tensile strength (284, 251, 223N/mm2 and ductility (1.82, 0.91, 0.45%E decreased as grain size of the inoculant increased. The overall results showed that the used agro-waste based inoculant has the capability of refining the crystal size of pure aluminium as its grain size increases. This will make the resulting aluminium alloy applicable in areas where hardness is of
Detection of Mycoplasma gallisepticum in House Finches ( Haemorhous mexicanus) from Arizona.
Staley, Molly; Bonneaud, Camille; McGraw, Kevin J; Vleck, Carol M; Hill, Geoffrey E
2018-03-01
In 1994, an endemic poultry pathogen, Mycoplasma gallisepticum (MG), was identified as the causative agent of a novel disease in house finches ( Haemorhous mexicanus). After an initial outbreak in Maryland, MG spread rapidly throughout eastern North American populations of house finches. Subsequently, MG spread slowly through the northern interior of North America and then into the Pacific Northwest, finally reaching California in 2006. Until 2009, there were no reports of MG in the southwestern United States east of California. In August 2011, after reports of house finches displaying conjunctivitis characteristic of MG infection in Arizona, we trapped house finches at bird feeders in central Arizona (Tempe) and southern Arizona (Tucson and Green Valley) to assay for MG infection. Upon capture, we noted whether birds exhibited conjunctivitis, and we collected choanal swabs to test for the presence of MG DNA using PCR. We detected MG in finches captured from Green Valley (in ∼12% of birds captured), but not in finches from Tucson or Tempe. Based on resampling of house finches at these sites in July 2014, we suggest that central Arizona finches likely remain unexposed to MG. We also suggest that low urban connectivity between arid habitats of southern and central Arizona or a reduction in the prevalence of MG after its initial arrival in Arizona may be limiting the spread of MG from south to north in Arizona. In addition, the observed conjunctivitis-like signs in house finches that were negative for MG by PCR may be caused primarily by avian pox virus.
Hutton, S; Bettridge, J; Christley, R; Habte, T; Ganapathy, K
2017-02-01
A survey was conducted into respiratory infectious diseases of poultry on a chicken breeder farm run by the Ethiopian Institute of Agricultural Research (EIAR), located in Debre Zeit, Ethiopia. Oropharyngeal swabs were collected from 117 randomly selected birds, and blood was taken from a subset of 73 of these birds. A combination of serological and molecular methods was used for detection of pathogens. For the first time in Ethiopia, we report the detection of variant infectious bronchitis virus (793B genotype), avian metapneumovirus subtype B and Mycoplasma synoviae in poultry. Mycoplasma gallisepticum was also found to be present; however, infectious laryngotracheitis virus was not detected by PCR. Newcastle disease virus (NDV) was not detected by PCR, but variable levels of anti-NDV HI antibody titres shows possible exposure to virulent strains or poor vaccine take, or both. For the burgeoning-intensive industry in Ethiopia, this study highlights several circulating infectious respiratory pathogens that can impact on poultry welfare and productivity.
Inoculation Expedition of Agar wood
International Nuclear Information System (INIS)
Peng, C.S.; Mohd Fajri Osman; Rusli Zakaria
2015-01-01
Inoculation expedition of agar wood is a main field works for researcher in Nuclear Malaysia to prove the real inoculation of agar wood in real jungle. These expeditions was conducted fourth times in the jungles of Malaysia including Gunung Tebu in Terengganu, Murum in Belaga, Sarawak, Kampung Timbang in Kota Belud, Sabah and Nuclear Malaysia itself. This expedition starts from preparation of samples and equipment, transportation into the jungle, searching and recognition of agar wood and lastly, inoculation of the agar wood. Safety aspects precedence set out in the preparation and implementation of this expedition. (author)
Lorenzen, Emma; Follmann, Frank; Secher, Jan O; Goericke-Pesch, Sandra; Hansen, Mette S; Zakariassen, Hannah; Olsen, Anja W; Andersen, Peter; Jungersen, Gregers; Agerholm, Jørgen S
2017-06-01
Advanced animal models, such as minipigs, are needed for the development of a globally requested human Chlamydia vaccine. Previous studies have shown that vaginal inoculation of sexually mature Göttingen minipigs with Chlamydia trachomatis resulted in an infection lasting only 3-5 days. The aim of this study was to evaluate the effect of targeting the upper porcine genital tract by transcervical and transabdominal intrauterine inoculation, compared to previously performed vaginal inoculation. Furthermore, we investigated the effect of the hormonal cycle, estrus vs. diestrus, on the establishment of a C. trachomatis infection in the minipig. Targeting the upper genital tract (transcervical inoculation) resulted in a longer lasting infection (at least 7 days) compared to vaginal inoculation (3-5 days). When comparing intrauterine inoculation during estrus and diestrus, inoculation during diestrus resulted in a longer lasting infection (at least 10 days) compared to estrus (3-5 days). Furthermore, we found a significant C. trachomatis specific IFN-γ response in pigs inoculated during estrus correlating with the accelerated clearance of infection in these pigs. These findings suggest that for implementation of an optimal model of C. trachomatis in minipigs, inoculation should bypass the cervix and preferable be performed during diestrus. Copyright © 2017 The Author(s). Published by Elsevier Masson SAS.. All rights reserved.
New inoculants on maize silage fermentation
Directory of Open Access Journals (Sweden)
Fábia Giovana do Val de Assis
2014-08-01
Full Text Available The objective of this study was to evaluate the effect of bacterial inoculants at two inoculation rates on chemical and biological characteristics of maize silage. The treatments consisted of two inoculating rates (5 and 6 log cfu g-1 of forage for each strain of lactic acid bacteria (LAB identified as Lactobacillus buchneri, L. hilgardii, or L. plantarum. The maize was ensiled in experimental PVC silos. Samples were taken for the determination of the contents of dry matter (DM, crude protein (CP, neutral detergent fiber (NDF, water-soluble carbohydrates (WSC, organic acids and alcohols, for the evaluation of the populations of lactic acid bacteria, yeasts, filamentous fungi, and for the determination of pH values during ensilage and after 30 or 90 days of fermentation. The doses of inoculants did not promote significant differences on the evaluated characteristics. There was effect of inoculants on acetic acid, 1.2-propanediol, LAB population, filamentous fungi, and pH value. No significant influence of the treatments with inoculants was observed in the variables DM, WSC, CP, lactic acid concentrations, or ethanol. The maximum temperature, i.e., the time to achieve the maximum temperature (TMT and aerobic stability (AS, was not influencied by treatments. However, a decrease in maximum temperature, an increase in TMT, and improvement in the AS were observed after 90 days of fermentation. These results proved the advantage of microbial inoculation. The treatments influenced LAB populations and filamentous fungi, but no effect was observed on the yeast population. The best inoculation dose is 6 cfu g-1 of forage because it provides higher reduction of filamentous fungi in maize silage, thereby decreasing the aerobic deterioration by these microorganisms.
Inoculation Technique for Fungus Cultures
Fusaro, Ramon M.
1972-01-01
A plastic straw and wood applicator stick serve as a simple, inexpensive, and disposable inoculation unit for fungal studies. The method gives a uniform and intact inoculum. The technique is especially useful because a large number of agar plates can be inoculated rapidly. Images PMID:5059618
Kennedy, J R; Rouat, B; Daloz, D; Bouzy, E; Zollinger, J
2018-04-25
The process of isomorphic inoculation relies on precise selection of inoculant alloys for a given system. Three alloys, Ti-10Al-25Nb, Ti-25Al-10Ta, and Ti-47Ta (at %) were selected as potential isomorphic inoculants for a Ti-46Al alloy. The binary Ti-Ta alloy selected was found to be ineffective as an inoculant due to its large density difference with the melt, causing the particles to settle. Both ternary alloys were successfully implemented as isomorphic inoculants that decreased the equiaxed grain size and increased the equiaxed fraction in their ingots. The degree of grain refinement obtained was found to be dependent on the number of particles introduced to the melt. Also, more new grains were formed than particles added to the melt. The grains/particle efficiency varied from greater than one to nearly twenty as the size of the particle increased. This is attributed to the breaking up of particles into smaller particles by dissolution in the melt. For a given particle size, Ti-Al-Ta and Ti-Al-Nb particles were found to have a roughly similar grain/particle efficiency.
Perrineau, M M; Le Roux, C; de Faria, S M; de Carvalho Balieiro, F; Galiana, A; Prin, Y; Béna, G
2011-07-01
Acacia mangium is a legume tree native to Australasia. Since the eighties, it has been introduced into many tropical countries, especially in a context of industrial plantations. Many field trials have been set up to test the effects of controlled inoculation with selected symbiotic bacteria versus natural colonization with indigenous strains. In the introduction areas, A. mangium trees spontaneously nodulate with local and often ineffective bacteria. When inoculated, the persistence of inoculants and possible genetic recombination with local strains remain to be explored. The aim of this study was to describe the genetic diversity of bacteria spontaneously nodulating A. mangium in Brazil and to evaluate the persistence of selected strains used as inoculants. Three different sites, several hundred kilometers apart, were studied, with inoculated and non-inoculated plots in two of them. Seventy-nine strains were isolated from nodules and sequenced on three housekeeping genes (glnII, dnaK and recA) and one symbiotic gene (nodA). All but one of the strains belonged to the Bradyrhizobium elkanii species. A single case of housekeeping gene transfer was detected among the 79 strains, suggesting an extremely low rate of recombination within B. elkanii, whereas the nodulation gene nodA was found to be frequently transferred. The fate of the inoculant strains varied depending on the site, with a complete disappearance in one case, and persistence in another. We compared our results with the sister species Bradyrhizobium japonicum, both in terms of population genetics and inoculant strain destiny. Copyright © 2011 Elsevier GmbH. All rights reserved.
Accessing inoculation methods of maize and wheat with Azospirillum brasilense.
Fukami, Josiane; Nogueira, Marco Antonio; Araujo, Ricardo Silva; Hungria, Mariangela
2016-03-01
The utilization of inoculants containing Azospirillum is becoming more popular due to increasing reports of expressive gains in grain yields. However, incompatibility with pesticides used in seed treatments represents a main limitation for a successful inoculation. Therefore, in this study we searched for alternatives methods for seed inoculation of maize and wheat, aiming to avoid the direct contact of bacteria with pesticides. Different doses of inoculants containing Azospirillum brasilense were employed to perform inoculation in-furrow, via soil spray at sowing and via leaf spray after seedlings had emerged, in comparison to seed inoculation. Experiments were conducted first under greenhouse controlled conditions and then confirmed in the field at different locations in Brazil. In the greenhouse, most parameters measured responded positively to the largest inoculant dose used in foliar sprays, but benefits could also be observed from both in-furrow and soil spray inoculation. However, our results present evidence that field inoculation with plant-growth promoting bacteria must consider inoculant doses, and point to the need of fine adjustments to avoid crossing the threshold of growth stimulation and inhibition. All inoculation techniques increased the abundance of diazotrophic bacteria in plant tissues, and foliar spray improved colonization of leaves, while soil inoculations favored root and rhizosphere colonization. In field experiments, inoculation with A. brasilense allowed for a 25 % reduction in the need for N fertilizers. Our results have identified alternative methods of inoculation that were as effective as the standard seed inoculation that may represent an important strategy to avoid the incompatibility between inoculant bacteria and pesticides employed for seed treatment.
Directory of Open Access Journals (Sweden)
Diyantoro Diyantoro
2017-06-01
Full Text Available This study aimed to figure out the prevalence and risk factors of Mycoplasma gallisepticum (MG infection in commercial layer farm in Blitar District. Blood samples and questionnaires were taken during December 2014 to February 2015. A total of 264 sera samples were collected from 22 commercial layer farm. Based on serum plate agglutination test, 26 sera samples were MG positive that were indicated an infection prevalence was 9.85%. The highest SRR value for MG infection was occurred in Bakung Subdistrict (SRR = 2.5. Based on Analysis of multivariate logistic regression showed that a very significant influenced risk factors of MG infection have occurred in flocking density more than 3,000 birds per flock (?2= 11.10; p= 0.001; OR= 6.1, flocking density about 1,501 to 3,000 birds per flock (?2 = 11.10; p= 0.001; OR= 6.1, bird feeding once a day (?2= 9.32; p= 0.002; OR= 0.3, house desinfection once in every two weeks (?2 =7.70; p= 0.009; OR= 1.2, house desinfection once a month or only in case (?2= 9.36; p= 0.006; OR= 3.9. It was concluded that seroprevalence of MG infection in studied area was 9,85%. the MG seroprevalence were influenced by flocking density more than 3,000 birds per flock, flocking density about 1,501 to 3,000 birds per flock, bird feeding once a day, house desinfection once every two weeks, and house desinfection once a month or only in case. ABSTRAK Mycoplasmosis merupakan salah satu penyakit paling penting yang dihadapi oleh industri perunggasan di Indonesia. Penelitian ini bertujuan untuk mengetahui prevalensi dan faktor risiko penularan Mycoplasma gallisepticum (MG pada peternakan ayam petelur komersial di Kabupaten Blitar, Jawa Timur. Contoh darah dan kuisioner diambil selama periode Desember 2014 hingga Februari 2015. Sebanyak 264 contoh serum dikumpulkan dari 22 peternakan ayam petelur komersial. Berdasarkan uji Rapid Serum Agglutination (RSA, 26 contoh ditemukan positif MG dengan prevalensi infeksi MG di Kabupaten Blitar
Directory of Open Access Journals (Sweden)
Isaac Estevan Torres
2010-10-01
Full Text Available ResumenEste trabajo pretendió analizar el tiempo de ejecución (TE, el tiempo de impacto, la fuerza máxima de golpeo (FMG y la fuerza relativa de golpeo (FRG, según tres distancias de ejecución, en la patada circular al pecho y a la cara, y analizar la relación entre TE-FMG, y FMG-peso. La muestra estuvo compuesta por 23 taekwondistas: medallistas (n = 12 y no medallistas (n = 11. En el grupo de no medallistas se hallaron diferencias según la distancia de ejecución en la FMG y FRG entre la patada circular al pecho y a la cara (p AbstractThe purpose of the research was to examine and compare execution time (TE, impact time, maximum impact force (FMG and relative impact force (FRG in terms of the execution distance, in the roundhouse kick to the chest and to the head and to analyze the relationship between ET-FMG, and between FMG-weight. 23 taekwondo athletes, medallist (n = 12 and non-medallist (n = 11, participated in the study. For the non-medallists’ group significant differences were found from several execution distances, in FMG and FRG between roundhouse kick to the chest and to the head (p
Hu, Kai; Malla, Tejsu; Zhai, Yujia; Dong, Lili; Tang, Ru
2015-01-01
To evaluate the comparative effect of topical versus intramuscular administration of nanoparticle-carried DNA vaccine in preventing corneal herpes simplex virus type 1 (HSV-1) infection. Nanoparticle [polyethylenimine (PEI)-Fe3O4]-carried DNA vaccine (PEI-Fe3O4-pRSC-gD-IL-21) or DNA vaccine (pRSC-gD-IL-21) alone were topically versus intramuscularly inoculated into one eye each of mice on days 0, 14 and 28. Three weeks after the final immunization, the specific immune responses and clinical degrees of primary herpes simplex keratitis were evaluated. Topical inoculation of nanoparticle-carried DNA vaccine induced mice to generate similar levels of specific HSV-1-neutralizing antibody, IFN-γ and IL-4 in serum and specific killing (cytotoxicity) and proliferative activities of the splenic lymphocytes, but a significantly higher level of secretory IgA in tears compared to those of intramuscular inoculation. More importantly, the mice inoculated topically showed a significantly decreased herpes simplex keratitis severity than the mice inoculated intramuscularly after HSV-1 challenge on the corneas of the mice. Topical inoculation of nanoparticle-carried DNA vaccine elicits a stronger specific local immune response and more effectively inhibits herpes simplex keratitis as compared to intramuscular inoculation in an HSV-1 ocular challenge mouse model. Thus, topical administration may be a promising inoculating route for the nanoparticle-carried DNA vaccine to prevent corneal infections. © 2015 S. Karger AG, Basel.
Comparison of bedside inoculation of culture media with ...
African Journals Online (AJOL)
Background: The yield of bacterial cultures from cerebrospinal fluid (CSF) at Kenyatta National Hospital (KNH) is very low. Bedside inoculation of culture media with CSF may improve yields. Objective: To compare the culture yield of CSF inoculated onto culture medium at the bedside to that of CSF inoculated onto culture ...
Pakpinyo, Somsak; Sasipreeyajan, Jiroj
2007-11-15
In this study, three consecutive approaches of molecular characterization, determination of minimum inhibitory concentration (MIC) and antimicrobial tested on Mycoplasma gallisepticum (MG) isolated from chicken farms were investigated. These approaches were conducted between 2004 and 2005 to 134 MG samples collected from five different regions of the intensive farming area of Thailand. Twenty MG isolates and four reference strains including S6, F, ts-11, and 6/85 were classified according to Random Amplification of Polymorphic DNA (RAPD) patterns prior to the antimicrobial tests. These isolates exhibited 5 different genotypes (A-E). Consequently, MG isolates representing each genotype were tested on 11 registered antibiotics. The levels of MIC were determined. Three antibiotics, doxycycline (0.20 microg/ml), tiamulin (0.10 microg/ml), and tylosin (0.33 microg/ml), gave the least MICs among all effective drugs. Break point comparisons of each antimicrobial suggested that the MG isolates were most sensitive to lincomycin, oxytetracycline, tiamulin, and tylosin. Some MG isolates had an intermediate effect on josamycin and were resistant to enrofloxacin and erythromycin. Our results also indicated that MG isolated and collected from the region and nearby districts had similar RAPD patterns showing properties of antimicrobial resistance. The RAPD patterns may imply the frequent use of antibiotics and a resistant strain of MG. This is the first report of genetic characterization using RAPD reflected by the levels of MIC against MG. The information is useful to plan for prophylactic and therapeutic impacts on the poultry industry especially in the area of intensive use of antibiotics.
Inoculation message treatments for curbing noncommunicable disease development.
Mason, Alicia M; Miller, Claude H
2013-07-01
To study the effect of various types of inoculation message treatments on resistance to persuasive and potentially deceptive health- and nutrition-related (HNR) content claims of commercial food advertisers. A three-phase experiment was conducted among 145 students from a Midwestern U.S. university. Quantitative statistical analyses were used to interpret the results. RESULTS provide clear evidence that integrating regulatory focus/fit considerations enhances the treatment effectiveness of inoculation messages. Inoculation messages that employed a preventative, outcome focus with concrete language were most effective at countering HNR advertising claims. The findings indicate that inoculation fosters resistance equally across the most common types of commercially advertised HNR product claims (e.g., absolute, general, and structure/function claims). As the drive to refine the inoculation process model continues, further testing and application of this strategy in a public health context is needed to counter ongoing efforts by commercial food advertisers to avoid government regulations against deceptive practices such as dubious health/nutrition claims. This research advances inoculation theory by providing evidence that 1) good regulatory fit strengthens the effect of refutational preemption and 2) an inoculation approach is highly effective at fostering resistance to commercial advertisers' HNR content claims. This macro approach appears far superior to education or information-based promotional health campaigns targeted solely at specific populations demonstrating rising rates of noncommunicable disease.
Inoculation message treatments for curbing noncommunicable disease development
Directory of Open Access Journals (Sweden)
Alicia M. Mason
2013-07-01
Full Text Available OBJECTIVE: To study the effect of various types of inoculation message treatments on resistance to persuasive and potentially deceptive health- and nutrition-related (HNR content claims of commercial food advertisers. METHODS: A three-phase experiment was conducted among 145 students from a Midwestern U.S. university. Quantitative statistical analyses were used to interpret the results. Results: Results provide clear evidence that integrating regulatory focus/fit considerations enhances the treatment effectiveness of inoculation messages. Inoculation messages that employed a preventative, outcome focus with concrete language were most effective at countering HNR advertising claims. The findings indicate that inoculation fosters resistance equally across the most common types of commercially advertised HNR product claims (e.g., absolute, general, and structure/function claims. CONCLUSIONS: As the drive to refine the inoculation process model continues, further testing and application of this strategy in a public health context is needed to counter ongoing efforts by commercial food advertisers to avoid government regulations against deceptive practices such as dubious health/nutrition claims. This research advances inoculation theory by providing evidence that 1 good regulatory fit strengthens the effect of refutational preemption and 2 an inoculation approach is highly effective at fostering resistance to commercial advertisers' HNR content claims. This macro approach appears far superior to education or information-based promotional health campaigns targeted solely at specific populations demonstrating rising rates of noncommunicable disease.
Antioxidant properties of soybean seedlings inoculated with Trichoderma asperellum
Directory of Open Access Journals (Sweden)
Manojlović Ana S.
2017-01-01
Full Text Available This study was conducted in order to assess the effect of inoculation of soybean (Glycine max L. seeds with Trichoderma asperellum, followed by mites (Tetranychus urticae exposure on lipid peroxidation (LP process and the activity of antioxidant enzymes. T. urticae is an occasional pest of soybean that causes biotic stress. Biotic stress leads to overproduction of reactive oxygen species (ROS which may cause damage to vital biomolecules. Enzymatic antioxidant defense systems protect plants against oxidative stress. T. asperellum is commonly used as biocontrol agent against plant pathogens. It has been suggested that previous inoculation of seeds with T. asperellum may cause induced resistance against biotic stress. The aim of this study was to determine LP intensity and antioxidant enzymes activity in inoculated and non-inoculated soybean seedlings with and without exposure to mites. Noticeably higher LP intensity was detected in non-inoculated group treated with mites compared to control group. Inoculated soybean seedlings treated with mites had lower LP intensity compared to noninoculated group. Also, it has been noticed that inoculation with Trichoderma asperellum itself, produced mild stress in plants. In addition, positive correlation between enzymes activity and LP was noticed. The level of oxidative stress in plants was followed by the change of LP intensity. According to results obtained, it was concluded that the greatest oxidative stress occurred in non-inoculated group treated with mites and that inoculation successfully reduced oxidative stress. The results indicate that inoculation of soybean seeds with T. asperellum improves resistance of soybean seedlings against mites attack. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. TR-31022
Key factors to inoculate Botrytis cinerea in tomato plants
Borges,Álefe Vitorino; Saraiva,Rodrigo Moreira; Maffia,Luiz Antonio
2014-01-01
Studies addressing the biological control of Botrytis cinerea have been unsuccessful because of fails in inoculating tomato plants with the pathogen. With the aim of establishing a methodology for inoculation into stems, experiments were designed to assess: i. the aggressiveness of pathogen isolates; ii. the age at which tomato plants should be inoculated; iii. the susceptibility of tissues at different stem heights; iv. the need for a moist chamber after inoculation; and v. the effectiveness...
Klebsiella pneumoniae inoculants for enhancing plant growth
Triplett, Eric W [Middleton, WI; Kaeppler, Shawn M [Oregon, WI; Chelius, Marisa K [Greeley, CO
2008-07-01
A biological inoculant for enhancing the growth of plants is disclosed. The inoculant includes the bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101, Pantoea agglomerans P102, Klebsiella pneumoniae 342, Klebsiella pneumoniae zmvsy, Herbaspirillum seropedicae Z152, Gluconacetobacter diazotrophicus PA15, with or without a carrier. The inoculant also includes strains of the bacterium Pantoea agglomerans and K. pneumoniae which are able to enhance the growth of cereal grasses. Also disclosed are the novel bacterial strains Herbaspirillum seropedicae 2A, Pantoea agglomerans P101 and P102, and Klebsiella pneumoniae 342 and zmvsy.
Biological Inoculants in Forage Conservation
Directory of Open Access Journals (Sweden)
Judit Peter Szucs
2011-05-01
Full Text Available 3rd generation biological inoculants –containing lactic acid bacteria and enzymes – are prefered nowadays in order to coordinate the fermentation in such a way that they increase lactic acid production by leaps and bounds at the beginning of the fermentation and improve the quality and stability of silage during the fermentation and feeding. The quality of raw material (maturity of plant, chop lenght, spreading of inoculant uniformly and the proper filling, compacting, covering and wrapping have a great influence on the effectiveness of the inoculant. The mycotoxin content of malfermented silages is an undesirable risk factor. The authors established, that the Lactobacillus buchneri and enzymes containing inoculant protected better the carotene content of low, medium- and high wilteed lucerne haylages (P<0,05 compare to untreated ones Aerobic stability experiment by Honnig 1990 method was carried out with medium wilted (36 % DM lucerne haylage which was treatedtreated before ensilage with , the dosage of 105 CFU/g Pediococcus acidilactici, 1,5x105 CFU/g Lactobacillus buchneri and cellulase and hemicellulase enzimes (20 000 CMC /g remained stabyle, unspoiled after 9 days exposure to the air, while the untreated haylages spoiled after 2;4;or 7days on aerobic condition. The different Lactobacillus plantarum strains (50.000 CFU of Lactobacillus plantarum DSM 16568 + 50.000 CFU of Lactobacillus plantarum DSM 4784/ g FM of maize applied together were able to improve the aerobic stability of silomaize silage.
International Nuclear Information System (INIS)
Ventura, Cesar E; Ramirez, Gloria; Vera, Victor
2012-01-01
Mycoplasmas are worldwide pathogens that affect the poultry industry causing respiratory illness which cause a negative economic impact. Two mycoplasmas species are the most important in the commercial poultry: mycoplasma gallisepticum (MG) and mycoplasma synoviae (MS). By its importance and necessity to know and differentiate between mycoplasmas species in local's poultry houses this study used the PCR technique like a diagnosis tool, using tracheal swabs from bird with respiratory symptoms. A total of 91 samples from broilers, layers and breeders farms located in the departments of Cundinamarca and Boyaca was processed. The punctual prevalence founded in this study was 39.6 % for mg and 47.3 % for MS. statistical differences for type of production and positive samples for mg y MS (p < 0.05) were founded, a bigger number of positive samples from layers and breeder in comparison to broilers were found. In the same way, the positive samples for the layers and breeder from the age group between 20 and 60 weeks was greater, while for the broilers group most of the positive samples were from five weeks old birds for mg and two weeks old birds for MS.
Mycorrhizal inoculation affects the phytochemical content in strawberry fruits
Directory of Open Access Journals (Sweden)
Ana Paula Cecatto
2016-04-01
Full Text Available The aim of this research was to evaluate the effect of the inoculation date of arbuscular mycorrhizal fungi on the fruit quality and the content of phytochemicals in a strawberry soilless growing system. The experiment was performed in Huelva (Spain and was conducted in a greenhouse on the La Rábida Campus of Huelva University under natural light and temperature from October 2013 to June 2014. Three short-day strawberry cultivars (‘Splendor’, ‘Sabrina’ and ‘Fortuna’ were grown in polyethylene bags filled with coconut fibres. Randomized block design, with 3 repetitions and factorial arrangement (3 cultivars x 3 treatments, was established. Each replicate consisted of one bag with 12 plants supporting structures at 40 cm height. The treatments were: T1 = mycorrhizal inoculation in the transplantation; T2 = mycorrhizal inoculation 30 days after transplantation (DAT; and T0 = control treatment, without inoculation. Arbuscular mycorrhizal fungi inoculation significantly affected the contents of anthocyanin and phenolics. When the inoculation is performed in the transplantation, the fruits showed a high content of anthocyanin and total phenolics. The mycorrhizal inoculation influences decreasing the acidity in fruit throughout the growing season and increase firmness only during the early stage of production.
Banas, John A.; Miller, Gregory
2013-01-01
This investigation examined the boundaries of inoculation theory by examining how inoculation can be applied to conspiracy theory propaganda as well as inoculation itself (called metainoculation). A 3-phase experiment with 312 participants compared 3 main groups: no-treatment control, inoculation, and metainoculation. Research questions explored…
Conditions Affecting Shelf-Life of Inoculated Legume Seed
Directory of Open Access Journals (Sweden)
Greg Gemell
2012-02-01
Full Text Available Microbial inoculants are becoming more available as sustainable alternatives to fertilizers and other agrichemicals in broad-acre cropping. However, with the exception of legume inoculants little is understood about effective delivery and survival of the inoculum. Legume inoculants are applied to both seed and soil but seed inoculation is the most economical technique. Large quantities of pasture seed in Australia are inoculated by commercial seed coating companies, but the long-term survival of seed-applied inoculum is variable and monitoring of viability requires specialist microbiology skills and facilities. The aim of our research was to define optimum storage conditions for survival of rhizobia on legume seed and evaluate water activity as a means of monitoring shelf-life. The relationship between survival and water activity varied according to seed species, inoculum preparation, coating ingredients, initial water activity and time suggesting that storage conditions would need to be defined for each different combination. Although drying seeds after coating significantly reduced viable numbers of rhizobia, survival of rhizobia on dried commercially coated lucerne seed after 11 weeks was less variable than seeds that had not been dried. The highest numbers were maintained when seeds remained dry with water activities of between 0.47 and 0.38. The quality of inoculated seed could be improved by reducing the death rate of inoculum during preparation and providing optimum storage conditions for long-term survival.
Adelman, James S; Moyers, Sahnzi C; Farine, Damien R; Hawley, Dana M
2015-09-22
Individual heterogeneity can influence the dynamics of infectious diseases in wildlife and humans alike. Thus, recent work has sought to identify behavioural characteristics that contribute disproportionately to individual variation in pathogen acquisition (super-receiving) or transmission (super-spreading). However, it remains unknown whether the same behaviours enhance both acquisition and transmission, a scenario likely to result in explosive epidemics. Here, we examined this possibility in an ecologically relevant host-pathogen system: house finches and their bacterial pathogen, Mycoplasma gallisepticum, which causes severe conjunctivitis. We examined behaviours likely to influence disease acquisition (feeder use, aggression, social network affiliations) in an observational field study, finding that the time an individual spends on bird feeders best predicted the risk of conjunctivitis. To test whether this behaviour also influences the likelihood of transmitting M. gallisepticum, we experimentally inoculated individuals based on feeding behaviour and tracked epidemics within captive flocks. As predicted, transmission was fastest when birds that spent the most time on feeders initiated the epidemic. Our results suggest that the same behaviour underlies both pathogen acquisition and transmission in this system and potentially others. Identifying individuals that exhibit such behaviours is critical for disease management. © 2015 The Author(s).
Nitrogen translocation in wheat inoculated with Azospirillum and fertilized with nitrogen
Directory of Open Access Journals (Sweden)
RODRIGUES OSMAR
2000-01-01
Full Text Available The productivity and the translocation of assimilates and nitrogen (N were compared after inoculation of wheat (Triticum aestivum L., cv. BR-23 seeds with two strains of Azospirillum brasilense (strains 245 and JA 04 under field conditions. The inoculation of wheat seeds was done with a peat inoculant at sowing time. Plant material for evaluations were collected at anthesis and maturity. No differences in grain yield and in the translocation of assimilates resulting from inoculation were detected. Differences were observed in relation to N rates (0, 15, and 60 kg ha-1. N content in the grain increased significantly in the bacteria-inoculated treatments in which N was not added. This increase in N content in the grain with inoculation was probably due to higher N uptake after anthesis without any significant contribution on the grain yield. Such increment was of 8.4 kg ha-1 of N representing 66% more N than in no inoculated treatment. Regardless of the inoculation and the rate of N applied, it was observed that about 70% of the N accumulated at anthesis was translocated from vegetative parts to the grain.
Remediation of petroleum hydrocarbons by inoculation with laboratory-cultured microorganisms
International Nuclear Information System (INIS)
Maxwell, C.R.; Baqai, H.A.
1995-01-01
An unauthorized release of gasoline from an underground storage tank (UST) impacted the soil and groundwater beneath a maintenance and fueling capacity. The property owner attempted to remediate the site by inoculating wells screened within the unsaturated and saturated zones with laboratory-cultured microorganisms. The inoculation was a one-time event. No nutrients were added to the subsurface. Air was injected into all inoculation wells during the project to promote aerobic microbial activity. At the first groundwater sampling event after inoculation, concentrations of petroleum hydrocarbon constituents increased inoculation wells. Measurements of dissolved oxygen in the groundwater appeared to indicate that oxygen consumption, and thus hydrocarbon degradation, was not occurring. Visual and olfactory evidence of the groundwater indicated evidence of decaying organic matter. After approximately 1 year and a thorough purging of the inoculation wells, decaying matter disappeared and dissolved oxygen and hydrocarbon concentrations generally returned to preproject levels. Further contaminant reduction did not occur, indicating temporary degradation of water quality as a result of the project and unsuccessful remediation
Inoculation Effects of Cast Iron
Directory of Open Access Journals (Sweden)
E. Fraś
2012-12-01
Full Text Available The paper presents a solidification sequence of graphite eutectic cells of A and D types, as well as globular and cementite eutectics. The morphology of eutectic cells in cast iron, the equations for their growth and the distances between the graphite precipitations in A and D eutectic types were analyzed. It is observed a critical eutectic growth rate at which one type of eutectic transformed into another. A mathematical formula was derived that combined the maximum degree of undercooling, the cooling rate of cast iron, eutectic cell count and the eutectic growth rate. One type of eutectic structure turned smoothly into the other at a particular transition rate, transformation temperature and transformational eutectic cell count. Inoculation of cast iron increased the number of eutectic cells with flake graphite and the graphite nodule count in ductile iron, while reducing the undercooling. An increase in intensity of inoculation caused a smooth transition from a cementite eutectic structure to a mixture of cementite and D type eutectic structure, then to a mixture of D and A types of eutectics up to the presence of only the A type of eutectic structure. Moreover, the mechanism of inoculation of cast iron was studied.
smallholder farmers' use and profitability of legume inoculants
African Journals Online (AJOL)
ACSS
Rhizobia inoculant, a product of Kenya, and its profitability in smallholder farms. Data were collected from ... of the inoculants use and gross margin analysis to examine profitability. The area under the .... the effects of various factors on the extent of. BIOFIX® use. ..... little information, resulting in reduced adoption of legume ...
Cross inoculation of anthracnose pathogens infecting various tropical fruits
Suparman; Rahmiyah, M.; Pujiastuti, Y.; Gunawan, B.; Arsi
2018-01-01
Anthracnose disease is very important disease of tropical fruits causing significant yield losses. The disease is caused by Colletotrichum spp. and infects almost all tropical fruit species, especially the succulent ones. Various species of Colletotrichum infect various tropical fruits and there are possibilities for cross inoculation to occur among tropical fruits which might cause severe infection. An experimental research was conducted to examine the effect of cross inoculation of anthracnose pathogen among papaya, eggplant, chili and common bean on the infection development and severity of the disease on each inoculated fruit species. Colletotrichum spp. were isolated from naturally infected papaya, eggplant, chili and common bean. Each fungal isolate was purified and identified to determine the species name. The spores of each isolate were then used to separately inoculate healthy and sterilized papaya, eggplant, chili and common bean. The results showed that cross infection developed on chili, eggplant and papaya but not on bean. Chili showed the highest susceptibility to all Colletotrichum isolates and significantly different from eggplant and papaya. The anthracnose pathogen isolated from common bean showed no pathogenicity to other hosts and might be used as cross protection inoculant to the disease in the other hosts.
More on Inoculating Against Reactance to Persuasive Health Messages: The Paradox of Threat.
Richards, Adam S; Banas, John A; Magid, Yoav
2017-07-01
This research examined the efficacy of inoculation as a strategy to mitigate psychological reactance based on the level of threat communicated in the forewarning and subsequent persuasive health appeal. Two 2 (inoculation) × 2 (freedom-threatening language) experiments were conducted. The first (N = 181) used elaborated inoculation designed to enhance the threat of impending reactance to a message advocating for responsible alcohol consumption. The second (N = 159) used limited inoculation designed to minimize the threat of impending reactance to a message advocating for responsible soft drink consumption. Results showed that elaborated inoculation increased reactance, whereas limited inoculation decreased reactance but only when the subsequent appeal used less freedom-threatening language. These findings suggest that inoculation has the potential to facilitate or buffer reactance depending on the level of threat communicated in inoculation forewarnings and in subsequent persuasive health appeals.
GERMINATION OF GRASSES DUE TO INOCULATION DIAZOTROPHIC BACTERIA
Directory of Open Access Journals (Sweden)
C. D. A. Moreira
2014-07-01
Full Text Available The germination of forage grasses suffers from numbness and a natural tendency to low quality. The use of microorganisms inoculated in seeds with the purpose of increasing and meet the demand of some nutrient has been shown to be efficient, but the role of the microorganism in germination and rate of force is still unknown. Therefore the goal as study was to evaluate the germination rate of seeds of three cultivars of Brachiaria brizantha CV. Marandu, b., b. brizantha CV. Xaraés and b. humidícola cv Tupi and a cultivar of millet, P. hybrid cv Massai depending on the bacterium Azospirillum brasilense diazotrofic inoculation (nitrogen-fixing. Germination test was used in seed dispersal to assess the effect of first count (VPC in the treatments with and without inoculation. It was done also conducted further tests of electrical conductivity, weight of thousand seeds and water content. The delineation used was randomized entirely (DIC and the statistical analysis carried out through the analysis of variance and comparison of means using the Tukey test, the 5% probability. Massai grass seeds have the highest rate of force of first count in both treatments. Inoculation of bacterium Azospirillum brasilense did not affect the values of force of first count on seeds of the cultivars Marandu, Xaraés, Tupi and Massai. The seeds of the massai have higher germination speed relative the other cultivars evaluated when inoculated.
Inoculation in Political Campaign Communication.
Pfau, Michael; Burgoon, Michael
1988-01-01
Posits a strategy of resistance to the influence of attack messages in political campaigns. Finds that political campaign messages can be designed to inoculate supporters of candidates against subsequent attack messages of opposing candidates. (MS)
Experimental inoculation of equine coronavirus into Japanese draft horses.
Nemoto, Manabu; Oue, Yasuhiro; Morita, Yoshinori; Kanno, Toru; Kinoshita, Yuta; Niwa, Hidekazu; Ueno, Takanori; Katayama, Yoshinari; Bannai, Hiroshi; Tsujimura, Koji; Yamanaka, Takashi; Kondo, Takashi
2014-12-01
Recently, outbreaks associated with equine coronavirus (ECoV) have occurred in Japan and the United States. While ECoV is likely to be pathogenic to horses, it has not been shown that experimental inoculation of horses with ECoV produces clinical signs of disease. In this study, we inoculated three Japanese draft horses with an ECoV-positive diarrheic fecal sample to confirm infection after inoculation and to investigate the clinical course and virus shedding patterns of ECoV. Virus neutralization tests showed that all three horses became infected with ECoV. Two of the three horses developed clinical signs similar to those observed during ECoV outbreaks, including fever, anorexia, and gastrointestinal dysfunction. All horses excreted a large amount of virus into their feces for more than 9 days after inoculation regardless of the presence or absence of clinical signs, which suggests that feces are an important source of ECoV infection. ECoV was also detected in nasal swabs from all horses, suggesting that respiratory transmission of ECoV may occur. Both symptomatic horses developed viremia, while the asymptomatic horse did not. White blood cell counts and serum amyloid A concentrations changed relative to the clinical condition of the inoculated horses; these may be useful markers for monitoring the clinical status of horses infected with ECoV. This is the first report of induction of clinical signs of ECoV infection in horses by experimental inoculation. These clinical and virological findings should aid further investigation of the pathogenesis of ECoV.
effect of tillage, rhizobium inoculation in maize-soybean- based ...
African Journals Online (AJOL)
main plot, four rhizobium inoculation in soybean-maize-based cropping systems ... production systems, such as cropping systems, ... of commercial inoculants. Studies ... and distributed by IITA business incubation ... sowing, while the remaining part (2/3) was done as ...... biological nitrogen fixation potential and grain yield.
Key factors to inoculate Botrytis cinerea in tomato plants
Directory of Open Access Journals (Sweden)
Álefe Vitorino Borges
2014-09-01
Full Text Available Studies addressing the biological control of Botrytis cinerea have been unsuccessful because of fails in inoculating tomato plants with the pathogen. With the aim of establishing a methodology for inoculation into stems, experiments were designed to assess: i. the aggressiveness of pathogen isolates; ii. the age at which tomato plants should be inoculated; iii. the susceptibility of tissues at different stem heights; iv. the need for a moist chamber after inoculation; and v. the effectiveness of gelatin regarding inoculum adhesion. Infection with an isolate from tomato plants that was previously inoculated into petioles and then re-isolated was successful. An isolate from strawberry plants was also aggressive, although less than that from tomato plants. Tomato plants close to flowering, at 65 days after sowing, and younger, middle and apical stem portions were more susceptible. There was positive correlation between lesion length and sporulation and between lesion length and broken stems. Lesion length and the percentage of sporulation sites were reduced by using a moist chamber and were not affected by adding gelatin to the inoculum suspension. This methodology has been adopted in studies of B. cinerea in tomato plants showing reproducible results. The obtained results may assist researchers who study the gray mold.
Experimental inoculation of North American opossums (Didelphis virginiana) with Mycobacterium bovis.
Diegel, Kelly L; Fitzgerald, Scott D; Berry, Dale E; Church, Steven V; Reed, Willie M; Sikarskie, James G; Kaneene, John B
2002-04-01
Eight North American opossums (Didelphis virginiana) were inoculated with 1 x 10(5) colony forming units of Mycobacterium bovis to investigate their potential as reservoir hosts for bovine tuberculosis in Michigan. Four animals received this dose orally and four were inoculated intramuscularly (i.m.). In each group, two animals were euthanized 1 mo postinoculation (PI) and two at 2 mo PI. Four control animals were housed separately and sacrificed in the same manner as those inoculated. One of four orally inoculated opossums and three of four i.m.-inoculated opossums were positive for M. bovis by culture of tissues obtained at necropsy. The oral recipient had positive cultures from intestine and pooled lymphoid samples. Pooled lymphoid samples were positive in three i.m.-inoculated animals and two of these also had positive liver and lung cultures. One animal with gross and histologic lesions compatible with tuberculosis had negative tissue cultures. The findings suggest that opossums are susceptible to M. bovis infection by multiple routes, although their relative susceptibility compared to true reservoir hosts appears to be low.
Co-inoculation of Azospirillum brasilense and Herbaspirillum seropedicae in maize
Directory of Open Access Journals (Sweden)
Janaína Dartora
2016-06-01
Full Text Available ABSTRACT Bacteria from the genera Azospirillum and Herbaspirillum have been associated with increments in maize yield. The aim of this study was to evaluate the maize yield and nutritional content in response to inoculation with A. brasilense and H. seropediceae in association with nitrogen (N fertilization. The experimental design was randomized blocks in a 4 x 5 factorial scheme, with four replicates. The treatments consisted of seed inoculation (control without N and inoculation, A. brasilense strain - AbV5, H. seropediceae strain - SMR1 and co-inoculation AbV5 + SMR1 and N doses (0, 40, 80, 120 and 160 kg ha-1. The following variables were evaluated: ear insertion height, ear length, ear diameter, number of rows per ear, number of grains per row, ear weight, yield and NPK contents in leaves and grains. There was no interaction between the factors studied. Co-inoculation with the strains promoted increments of 12% in leaf P content, compared with control, and N fertilization promoted increase in yield and leaf P content up to the maximum dose studied.
Co-inoculation with diazotrophic bacteria in soybeans associated to urea topdressing
Directory of Open Access Journals (Sweden)
Glauber Monçon Fipke
Full Text Available ABSTRACT Increased grain yield can be obtained via an interaction between plants and growth-promoting microorganisms. The Bradyrhizobium spp. are capable of fixing atmospheric nitrogen in soybeans [Glycine max (L. Merril], and Azospirillum spp. induce the synthesis of phytohormones. The aim of this study was to evaluate inoculation with Bradyrhizobium and co-inoculation with Bradyrhizobium + Azospirillum brasilense in soybeans in combination with the application a topdressing of 0, 75 or 150 kg of N ha-1 of urea during the reproductive stage. Three soybean cultivars (BMX Ativa, TEC 6029 and BMX Potência, were tested in field experiments in Santa Maria, RS, Brazil, during two agricultural years (2013/2014 and 2014/2015 and two sowing times. Morphological, nodulation and yield components were evaluated. Co-inoculation increased the grain yield by 240 kg ha-1 compared with conventional inoculation. When co-inoculated, cultivars BMX Ativa, TEC 6029 and BMX Potência showed increased grain yields of 6, 4 and 12%, respectively. The application of 150 kg ha-1 of N as a topdressing increased the grain yield by 300 kg ha-1 in the co-inoculated cultivars TEC 6029 and BMX Potência, but without a financial return. When inoculated only with Bradyrhizobium, the cultivars did not respond positively to the application of urea.
Legume bioactive compounds: influence of rhizobial inoculation
Directory of Open Access Journals (Sweden)
Luis R. Silva
2017-04-01
Full Text Available Legumes consumption has been recognized as beneficial for human health, due to their content in proteins, fiber, minerals and vitamins, and their cultivation as beneficial for sustainable agriculture due to their ability to fix atmospheric nitrogen in symbiosis with soil bacteria known as rhizobia. The inoculation with these baceria induces metabolic changes in the plant, from which the more studied to date are the increases in the nitrogen and protein contents, and has been exploited in agriculture to improve the crop yield of several legumes. Nevertheless, legumes also contain several bioactive compounds such as polysaccharides, bioactive peptides, isoflavones and other phenolic compounds, carotenoids, tocopherols and fatty acids, which makes them functional foods included into the nutraceutical products. Therefore, the study of the effect of the rhizobial inoculation in the legume bioactive compounds content is gaining interest in the last decade. Several works reported that the inoculation of different genera and species of rhizobia in several grain legumes, such as soybean, cowpea, chickpea, faba bean or peanut, produced increases in the antioxidant potential and in the content of some bioactive compounds, such as phenolics, flavonoids, organic acids, proteins and fatty acids. Therefore, the rhizobial inoculation is a good tool to enhance the yield and quality of legumes and further studies on this field will allow us to have plant probiotic bacteria that promote the plant growth of legumes improving their functionality.
Fitzgerald, Scott D; Zwick, Laura S; Diegel, Kelly L; Berry, Dale E; Church, Steven V; Sikarskie, James G; Kaneene, John B; Reed, Willie M
2003-04-01
The goal of this study was to evaluate the susceptibility of North American opossums (Didelphis virginiana) to aerosol inoculation of Mycobacterium bovis at two dose levels in order to gain information on disease pathogenesis, fecal shedding of the organism, and the potential role that opossums play in the spread of this disease in nature. Six opossums received high dose (1 x 10(7) colony forming units (cfu) by aerosol inoculation, six opossums received low dose (1 x 10(3) cfu inoculation, and six opossums were sham-inoculated with sterile water and served as controls. Lungs were the most frequently infected tissues, with nine of 12 inoculated opossums positive for M. bovis on culture. Gross lesions consisted of multifocal pneumonia and enlarged lymph nodes. Microscopically, granulomatous pneumonia and granulomatous lymphadenitis associated with acid-fast bacilli were present in eight of 12 inoculated opossums. Fecal shedding of M. bovis was uncommon at both inoculation doses. While opossums were highly susceptible to aerosol inoculation of M. bovis, they did not become emaciated or develop widely disseminated lesions. From this study, opossums may transmit tuberculosis by aerosol infection to other opossums in close contact and serve as a source of infection to carnivores that feed upon them, however, transmission of the disease to large herbivores by fecal shedding or direct contact may be less likely.
Thermal analysis control of in-mould and ladle inoculated grey cast irons
Directory of Open Access Journals (Sweden)
Mihai Chisamera
2009-05-01
Full Text Available The effect of addition of 0.05wt.% to 0.25 wt.% Ca, Zr, Al-FeSi alloy on in-ladle and in-mould inoculation of grey cast irons was investigated. In the present paper, the conclusions drawn are based on thermal analysis. For the solidification pattern, some specific cooling curves characteristics, such as the degree of undercooling at the beginning of eutectic solidifi cation and at the end of solidifi cation, as well as the recalescence level, are identifi ed to be more infl uenced by the inoculation technique. The degree of eutectic undercooling of the electrically melted base iron having 0.025% S, 0.003% Al and 3.5% Ce is excessively high (39–40℃, generating a relatively high need for inoculation. Under these conditions, the in-mould inoculation has a more signifi cant effect compared to ladle inoculation, especially at lower inoculant usage (less than 0.20 wt.%. Generally, the efficiency of 0.05wt.%–0.15wt.% of alloy for in-mould inoculation is comparable to, or better than, that of 0.15wt.%–0.25wt.% addition in ladle inoculation procedures. In order to secure stable and controlled processes, representative thermal analysis parameters could be used, especially in thin wall grey iron castings production.
Sunflower growth according to seed inoculation with endophytic bacteria
Directory of Open Access Journals (Sweden)
Juliana Fernandes dos Santos
2014-06-01
Full Text Available The sunflower crop has a great importance worldwide, due to the oil of excellent quality extracted from its seeds and in natura grains that are consumed in various ways. However, drought is one of the main environmental factors that limit its yield. An experiment was carried out under controlled greenhouse conditions, in a completely randomized experimental design, in order to determine the effect of endophytic bacteria inoculation (Bacillus sp. and Enterobacter cloacae on the growth and contents of nutrients and organic solutes, in sunflower leaves and roots under water deficit. Plant height, stem diameter, fresh and dry biomass of shoot and roots, as well as contents of N, P, K, soluble carbohydrates, free proline, free amino acids and soluble proteins, were determined at 35 days after the plant emergence. The water deficit reduced plant growth regardless inoculation. However, under optimum conditions of soil moisture, the combination of both endophytic bacteria increased the sunflower growth. The water deficit also increased the N and K contents in leaves, as well as the organic solutes content in shoots, especially in inoculated plants. These results suggest that the inoculation of endophytic bacteria may increase the capacity of drought stressed plants to perform the osmotic adjustment through a higher accumulation of organic solutes, when compared to plants not inoculated.
Effects of single and combined inoculations of selected Trichoderma ...
African Journals Online (AJOL)
Effects of single and combined inoculations of selected Trichoderma and Bacillus isolates on growth of dry bean and biological control of Rhizoctonia solani damping-off. ... Greenhouse trials showed that combined inoculations of T. atroviride strain 6 and B. subtilis B69 gave the highest growth promotion of bean in terms of ...
Kyei-Boahen, Stephen; Savala, Canon E. N.; Chikoye, David; Abaidoo, Robert
2017-01-01
Cowpea (Vigna unguiculata) is a major source of dietary protein and essential component of the cropping systems in semi-arid regions of Sub-Saharan Africa. However, yields are very low due to lack of improved cultivars, poor management practices, and limited inputs use. The objectives of this study were to assess the effects of rhizobia inoculant and P on nodulation, N accumulation and yield of two cowpea cultivars in Mozambique. Field study was conducted in three contrasting environments during the 2013/2014 and 2014/2015 seasons using randomized complete block design with four replications and four treatments. Treatments consisted of seed inoculation, application of 40 kg P2O5 ha-1, inoculation + P, and a non-inoculated control. The most probable number (MPN) technique was used to estimate the indigenous bradyrhizobia populations at the experimental sites. The rhizobia numbers at the sites varied from 5.27 × 102 to 1.07 × 103 cells g-1 soil. Inoculation increased nodule number by 34–76% and doubled nodule dry weight (78 to 160 mg plant-1). P application improved nodulation and interacted positively with the inoculant. Inoculation, P, and inoculant + P increased shoot dry weight, and shoot and grain N content across locations but increases in number of pods plant-1, seeds pod-1, and 100-seed weight were not consistent among treatments across locations. Shoot N content was consistently high for the inoculated plants and also for the inoculated + P fertilized plants, whereas the non-inoculated control plants had the lowest tissue N content. P uptake in shoot ranged from 1.72 to 3.77 g kg-1 and was higher for plants that received P fertilizer alone. Inoculation and P either alone or in combination consistently increased cowpea grain yield across locations with yields ranging from 1097 kg ha-1 for the non-inoculated control to 1674 kg ha-1 for the inoculant + P treatment. Grain protein concentration followed a similar trend as grain yield and ranged from 223 to
Zhao, Yue; Lu, Qian; Wei, Yuquan; Cui, Hongyang; Zhang, Xu; Wang, Xueqin; Shan, Si; Wei, Zimin
2016-11-01
In this study, actinobacteria agent including Streptomyces sp. and Micromonospora sp. were inoculated during chicken manure composting by different inoculation methods. The effect of different treatments on cellulose degradation and the relationship between inoculants and indigenous actinobacteria were investigated during composting. The results showed that inoculation in different stages of composting all improved the actinobacteria community diversity particularly in the cooling stage of composting (M3). Moreover, inoculation could distinctly accelerate the degradation of organic matters (OM) especially celluloses. Redundancy analysis indicated that the correlation between indigenous actinobacteria and degradation of OM and cellulose were regulated by inoculants and there were significant differences between different inoculation methods. Furthermore, synergy between indigenous actinobacteria and inoculants for degradation of OM and cellulose in M3 was better than other treatments. Conclusively, we suggested an inoculation method to regulate the indigenous actinobacteria based on the relationship between inoculants and indigenous actinobacteria and degradation content. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Domizia Donnini
2014-08-01
Full Text Available Aim of study: the main aims of this study were to evaluate the quality of truffle-inoculated seedlings produced by commercial nurseries in Italy and to identify their minimum requisites in terms of plant age, health, homogeneity, and cut-off percentage of inoculated Tuber and non-Tuber ectomycorrhizae, based on the analysis of an extensive sample of seedlings subjected to quality control and certification.Area of study: truffle-inoculated seedlings produced by Italian commercial nurseries.Material and Methods: analysis of truffle-inoculated seedlings for health and quality standards; recording of presence of inoculated Tuber spp. and other concurrent fungi according to the official Italian method for certification; selective amplification of ectomycorrhizal DNA by PCR species-specific primers.Main results: We showed that mycorrhization levels in truffle-inoculated seedlings increased with time after truffle-spore inoculation. The highest mean percentage of the inoculated Tuber spp., but also the highest presence of contaminants, were recorded after three years. The mycorrhization level of Tuber melanosporum and T. aestivum was higher in Corylus and Ostrya seedlings than in Q. ilex and Q. pubescens, but the latter two host species showed the lowest presence of other ectomycorrhizal fungi. Mycorrhization level distribution in truffle-inoculated seedlings of suitable batches differed very little from the distribution in only all suitable seedlings. Truffle seedlings with other Tuber spp. were very few and even absent after three years. The general quality of Italian truffle-inoculated seedlings is high but can be improved even further by revising the parameters used for their certification.Research highlights: Mycorrhization assessment in truffle-inoculated seedlings produced by commercial nurseries and a revision of the parameters of quality standards following several years of certification in Italy.Keywords: Truffle cultivation; truffle
Establishment and effectiveness of inoculated arbuscular mycorrhizal fungi in agricultural soils.
Köhl, Luise; Lukasiewicz, Catherine E; van der Heijden, Marcel G A
2016-01-01
Arbuscular mycorrhizal fungi (AMF) are promoted as biofertilizers for sustainable agriculture. So far, most researchers have investigated the effects of AMF on plant growth under highly controlled conditions with sterilized soil, soil substrates or soils with low available P or low inoculum potential. However, it is still poorly documented whether inoculated AMF can successfully establish in field soils with native AMF communities and enhance plant growth. We inoculated grassland microcosms planted with a grass-clover mixture (Lolium multiflorum and Trifolium pratense) with the arbuscular mycorrhizal fungus Rhizoglomus irregulare. The microcosms were filled with eight different unsterilized field soils that varied greatly in soil type and chemical characteristics and indigenous AMF communities. We tested whether inoculation with AMF enhanced plant biomass and R. irregulare abundance using a species specific qPCR. Inoculation increased the abundance of R. irregulare in all soils, irrespective of soil P availability, the initial abundance of R. irregulare or the abundance of native AM fungal communities. AMF inoculation had no effect on the grass but significantly enhanced clover yield in five out of eight field soils. The results demonstrate that AMF inoculation can be successful, even when soil P availability is high and native AMF communities are abundant. © 2015 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Md. Zulfekar Ali
2015-01-01
Full Text Available Aim: Mycoplasma gallisepticum (MG is important avian pathogen responsible for chronic respiratory disease of chicken and turkeys, which result in large economic loss for the poultry industry. The objectives of this study were determination of seroprevalence of MG antibody of commercial layer chicken at laying period in selected areas of Bangladesh. Materials and Methods: A total of 563 blood samples were collected randomly from selected commercial layer chickens at laying period during the period from July to December, 2013. Indirect enzyme linked immunosorbent assay (iELISA and serum plate agglutination (SPA test were performed to detect the presence of antibodies against MG. Results: Of 563 samples, 64.47% and 56.13% showed an overall prevalence of MG antibodies in iELISA and SPA test respectively. Prevalence of MG was recorded the highest (69.63% at 50-55 weeks of age compared with lowest (53.26% at 56-61 weeks of age (p<0.05. Significant (p<0.05 effect of breed were observed in the seroprevalence of MG infection in layer birds in the present study. The overall, 68.77%, 63.74% and 59.37% prevalence were found respectively in sonali, ISA Brown and White leg horn. The prevalence of MG antibodies was the highest (70.13% in December followed by November (68%, October (65.67%, August (63.46%, September (58.54% and July (51.78% month. The seroprevalence of MG antibodies was higher (69.63% in most of the large flocks and lower (56.82% in small flocks. Conclusion: Therefore, might be suggested that the commercial layer farms should be routinely checked to monitor MG infection and the reactor birds should be culled since MG organism has the potential to transmit vertically. The correlation between MG antibody in month and flock size was not significant (p=0.359 and p=0.868, respectively.
Lactating cow response to lucerne silage inoculated with Lactobacillus plantarum
It is unclear why bacterial silage inoculants improve milk production in lactating dairy cattle. However, recent in vitro results suggest that inoculated silage effects on milk production may be tied to greater production of rumen microorganisms. Our objective was to determine if alfalfa silage trea...
Inoculation stress hypothesis of environmental enrichment.
Crofton, Elizabeth J; Zhang, Yafang; Green, Thomas A
2015-02-01
One hallmark of psychiatric conditions is the vast continuum of individual differences in susceptibility vs. resilience resulting from the interaction of genetic and environmental factors. The environmental enrichment paradigm is an animal model that is useful for studying a range of psychiatric conditions, including protective phenotypes in addiction and depression models. The major question is how environmental enrichment, a non-drug and non-surgical manipulation, can produce such robust individual differences in such a wide range of behaviors. This paper draws from a variety of published sources to outline a coherent hypothesis of inoculation stress as a factor producing the protective enrichment phenotypes. The basic tenet suggests that chronic mild stress from living in a complex environment and interacting non-aggressively with conspecifics can inoculate enriched rats against subsequent stressors and/or drugs of abuse. This paper reviews the enrichment phenotypes, mulls the fundamental nature of environmental enrichment vs. isolation, discusses the most appropriate control for environmental enrichment, and challenges the idea that cortisol/corticosterone equals stress. The intent of the inoculation stress hypothesis of environmental enrichment is to provide a scaffold with which to build testable hypotheses for the elucidation of the molecular mechanisms underlying these protective phenotypes and thus provide new therapeutic targets to treat psychiatric/neurological conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Lorenzen, Emma; Follmann, Frank; Secher, Jan O
2017-01-01
Advanced animal models, such as minipigs, are needed for the development of a globally requested human Chlamydia vaccine. Previous studies have shown that vaginal inoculation of sexually mature Göttingen minipigs with Chlamydia trachomatis resulted in an infection lasting only 3-5 days. The aim...... resulted in a longer lasting infection (at least 10 days) compared to estrus (3-5 days). Furthermore, we found a significant C. trachomatis specific IFN-γ response in pigs inoculated during estrus correlating with the accelerated clearance of infection in these pigs. These findings suggest...
Directory of Open Access Journals (Sweden)
Gautam P. Sadarangani
2017-07-01
Full Text Available There is increasing research interest in technologies that can detect grasping, to encourage functional use of the hand as part of daily living, and thus promote upper-extremity motor recovery in individuals with stroke. Force myography (FMG has been shown to be effective for providing biofeedback to improve fine motor function in structured rehabilitation settings, involving isolated repetitions of a single grasp type, elicited at a predictable time, without upper-extremity movements. The use of FMG, with machine learning techniques, to detect and distinguish between grasping and no grasping, continues to be an active area of research, in healthy individuals. The feasibility of classifying FMG for grasp detection in populations with upper-extremity impairments, in the presence of upper-extremity movements, as would be expected in daily living, has yet to be established. We explore the feasibility of FMG for this application by establishing and comparing (1 FMG-based grasp detection accuracy and (2 the amount of training data necessary for accurate grasp classification, in individuals with stroke and healthy individuals. FMG data were collected using a flexible forearm band, embedded with six force-sensitive resistors (FSRs. Eight participants with stroke, with mild to moderate upper-extremity impairments, and eight healthy participants performed 20 repetitions of three tasks that involved reaching, grasping, and moving an object in different planes of movement. A validation sensor was placed on the object to label data as corresponding to a grasp or no grasp. Grasp detection performance was evaluated using linear and non-linear classifiers. The effect of training set size on classification accuracy was also determined. FMG-based grasp detection demonstrated high accuracy of 92.2% (σ = 3.5% for participants with stroke and 96.0% (σ = 1.6% for healthy volunteers using a support vector machine (SVM. The use of a training set that was 50
Response of chickpea ( Cicer arietinum L.) to inoculation with native ...
African Journals Online (AJOL)
The results from the field and pot experiments indicated that chickpea crop yield can be improved using proper Mesorhizobium inoculation. Inoculation had a pronounced effect on grain yield, yield component, total N uptake, grain protein content, percentage N derived from the atmosphere (%Ndfa) for the seed, and amount ...
Re-Thinking Anxiety: Using Inoculation Messages to Reduce and Reinterpret Public Speaking Fears.
Jackson, Ben; Compton, Josh; Thornton, Ashleigh L; Dimmock, James A
2017-01-01
Inoculation theory offers a framework for protecting individuals against challenges to an existing attitude, belief, or state. Despite the prevalence and damaging effects of public speaking anxiety, inoculation strategies have yet to be used to help individuals remain calm before and during public speaking. We aimed to test the effectiveness of an inoculation message for reducing the onset of public speaking anxiety, and helping presenters interpret their speech-related anxiety more positively. Participants (Mage = 20.14, SD = 2.72) received either an inoculation (n = 102) or control (n = 128) message prior to engaging a public speaking task and reported a range of anxiety-related perceptions. Accounting for personality characteristics and perceptions of task importance, and relative to control participants, those who received the inoculation message reported significantly lower pre-task anxiety, and following the task, reported that they had experienced lower somatic anxiety, and that the inoculation message had caused them to view their nerves in a less debilitating light. Inoculation messages may be an effective strategy for helping participants reframe and reduce their apprehension about public speaking, and investigating their efficacy in other stress-inducing contexts may be worthwhile.
Effects of a dual-purpose bacterial inoculant on the fermentation ...
African Journals Online (AJOL)
Effects of a dual-purpose bacterial inoculant on the fermentation characteristics of high-moisture maize silage and dairy cattle performance. ... Inoculation did not affect the nutritive value or the aerobic stability of the maize silage, but increased the neutral detergent and acid detergent fibre fractions of the silage. However ...
Co-inoculation effects of Bradyrhizobium japonicum and ...
African Journals Online (AJOL)
Co-inoculation effects of Bradyrhizobium japonicum and Azospirillum sp. on competitive nodulation and rhizosphere eubacterial community structures of soybean under rhizobia-established soil conditions.
Gkana, E; Chorianopoulos, N; Grounta, A; Koutsoumanis, K; Nychas, G-J E
2017-04-01
The objective of the present study was to determine the factors affecting the transfer of foodborne pathogens from inoculated beef fillets to non-inoculated ones, through food processing surfaces. Three different levels of inoculation of beef fillets surface were prepared: a high one of approximately 10 7 CFU/cm 2 , a medium one of 10 5 CFU/cm 2 and a low one of 10 3 CFU/cm 2 , using mixed-strains of Listeria monocytogenes, or Salmonella enterica Typhimurium, or Escherichia coli O157:H7. The inoculated fillets were then placed on 3 different types of surfaces (stainless steel-SS, polyethylene-PE and wood-WD), for 1 or 15 min. Subsequently, these fillets were removed from the cutting boards and six sequential non-inoculated fillets were placed on the same surfaces for the same period of time. All non-inoculated fillets were contaminated with a progressive reduction trend of each pathogen's population level from the inoculated fillets to the sixth non-inoculated ones that got in contact with the surfaces, and regardless the initial inoculum, a reduction of approximately 2 log CFU/g between inoculated and 1st non-inoculated fillet was observed. S. Typhimurium was transferred at lower mean population (2.39 log CFU/g) to contaminated fillets than E. coli O157:H7 (2.93 log CFU/g), followed by L. monocytogenes (3.12 log CFU/g; P < 0.05). Wooden surfaces (2.77 log CFU/g) enhanced the transfer of bacteria to subsequent fillets compared to other materials (2.66 log CFU/g for SS and PE; P < 0.05). Cross-contamination between meat and surfaces is a multifactorial process strongly depended on the species, initial contamination level, kind of surface, contact time and the number of subsequent fillet, according to analysis of variance. Thus, quantifying the cross-contamination risk associated with various steps of meat processing and food establishments or households can provide a scientific basis for risk management of such products. Copyright © 2016 Elsevier Ltd
[Development of nursing pratice in family medecine groups].
D'Amour, Danielle; Goudreau, Johanne; Hudon, Eveline; Beaulieu, Marie-Dominique; Lamothe, Lise; Jobin, Guy; Gilbert, Frédéric
2008-01-01
The purpose of the study was to analyze the development of nursing practice in family medicine groups (FMGs). The two-year case study consisted of 73 semi-directed interviews ofnurses, physicians and managers in five FMGs. The findings led to three main observations: nursing practice varies considerably from one FMG to another, the development of nurses' practice seems to be associated with the development of a collaborative relationship, and the satisfaction of the professionals in the FMG, nurses in particular, depends on the type of practice. It is important to implement measures to encourage the optimal use ofnurses' skills in a FMG.
Gbylik-Sikorska, Malgorzata; Posyniak, Andrzej; Sniegocki, Tomasz; Sell, Bartosz; Gajda, Anna; Sawicka, Anna; Olszewska-Tomczyk, Monika; Bladek, Tomasz; Tomczyk, Grzegorz; Zmudzki, Jan
2016-04-01
Most of antibiotics, administrated in the treatment of poultry diseases are dissolved in drinking water, and it can lead to water supply systems contamination, especially when the regular cleaning is not using. This situation can lead to unconscious administration of low doses of antibiotics to untreated animals. The aim of this study was to clarify the impact of the exposure of enrofloxacin traces (500 μg l(-1)) to doxycycline pharmacokinetics in healthy and experimentally Mycoplasma gallisepticum infected broiler chickens., Two experimental groups, received of enrofloxacin in water and all groups, received 20 mg kg(-1) bw of doxycycline. The compounds concentrations in muscles and livers were determined by LC-MS/MS. The maximum drug tissue concentration (Cmax) of doxycycline was highest in liver obtained from infected chickens which, received enrofloxacin traces (ENR + DC/MG). It was about 40% higher than in healthy chickens from group I which received only doxycycline. It was found that the concentration-time curve AUC(0-t) values in group ENR + DC/MG were almost 75% higher than in the group (DC) and 35% higher than in group (ENR + DC) which also received enrofloxacin traces. The constant exposure of broiler chickens on enrofloxacin traces as well as infection, may significantly influenced on doxycycline tissue pharmacokinetic profile. Copyright © 2016 Elsevier Ltd. All rights reserved.
Striatal dopamine D2/3 receptor regulation by stress inoculation in squirrel monkeys
Directory of Open Access Journals (Sweden)
Alex G. Lee
2016-06-01
Full Text Available Intermittent mildly stressful situations provide opportunities to learn, practice, and improve coping in a process called stress inoculation. Stress inoculation also enhances cognitive control and response inhibition of impulsive motivated behavior. Cognitive control and motivation have been linked to striatal dopamine D2 and/or D3 receptors (DRD2/3 in rodents, monkeys, and humans. Here, we study squirrel monkeys randomized early in life to stress inoculation with or without maternal companionship and a no-stress control treatment condition. Striatal DRD2/3 availability in adulthood was measured in vivo by [11C]raclopride binding using positron emission tomography (PET. DRD2/3 availability was greater in caudate and putamen compared to ventral striatum as reported in PET studies of humans and other non-human primates. DRD2/3 availability in ventral striatum was also consistently greater in stress inoculated squirrel monkeys compared to no-stress controls. Squirrel monkeys exposed to stress inoculation in the presence of their mother did not differ from squirrel monkeys exposed to stress inoculation without maternal companionship. Similar effects in different social contexts extend the generality of our findings and together suggest that stress inoculation increases striatal DRD2/3 availability as a correlate of cognitive control in squirrel monkeys.
Directory of Open Access Journals (Sweden)
Leandro Hahn
Full Text Available ABSTRACT Rhizobia and associative bacteria promote growth in rice plants (Oryza sativa L. through a series of mechanisms, but most studies on inoculation have been performed based on inoculation with these bacteria in a separate or singular manner. The objective of this study was to assess the efficiency of single/isolated inoculation and inoculation combined with symbiotic rhizobia from forage legume and with Azospirillum brasilense on promoting growth and the root colonization process in wetland rice. Two rhizobia among four isolates from a greenhouse and a laboratory experiment were selected that efficiently promoted seed germination and rice plant growth in a sterilized substrate and in soil. The two most efficient isolates (UFRGS Vp16 and UFRGS Lc348 were inoculated alone or in combination with a commercial product containing A. brasilense in two field experiments using two wetland rice cultivars over two growing seasons. In the field experiments, these isolates coinoculated with A. brasilense promoted larger increases in the agronomic variables of wetland rice compared to the control without inoculation. Confocal laser microscopy confirmed the presence of inoculated bacteria tagged with gfp (UFRGS Vp16, UFRGS Lc348, and A. brasilense colonizing the root surface of the rice seedlings, mainly in the root hairs and lateral roots.
Devi, Apramita; Archana, Kodira Muthanna; Bhavya, Panikuttria Kuttappa; Anu-Appaiah, Konerira Aiyappaa
2018-02-01
Co-inoculation has been adapted by many wine-producing countries because it enhances the success of malolactic fermentation and reduces the fermentation cost, as well as time. However, wine phenolics have been sparsely highlighted during co-inoculation, even though polyphenols are an important parameter affecting wine colour, astringency and aroma. In the present study, we investigated the impact of co-inoculation on non-anthocyanin polyphenol profile for two different grape varieties. Co-inoculation of native yeast strain (AAV2) along with Oenococcus oeni was adapted for Cabernet Sauvignon and Shiraz wine. It was observed that the co-inoculation had minimal yet significant impact on the phenolic composition of wines for both the grape varieties. Color loss, as well as fruity aroma development, was observed in co-inoculated wines. The wines were on a par with the commercial wine, as well as wines without malolactic fermentation, in terms of phenolic compounds and overall organoleptic acceptance. Principal component analysis and hierarchical cluster analysis further suggested that the varietal influence on phenolic composition was dominating compared to inoculation strategies. Among the varieties, the inoculation strategies have significantly influenced the Cabernet wines compared to Shiraz wines. The results of the present study demonstrate that the phenolic compounds are not drastically affected by metabolic activities of malolactic bacteria during co-inoculation and, hence, are equally suitable for wine fermentation. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Effect of Titanium Inoculation on Tribological Properties of High Chromium Cast Iron
Directory of Open Access Journals (Sweden)
Siekaniec D.
2017-12-01
Full Text Available The present investigation focuses on the study of the influence of titanium inoculation on tribological properties of High Chromium Cast Iron. Studies of tribological properties of High Chromium Cast Iron, in particularly the wear resistance are important because of the special application of this material. High Chromium Cast Iron is widely used for parts that require high wear resistance for example the slurry pumps, brick dies, several pieces of mine drilling equipment, rock machining equipment, and similar ones. Presented research described the effects of various amounts of Fe-Ti as an inoculant for wear resistance. The results of wear resistance were collated with microstructural analysis. The melts were conducted in industrial conditions. The inoculation was carried out on the stream of liquid metal. The following amount of inoculants have been used; 0.17% Fe-Ti, 0.33% Fe-Ti and 0.66% Fe-Ti. The tests were performed on the machine type MAN. The assessment of wear resistance was made on the basis of the weight loss. The experimental results indicate that inoculation improve the wear resistance. In every sample after inoculation the wear resistance was at least 20% higher than the reference sample. The best result, thus the smallest wear loss was achieved for inoculation by 0.66% Fe-Ti. There is the correlation between the changing in microstructure and wear resistance. With greater amount of titanium the microstructure is finer. More fine carbides do not crumbling so quickly from the matrix, improving the wear resistance.
Czech Academy of Sciences Publication Activity Database
Janoušková, Martina; Krak, Karol; Vosátka, Miroslav; Püschel, David; Štorchová, Helena
2017-01-01
Roč. 12, č. 7 (2017), s. 1-21, č. článku e0181525. E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) LH14285 Institutional support: RVO:67985939 ; RVO:61389030 Keywords : inoculation * arbuscular mycorrhiza * community Subject RIV: EH - Ecology, Behaviour; EH - Ecology, Behaviour (UEB-Q) OBOR OECD: Plant sciences, botany; Plant sciences, botany (UEB-Q) Impact factor: 2.806, year: 2016
Response of Sesbania grandiflora to Inoculation of Soil with Vesicular-Arbuscular Mycorrhizal Fungi.
Habte, M; Aziz, T
1985-09-01
A greenhouse experiment was conducted to determine the influence of two tropical isolates of Glomus fasciculatum and Glomus mosseae on the nutrient uptake and growth of Sesbania grandiflora. Inoculation of sterile soil with the fungi significantly improved growth and nutrient uptake by S. grandiflora, but the response of the legume was markedly better when the soil was inoculated with G. fasciculatum than when it was inoculated with G. mosseae. Nutrient uptake and growth of S. grandiflora in nonsterile soil was also significantly stimulated by inoculation, but the legume did not respond differently to the two endophytes under this condition.
Milk production response to feeding alfalfa silage inoculated with Lactobacillus plantarum
In mini-silo trials, silages treated with a Lactobacillus plantarum silage inoculant (Ecosyl, Yorkshire, UK) had increased in vitro rumen microbial biomass production compared to untreated. Our objective was to determine if alfalfa silage treated with this inoculant could produce a milk production r...
Albendazole inhibits Pneumocystis carinii proliferation in inoculated immunosuppressed mice.
Bartlett, M S; Edlind, T D; Lee, C H; Dean, R; Queener, S F; Shaw, M M; Smith, J W
1994-01-01
Albendazole, a benzimidazole derivative widely used for treating helminth infections, was successfully used to treat and prevent development of Pneumocystis carinii pneumonia in transtracheally inoculated immunosuppressed mice. For treatment, 3 weeks postinoculation, albendazole at 300 and 600 mg/kg of body weight per day was administered in food for 3 weeks. For prophylaxis, albendazole was begun on the same day as inoculation at 300 mg/kg/day for 7 days, and then the dose was reduced to 150...
Microbial Inoculants and Their Impact on Soil Microbial Communities: A Review
Directory of Open Access Journals (Sweden)
Darine Trabelsi
2013-01-01
Full Text Available The knowledge of the survival of inoculated fungal and bacterial strains in field and the effects of their release on the indigenous microbial communities has been of great interest since the practical use of selected natural or genetically modified microorganisms has been developed. Soil inoculation or seed bacterization may lead to changes in the structure of the indigenous microbial communities, which is important with regard to the safety of introduction of microbes into the environment. Many reports indicate that application of microbial inoculants can influence, at least temporarily, the resident microbial communities. However, the major concern remains regarding how the impact on taxonomic groups can be related to effects on functional capabilities of the soil microbial communities. These changes could be the result of direct effects resulting from trophic competitions and antagonistic/synergic interactions with the resident microbial populations, or indirect effects mediated by enhanced root growth and exudation. Combination of inoculants will not necessarily produce an additive or synergic effect, but rather a competitive process. The extent of the inoculation impact on the subsequent crops in relation to the buffering capacity of the plant-soil-biota is still not well documented and should be the focus of future research.
Directory of Open Access Journals (Sweden)
Nigel F Delaney
2012-02-01
Full Text Available Measureable rates of genome evolution are well documented in human pathogens but are less well understood in bacterial pathogens in the wild, particularly during and after host switches. Mycoplasma gallisepticum (MG is a pathogenic bacterium that has evolved predominantly in poultry and recently jumped to wild house finches (Carpodacus mexicanus, a common North American songbird. For the first time we characterize the genome and measure rates of genome evolution in House Finch isolates of MG, as well as in poultry outgroups. Using whole-genome sequences of 12 House Finch isolates across a 13-year serial sample and an additional four newly sequenced poultry strains, we estimate a nucleotide diversity in House Finch isolates of only ∼2% of ancestral poultry strains and a nucleotide substitution rate of 0.8-1.2×10(-5 per site per year both in poultry and in House Finches, an exceptionally fast rate rivaling some of the highest estimates reported thus far for bacteria. We also found high diversity and complete turnover of CRISPR arrays in poultry MG strains prior to the switch to the House Finch host, but after the invasion of House Finches there is progressive loss of CRISPR repeat diversity, and recruitment of novel CRISPR repeats ceases. Recent (2007 House Finch MG strains retain only ∼50% of the CRISPR repertoire founding (1994-95 strains and have lost the CRISPR-associated genes required for CRISPR function. Our results suggest that genome evolution in bacterial pathogens of wild birds can be extremely rapid and in this case is accompanied by apparent functional loss of CRISPRs.
Azolla filiculoides Nitrogenase Activity Decrease Induced by Inoculation with Chlamydomonas sp. †
Habte, Mitiku
1986-01-01
Experiments were conducted to determine the influence of Chlamydomonas sp. on nitrogen fixation (C2H2 → C2H4) in Azolla filiculoides and on the nitrogen fixation and growth of free-living Anabaena azollae 2B organisms. Inoculation of azolla medium with Chlamydomonas sp. was associated with decreased nitrogenase activity in A. filiculoides and with increases in the density of a fungal population identified as Acremonium sp. Subsequent inoculation of azolla medium with this fungus was also accompanied by a significant decrease in nitrogenase activity of A. filiculoides. However, the extent of depression of nitrogenase activity was significantly higher when azolla medium was inoculated with Chlamydomonas sp. than when it was inoculated with Acremonium sp. Inoculation of nitrogen-free Stanier medium with either Acremonium sp. or Chlamydomonas sp. did not adversely affect the growth or nitrogenase activity of free-living A. azollae. Decreased nitrogenase activity in A. filiculoides is apparently related to the adverse influence of the green alga and the fungus on the macrosymbiont. The mechanisms that might be involved are discussed. PMID:16347211
Inoculation with arbuscular mycorrhizal fungi improves the nutritional value of tomatoes.
Hart, Miranda; Ehret, David L; Krumbein, Angelika; Leung, Connie; Murch, Susan; Turi, Christina; Franken, Philipp
2015-07-01
Arbuscular mycorrhizal (AM) fungi can affect many different micronutrients and macronutrients in plants and also influence host volatile compound synthesis. Their effect on the edible portions of plants is less clear. Two separate studies were performed to investigate whether inoculation by AM fungi (Rhizophagus irregularis, Funneliformis mosseae, or both) can affect the food quality of tomato fruits, in particular common minerals, antioxidants, carotenoids, a suite of vitamins, and flavor compounds (sugars, titratable acids, volatile compounds). It was found that AM fungal inoculation increased the nutrient quality of tomato fruits for most nutrients except vitamins. Fruit mineral concentration increased with inoculation (particularly N, P, and Cu). Similarly, inoculated plants had fruit with higher antioxidant capacity and more carotenoids. Furthermore, five volatile compounds were significantly higher in AM plants compared with non-AM controls. Taken together, these results show that AM fungi represent a promising resource for improving both sustainable food production and human nutritional needs.
ORF Alignment: NC_004829 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ma gallisepticum R] ref|NP_853289.1| Hit-like ... [Mycoplasma gallisepticum R] ... Length = 131 ... Query: 15 ... NCVFCKIINNE...IQAHVVAQNDLAIAFLDAFPVSNGHTLVIPKKHHQDFSRTPKEEMHAVT 74 ... NCVFCKIINNEIQAHVVAQ...NDLAIAFLDAFPVSNGHTLVIPKKHHQDFSRTPKEEMHAVT Sbjct: 1 ... NCVFCKIINNEIQAHVVAQNDLAIAFLD
International Nuclear Information System (INIS)
Zhu, R.; Tang, F.; Liu, F.; Chen, J.
2016-01-01
The study was to investigate the effects of combined inoculation of Glomus mosseae (arbusculr mycorrhizae fungi, AMF) and Sinorhizobium meliloti (nitrogen-fixing bacteria, i.e., an Rhizobium meliloti, RM) on yield, nutrient contents, nodulation and mycorrhizal colonization of different alfalfa cultivars under saline conditions. An experiment was conducted to test the efficacy of AMF and RM inoculation in development of salt tolerance in alfalfa cultivars (Zhaodong, Nongjing and Longmu) under different salinity levels (0, 60, 120 and 180 mM NaCl). We found that under non stress condition, double inoculation of alfalfa with rhizobium and AM increased the alfalfa yield, nodule weight and number, as well as shoot proline contents, the most when plants were double inoculated followed by AM and rhizobium inoculation, respectively. Whereas under salinity condition, double inoculation of alfalfa with rhizobium and AM increased alfalfa yield, mycorrhizal infection, nodule weight and number as well as increased in shoot proline content, the most followed by AM and rhizobium inoculation, respectively. The Results suggest that growth of alfalfa may be improved by combined inoculation of alfalfa with AM and rhizobium under salt and non-stress conditions. Alleviation of alfalfa growth under saline condition was perhaps due to an increase in mycorrhizal infection and nodule weight and number as well as an increased in shoot proline content by dual inoculation. (author)
Co-inoculation effects of Bradyrhizobium japonicum and ...
African Journals Online (AJOL)
Corporate Edition
2013-05-15
. 2851. MATERIALS AND METHODS. Bacterial strains, media and growth conditions. Two B. japonicum strains of CB 1809 and USDA 110 those currently used in rhizobial inoculants production for soybean at the. Department ...
[Nursing activities in family medicine groups for patients with chronic pain].
Bergeron, Dave A; Bourgault, Patricia; Gallagher, Frances
2015-01-01
Thousands of people treated in primary care are currently experiencing chronic pain (CP), for which management is often inadequate. In Quebec, nurses in family medicine groups (FMGs) play a key role in the management of chronic health problems. The present study aimed to describe the activities performed by FMG nurses in relation to CP management and to describe barriers to those activities. A descriptive correlational cross-sectional postal survey was used. The accessible population includes FMG nurses on the Ordre des infirmières et infirmiers du Québec list. All nurses on the list who provided consent to be contacted at home for research purposes were contacted. A self-administered postal questionnaire (Pain Management Activities Questionnaire) was completed by 53 FMG nurses. Three activities most often performed by nurses were to establish a therapeutic relationship with the client; discuss the effectiveness of therapeutic measures with the physician; and conduct personalized teaching for the patient. The average number of individuals seen by interviewed nurses that they believe suffer from CP was 2.68 per week. The lack of knowledge of possible interventions in pain management (71.7%) and the nonavailability of information on pain management (52.8%) are the main barriers perceived by FMG nurses. FMG nurses are currently performing few activities in CP management. The nonrecognition of CP may explain this situation.
Pereira-Defilippi, L; Pereira, E M; Silva, F M; Moro, G V
2017-05-31
The relative quantitative real-time expression of two expressed sequence tags (ESTs) codifying for key enzymes in nitrogen metabolism in maize, nitrate reductase (ZmNR), and glutamine synthetase (ZmGln1-3) was performed for genotypes inoculated with Azospirillum brasilense. Two commercial single-cross hybrids (AG7098 and 2B707) and two experimental synthetic varieties (V2 and V4) were raised under controlled greenhouse conditions, in six treatment groups corresponding to different forms of inoculation and different levels of nitrogen application by top-dressing. The genotypes presented distinct responses to inoculation with A. brasilense. Increases in the expression of ZmNR were observed for the hybrids, while V4 only displayed a greater level of expression when the plants received nitrogenous fertilization by top-dressing and there was no inoculation. The expression of the ZmGln1-3EST was induced by A. brasilense in the hybrids and the variety V4. In contrast, the variety V2 did not respond to inoculation.
Quantitative Simulation of Damage Roots on Inoculated Alfalfa by Arbuscular Mycorrhiza Fungi
Directory of Open Access Journals (Sweden)
Ying Liu
2017-12-01
Full Text Available Underground mining would cause ground subsidence damage and large amounts of cracks, which would result a loss of surface moisture and nutrient and intensifying drought. There are a few reports about damage to plant roots caused by coal mining. The irregular distribution of plant roots in soil and the different forces generated in process of surface subsidence are difficult to study comprehensively. The technologies to repair damaged plant roots have not been completely perfected yet. Based on quantitative simulation of alfalfa root cut-repair experiment, this paper discusses the influences of inoculated Arbuscular Mycorrhiza Fungi on alfalfa root and the mitigation effects of an inoculation on the growth of alfalfa. Root injured alfalfa were investigated by soil pot experiments. The result indicated that at the same cut degree, the growth situation of inoculated alfalfa is better than the contrast. Compared with the Olsen-P content, at cut level of 0 and 1/3, the sand of inoculated alfalfa has less Olsen-P than contrast, at cut degree of 1/2 and 2/3, the sand of inoculated alfalfa has more Olsen-P than contrast, at degree of 3/4, the sand of inoculated alfalfa has less Olsen-P than contrast, the change trend of Olsen-P content is concerned with the relative strength size of absorb Olsen-P by alfalfa root and dissolve Olsen-P by root exudates and hyphae interstate.
Zhao, Yi; Zhao, Yue; Zhang, Zhechao; Wei, Yuquan; Wang, Huan; Lu, Qian; Li, Yanjie; Wei, Zimin
2017-10-01
The inoculum containing four cellulolytic thermophilic actinomycetes was screened from compost samples, and was inoculated into co-composting during different inoculation phases. The effect of different inoculation phases on cellulose degradation, humic substances formation and the relationship between inoculation and physical-chemical parameters was determined. The results revealed that inoculation at different phases of composting improved cellulase activities, accelerated the degradation of cellulose, increased the content of humic substances and influenced the structure of actinomycetic community, but there were significant differences between different inoculation phases. Redundancy analysis showed that the different inoculation phases had different impacts on the relationship between exogenous actinobacteria and physical-chemical parameters. Therefore, based on the promoting effort of inoculation in thermophilic phase of composting for the formation of humic substances, we suggested an optimized inoculation strategy to increase the content of humic substances, alleviate CO 2 emission during composting. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Tânia Maria Müller
2015-01-01
Full Text Available Nitrogen (N is the most limiting nutrient for corn production. Thereby, the goal of the paper was to evaluate inoculation methods of Azospirillum brasilense in order to partially supply N required by the crop. The experiment was carried out in Guarapuava, PR, Brasil, in 2011/2012 growing season. Randomized blocks with factorial 3 inoculation methods (seed treatment, planting furrow and non-inoculated control x 5 doses of nitrogen (0, 75, 150, 225 and 300kg ha-1 x 8 replications was used as the experimental design. Leaf are index, foliar nitrogen content, total chlorophyll, grains per ear and yield were evaluated. There was significant interaction between inoculation methods and nitrogen fertilization to leaf area index, but not for yield. Inoculation with the diazotrophic bacteria provided yield increase of 702kg ha-1 for inoculation in seeding furrow and 432kg ha-1 for inoculation in seed treatment compared to the control, but both treatments did not differ between each other. Furthermore, total chlorophyll, grains per ear and yield were positively affected, with quadratic response, by the nitrogen fertilization in broadcasting
Effect of water salinity on wheat inoculated with N fixing bacteria using 15N tracer technique
International Nuclear Information System (INIS)
Al-Sayed, M. A.; Soliman, S. M.; Galal, Y. G. M.; El-Hadidi, E. M.
2012-12-01
A pot experiment was carried out under greenhouse controlled conditions to investigate the effect of water salinity and bacterial inoculation on growth parameters and nutrient uptake by wheat ( Triticum aestivum, L. seda 6). Dry matter yield of shoots was gradually increased with increasing water salinity levels under dual inoculation (Rh + Az). This phenomenon was more pronounced with 6 ds m -1 rather than 3 ds m -1 water salinity level. This holds true with all inoculation treatments. Similar trend was noticed with root dry matter yield. N uptake by shoots was positively affected by water salinity levels under bacterial inoculation especially the dual treatments where N uptake tended to increase with increasing water salinity levels. N uptake by roots was severely affected by increasing water salinity levels as compared to fresh water treatment. N uptake by shoots was enhanced by inoculation under different water salinity levels as compared to the un inoculated treatment. Nitrogen uptake roots was dramatically affected by inoculation. It was only increased by inoculation when plants were irrigated with fresh water. Portions of Ndff were frequently affected by both water salinity levels and microbial inoculation. wheat plant as representative of cereal crops was more dependent on the portion of nitrogen up taken from fertilizer rather than those fixed from the air. Therefore, the plant-bacteria association was not efficient enough. Inoculated treatments compensated considerable amounts of its N demand from air beside those derived from fertilizer, therefore the remained N from fertilizer in soil was higher than those of un inoculated control which is more dependable on Ndff as well as Ndf s. 1 5N recovery by wheat plants was enhanced by bacterial inoculation as well as water salinity levels did. (Author)
Imran, Asma; Mirza, Muhammad S.; Shah, Tariq M.; Malik, Kauser A.; Hafeez, Fauzia Y.
2015-01-01
Pakistan is among top three chickpea producing countries but the crop is usually grown on marginal lands without irrigation and fertilizer application which significantly hampers its yield. Soil fertility and inoculation with beneficial rhizobacteria play a key role in nodulation and yield of legumes. Four kabuli and six desi chickpea genotypes were, therefore, evaluated for inoculation response with IAA-producing Ochrobactrum ciceri Ca-34T and nitrogen fixing Mesorhizobium ciceri TAL-1148 in single and co-inoculation in two soils. The soil type 1 was previously unplanted marginal soil having low organic matter, P and N contents compared to soil type 2 which was a fertile routinely legume-cultivated soil. The effect of soil fertility status was pronounced and fertile soil on average, produced 31% more nodules, 62% more biomass and 111% grain yield than marginal soil. Inoculation either with O. ciceri alone or its co-inoculation with M. ciceri produced on average higher nodules (42%), biomass (31%), grains yield (64%) and harvest index (72%) in both chickpea genotypes over non-inoculated controls in both soils. Soil 1 showed maximum relative effectiveness of Ca-34T inoculation for kabuli genotypes while soil 2 showed for desi genotypes except B8/02. Desi genotype B8/02 in soil type 1 and Pb-2008 in soil type 2 showed significant yield increase as compared to respective un-inoculated controls. Across bacterial inoculation treatments, grain yield was positively correlated to growth and yield contributing parameters (r = 0.294* to 0.838*** for desi and r = 0.388* to 0.857** for kabuli). PCA and CAT-PCA analyses clearly showed a site-specific response of genotype x bacterial inoculation. Furthermore, the inoculated bacterial strains were able to persist in the rhizosphere showing colonization on root and within nodules. Present study shows that plant growth promoting rhizobacteria (PGPR) inoculation should be integrated with national chickpea breading program in
Torii, Masato; Matsuda, Yosuke; Seo, Sang Tae; Kim, Kyung Hee; Ito, Shin-Ichiro; Moon, Myung Jin; Kim, Seong Hwan; Yamada, Toshihiro
2014-06-01
In Korea, mass mortality of Quercus mongolica trees has become obvious since 2004. Raffaelea quercus-mongolicae is believed to be a causal fungus contributing the mortality. To evaluate the pathogenicity of the fungus to the trees, the fungus was multiple- and single-inoculated to the seedlings and twigs of the mature trees, respectively. In both the inoculations, the fungus was reisolated from more than 50% of inoculated twigs and seedlings. In the single inoculations, proportions of the transverse area of non-conductive sapwood at inoculation points and vertical lengths of discoloration expanded from the points were significantly different between the inoculation treatment and the control. In the multiple inoculations, no mortality was confirmed among the seedlings examined. These results showed that R. quercus-mongolicae can colonize sapwood, contribute to sapwood discoloration and disrupt sap flows around inoculation sites of Q. mongolica, although the pathogenicity of the fungus was not proven.
( Rosa damascena Mill.) by microbial inoculation
African Journals Online (AJOL)
This study was carried out to determine the effects of microbial inoculation in breaking seed dormancy and on the germination of Rosa damascena Mill. Seeds of R. damascena Mill. are the most used scented rose species in rose oil production. The most important production centers around the world are Turkey and ...
Greenfield, Melinda; Gómez-Jiménez, María I.; Ortiz, Viviana; Vega, Fernando E.; Kramer, Matthew; Parsa, Soroush
2016-01-01
We investigated the fungal entomopathogens Beauveria bassiana and Metarhizium anisopliae to determine if endophytic colonization could be achieved in cassava. An inoculation method based on drenching the soil around cassava stem cuttings using conidial suspensions resulted in endophytic colonization of cassava roots by both entomopathogens, though neither was found in the leaves or stems of the treated cassava plants. Both fungal entomopathogens were detected more often in the proximal end of the root than in the distal end. Colonization levels of B. bassiana were higher when plants were sampled at 7–9 days post-inoculation (84%) compared to 47–49 days post-inoculation (40%). In contrast, the colonization levels of M. anisopliae remained constant from 7–9 days post-inoculation (80%) to 47–49 days post-inoculation (80%), which suggests M. anisopliae is better able to persist in the soil, or as an endophyte in cassava roots over time. Differences in colonization success and plant growth were found among the fungal entomopathogen treatments. PMID:27103778
Directory of Open Access Journals (Sweden)
Fisun Koc
2009-12-01
Full Text Available This study was carried out to determine the effects of actic acid bacterial inoculant on the fermentation and aerobic stability of sunflower silages. Sunflower was harvested at the milk stage. Inoculant-1174 (Pioneer®,USA was used as homofermentative lactic acid bacterial inoculant. Inoculant was applied 6.00 log10 cfu/g silage levels. Silages with no additive served as controls. After treatment, the chopped sunflower was ensiled in the PVC type laboratory silos. Three silos for each group were sampled for chemical and microbiological analysis on days 2, 4, 7, 14, 21, 28 and 56 after ensiling. At the end of the ensiling period, all silages were subjected to an aerobic stability test for 14 days. Neither inoculant improved the fermentation parameters of sunflower silages. At the end of the ensiling period, inoculant increased lactic acid bacteria (LAB and decreased yeast and mould numbers of silages. Inoculant treatment did not affect aerobic stability of silages.
EFFECT OF MYCORRHIZAL INOCULANTS IN THE DEVELOPMENT OF MEXICAN LANDRACE AVOCADO ROOTSTOCKS
Directory of Open Access Journals (Sweden)
Edgar Castro Alvarado
2013-12-01
Full Text Available The aim of this work was to assess the effect of two arbuscular mycorrhizal fungi (AMF inoculants in the development of avocado rootstocks. Seeds of Mexican landrace avocado (Persea americana Mill. var. drymifolia were used, with two commercial inoculants: T1 containing Glomus fasciculatum, G. constrictum, G. tortuosum, G. geosporum,and Acaulospora scrobiculata, and T2, containing G. mosseae and G. cubense. The plants inoculated with AMF showed more rapid growth than the no inoculant control as measured by plant height (50% and 54%, stem diameter (35% and 36%, leaf number (48% and 37% and length (31% and 40%, and root fresh weight (85% and 59%; however, no significant differences were observed between T1 and T2. The chlorophyll concentration in the leaves from T1 was 16.4% and T2 was 19% higher than the control suggesting a higher photosynthetic capacity in T1 and T2. Finally the shoot/root ratio, as indicator of the potential development of plantations, was 79% and 50% higher in mycorrhizal plants than in the control. In conclusion both T1 and T2 inoculants improved growth rate and vigor of avocado nursery rootstocks producing higher quality plants.
Jackson, Ben; Compton, Josh; Whiddett, Ryan; Anthony, David R.; Dimmock, James A.
2015-01-01
Although inoculation messages have been shown to be effective for inducing resistance to counter-attitudinal attacks, researchers have devoted relatively little attention toward studying the way in which inoculation theory principles might support challenges to psychological phenomena other than attitudes (e.g., self-efficacy). Prior to completing a physical (i.e., balance) task, undergraduates (N = 127, Mage = 19.20, SD = 2.16) were randomly assigned to receive either a control or inoculation message, and reported their confidence in their ability regarding the upcoming task. During the task, a confederate provided standardized negative feedback to all participants regarding their performance, and following the completion of the task, participants again reported their self-efficacy along with measures assessing in-task processes. Findings supported the viability of efficacy inoculation; controlling for pre-task self-efficacy, task performance, and relevant psycho-social variables (e.g., resilience, self-confidence robustness), participants in the inoculation condition reported greater confidence in their ability (i.e., task self-efficacy) than those in the control condition at post-task. Relative to those in the inoculation condition, participants in the control condition also experienced greater concentration disruption and self-presentation concerns during the task. PMID:25898287
Directory of Open Access Journals (Sweden)
Ladan Bayat
2014-01-01
Full Text Available Introduction: Plant growth stimulating rhizobacteria are beneficial bacteria that can cause resistance to various stresses in plants. One of these stresses is SO2 air pollution. SO2 is known as a strong damaging air pollutant that limits growth of plants. The aim of this study is evaluation of the effects of bacterial inoculation with native and standard Rhizobium on Persian clover root growth and antioxidants activity and capacity under air SO2 pollution. Materials and methods: In this study, 31 days plants (no-inoculated and inoculated with two strains of Rhizobium exposed to the different concentrations of SO2 (0 as a control, 0.5, 1, 1.5 and 2 ppm for 5 consecutive days and 2 hours per day. Results: Results showed different concentrations of SO2 had a significant effect on Persian clover root weight and antioxidant system. Increasing SO2 stress decreased root fresh and dry weight and antioxidant capacities (IC50 and increased antioxidant activities (I% of Persian clover leaves significantly in comparison to the control plants (under 0 ppm and increased SOD, CAT and GPX activity. Inoculation of Persian clover plants with native and standard Rhizobium increased root weight and did not show a significant effect on antioxidants activity and capacity, but interaction between Rhizobium inoculation and SO2 treatment reduced significantly the stress effects of high concentration of SO2 on root growth and antioxidants activity and capacity. In fact, level of this change of root growth and antioxidant system under SO2 pollution stress in inoculated plants was lower than in the non-inoculated plants. Discussion and conclusion: As a result, an increase in SO2 concentration caused a decrease in root weight, increase in antioxidants activity and capacity of Persian clover. Inoculation with Rhizobium strains could alleviate the effect of SO2 pollution on antioxidant system by effects on root growth.
Development and nitrate reductase activity of sugarcane inoculated with five diazotrophic strains.
Dos Santos, Silvana Gomes; da Silva Ribeiro, Flaviane; da Fonseca, Camila Sousa; Pereira, Willian; Santos, Leandro Azevedo; Reis, Veronica Massena
2017-08-01
Diazotrophs are able to stimulate plant growth. This study aimed at evaluating the effect of inoculation of five diazotrophic strains on growth promotion and nitrate reductase (NR, EC 1.7.1.1) activity in sugarcane. An experiment was carried out from three stages of cultivation: sprouting, tubes, and in hydroponics. On the first two stages, seven treatments were adopted: uninoculated control; mixed inoculation with five strains; and individual inoculation with Gluconacetobacter diazotrophicus (Gd), Herbaspirillum rubrisubalbicans (Hr), Herbaspirillum seropedicae (Hs), Nitrospirillum amazonense (Na), and Paraburkholderia tropica (Pt). The four treatments showing the best performance were transferred to the hydroponic system for analysis of NR activity. Hs, Pt, and the mixture of all strains led to the highest seedling biomass in tubes, followed by Hr. In hydroponics, the mixture and the strain Hr had the highest growth-promoting effect. NR activity was influenced by inoculation only under low N supply conditions, with positive effect of Hr, Pt, and the mixture.
Directory of Open Access Journals (Sweden)
CESAR VENTURA
2012-09-01
Full Text Available Los micoplasmas son importantes patógenos en las aves por ser responsables de cuadros respiratorios que ocasionan grandes pérdidas económicas a la industria avícola a nivel mundial. Existen principalmente dos especies de micoplasmas como causantes de enfermedad en aves comerciales, el Mycoplasma gallisepticum (MG y el Mycoplasma synoviae (MS. Teniendo en cuenta su importancia y la necesidad de conocer y diferenciar la presencia de las diferentes especies de micoplasmas presentes en las explotaciones avícolas, se tomaron 91 muestras de hisopos traqueales de aves con síntomas respiratorios, provenientes de igual número de granjas de pollo de engorde, ponedoras comerciales y reproductoras pesadas ubicadas en los departamentos de Cundinamarca y Boyacá y se determinó la presencia de MG y MS por la técnica de PCR. La prevalencia determinada fue de 39,6% para MG y 47,3% para MS, encontrándose diferencias estadísticamente significativas cuando se comparó la positividad a MG y MS y el tipo de explotación (p
International Nuclear Information System (INIS)
Janat, M.; Kurdali, F.
2008-01-01
Soybean in naturally N 2 -fixing legume, but it needs artificial inoculation with appropriate strains of rhizobia when introduced to land not previously cultivated to the crop. As soybean is being introduced to Syria, inoculation with Bradyrhizobium japonicum is essential to ensure effective biological nitrogen fixation by the crop. The question is: what is the most effective mean of inoculation?. As Syria is a water-short country, we examined the possibility of applying the rhizobial inoculant in irrigation system (Biofertigation) in contrast with the conventional seed pelleting application. In a 2 year experiment at a research station near Damascus, we compared seed pelleting of the inoculant under furrow and drip irrigation, with repeated inoculation by injection of a liquid culture rhizobial inoculum through the drip system. Drip irrigation enhanced N 2 fixation by soybean regardless of inoculation technique ad repeated inoculation. Injection of the liquid rhizobial inoculum through drip irrigation system was shown to enhances the acquisition of atmospheric N 2 and improve N 2 fixation by soybean.(author)
DEVELOPMENT OF PIGEON PEA INOCULATED WITH RHIZOBIUM ISOLATED FROM COWPEA TRAP HOST PLANTS
Directory of Open Access Journals (Sweden)
SALOMÃO LIMA GUIMARÃES
2016-01-01
Full Text Available Pigeon pea is an important protein source grown in several tropical and sub - tropical countries, and is considered a multi - purpose plant that is resistant to the conditions of the Brazilian Cerrado. Among the possible uses for cowpea, its use as a green manure, increasing soil nitrogen content through the association with diazotrophic bacteria, generically known as rhizobia, is noteworthy. The present work aimed to evaluate the efficiency of Rhizobium strains isolated from cowpea plants in the development of pigeon peas cultured in Red Latosol. The experiment was conducted in a greenhouse, using a completely randomized design with seven treatments and four replications. Treatments consisted of inoculation with four Rhizobium strains (MT8, MT15, MT16, and MT23 and one commercial inoculant comprising Bradyrhizobium spp. strains BR 2801 and BR 2003. There were two controls, one absolute (without inoculation or nitrogen fertilization and the other with nitrogen fertilization. Each experimental plot consisted of an 8 - dm 3 vase containing three plants. Analyzed variables included plant height, SPAD index, number and dry weight of nodules, and shoot and root dry masses. Pigeon peas responded significantly to inoculation treatment, since all the plants inoculated with Rhizobium strains isolated from cowpea strains showed results similar to plants in the nitrogen control and commercial inoculant treatments. This demonstrates a favorable plant – bacteria interaction, which can be utilized as an alternative nitrogen source for pigeon peas.
Zhu, Xuezhu; Wang, Wanqing; Sun, Kai; Lin, Xianghao; Li, Shuang; Waigi, Michael Gatheru; Ling, Wanting
2017-08-03
This research was conducted to find an optimal inoculation way for a pyrene-degrading endophytic Serratia sp. PW7 to colonize wheat for reducing pyrene contamination. Three inoculation ways, which are soaking seeds in inocula (TS), dipping roots of seedlings in inocula (TR), and spraying inocula on leaves of seedlings (TL), were used in this study. Inoculated seedlings and noninoculated seedlings (CK) were, respectively, cultivated in Hoagland solutions supplemented with pyrene in a growth chamber. The results showed that strain PW7 successfully colonized the inoculated seedlings in high numbers, and significantly promoted the growth of seedlings (TS and TR). More importantly, strain PW7 reduced pyrene levels in the seedlings and the Hoagland solutions. Compared to the noninoculated seedlings, the pyrene contents of the inoculated seedlings were decreased by 35.7-86.3% in the shoots and by 26.8-60.1% in the roots after 8-day cultivation. By comparing the efficiencies of decreasing pyrene residues, it can be concluded that TR was an optimal inoculation way for endophytic strains to colonize the inoculated plants and to reduce the pyrene contamination. Our findings provide an optimized inoculation way to reduce organic contamination in crops by inoculating plants with functional endophytic bacteria.
Wei, Yuquan; Zhao, Yue; Fan, Yuying; Lu, Qian; Li, Mingxiao; Wei, Qingbin; Zhao, Yi; Cao, Zhenyu; Wei, Zimin
2017-10-01
This study aimed to assess the effect of phosphate-solubilizing bacteria (PSB) application and inoculation methods on rock phosphate (RP) solubilization and bacterial community during composting. The results showed that PSB inoculation in different stages of composting, especially both in the beginning and cooling stages, not only improved the diversity and abundance of PSB and bacterial community, but also distinctly increased the content of potential available phosphorus. Redundancy analysis indicated that the combined inoculation of PSB in the initial stage with higher inoculation amount and in the cooling stage with lower inoculation amount was the best way to improve the inoculation effect and increase the solubilization and utilization of RP during composting. Besides, we suggested three methods to improve phosphorus transformation and long-term utilization efficiency in composts based on biological fixation of phosphates by humic substance and phosphate-accumulating organisms. Copyright © 2017 Elsevier Ltd. All rights reserved.
EST Table: FS803374 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS803374 E_FL_fmgV_12D12_F_0 10/09/28 45 %/149 aa ref|XP_973163.1| PREDICTED: similar to jump...46 %/150 aa gnl|Amel|GB14856-PA 10/09/10 45 %/149 aa gi|91086783|ref|XP_973163.1| PREDICTED: similar to jumping translocation breakpoint protein [Tribolium castaneum] FS906679 fmgV ...
EST Table: FS822360 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS822360 E_FL_fmgV_12D12_R_0 10/09/28 46 %/153 aa ref|XP_973163.1| PREDICTED: similar to jump...46 %/151 aa gnl|Amel|GB14856-PA 10/09/10 46 %/153 aa gi|91086783|ref|XP_973163.1| PREDICTED: similar to jumping translocation breakpoint protein [Tribolium castaneum] FS891321 fmgV ...
EST Table: FS809383 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS809383 E_FL_fmgV_28P15_F_0 10/09/28 91 %/173 aa ref|NP_001036831.1| saposin-relat...29 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 39 %/158 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 fmgV ...
EST Table: FS828361 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS828361 E_FL_fmgV_28P15_R_0 10/09/28 92 %/173 aa ref|NP_001036831.1| saposin-relat...29 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 39 %/158 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS895586 fmgV ...
Directory of Open Access Journals (Sweden)
Matheus O Costa
Full Text Available "Brachyspira hampsonii" causes disease indistinguishable from swine dysentery, and the structure of the intestinal microbiome likely plays a role in determining susceptibility of individual pigs to infection and development of clinical disease. The objectives of the current study were to determine if the pre-inoculation fecal microbiota differed between inoculated pigs that did (INOC MH or did not (INOC non-MH develop mucohaemorrhagic diarrhea following challenge with "B. hampsonii", and to quantify changes in the structure of the microbiome following development of clinical disease. Fecal microbiota profiles were generated based on amplification and sequencing of the cpn60 universal target sequence from 89 samples from 18 pigs collected at -8, -5, -3 and 0 days post-inoculation, and at termination. No significant differences in richness, diversity or taxonomic composition distinguished the pre-inoculation microbiomes of INOC MH and INOC non-MH pigs. However, the development of bloody diarrhea in inoculated pigs was associated with perturbation of the microbiota relative to INOC non-MH or sham-inoculated control pigs. Specifically, the fecal microbiota of INOC MH pigs was less dense (fewer total 16S rRNA copies per gram of feces, and had a lower Bacteroidetes:Firmicutes ratio. Further investigation of the potential long-term effects of Brachyspira disease on intestinal health and performance is warranted.
SEED INOCULATION WITH Azospirillum brasilense, ASSOCIATED WITH THE USE OF BIOREGULATORS IN MAIZE
Directory of Open Access Journals (Sweden)
ALESSANDRO DE LUCCA E BRACCINI
2012-01-01
Full Text Available The inoculation of seeds with the bacterium Azospirillum has been carried out in maize culture and other grasses. The application of growth bio-regulators is another technology whose results in maize culture have yet to become more widespread. Current study evaluates the agronomic effectiveness of seed inoculation with Azospirillum brasilense in maize, associated with the use of the growth regulator Stimulate ®. Triple hybrid maize CD 304 underwent the following treatments: 1 - control without nitrogen and without Azospirillum brasilense; 2 - Treatment without nitrogen but with Azospirillum brasilense; 3 - Treatment without nitrogen but with Azospirillum brasilense + Stimulate ®; 4 - Treatment with 50% of nitrogen dose recommended for maize culture; 5 - Treatment with 50% of nitrogen dose and inoculation with Azospirillum brasilense; 6 - Same as 5 but with Stimulate ®; 7 - Total N recommended; 8 - Total N recommended + Azospirillum brasilense ; 9 - Total N recommended + Azospirillum brasilense + Stimulate ®. The inoculation of maize seeds with Azospirillum brasilense increases plant height and grain yield when compared with rates in control. The use of 50% of N dose in sowing, associated with the inoculation of maize seeds with Azospirillum brasilense at 200 mL ha-1 (mixed to the seeds and associated with Stimulate ® (in foliar application, is viable.
Plant yield and nitrogen content of a digitgrass in response to azospirillum inoculation
Energy Technology Data Exchange (ETDEWEB)
Schank, S.C.; Weier, K.L.; MacRae, I.C.
1981-02-01
Two Australian soils, a vertisol (pH 6.8, 0.299% N) and a sandy yellow podzol (pH 6.2, 0.042% N), were used with digitgrass, Digitaria sp. X46-2 (PI 421785), in a growth room experiment. Comparisons were made between plants inoculated with live and autoclaved bacterial suspensions of Australian and Brazilian isolates of Azospirillum brasilense. Seedlings were inoculated on days 10 and 35. Acetylene-reducing activity was measured five times during the experiment. Dry matter yields of the digitgrass on the podzol (low N) inoculated with liver bacteria were 23% higher than those of the controls. On the vertisol (high N), yield increases from inoculation with live bacteria were 8.5%. The higher-yielding plants had significantly lower precent nitrogen, but when total nitrogen of the tops was calculated, the inoculated plants had a higher total N than did the controls (P = 0.04). Acetylene-reducing activity was variable in the experiment, ranging from 0.5 to 11.9 mu mol of C2H2 core -1 day -1. Live bacterial treatment induced a proliferation of roots, possible earlier maturity, higher percent dry matter, and a higher total N in the tops. (Refs. 21).
Immunity to infection with porcine parvovirus in pigs inoculated with the attenuated HT- strain.
Fujisaki, Y; Murakami, Y
1982-01-01
Swine were inoculated once with the attenuated HT- strain of porcine parvovirus. Several months later they were challenged by oral inoculation with a field strain of the virus to examine an ability to prevent infection. After challenge inoculation unimmunized control swine exhibited an increase in antibody titer, viremia, and virus discharge. The virus was recovered from many organs. The swine preinoculated with the attenuated HT- strain, however, manifested none of these symptoms and were negative for virus recovery from any organ.
Inoculation of maize with Azospirillum brasilense in the seed furrow
Directory of Open Access Journals (Sweden)
Tâmara Prado de Morais
2016-06-01
Full Text Available ABSTRACT Several studies addressing the inoculation of cereals with diazotrophic microorganisms can be found in the literature. However, in many experiments, investigators have overlooked the feasibility of applying these microorganisms to the furrow together with the seed, and the effect of bacterial concentration on phytostimulation. The aim of this work was to evaluate the effect of doses of an inoculant based on Azospirillum brasilense, applied to the seed furrow when planting maize, combined with different doses of nitrogen fertiliser. The experiment was carried out in the field, in soil of the cerrado region of Brazil. An experimental design of randomised blocks in bands was adopted, comprising nitrogen (40, 100, 200 and 300 kg ha-1 and doses of an A. brasilense-based liquid inoculant applied to the seed furrow (0, 100, 200, 300 and 400 mL ha-1. The dose of 200 mL ha-1Azospirillum was noteworthy for grain production. This is the first report of the effective application of Azospirillum in the seed furrow when planting maize in the cerrado region of Brazil.
Effects of bacterial inoculation on the fermentation characteristics ...
African Journals Online (AJOL)
DNkosi
2016-05-11
May 11, 2016 ... The chopped forages were treated with or without the bacterial .... packed loosely in an open plastic jar, which was covered with two ..... be because LD inoculant contains enzymes that may be capable of degrading fibre.
WANDREILLA MOREIRA GARCIA; WILLIAN KRAUSE; DEJÂNIA VIEIRA DE ARAÚJO; ISANE VERA KARSBURG; RIVANILDO DALLACORT
2017-01-01
The objective of this work was to evaluate Fusarium guttiforme inoculation methods and genetic resistance of pineapple accessions. Thus, three experiments were conducted: pathogen inoculation of different leaf types ( B, D and F ) of pineapple (1), pathogen inoculation of pineapple cuttings and detached D leaves (2), and identification of resistance to fusariosis in 19 pineapple accessions (3) sampled in the State of Mato Grosso, Brazil. The cultivars Pérola (susceptible...
Carroll, Timothy; Lo, Ming; Lanteri, Marion; Dutra, Joseph; Zarbock, Katie; Silveira, Paola; Rourke, Tracy; Ma, Zhong-Min; Fritts, Linda; O'Connor, Shelby; Busch, Michael; Miller, Christopher J
2017-07-01
Zika virus (ZIKV) is a mosquito-transmitted virus that can cause severe defects in an infected fetus. ZIKV is also transmitted by sexual contact, although the relative importance of sexual transmission is unclear. To better understand the role of sexual transmission in ZIKV pathogenesis, a nonhuman primate (NHP) model of vaginal transmission was developed. ZIKV was readily transmitted to mature cycling female rhesus macaque (RM) by vaginal inoculation with 104-106 plaque-forming units (PFU). However, there was variability in susceptibility between the individual RM with 1->8 vaginal inoculations required to establish infection. After treatment with Depoprovera, a widely used contraceptive progestin, two RM that initially resisted 8 vaginal ZIKV inoculations became infected after one ZIKV inoculation. Thus, Depoprovera seemed to enhance susceptibility to vaginal ZIKV transmission. Unexpectedly, the kinetics of virus replication and dissemination after intravaginal ZIKV inoculation were markedly different from RM infected with ZIKV by subcutaneous (SQ) virus inoculation. Several groups have reported that after SQ ZIKV inoculation vRNA is rapidly detected in blood plasma with vRNA less common in urine and saliva and only rarely detected in female reproductive tract (FRT) secretions. In contrast, in vaginally inoculated RM, plasma vRNA is delayed for several days and ZIKV replication in, and vRNA shedding from, the FRT was found in all 6 animals. Further, after intravaginal transmission ZIKV RNA shedding from FRT secretions was detected before or simultaneously with plasma vRNA, and persisted for at least as long. Thus, ZIKV replication in the FRT was independent of, and often preceded virus replication in the tissues contributing to plasma vRNA. These results support the conclusion that ZIKV preferentially replicates in the FRT after vaginal transmission, but not after SQ transmission, and raise the possibility that there is enhanced fetal infection and pathology
Spatial reversal learning in preclinical scrapie-inoculated mice.
Lysons, A M; Woollard, S J
1996-04-10
Acquisition and reversal of a two-choice spatial discrimination were tested in scrapie-inoculated mice. Both acquisition and reversal were normal in mice tested 138 and 103 days prior to the onset of clinical symptoms. At 65 days before onset of clinical symptoms, scrapie-inoculated mice required more trails to criterion in reversal learning, but this effect was not significant in a second experiment (68 days preclinical) and was transient: no effect was seen 33 days before symptoms. However, the course of reversal learning was abnormal in all three late preclinical groups (68, 65 and 33 days before symptoms). Reversal learning in these three groups was characterized by a rapid extinction of the original discrimination, followed by a period, absent in controls, during which performance showed no further improvement. This effect corresponds in time of onset to the appearance of characteristic neuropathological features.
Enhancement of Cotton Stalks Composting with Certain Microbial Inoculations
Directory of Open Access Journals (Sweden)
Osama Abdel-Twab Seoudi
2013-01-01
Full Text Available Effect of inoculation with Phanerochaete chrysosporium and Azotobacter chrococcum microbes on cotton stalks composting was studied in an attempt to achieve rapid maturity and desirable characteristics of produced compost. Composting process was maintained for 16 weeks under aerobic conditions with proper moisture content and turning piles. The C/N ratio of the mixtures was adjusted to about 30:1 before composting using chicken manure. Temperature evolution and its profile were monitored throughout the composting period. Mineralization rates of organic matter and changes in nitrogen content during composting stages were evaluated. Total plate count of mesophilic and thermophilic bacteria, cellulose decomposers and Azotobacter were determined during composting periods. The treatment of cotton stalks inoculated with both P. chrysosporium and Azotobacter gave the most desirable characteristics of the final product with respect to the narrow C/N ratio, high nitrogen content and high numbers of Azotobacter. The phytotoxicity test of compost extracts was evaluated. The use of P. chrysosporium in composting accelerated markedly decomposition process, so that 16 weeks composting enough to produce a stable and mature compost suitable for use as fertilizer while the fertilizer obtained by composting cotton stalks mixed with chicken manure and inoculated with microorganisms is highest quality Compost.
International Nuclear Information System (INIS)
Yaseen, T.; Ali, K.
2016-01-01
Effective inoculation of legumes has the ability not only to ensure nutrients availability to plants particularly in N and P-limiting (due to improvement in nutrients fixation) environments but also can manipulate the environmental hazards associated with over inorganic fertilization. To support this view, the current experiment was conducted to study the influence of rock phosphorus fertilization, Arbuscular Mycorrhizae (AM) and Rhizobium inoculation on growth and yield parameters of Lens culinaris (NARC.2008-4). In addition, the current experiments aimed to evaluate the effect of different inoculation practices on crop quality in comparison with control (no inoculation).The experiment was laid out in randomized complete block design with four replications during winter (2010-11 and 2012-13) at the Department of Botany University of Peshawar Pakistan. Overall, inoculated plant performed superior in terms of plant growth and quality over control. All plants measured parameters (Leaf chlorophyll content, seed protein, fiber and ash content, plant height, number of seed pod-1, leaves plant-1, flowers plant-1, pods plant-1, pod length and thousand seed weight) were highest in plant samples inoculated with VAM and Rhizobium in combination as compared to sole application of VAM or Rhizobium. Combined inoculation of VAM and Rhizobium caused 10, 24, 17, 21 and 14% increase in seed protein content, leaf chlorophyll content, seed fiber content, seed ash content and number of seed pod-1 over sole application of VAM and Rhizobium when averaged over two years. Combined application of Rhizobium + VAM enhanced seed yield plant-1 by 45% over control and 24% and 28% over sole inoculation of VAM and Rhizobium respectively. It is therefore concluded that dual inoculation of VAM + Rhizobium and rock phosphate may be of only limited consequence in high input agricultural systems. (author)
Holmes, R A; Klei, T R; McClure, J R; Turk, M A; Watters, J W; Chapman, M R
1990-04-01
Semiselective mesenteric arteriography was performed at regular intervals (inoculation weeks [IW] 0, 11, 18, and 24) in 9 of 10 pony foals raised to be free of parasites. Fifty infective larvae (L3) of Strongylus vulgaris were administered weekly for 4 weeks, then every 2 weeks through the 20th week. Three ponies were given ivermectin (oral paste, 0.2 mg/kg of body weight) treatment at IW 8, 16 and 24. Four ponies were inoculated, but did not receive ivermectin, and a third group of 2 ponies acted as uninoculated controls. Control ponies did not have gross or arteriographic lesions, whereas the inoculated untreated ponies had gross and progressive arteriographic lesions typical of verminous arteritis. Arteriographic lesions in the ivermectin-treated inoculated ponies were not as severe those in the untreated inoculated group, and there was either a partial resolution or a lack of progression of arteriographic lesions in all treated ponies. One untreated inoculated pony did not have progressive arterial lesions as did the 3 others in the group, and may develop resistance to the parasite.
Adoption of Calliandra calothyrsus for fodder and it's Inoculation Potential on Farms in Kenya
International Nuclear Information System (INIS)
Kiptot, E; Wanjiku, J; Obonyo, E; Odee, D.W
2007-01-01
In Kenya, productivity of dairy animals is mostly limited by inadequate nutrition especially proteins. To improve feed quality, the use of fodder trees is a preferred option. One of the most widely used fodder tree is calliandra calothyrsus (calliandra) whose productivity can be improved through rhizobia inoculation. A study was initiated to assess farmers' management practices and utilization of calliandra as well as to elicit their knowledge on it's inoculation. Survey sites were identified were identified in areas where calliandra had been previously introduced in central and western regions of Kenya. Results indicated that, for the first establishment of calliandra trees (NGOs) 68.3% of the farmers acquired seedlings from research institutions as well as Non-Governmental Organizations (NGOs) working within the research area. During subsequent establishments, reported only in central region a reverse trend was observed with 73% of farmers acquiring seedlings from private and individual nurseries. A majority of farmers (56%) planted calliandra on contours and 78% used it for fodder, while 22% had no knowledge of food potential. About 41% of farmers from central region had planted inoculated seedlings and only 1.6% from the western region had inoculants. Though the inoculant had been provided free, 47% of the farmers were willing to purchase it if made available. In central region calliandra was highly utilized for dairy animals consequently motivating farmers to expand planting. Contour planting was preferred niche due to the perceived low competition with associate crops for space and growth parameters. The study concluded that though calliandra was accepted as a fodder tree, a knowledge gap existed on farms on the role of rhizobia inoculation in productivity. There is therefore an urgent need to sensitize on the benefits of inoculation
Directory of Open Access Journals (Sweden)
B.C. Pedreira
Full Text Available ABSTRACT The objective of this study is to verify the population density and the dynamics of tillering in the Marandu palisade grass sward subjected to nitrogen (N fertilization strategies, characterized by the N supply via urea or bacterial inoculant (Azospirillum brasilense. The treatments comprised of four nitrogen fertilization strategies: (A Without fertilization, (B 80 kg N/ha, (C inoculant (A. brasilense, and (D 80 kg N/ha + inoculant, distributed in a randomized complete block design, with three replications. The nitrogen supply strategies were evaluated during six periods: October, November, and December (2012 as well as January, March, and April (2013. The nitrogen dose or inoculant had no effect on the tiller appearance rate (TAR, tiller mortality rate (TMR, tiller survival rate (TSR, or tiller population density (TPD. However, these variables were influenced by the season. The TAR and TSR were higher at the beginning of the experimental period (October and lower towards the end of the period (March-April, whereas, TMR and TPD exhibited the opposite behavior, with lower values in October and higher from January onward. Neither the nitrogen nor the inoculant influenced the population dynamics of the tillers in Marandu palisade grass.
Directory of Open Access Journals (Sweden)
Leonardo Sulas
2017-12-01
Full Text Available To assess the feasibility of the sulla [Sulla coronaria (L. Medik] forage legume in a new agroecosystem, its host-specific symbiotic interaction needs to be taken into account. This study aimed to investigate the effects of inoculation and nitrogen (N fertiliser on productive performances and N-fixation ability of sulla established in a new habitat within a Mediterranean agropastoral area. Sulla plants, previously inoculated (with peat-based, liquid inoculants, and using soil from an existing sulla field and unfertilised or N fertilised were evaluated in Sardinia (Italy. During 2013-2014, sulla plants were sampled at four growing stages, from vegetative stage to seed set, and shoot length, shoot dry matter (DM yield and N content were monitored. Moreover, atom% 15N isotopic excess, proportion of N derived from the atmosphere and fixed N of sulla shoots were quantified. Inoculation and N fertilisation both affected growth, DM and N yields, and N-fixation of sulla. Compared to the best inoculated treatment, the DM yield and fixed N of the control only represented 10 to 22% and 2 to 11%, respectively. Nitrogen fertilisation caused temporary decreases in the N fixing ability of sulla. Results pointed out that rhizobial inoculation is essential for the exploitation of sulla outside its traditional cropping area.
Directory of Open Access Journals (Sweden)
WANDREILLA MOREIRA GARCIA
2017-01-01
Full Text Available The objective of this work was to evaluate Fusarium guttiforme inoculation methods and genetic resistance of pineapple accessions. Thus, three experiments were conducted: pathogen inoculation of different leaf types ( B, D and F of pineapple (1, pathogen inoculation of pineapple cuttings and detached D leaves (2, and identification of resistance to fusariosis in 19 pineapple accessions (3 sampled in the State of Mato Grosso, Brazil. The cultivars Pérola (susceptible to fusariosis and BRS - Vitória (resistant to fusariosis were used as controls. The fusariosis severity was evaluated at 10, 15, 20, 25 and 30 days after inoculation with F. guttiforme . The lesion diameters (severity level were used in order to calculate the area under the disease progress curve (AUDPC. The inoculation of detached D leaves was the most efficient, fast and inexpensive method, and the one that most satisfactorily reproduced the disease symptoms. The period of 10 to 20 days after inoculation of the D detached leaves with the pathogen is the most suitable to evaluate the resistance of pineapple accessions to fusariosis. The lowest lesion area and AUDPC was found in the accession 1, in all evaluations. Thus, the accession 1 can be used in pineapple breeding programs for resistance to fusariosis.
Directory of Open Access Journals (Sweden)
M.A. Ahangar
2012-11-01
Full Text Available Microbial inoculants (Trichoderma harzianum, Pseudomonas fluorescens,Laccaria laccata inoculated either individually or in combinationsignificantly improved the growth and biomass of blue pine seedlings. The ECM fungus Laccaria laccata, when inoculated individually, showed significantly higher plant growth, followed by Pseudomonas fluorescens and Trichoderma harzianum. The combined inoculation of rhizosphere microorganisms showed synergistic growth promoting action and proved superior in enhancing the growth of blue pine than individual inoculation. Co-inoculation of L. laccata with P. fluorescens resulted in higher ectomycorrhizal root colonization. Uptake of nutrients (N, P, K was significantly improved by microbial inoculants, tested individually or in combination. Combined inoculation of L. laccata with T. harzianum and P. fluorescens significantly increased in N, P and K contents in blue pine seedlings as compared to control. Acid phosphatase activity in the rhizosphere of blue pine seedlings was also enhanced by these microorganisms. L. laccata exhibited higher acid phosphatase activity followed by P. fluorescens.
Directory of Open Access Journals (Sweden)
Fernando S. Galindo
Full Text Available ABSTRACT Biological nitrogen fixation (BNF efficiency can be increased by co-inoculation with bradyrhizobia and Azospirillum brasilense, allowing even greater uptake of water and nutrients, leading to higher yields. Thus, this study aimed to evaluate the technical and economic viability of soybean in the Cerrado, according to the cultivars and co-inoculation with Azospirillum brasilense. The experiment was conducted in Selvíria, MS, in no-tillage system, in Oxisol, arranged in a randomized block design in a 2 x 2 factorial scheme with two cultivars (‘Potência’ and ‘Valiosa’, with and without co-inoculation with Azospirillum brasilense in the seed. Co-inoculation with A. brasilense increases grain yield in the cultivars ‘Potência’ and ‘Valiosa’, being economically viable. However, using the cultivar ‘Potência’ co-inoculated led to the highest profitability.
Coping With Pain: Studies in Stress Inoculation.
Horan, John J.; And Others
The stress-inoculation paradigm for helping clients deal with pain consists of education about the psychological dimensions of pain, training in a number of coping skills relevant to each dimension, and practice in applying these skills to the noxious stimulus. Presented are two studies, the first of which represents a component analysis of stress…
Direct eye drop vaccination of poultry using live Mycoplasma gallisepticum vaccines provides the most efficient route of vaccination. The research reported in this study examines the effect of diluent used to rehydrate lyophilized M. gallisepticum vaccines on its ability to induce a measurable humo...
Improvement of Faba Bean Yield Using Rhizobium/Agrobacterium Inoculant in Low-Fertility Sandy Soil
Directory of Open Access Journals (Sweden)
Sameh H. Youseif
2017-01-01
Full Text Available Soil fertility is one of the major limiting factors for crop’s productivity in Egypt and the world in general. Biological nitrogen fixation (BNF has a great importance as a non-polluting and a cost-effective way to improve soil fertility through supplying N to different agricultural systems. Faba bean (Vicia faba L. is one of the most efficient nitrogen-fixing legumes that can meet all of their N needs through BNF. Therefore, understanding the impact of rhizobial inoculation and contrasting soil rhizobia on nodulation and N2 fixation in faba bean is crucial to optimize the crop yield, particularly under low fertility soil conditions. This study investigated the symbiotic effectiveness of 17 Rhizobium/Agrobacterium strains previously isolated from different Egyptian governorates in improving the nodulation and N2 fixation in faba bean cv. Giza 843 under controlled greenhouse conditions. Five strains that had a high nitrogen-fixing capacity under greenhouse conditions were subsequently tested in field trials as faba bean inoculants at Ismaillia Governorate in northeast Egypt in comparison with the chemical N-fertilization treatment (96 kg N·ha−1. A starter N-dose (48 kg N·ha−1 was applied in combination with different Rhizobium inoculants. The field experiments were established at sites without a background of inoculation under low fertility sandy soil conditions over two successive winter growing seasons, 2012/2013 and 2013/2014. Under greenhouse conditions, inoculated plants produced significantly higher nodules dry weight, plant biomass, and shoot N-uptake than non-inoculated ones. In the first season (2012/2013, inoculation of field-grown faba bean showed significant improvements in seed yield (3.73–4.36 ton·ha−1 and seed N-yield (138–153 Kg N·ha−1, which were higher than the uninoculated control (48 kg N·ha−1 that produced 2.97 Kg·ha−1 and 95 kg N·ha−1, respectively. Similarly, in the second season (2013
Li, Y; Nishino, N
2011-04-01
To understand the effects of lactic acid bacteria (LAB) inoculation on fermentation products, aerobic stability and microbial communities of silage. Wilted Italian ryegrass was stored in laboratory silos with and without inoculation of Lactobacillus rhamnosus and Lactobacillus buchneri. The silos were opened after 14, 56 and 120 days and then subjected to aerobic deterioration for 7 days. Intensive alcoholic fermentation was found in untreated silage; the sum of ethanol and 2,3-butanediol content at day 14 was about 7 times higher than that of lactic and volatile fatty acids. Alcoholic fermentation was suppressed by L. rhamnosus and L. buchneri inoculation and lactic acid and acetic acid became the dominant fermentation products, respectively. Silages were deteriorated in untreated and L. rhamnosus-inoculated silages, whereas no spoilage was found in L. buchneri-inoculated silage. Enterobacteria such as Erwinia persicina, Pantoea agglomerans and Rahnella aquatilis were detected in untreated silage, whereas some of these bacteria disappeared or became faint with L. rhamnosus treatment. When silage was deteriorated, Lactobacillus brevis and Bacillus pumilus were observed in untreated and L. rhamnosus-inoculated communities, respectively. The inoculated LAB species was detectable in addition to untreated bacterial communities. Saccharomyces cerevisiae and Pichia anomala were the main fungi in untreated and L. rhamnosus-inoculated silages; however, P. anomala was not visibly seen in L. buchneri-inoculated silage either at silo opening or after exposure to air. Inoculation with L. rhamnosus can suppress alcoholic fermentation of wilted grass silage with elimination of enterobacteria at the beginning of fermentation. Addition of L. buchneri may improve aerobic stability, with distinct inhibitory effect observed on P. anomala after silo opening. Bacterial and fungal community analyses help us to understand how inoculated LAB can function to improve the fermentation and
Directory of Open Access Journals (Sweden)
Fernando Reimann Skonieski
Full Text Available ABSTRACT The objective of this study was to determine the effect of Azospirillum brasilense inoculation and different nitrogen (N rates applied as topdressing on the productivity of a maize crop and the nutritional value of maize silage. Two experiments were conducted in the 2012/2013 and 2013/2014 harvests. Treatments were distributed in a randomized block design in a factorial arrangement, which consisted of two maize hybrids (AS 1572 and Defender coupled with nitrogen rates (0, 60, 120, 240, and 480 kg ha-1, inoculated or uninoculated with A. brasilense. Inoculated seeds were treated with the A. brasilense strains Ab-V5 and Ab-V6. Inoculation with A. brasilense showed interaction with the hybrids, agricultural years, and nitrogen rates for the maize plant yield. In the 2012/2013 agricultural year, inoculation increased the AS 1572 hybrid silage yield by 6.16% and, in the 2013/2014 harvest, A. brasilense inoculation produced an increase of 16.15% for the Defender hybrid. Nitrogen fertilization applied at 0, 60, and 120 kg ha-1 N benefited the plants inoculated with A. brasilense. The statistical equations revealed that N rates between 0 and 184 kg ha-1 in A. brasilense inoculated plants raised the plant productivity for silage when compared with the control plants. Regarding the nutritional value of the silage, inoculation with A. brasilense increased the ether extract levels and total digestible nutrients and reduced the amount of acid detergent fiber. For all this, positive results with inoculation for silage yield are dependent on nitrogen fertilization rate. Inoculation with A. brasilense can promote changes in the maize silage quality, but with obtained results it is not possible to definitely conclude upon nutritive value of maize silage.
Directory of Open Access Journals (Sweden)
Seyed A Ghorashi
Full Text Available Pathogenicity and presentation of Mycoplasma gallisepticum (MG infection may differ from one strain to another and this may have implications on control measures. Infection of individual birds with more than one MG strain has been reported. A PCR followed by high resolution melt (HRM curve analysis has been developed in our laboratory and routinely used for detection and differentiation of MG strains. However the potential of this test for identification of MG strains in a mixed specimen has not been evaluated. In the present study, the capability of PCR-HRM curve analysis technique, targeting vlhA and pvpA genes was assessed for identification of individual MG strains in a mixed population. Different DNA ratios of two MG strains from 1 to 10(-4 ng were tested with some generated conventional and normalized curves distinct from those of individual strains alone. Using genotype confidence percentages (GCP generated from HRM curve analysis, it was found that vlhA PCR-HRM was more consistent than pvpA PCR-HRM for the detection of MG ts-11 vaccine strain mixed with any of the MG strains 6/85, F, S6 or a field isolate. The potential of vlhA PCR-HRM to detect mixed MG strains in a specimen was found to be primarily dependent on quantity and proportion of the target DNAs in the mixture. This is the first study examining the capacity of PCR-HRM technique for identification of individual MG strains in a mixed strain population.
Inoculation, colonization and distribution of fungal endophytes in ...
African Journals Online (AJOL)
Mo
and for a part or whole of their life cycle live symptomlessly within the plant. ... inoculated in tissue culture banana plants, must occur at high frequencies in the plant and be able to persist in ... For instance, the influence of fungal endophytes.
DEFF Research Database (Denmark)
Sørensen, Chris Khadgi; Thach, Tine; Hovmøller, Mogens Støvring
2016-01-01
flexible application procedure for spray inoculation and it gave highly reproducible results for virulence phenotyping. Six point inoculation methods were compared to find the most suitable for assessment of pathogen aggressiveness. The use of Novec 7100 and dry dilution with Lycopodium spores gave...... for the assessment of quantitative epidemiological parameters. New protocols for spray and point inoculation of P. striiformis on wheat are presented, along with the prospect for applying these in rust research and resistance breeding activities....
Quilambo, OA; Weissenhorn, I.; Kuiper, P.J C; Stulen, I.
2005-01-01
The effects of inoculation with an indigenous Mozambican and a commercial arbuscular mycorrhizal (AM) inoculant on two peanut (Arachis hypogaea L.) cultivars, a traditional, low-yielding Mozambican landrace (Local) and a modern, high-yielding cultivar (Falcon), were tested in a non-sterile and
Parker, Karen J.; Buckmaster, Christine L.; Lindley, Steven E.; Schatzberg, Alan F.; Lyons, David M.
2012-01-01
Monkeys exposed to stress inoculation protocols early in life subsequently exhibit diminished neurobiological responses to moderate psychological stressors and enhanced cognitive control of behavior during juvenile development compared to non-inoculated monkeys. The present experiments extended these findings and revealed that stress inoculated…
Effect of different substrates on growth of Mimosa bimucronata seedlings inoculate with rhizobium
Directory of Open Access Journals (Sweden)
Juliana Müller Freire
2017-06-01
Full Text Available The objective of this study was to evaluate the growth response of Mimosa bimucronata (DC O. Kuntze seedlings in nursery conditions to inoculation with rhizobium strains previously selected using different substrates. An experimental design of randomized blocks with split plots was used, testing three substrates (pure organic-containing clay, sand and manure in 1: 1: 1 v: v: v ratio; organomineral mixed with 30% straw and sand with vermiculite in 1: 1 v: v and four N sources (inoculation with strains BR 3461 and BR 3470, control with N fertilization and control without fertilization, totalizing 12 treatments. Height and stem diameter were evaluate after 90 days and shoot, root and nodules dry mass were evaluate after 120 days. Organomineral substrates provided better seedling growth. However, only organic-substrate with straw and sand with vermiculite showed positive responses of plants inoculated with BR3470 strain. The performance of the inoculated seedlings was not higher than that of seedlings fertilized with N. The rate of N applied stimulated nodulation rather than inhibit it.
From Concept to Commerce: Developing a Successful Fungal Endophyte Inoculant for Agricultural Crops.
Murphy, Brian R; Doohan, Fiona M; Hodkinson, Trevor R
2018-02-11
The development of endophyte inoculants for agricultural crops has been bedevilled by the twin problems of a lack of reliability and consistency, with a consequent lack of belief among end users in the efficacy of such treatments. We have developed a successful research pipeline for the production of a reliable, consistent and environmentally targeted fungal endophyte seed-delivered inoculant for barley cultivars. Our approach was developed de novo from an initial concept to source candidate endophyte inoculants from a wild relative of barley, Hordeum murinum (wall barley). A careful screening and selection procedure and extensive controlled environment testing of fungal endophyte strains, followed by multi-year field trials has resulted in the validation of an endophyte consortium suitable for barley crops grown on relatively dry sites. Our approach can be adapted for any crop or environment, provided that the set of first principles we have developed is followed. Here, we report how we developed the successful pipeline for the production of an economically viable fungal endophyte inoculant for barley cultivars.
EST Table: FS813939 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS813939 E_FL_fmgV_41L05_F_0 10/09/28 65 %/121 aa ref|NP_001136225.1| hypothetical ...protein LOC100216500 [Bombyx mori] gb|ACJ66918.1| hypothetical protein 39 [Bombyx mori] 10/09/09 n.h 10/08/29 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AU001277 fmgV ...
EST Table: FS800709 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS800709 E_FL_fmgV_04M06_F_0 10/09/28 57 %/262 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti... aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 fmgV ...
EST Table: FS807612 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS807612 E_FL_fmgV_24A09_F_0 10/09/28 57 %/266 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti... aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 fmgV ...
EST Table: FS806480 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS806480 E_FL_fmgV_20N06_F_0 10/09/28 57 %/259 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti... aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 fmgV ...
EST Table: FS804646 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS804646 E_FL_fmgV_15M02_F_0 10/09/28 54 %/215 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti... aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 fmgV ...
EST Table: FS804486 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS804486 E_FL_fmgV_15E24_F_0 10/09/28 53 %/199 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti... aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 fmgV ...
EST Table: FS810510 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS810510 E_FL_fmgV_32C08_F_0 10/09/28 57 %/259 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti... aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 fmgV ...
EST Table: FS822271 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS822271 E_FL_fmgV_11P16_R_0 11/12/09 n.h 10/09/28 75 %/112 aa ref|XP_001656149.1| fetal alzheimer... antigen, falz [Aedes aegypti] gb|EAT35210.1| fetal alzheimer antigen, falz [Aedes aegypti] 1...8 %/115 aa gi|189240808|ref|XP_001811424.1| PREDICTED: similar to fetal alzheimer antigen, falz [Tribolium castaneum] FS822271 fmgV ...
Towle, D; Callan, D A; Lamprea, C; Murray, T S
2016-03-01
Non-tuberculous mycobacteria (NTMb), present in environmental water sources, can contribute to respiratory infection in patients with chronic pulmonary disease. Contaminated nebulizers are a potential source of respiratory infection. Treatment with baby bottle steam sterilizers disinfects home nebulizers inoculated with bacterial pathogens but whether this method works for disinfection of NTMb is unclear. Baby bottle steam sterilization was compared with vigorous water washing for disinfecting home nebulizers inoculated with NTMb mixed with cystic fibrosis sputum. No NTMb was recovered from any nebulizers after steam treatment whereas viable NTMb grew after water washing, demonstrating that steam sterilization effectively disinfects NTMb-inoculated nebulizers. Copyright © 2015 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Astrit Balliu
2015-12-01
Full Text Available The study aimed to investigate the effects of commercially available AMF inoculate (Glomus sp. mixture on the growth and the nutrient acquisition in tomato (Solanumlycopersicum L. plants directly after transplanting and under different levels of salinity. Inoculated (AMF+ and non-inoculated (AMF− tomato plants were subjected to three levels of NaCl salinity (0, 50, and 100 mM·NaCl. Seven days after transplanting, plants were analyzed for dry matter and RGR of whole plants and root systems. Leaf tissue was analyzed for mineral concentration before and after transplanting; leaf nutrient content and relative uptake rates (RUR were calculated. AMF inoculation did not affect plant dry matter or RGR under fresh water-irrigation. The growth rate of AMF−plants did significantly decline under both moderate (77% and severe (61% salt stress compared to the fresh water-irrigated controls, while the decline was much less (88% and 75%,respectivelyand statistically non-significant in salt-stressed AMF+ plants. Interestingly, root system dry matter of AMF+ plants (0.098 g plant–1 remained significantly greater under severe soil salinity compared to non-inoculated seedlings (0.082 g plant–1. The relative uptake rates of N, P, Mg, Ca, Mn, and Fe were enhanced in inoculated tomato seedlings and remained higher under (moderate salt stress compared to AMF− plants This study suggests that inoculation with commercial AMF during nursery establishment contributes to alleviation of salt stress by maintaining a favorable nutrient profile. Therefore, nursery inoculation seems to be a viable solution to attenuate the effects of increasing soil salinity levels, especially in greenhouses with low natural abundance of AMF spores.
Effect of arbuscular mycorrhizal fungal inoculation on growth, and ...
African Journals Online (AJOL)
FAMA
2015-09-30
Sep 30, 2015 ... AMF on root colonization, biomass production, mycorrhizal dependency (MD) and shoot mineral ... four months of growth in a sterilized soil and greenhouse conditions, grasses inoculated with AMF ..... Quetta, Pakistan.
effects of rhizobuim leguminosarum inoculation on the growth and ...
African Journals Online (AJOL)
user
beneficial symbiotic microorganisms into the plant. Rhizosphere ... Rhizobium strains in the yeast manitol broth were ... inoculants contained sixteen (16) colonies of Rhizobium leguminosarum bacterial cells per milliliter (ml) of the yeast ...
INOCULATION OF DIAZOTROPHIC BACTERIA AND NITROGEN FERTILIZATION IN TOPDRESSING IN IRRIGATED CORN
Directory of Open Access Journals (Sweden)
VANESSA ZIRONDI LONGHINI
2016-01-01
Full Text Available Corn is a nitrogen-intensive crop, and the use of management practices such as inoculation of the seed with diazotrophic bacteria, which can maximize crop productivity and reduce the need of nitrogen fertilizers, may result in lower production costs. The present study aimed to evaluate the effect of inoculation of corn seed with Azospirillum brasilense and controlled addition of nitrogen to topdressing on the nutrition, production components, and productivity of crop grain. The experimental design was a randomized block design, with four replications in a 2 × 5 factorial scheme. The treatments consisted of inoculation or not of corn seed with A. brasilense (at 100 mL per 25 kg of seed and five nitrogen (N levels in topdressing (0, 30, 60, 90, and 120 kg N ha-1 from urea [45% N] were applied when the corn was in the phenological growth stage V6. Foliar macronutrients, foliar chlorophyll index (FCI, production components, and yield of corn grain were valuated. Inoculation of corn seeds with A. brasilense increased plant height and grain yield. Fertilization in topdressing, with N levels up to 120 kg ha-1, linearly increased the foliar nutrients and productivity of corn cultivated in the spring/summer in the low-altitude Cerrado region of Brazil.
Inoculation of HMA and phosphoric fertilizer requirements Ipomea batata (L. Lam
Directory of Open Access Journals (Sweden)
Alberto Espinosa Cuéllar
2016-07-01
Full Text Available As well as sweet potato is a micotrófico crop, litle results where P fertilizer requirements associated with inoculation of strains of arbuscular mycorrhizal fungi (HMA are reported. For these purposes two experiments were performed, evaluating the response of the clones ‘INIVIT B2-2005’ or ‘CEMSA 78-354’ to application of five doses of phosphoric fertilizer with or without the application of the species Rhizoglomus intraradices (INCAM-11 in Phaeozems haplic calcari, in a randomized block design, factorial arrangement and four replications. Tuber yield, percentage of mycorrhizal colonization of mycorrhizal spores contained 50 g of soil and phosphorus content in the leaf, stem and root tuberous were evaluated. A significant response mineral fertilization in performance with an optimal dose of 75 kg ha-1, which decreased to 50 kg ha -1 when soil was inoculated with R. intraradices was found, while maintaining equivalent yields . This effect was similar in both clones and in both years. Inoculation significantly increased the percentage of colonization and spores and the highest values ever obtained in the treatment of 50 kg ha-1 of P2O5 , lower and upper fertilizations showed lower values. The contents of phosphorus in different organs also showed a similar response. It is concluded that efficient inoculating strain originates adequate mycorrhizal HMA performance in the presence of medium doses of fertilizer, ensuring high yields with lower doses of these.
Zhang, Dongchao; Long, Yuqing; Li, Meng; Gong, Jianfang; Li, Xiaohui; Lin, Jing; Meng, Jiali; Gao, Keke; Zhao, Ruili; Jin, Tianming
2018-04-01
Avian infectious bronchitis caused by the infectious bronchitis virus (IBV), and mycoplasmosis caused by Mycoplasma gallisepticum (MG) are two major respiratory diseases in chickens that have resulted in severe economic losses in the poultry industry. We constructed a recombinant adenovirus that simultaneously expresses the S1 spike glycoprotein of IBV and the TM-1 protein of MG (pBH-S1-TM-1-EGFP). For comparison, we constructed two recombinant adenoviruses (pBH-S1-EGFP and pBH-TM-1-EGFP) that express either the S1 spike glycoprotein or the TM-1 protein alone. The protective efficacy of these three vaccine constructs against challenge with IBV and/or MG was evaluated in specific pathogen free chickens. Groups of seven-day-old specific pathogen free chicks were immunized twice, two weeks apart, via the oculonasal route with the pBH-S1-TM-1-EGFP, pBH-S1-EGFP, or pBH-TM-1-EGFP vaccine candidates or the commercial attenuated infectious bronchitis vaccine strain H52 and MG vaccine strain F-36 (positive controls), and challenged with virulent IBV or MG two weeks later. Interestingly, by days 7 and 14 after the booster immunization, pBH-S1-TM-1-EGFP-induced antibody titre was significantly higher (P attenuated commercial IBV vaccine; however, there was no significant difference between the pBH-S1-TM-1-EGFP and attenuated commercial MG vaccine groups (P > 0.05). The clinical signs, the gross, and histopathological lesions scores of the adenovirus vaccine constructs were not significantly different from that of the attenuated commercial IBV or MG vaccines (positive controls) (P > 0.05). These results demonstrate the potential of the bivalent pBH-S1-TM-1-EGFP adenovirus construct as a combination vaccine against IB and mycoplasmosis.
Directory of Open Access Journals (Sweden)
Timothy Carroll
2017-07-01
Full Text Available Zika virus (ZIKV is a mosquito-transmitted virus that can cause severe defects in an infected fetus. ZIKV is also transmitted by sexual contact, although the relative importance of sexual transmission is unclear. To better understand the role of sexual transmission in ZIKV pathogenesis, a nonhuman primate (NHP model of vaginal transmission was developed. ZIKV was readily transmitted to mature cycling female rhesus macaque (RM by vaginal inoculation with 104-106 plaque-forming units (PFU. However, there was variability in susceptibility between the individual RM with 1->8 vaginal inoculations required to establish infection. After treatment with Depoprovera, a widely used contraceptive progestin, two RM that initially resisted 8 vaginal ZIKV inoculations became infected after one ZIKV inoculation. Thus, Depoprovera seemed to enhance susceptibility to vaginal ZIKV transmission. Unexpectedly, the kinetics of virus replication and dissemination after intravaginal ZIKV inoculation were markedly different from RM infected with ZIKV by subcutaneous (SQ virus inoculation. Several groups have reported that after SQ ZIKV inoculation vRNA is rapidly detected in blood plasma with vRNA less common in urine and saliva and only rarely detected in female reproductive tract (FRT secretions. In contrast, in vaginally inoculated RM, plasma vRNA is delayed for several days and ZIKV replication in, and vRNA shedding from, the FRT was found in all 6 animals. Further, after intravaginal transmission ZIKV RNA shedding from FRT secretions was detected before or simultaneously with plasma vRNA, and persisted for at least as long. Thus, ZIKV replication in the FRT was independent of, and often preceded virus replication in the tissues contributing to plasma vRNA. These results support the conclusion that ZIKV preferentially replicates in the FRT after vaginal transmission, but not after SQ transmission, and raise the possibility that there is enhanced fetal infection and
Mo, I P; Brugh, M; Fletcher, O J; Rowland, G N; Swayne, D E
1997-01-01
Pathologic changes and distribution of viral antigen as determined by immunohistochemistry were compared among 4-wk-old specific-pathogen-free chickens inoculated intratracheally with avian influenza virus (AIV) isolates of either low or high pathogenicity. Viruses of low pathogenicity, previously characterized as mildly pathogenic (MP), included A/chicken/Pennsylvania/21525/83 (H5N2) (MP-Penn) and A/chicken/Alabama/7395/75 (H4N8) (MP-Alab). Viruses of high pathogenicity included A/chicken/Pennsylvania/1370/83 (H5N2), A/chicken/Victoria/A185/85 (H7N7), and A/turkey/Ontario/7732/66 (H5N9). Extremely variable clinical signs ranging from mild respiratory distress to high mortality were present among chickens inoculated with these viruses. Chickens inoculated with highly pathogenic (HP) virus had histologic lesions of necrosis and inflammation in cloacal bursa, thymus, spleen, heart, pancreas, kidney, brain, trachea, lung, and skeletal muscle, whereas chickens inoculated with MP virus had histologic lesions most frequently in lung and trachea or lacked histologic lesions. Immunospecific staining for avian influenza viral proteins was most common in cells within heart, lung, kidney, brain, and pancreas of chicken inoculated with HP viruses, but immunospecific staining was present only and infrequently in trachea and lung of chickens inoculated with MP-Penn AIV. MP-Alab did not produce lesions nor have viral antigen in inoculated chickens but did produce serologic evidence of infection. The pattern of organ involvement and viral antigen distribution in chickens intratracheally inoculated with HP AIV isolates indicates a common capability to spread beyond the respiratory tract and confirms the pantrophic replicative, pathobiologic, and lethal nature of the viruses. However, variability in severity and lesion distribution exists between different HP AIVs. By contrast, MP viruses had the ability to replicate in respiratory or enteric tracts or both and produce lesions
Sebastiana, Mónica; da Silva, Anabela Bernardes; Matos, Ana Rita; Alcântara, André; Silvestre, Susana; Malhó, Rui
2018-04-01
We investigated whether the performance of cork oak under drought could be improved by colonization with the ectomycorrhizal fungus Pisolithus tinctorius. Results show that inoculation alone had a positive effect on plant height, shoot biomass, shoot basal diameter, and root growth. Under drought, root growth of mycorrhizal plants was significantly increased showing that inoculation was effective in increasing tolerance to drought. In accordance, mycorrhizal plants subjected to drought showed less symptoms of stress when compared to non-mycorrhizal plants, such as lower concentration of soluble sugars and starch, increased ability to maintain fatty acid content and composition, and increased unsaturation level of membrane lipids. After testing some of the mechanisms suggested to contribute to the enhanced tolerance of mycorrhizal plants to drought, we could not find any by which Pisolithus tinctorius could benefit cork oak, at least under the drought conditions imposed in our experiment. Inoculation did not increase photosynthesis under drought, suggesting no effect in sustaining stomatal opening at low soil water content. Similarly, plant water status was not affected by inoculation suggesting that P. tinctorius does not contribute to an increased plant water uptake during drought. Inoculation did increase nitrogen concentration in plants but it was independent of the water status. Furthermore, no significant mycorrhizal effect on drought-induced ROS production or osmotic adjustment was detected, suggesting that these factors are not important for the improved drought tolerance triggered by P. tinctorius.
International Nuclear Information System (INIS)
Khan, H.; Mahmood, N.H.; Iqbal, M.
1997-01-01
Five lentil (lens culinaris) genotypes, viz NARC-3, 20-8, 88522, 89511 and Mansehra-89, were evaluated in the field and pot experiments for natural nodulation and to study the effect of artificial inoculation on their nodulation, yield and grain protein content. Natural nodulation was almost absent in all the tested genotypes. Artificial rhizobial inoculation significantly increased the biological and grain yields in all the genotypes. Maximum increase in yield and nodulation due to inoculation was recorded in case of Mansehra-89. Grain protein was also increased by inoculation but not significantly. (author)
Fenton, Karla A; Fitzgerald, Scott D; Bolin, Steve; Kaneene, John; Sikarskie, James; Greenwald, Rena; Lyashchenko, Konstantin
2012-01-01
An endemic focus of Mycobacterium bovis (M. bovis) infection in the state of Michigan has contributed to a regional persistence in the animal population. The objective of this study was to determine if Virginia opossums (Didelphis virginiana) contribute to disease persistence by experimentally assessing intraspecies lateral transmission. One wild caught pregnant female opossum bearing 11 joeys (young opossum) and one age-matched joey were obtained for the study. Four joeys were aerosol inoculated with M. bovis (inoculated), four joeys were noninoculated (exposed), and four joeys plus the dam were controls. Four replicate groups of one inoculated and one exposed joey were housed together for 45 days commencing 7 days after experimental inoculation. At day 84 opossums were sacrificed. All four inoculated opossums had a positive test band via rapid test, culture positive, and gross/histologic lesions consistent with caseogranulomatous pneumonia. The exposed and control groups were unremarkable on gross, histology, rapid test, and culture. In conclusion, M. bovis infection within the inoculated opossums was confirmed by gross pathology, histopathology, bacterial culture, and antibody tests. However, M. bovis was not detected in the control and exposed opossums. There was no appreciable lateral transmission of M. bovis after aerosol inoculation and 45 days of cohabitation between infected and uninfected opossums.
Directory of Open Access Journals (Sweden)
Karla A. Fenton
2012-01-01
Full Text Available An endemic focus of Mycobacterium bovis (M. bovis infection in the state of Michigan has contributed to a regional persistence in the animal population. The objective of this study was to determine if Virginia opossums (Didelphis virginiana contribute to disease persistence by experimentally assessing intraspecies lateral transmission. One wild caught pregnant female opossum bearing 11 joeys (young opossum and one age-matched joey were obtained for the study. Four joeys were aerosol inoculated with M. bovis (inoculated, four joeys were noninoculated (exposed, and four joeys plus the dam were controls. Four replicate groups of one inoculated and one exposed joey were housed together for 45 days commencing 7 days after experimental inoculation. At day 84 opossums were sacrificed. All four inoculated opossums had a positive test band via rapid test, culture positive, and gross/histologic lesions consistent with caseogranulomatous pneumonia. The exposed and control groups were unremarkable on gross, histology, rapid test, and culture. In conclusion, M. bovis infection within the inoculated opossums was confirmed by gross pathology, histopathology, bacterial culture, and antibody tests. However, M. bovis was not detected in the control and exposed opossums. There was no appreciable lateral transmission of M. bovis after aerosol inoculation and 45 days of cohabitation between infected and uninfected opossums.
Experimental inoculation of beagle dogs with Ehrlichia species detected from Ixodes ovatus
Watanabe, Malaika; Oikawa, T; Hiraoka, Hiroko; Kaneko, N; Itamoto, Kazuhito; Mizuno, Tohru; Okuda, Masaru; Inokuma, Hisashi
2006-01-01
Three beagle dogs were inoculated with mice spleen/liver homogenate infected with Ehrlichia species detected from Ixodes ovatus (EIO) and one dog was used as a control. All three infected dogs did not show clinical signs of disease except for mild pyrexia throughout the 41-day study period. Splenomegaly was observed from Day 7 post-inoculation (p.i.) in two of the dogs. Hematological and biochemical abnormalities included mild thrombocytopenia, hypoproteinaemia, hypoalbuminaemia and increased...
Inoculation methods and aggressiveness of five Fusarium species against peach palm
Directory of Open Access Journals (Sweden)
Tiago Miguel Jarek
2018-04-01
Full Text Available ABSTRACT: Fusarium wilt is a major disease which affects peach palm (Bactris gasipaes Kunth.var gasipaes Henderson. This study aimed to evaluate inoculation methods and aggressiveness of isolates of five Fusarium species on peach palm. Fusarium proliferatum can infect the leaves, stem, and roots of peach palm. F. proliferatum, F. oxysporum species complex (FOSC, F. verticillioides, F. solani species complex (FSSC, and Gibberella fujikuroi species complex (GFSC are pathogenic to peach palm. The use of Fusarium-colonized ground corn for root inoculation was effective and reduced the level of damage to plants.
Silage extracts used to study the mode of action of silage inoculants in ruminants
Silage microbial inoculants can enhance animal performance, but the mechanisms involved in these effects are not clear. Our hypothesis was that an extractable factor from inoculated silage enhances rumen microbial activity. One alfalfa haylage (58% DM) and two corn silages (30% and 50% DM) were made...
Using Gamma Radiation for the Improvement of Silage Inoculant
International Nuclear Information System (INIS)
Wongwicharn, Aporn; Ljinakakr, Nongpanga; Piadang, Patharakorn
2006-09-01
A total of 117 acid producing baceria were isolated from grass and silage samples. Almost all isolates, 115 isolates posses homfermentative fermentation. All isolates produced lactic acid in a range of 0.36-2.05%. From their growth and their ability in producing lactic acid, two isolates, a coccus (T3-2-02) and a rod (T3-0-01) were selected for a mixed wild type strains for silage inoculant. After irradiation the wild type strains with gama ray, 51 and 58 isolates of high acid producer were selected from T3-2-02 and T3-0-01 strains, respectively. After testing the growht characteristics and the acid productivity, a coccus strain, MC08 and a rod stain, MR4 were choosen as a mixed irradiated starter culture strains for grass silage fermentation using a 50 dats old Pangola grass (Digitaria eriantha). The experiment was divided into 6 treatments. Treatmet I was the control. Treatmment 2, 4% molasses was added ro the grass. Treatment 3, a mixed wild type strains (T3-2-02+ T3-0-01) was inoculated into the grass. Treatment 4, a mixed irradiated strains (MC08+ MR04) was used. Treatment 5, A mixed wild tpye strains was used and supplemented with 4% molasses. Treatnebt 6, A mixed irradiated strain was assed and supplemented with 4% molasses. The results showed that a qualified silage can be obtained within a week from either the treatment inoculated with starter culture together with4% molasses (T5 and T6) or the treatment supplemented with 4% molasses alone (T2). further more, Silage of the treatments that using starter culture supplemented with 4% molasses gave volatile acid in a requred quantity. Silage of the treatments that inoculated either with a wild type pr a mixed irradiated starter culture posses bether quality than the control treatment. Further more silage that used irradiated starter culture showed a faster ffermentation and higher lactic acid production tha silage that uses wild type starter culture.
Inoculation of weaned pigs with E. coli reduces depots of vitamin E
DEFF Research Database (Denmark)
Lauridsen, Charlotte; Vestergaard, Ellen-Margrethe; Højsgaard, Søren
2011-01-01
This study was designed to investigate the effect of vitamin E supplementation on vitamin E depots and immune responses in weaned pigs after an E. coli inoculation. The design was a 2 × 2 factorial with vitamin E supplementation (150 mg/kg RRR-α-tocopheryl acetate versus a control diet containing...... 60 mg all-rac-α-tocopheryl acetate) and E. coli 0 149 inoculation (inoculation of 1 × 108 CFU on day 2 and 3 after weaning versus inoculation of vehicle). The pigs were housed individually during the experiment which lasted for 10 days from weaning at 7 weeks of age. Blood was sampled on day 1 (day...... of weaning) and 9 of the experiment, and serum was analyzed for α-tocopherol concentration. On day 10 of the experiment, pigs were killed and samples of liver, heart, muscle, adipose tissue and intestinal epithelium were obtained, and immune cells (alveolar macrophages) were harvested, and analyzed for α...
Inoculation of Ceratonia siliqua L. with native arbuscular mycorrhizal ...
African Journals Online (AJOL)
Inoculation of Ceratonia siliqua L. with native arbuscular mycorrhizal fungi mixture improves seedling establishment under greenhouse conditions. Ouahmane Lahcen, Ndoye Ibrahima, Morino Abdessadek, Ferradous Abderrahim, Sfairi Youssef, Al Faddy Mohamed Najib, Abourouh Mohamed ...
Effect of salinity and inoculation with Azosprillium on carbohydrate ...
African Journals Online (AJOL)
Jane
2011-08-17
Aug 17, 2011 ... Inoculation reduced harmful effects of salinity especially on mean kernel weight and grain ... considered to play a key role in stress induced metabolic processes and membrane ..... osmoregulation. Conclusion. Increase in ...
International Nuclear Information System (INIS)
Ingrid, Lenoir; Lounès-Hadj Sahraoui, Anissa; Frédéric, Laruelle; Yolande, Dalpé; Joël, Fontaine
2016-01-01
Very few studies reported the potential of arbuscular mycorrhizal symbiosis to dissipate hydrocarbons in aged polluted soils. The present work aims to study the efficiency of arbuscular mycorrhizal colonized wheat plants in the dissipation of alkanes and polycyclic aromatic hydrocarbons (PAHs). Our results demonstrated that the inoculation of wheat with Rhizophagus irregularis allowed a better dissipation of PAHs and alkanes after 16 weeks of culture by comparison to non-inoculated condition. These dissipations observed in the inoculated soil resulted from several processes: (i) a light adsorption on roots (0.5% for PAHs), (ii) a bioaccumulation in roots (5.7% for PAHs and 6.6% for alkanes), (iii) a transfer in shoots (0.4 for PAHs and 0.5% for alkanes) and mainly a biodegradation. Whereas PAHs and alkanes degradation rates were respectively estimated to 12 and 47% with non-inoculated wheat, their degradation rates reached 18 and 48% with inoculated wheat. The mycorrhizal inoculation induced an increase of Gram-positive and Gram-negative bacteria by 56 and 37% compared to the non-inoculated wheat. Moreover, an increase of peroxidase activity was assessed in mycorrhizal roots. Taken together, our findings suggested that mycorrhization led to a better hydrocarbon biodegradation in the aged-contaminated soil thanks to a stimulation of telluric bacteria and hydrocarbon metabolization in mycorrhizal roots. - Highlights: • Phytoremediation of aged-hydrocarbon polluted soils may be improved using arbuscular mycorrhizal fungi. • Inoculation of wheat with R. irregularis improved dissipation of PAH and alkanes. • Dissipation resulted from adsorption and bioaccumulation in wheat and mainly from biodegradation in soil. • Biodegradation was due to a stimulation of rhizosphere bacteria and an induction of root peroxidase. - Inoculation of wheat by an arbuscular mycorrhizal fungus improves biodegradation of alkanes and polycyclic aromatic hydrocarbons in an aged
Inoculation method could impact the outcome of microbiological experiments
DEFF Research Database (Denmark)
Kragh, Kasper Nørskov; Alhede, Maria; Rybtke, Morten
2018-01-01
For the last 150 years, bacteria have primarily been investigated in liquid bacth cultures (LBC). Contrary to most expectations, these cultures are not a homogeneous mixture of single-celled bacteria as free-floating bacterial aggregates eventually develop in most LBC. These aggregates share...... coli and Staphylococcus aureus also produce aggregates in LBC. Our results stress the importance of inoculation consistency throughout experiments and the substantial impact aggregate development in LBC has on the output of microbiological experiments.IMPORTANCE Liquid pure cultures are fundamental...... to the field of microbiological research. These cultures are normally thought of as a homogeneous mix of single cell bacteria. The present study shows how this is not always true. Bacteria may aggregate in these liquid cultures. The aggregation can be induced by the method chosen for inoculation. The presence...
International Nuclear Information System (INIS)
Sharif, M.; Saud, S.; Khan, F.
2012-01-01
A pot experiment was conducted to study the effect of inoculating maize (Zea mays L. Azam) with Arbuscular mycorrhizal (AM) fungi in 2 different series of North West Pakistan during the year 2007. Data showed significant increase in shoots and roots yield of maize with the inoculation of AM fungi alone and in combination with farm yard manure (FYM), poultry manure (PM) and humic acid (HA) over control and N-P-K treatments. Accumulation of N by maize shoots increased significantly by the addition of HA, PM and FYM plus N-P-K with or without inoculation of AM fungi over the treatments of N-P-K and control. Plants P accumulation increased significantly over control and N-P-K treatments with the inoculation of AM fungi alone and in combination with FYM, PM and HA in missa soil series. In missa gullied soil series, significantly increased plants P accumulation was noted by the treatments of AM inoculation with PM followed by HA. Accumulation of Mn by maize shoots increased significantly with AM inoculation with HA and PM over all other treatments, Fe increased with PM, HA and FYM. Plants Cu accumulation in missa series increased significantly over control and N-P-K treatments by AM alone and in combination with PM, FYM and HA and by AM fungi with PM, FYM and HA in missa gullied series. Maximum Mycorrhizal root infection rate of 51 % was recorded in the treatment of AM fungal inoculation with HA followed by the treatment inoculated with AM fungi with FYM. In missa gullied soil series, Maximum (59 %) and significantly increased roots infection rates over all treatments were observed in the treatment of AM fungal inoculation with HA followed by PM. Spores concentrations of AM fungi increased significantly with AM inoculation alone and with FYM, PM and HA. Maximum spores numbers of 50 in 20 g soil were recorded by the inoculation of AM fungi alone and with HA. (author)
Johnigk, S-A; Ecke, F; Poehling, M; Ehlers, R-U
2004-06-01
Heterorhabditis bacteriophora is used in biological control of soil-borne insect pests in horticulture and turf. Mass production is carried out in monoxenic liquid cultures pre-incubated with the symbiont of the nematodes, the bacterium Photorhabdus luminescens, before nematode dauer juveniles (DJ) are inoculated. As a response to bacterial food signals, the DJ recover from the developmentally arrested dauer stage, grow to adults and produce DJ offspring. Variable DJ recovery after inoculation into cultures of P. luminescens often causes process failure due to low numbers of adult nematodes in the medium. In order to enhance DJ recovery, improve nematode population management and increase yields, the optimal timing for DJ inoculation was sought. The process parameter pH and respiration quotient (RQ) were recorded in order to test whether changes can be used to identify the best moment for DJ inoculation. When DJ were inoculated during the lag and early logarithmic growth phases of P. luminescens cultures, DJ recovery was low and almost no nematode reproduction was obtained. High populations of P. luminescens phase variants were recorded. Recovery and yields increased when DJ were inoculated during the latter log phase during which the RQ dropped to values <0.8 and the pH reached a maximum. The highest DJ recovery and yields were observed in cultures that were inoculated during the late stationary growth phase. This period started with the increase of the pH after its distinct minimum at pH <8.0. Thus optimal timing for DJ inoculation can be defined through monitoring of the pH in the P. luminescens culture.
Directory of Open Access Journals (Sweden)
Irina V. Khilyas
2017-01-01
Full Text Available Bioelectrochemical systems such as microbial fuel cells (MFCs are promising new technologies for efficient removal of organic compounds from industrial wastewaters, including that generated from swine farming. We inoculated two pairs of laboratory-scale MFCs with sludge granules from a beer wastewater-treating anaerobic digester (IGBS or from sludge taken from the bottom of a tank receiving swine wastewater (SS. The SS-inoculated MFC outperformed the IGBS-inoculated MFC with regard to COD and VFA removal and electricity production. Using a metagenomic approach, we describe the microbial diversity of the MFC planktonic and anodic communities derived from the different inocula. Proteobacteria (mostly Deltaproteobacteria became the predominant phylum in both MFC anodic communities with amplification of the electrogenic genus Geobacter being the most pronounced. Eight dominant and three minor species of Geobacter were found in both MFC anodic communities. The anodic communities of the SS-inoculated MFCs had a higher proportion of Clostridium and Bacteroides relative to those of the IGBS-inoculated MFCs, which were enriched with Pelobacter. The archaeal populations of the SS- and IGBS-inoculated MFCs were dominated by Methanosarcina barkeri and Methanothermobacter thermautotrophicus, respectively. Our results show a long-term influence of inoculum type on the performance and microbial community composition of swine wastewater-treating MFCs.
Directory of Open Access Journals (Sweden)
Darko Uher
2012-09-01
Full Text Available Development and basic existence of animal production as well as production of high quality milk depends upon possibility of sufficient production of quality and protein sufficient forage. Forage crop that satisfies these demands is alfalfa which is one of the most important perennial forage crop legumes. The aim of this study was to enhance alfalfa production on acid soil by liming and alfalfa seed inoculation with efficient Sinorhizobium meliloti strains in order to reduce the use of mineral nitrogen fertilization and enable qualitative and cost effective production of forage on the dairy farms. Field trial was established at family farm in the area of Bjelovar and Bilogora county. During two years experimental period statistically significant influence of inoculation and liming on forage and dry matteryield was determined. Significantly the lowest yields were determined on untreated plots without liming material. In all untreated plots, significantly lower yields were determined, but significant differences in yields were also obtained by inoculation with different S. meliloti strains, emphasizing the importance of strains selection used for alfalfa inoculation. In both experimental years total forage yield were ranging from 34 t/ha (untreated plots without liming up to 60 t/ha on plots inoculated with strain 2011 and without liming. Values of total dry matter yield for both experimental years ranged from 6.5 t/ha (untreated plots without liming up to 15,7 t/ha on plots inoculated with strain 2011 without liming. Results of this study showed that application of liming materials for acidity removal had positive effect on alfalfa yields in both experimental years and significantly improved alfalfa production on acid soils. The results of this study clearly showed that inoculation with selected S. meliloti strains may improve alfalfa production on acid soils and may contribute to more efficient forage production for dairy farms under particular
Effect of inoculating blue-green algae and Azolla on rice yield
International Nuclear Information System (INIS)
Kulasooriya, S.A.
1985-01-01
Nitrogen fixing blue-green algae (BGA) and the Azolla-Anaebaena symbiosis are potential alternative sources of nitrogen for lowland rice production. A survey of the literature shows that on the average, when BGA inoculation is effective, a rice yield increase of 14% (450 kg grain ha -1 ) has been observed. However, in Sri Lanka no significant increases in grain yield have been observed due to BGA inoculation. Azolla inoculation in broadcast, transplanted, and avenue transplanted rice gave yield increases of 12, 22 and 48%, and was equivalent to 55 to 80 kg N ha -1 as urea. Azolla was observed to reduce weed growth by 53%. Azolla is easier to establish in rice fields since it can be easily recognized with the naked eye, however, BGA are better able to withstand periods of desiccation which occur in rain-fed rice production. Most algalization experiments have been performed on a ''black box'' basis where only the final grain yield has been measured. Isotope experiments can play a vital role in understanding the processes by which BGA and Azolla increase rice yields. (author)
Treatment of dairy wastewater in UASB reactors inoculated with ...
African Journals Online (AJOL)
Treatment of dairy wastewater in UASB reactors inoculated with flocculent biomass. ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING ... of using flocculent sludge in UASB reactors applied to the treatment of dairy ...
Maize response to inoculation with strains of plant growth-promoting bactéria
Directory of Open Access Journals (Sweden)
Janaína Dartora
Full Text Available ABSTRACT The aim of this study was to evaluate the response of maize to inoculation with strains of plant growth-promoting bacteria (PGPB in two cultivation years. The experiment was set in a randomized block design with four replicates in two cultivation years (2012/13 and 2013/14. The treatments consisted of PGPB inoculation: control (without N and without inoculation; 30 kg of N ha-1 at sowing (N1; 160 kg of N ha-1 (N1 + 130 kg of N ha-1 as top-dressing; N1 + A. brasilense, Ab-V5; N1 + A. brasilense, HM053; N1 + Azospirillum sp. L26; N1 + Azospirillum sp. L27; N1 + Enhydrobacter sp. 4331; N1 + Rhizobium sp. 8121. Basal stem diameter, plant height, leaf area, shoot dry matter and yield were evaluated. The strain of Rhizobium sp. 8121and the isolate Azospirillum sp. L26 associated with 30 kg of N ha-1 at sowing promoted yields equivalent to that of the N fertilization of 160 kg ha-1, demonstrating the potential to be used in the inoculation of maize seeds.
Effect of Inoculating Bradyrhizobium on Phosphorus Use Efficiency ...
African Journals Online (AJOL)
3 School of Natural Resources Management and Environmental Sciences, ..... was produced per unit of P applied by un-inoculated, SB6B1 and Legumefix ... meet the high energy costs for adenosine triphosphate (ATP) synthesis .... Kumar and Kairon (1980) also determined an apparent P .... Prentice Hall, New Jersey.
Curá, José Alfredo; Franz, Diego Reinaldo; Filosofía, Julián Ezequiel; Balestrasse, Karina Beatríz; Burgueño, Lautaro Exequiel
2017-07-26
Stress drought is an important abiotic factor that leads to immense losses in crop yields around the world. Strategies are urgently needed to help plants adapt to drought in order to mitigate crop losses. Here we investigated the bioprotective effects of inoculating corn grown under drought conditions with two types of plant growth-promoting rhizobacteria (PGPR), A. brasilense , strain SP-7, and H. seropedicae , strain Z-152. Plants inoculated with the bacteria were grown in a greenhouse with perlite as a substrate. Two hydric conditions were tested: normal well-watered conditions and drought conditions. Compared to control non-inoculated plants, those that were inoculated with PGPR bacteria showed a higher tolerance to the negative effects of water stress in drought conditions, with higher biomass production; higher carbon, nitrogen, and chlorophyll levels; and lower levels of abscisic acid and ethylene, which are plant hormones that affect the stress response. The oxidative stress levels of these plants were similar to those of non-inoculated plants grown in well-watered conditions, showing fewer injuries to the cell membrane. We also noted higher relative water content in the vegetal tissue and better osmoregulation in drought conditions in inoculated plants, as reflected by significantly lower proline content. Finally, we observed lower gene expression of ZmVP14 in the inoculated plants; notably, ZmVP14 is involved in the biosynthesis of abscisic acid. Taken together, these results demonstrate that these bacteria could be used to help plants cope with the negative effects of drought stress conditions.
Ingrid, Lenoir; Lounès-Hadj Sahraoui, Anissa; Frédéric, Laruelle; Yolande, Dalpé; Joël, Fontaine
2016-06-01
Very few studies reported the potential of arbuscular mycorrhizal symbiosis to dissipate hydrocarbons in aged polluted soils. The present work aims to study the efficiency of arbuscular mycorrhizal colonized wheat plants in the dissipation of alkanes and polycyclic aromatic hydrocarbons (PAHs). Our results demonstrated that the inoculation of wheat with Rhizophagus irregularis allowed a better dissipation of PAHs and alkanes after 16 weeks of culture by comparison to non-inoculated condition. These dissipations observed in the inoculated soil resulted from several processes: (i) a light adsorption on roots (0.5% for PAHs), (ii) a bioaccumulation in roots (5.7% for PAHs and 6.6% for alkanes), (iii) a transfer in shoots (0.4 for PAHs and 0.5% for alkanes) and mainly a biodegradation. Whereas PAHs and alkanes degradation rates were respectively estimated to 12 and 47% with non-inoculated wheat, their degradation rates reached 18 and 48% with inoculated wheat. The mycorrhizal inoculation induced an increase of Gram-positive and Gram-negative bacteria by 56 and 37% compared to the non-inoculated wheat. Moreover, an increase of peroxidase activity was assessed in mycorrhizal roots. Taken together, our findings suggested that mycorrhization led to a better hydrocarbon biodegradation in the aged-contaminated soil thanks to a stimulation of telluric bacteria and hydrocarbon metabolization in mycorrhizal roots. Copyright © 2016 Elsevier Ltd. All rights reserved.
Effect of Azospirillum brasilense inoculation on urease activity in soil and gamma-sterilized soil
International Nuclear Information System (INIS)
Perotti, E.B.R.; Pidello, A.
1999-01-01
Azospirillum spp. is considered a PGPR (plant growth promoting rhyzobacteria) bacterium, besides this interest, there is little information about its effects on other functional microbial groups or on soil enzymes. In this paper, the impact that Azospirillum brasilense 7001 inoculation has on urease activity expression in a Typic Argiudoll was studied. Evolution of urease activity of soil and of gamma irradiation (25 KGy) sterilized soil, and the inoculated strain survival were tested. The relation between soil urease activity and soil NH 4 +-N was also determined. In γ-sterilized soil, urease activity of inoculated soil increased with time, showing significant differences with regard to the control soil without inoculum at day 15. In non-sterile soil, urease activity decreased during the studied period in all treatments; in inoculated soil, it showed higher or lower values than the control depending on sampling time. Azospirillum survival was important and different according to soil condition conditions. The negative relation between NH 4 +-N concentration and soil urease activity (r 2 = 0.62) was observed in inoculated soil. The role of the addition of autoclaved inoculum in the urease activity expression is discussed. The research proves that in both studied situations Azospirillum modified soil urease activity, and that the competition with native microorganisms and soil NH 4 +-N may affect this bacterium capacity. (author)
Characteristics of respiratory tract disease in horses inoculated with equine rhinitis A virus.
Diaz-Méndez, Andrés; Hewson, Joanne; Shewen, Patricia; Nagy, Eva; Viel, Laurent
2014-02-01
To develop a method for experimental induction of equine rhinitis A virus (ERAV) infection in equids and to determine the clinical characteristics of such infection. 8 ponies (age, 8 to 12 months) seronegative for antibodies against ERAV. PROCEDURES-Nebulization was used to administer ERAV (strain ERAV/ON/05; n = 4 ponies) or cell culture medium (control ponies; 4) into airways of ponies; 4 previously ERAV-inoculated ponies were reinoculated 1 year later. Physical examinations and pulmonary function testing were performed at various times for 21 days after ERAV or mock inoculation. Various types of samples were obtained for virus isolation, blood samples were obtained for serologic testing, and clinical scores were determined for various variables. ERAV-inoculated ponies developed respiratory tract disease characterized by pyrexia, nasal discharge, adventitious lung sounds, and enlarged mandibular lymph nodes. Additionally, these animals had purulent mucus in lower airways up to the last evaluation time 21 days after inoculation (detected endoscopically). The virus was isolated from various samples obtained from lower and upper airways of ERAV-inoculated ponies up to 7 days after exposure; this time corresponded with an increase in serum titers of neutralizing antibodies against ERAV. None of the ponies developed clinical signs of disease after reinoculation 1 year later. Results of this study indicated ERAV induced respiratory tract disease in seronegative ponies. However, ponies with neutralizing antibodies against ERAV did not develop clinical signs of disease when reinoculated with the virus. Therefore, immunization of ponies against ERAV could prevent respiratory tract disease attributable to that virus in such animals.
Effects of Rhizobuim leguminosarum inoculation on the growth and ...
African Journals Online (AJOL)
g per plant in 2008 and 2009 seasons, respectively. The findings suggested that inoculation of Mucuna flagellipies with Rhizobium is beneficial and produced high seed yield and could be use as biofertilizer an alternative to nitrogen fertilizer.
Yeast Population Dynamics in Spontaneous and Inoculated Alcoholic Fermentations of Zametovka Must
Directory of Open Access Journals (Sweden)
Franc Cus
2002-01-01
Full Text Available Inoculated fermentations, which are more rapid and more reliable than spontaneous fermentations, and assure predictable wine quality, are nowadays prevalent in Slovenia’s large-scale wine production. However, spontaneous fermentation strengthens local characteristics of wine and offers opportunities for technological innovation. In the 1999 vintage, spontaneous and inoculated fermentations of Zametovka (Vitis vinifera grape must were studied. Zametovka is the main red variety in production of traditional Slovene red blend wine, Cvicek. The diversity of yeast species and strains in both of the investigated fermentations was determined by molecular and traditional identification methods. The outset of alcoholic fermentation, yeast growth kinetics, and yeast population dynamics presents the main differences between the examined fermentations. Yeast population diversity was higher in the spontaneous process. Dominant yeast isolates from spontaneous fermentation were identified as Candida stellata, Hanseniaspora uvarum and Saccharomyces cerevisiae; whereas Saccharomyces bayanus, Pichia kluyveri, Pichia membranifaciens and Torulaspora delbrueckiim were found less frequently. Dominant species in the inoculated fermentation was Saccharomyces cerevisiae; other species found in smaller numbers were Candida stellata, Hanseniaspora uvarum and Debaryomyces hansenii var. hansenii. Using PFGE, we were able to distinguish among 15 different Saccharomyces cerevisiae strains and three different Saccharomyces bayanus strains isolated from spontaneous fermentation, whereas, in the case of inoculated fermentation, only two Saccharomyces cerevisiae strains were found. Their chromosomal patterns coincide with the chromosomal patterns of the starter culture strains.
2010-04-01
... for use. To aid in the control of chronic respiratory disease caused by Mycoplasma gallisepticum. (c...) Indications for use. To aid in the control of chronic respiratory disease caused by Mycoplasma gallisepticum...) Chickens—(a) Amount per ton. Tylosin, 4-50 grams. (1) Indications for use. For increased rate of weight...
International Nuclear Information System (INIS)
Ahmed, B.
2014-01-01
The present study was conducted to evaluate the effects of bacterial inoculation on different growth parameters of rice variety JP-5. Three bacterial strains (Azospirillum brasilense R1, Azospirillum lipoferum RSWT1 and Pseudomonas Ky1) were used to inoculate rice varietyJP-5 at control lab environment and field. Plant growth promotion was observed in all inoculated treatments over non-inoculated, which was evident from increase in root area, root length, number of tillers, straw and grain yields and total weight of plant. Azospirillum brasilense R1 was more effective in plant growth promotion than other strains and showed 19% increase in the straw weight and 39.5% increase in grain weight. Inoculation with Azospirillum lipoferum RSWT1 and Pseudomonas Ky1 increased grain weight by 18.5% and 13.8% respectively. The study revealed that beneficial strains of PGPR can be used as biofertilizer for rice. (author)
Plant Growth Promotion and Suppression of Bacterial Leaf Blight in Rice by Inoculated Bacteria.
Directory of Open Access Journals (Sweden)
Sumera Yasmin
Full Text Available The present study was conducted to evaluate the potential of rice rhizosphere associated antagonistic bacteria for growth promotion and disease suppression of bacterial leaf blight (BLB. A total of 811 rhizospheric bacteria were isolated and screened against 3 prevalent strains of BLB pathogen Xanthomonas oryzae pv. oryzae (Xoo of which five antagonistic bacteria, i.e., Pseudomonas spp. E227, E233, Rh323, Serratia sp. Rh269 and Bacillus sp. Rh219 showed antagonistic potential (zone of inhibition 1-19 mm. Production of siderophores was found to be the common biocontrol determinant and all the strains solubilized inorganic phosphate (82-116 μg mL-1 and produced indole acetic acid (0.48-1.85 mg L-1 in vitro. All antagonistic bacteria were non-pathogenic to rice, and their co-inoculation significantly improved plant health in terms of reduced diseased leaf area (80%, improved shoot length (31%, root length (41% and plant dry weight (60% as compared to infected control plants. Furthermore, under pathogen pressure, bacterial inoculation resulted in increased activity of defense related enzymes including phenylalanine ammonia-lyase and polyphenol oxidase, along with 86% increase in peroxidase and 53% increase in catalase enzyme activities in plants inoculated with Pseudomonas sp. Rh323 as well as co-inoculated plants. Bacterial strains showed good colonization potential in the rice rhizosphere up to 21 days after seed inoculation. Application of bacterial consortia in the field resulted in an increase of 31% in grain yield and 10% in straw yield over non-inoculated plots. Although, yield increase was statistically non-significant but was accomplished with overall saving of 20% chemical fertilizers. The study showed that Pseudomonas sp. Rh323 can be used to develop dual-purpose inoculum which can serve not only to suppress BLB but also to promote plant growth in rice.
Detection of wood discoloration in a canker fungus-inoculated Japanese cedar by neutron radiography
International Nuclear Information System (INIS)
Yamada, T.; Aoki, Y.; Yamato, M.; Komatsu, M.; Kusumoto, D.; Suzuki, K.; Nakanishi, T.M.
2005-01-01
Neutron radiography (NRG) was applied to trace the development of discolored tissue in the wood of Japanese cedar (Cryptomeria japonica) after being infected with a canker fungus. Japanese cedar seedlings were wound inoculated with a virulent and avirulent isolate of a canker fungus, Guignardia cryptomeriae. Three, 7, 13 and 22 days after the inoculation, the seedlings were irradiated with thermal neutrons. The image on the X-ray film showed that the whiteness in the image corresponded to the water content in the sample. Discolored tissue and surrounding dry zones induced by the fungal inoculation were detected as dark areas, indicating water deficiency with a high resolution. Through image analysis, the dry zones were detected as early as 3 days after inoculation. Neutron images also showed the difference in the size of water deficient parts due to the tissue damage among the treatments. The neutron beam dose used in this experiment had no effect on the growth rate of the fungus on a medium, showing that NRG is an effective method for pathological research of trees. (author)
Silva de Ruiz, C; del R Rey, M; Nader-Macías, M E
2003-06-01
To assess, using structural and ultrastructural studies of the urinary tract, the effects of the intraurethral inoculation of lactobacilli (probiotic treatment) as lactobacilli are the predominant micro-organisms of the urogenital tract of humans, monkeys and mice. Previous work showed the protective effect of Lactobacillus fermentum CRL 1058 intraurethrally inoculated against the challenge of uropathogenic Escherichia coli. There was also an effect of oestrogens and antibiotics in the kinetics of colonization of both micro-organisms in mice. In the present study L. fermentum was inoculated with agarose beads (107 colony-forming units) and the number of micro-organisms determined by plating in selective media, giving a high degree of colonization in all the organs studied. The urinary tract organs were processed by histological and electron microscopy techniques standardized in our laboratory. The intraurethral inoculation of lactobacilli produced no adverse effects or significant changes in any of the organs assessed (kidney, ureter, bladder or urethra), when evaluated by histological and ultrastructural techniques. The use of lactobacilli as a probiotic treatment is probably safe.
Silva, Luís R; Azevedo, Jessica; Pereira, Maria J; Carro, Lorena; Velazquez, Encarna; Peix, Alvaro; Valentão, Patrícia; Andrade, Paula B
2014-01-22
Pepper (Capsicum annuum L.) is an economically important agricultural crop and an excellent dietary source of natural colors and antioxidant compounds. The levels of these compounds can vary according to agricultural practices, like inoculation with plant growth-promoting rhizobacteria. In this work we evaluated for the first time the effect of the inoculation of two Rhizobium strains on C. annuum metabolites and bioactivity. The results revealed a decrease of organic acids and no effect on phenolics and capsaicinoids of leaves from inoculated plants. In the fruits from inoculated plants organic acids and phenolic compounds decreased, showing that fruits from inoculated plants present a higher ripeness stage than those from uninoculated ones. In general, the inoculation with Rhizobium did not improve the antioxidant activity of pepper fruits and leaves. Considering the positive effect on fruit ripening, the inoculation of C. annuum with Rhizobium is a beneficious agricultural practice for this nonlegume.
Sandheep, A R; Asok, A K; Jisha, M S
2013-06-15
This study was conducted to evaluate the plant growth promoting efficiency of combined inoculation of rhizobacteria on Vanilla plants. Based on the in vitro performance of indigenous Trichoderma spp. and Pseudomonas spp., four effective antagonists were selected and screened under greenhouse experiment for their growth enhancement potential. The maximum percentage of growth enhancement were observed in the combination of Trichoderma harzianum with Pseudomonas fluorescens treatment followed by Pseudomonas fluorescens, Trichoderma harzianum, Pseudomonas putida and Trichoderma virens, respectively in decreasing order. Combined inoculation of Trichoderma harzianum and Pseudomonas fluorescens registered the maximum length of vine (82.88 cm), highest number of leaves (26.67/plant), recorded the highest fresh weight of shoots (61.54 g plant(-1)), fresh weight of roots (4.46 g plant(-1)) and dry weight of shoot (4.56 g plant(-1)) where as the highest dry weight of roots (2.0806 g plant(-1)) were achieved with treatments of Pseudomonas fluorescens. Among the inoculated strains, combined inoculation of Trichoderma harzianum and Pseudomonas fluorescens recorded the maximum nitrogen uptake (61.28 mg plant(-1)) followed by the combined inoculation of Trichoderma harzianum (std) and Pseudomonas fluorescens (std) (55.03 mg plant(-1)) and the highest phosphorus uptake (38.80 mg plant(-1)) was recorded in dual inoculation of Trichoderma harzianum and Pseudomonas fluorescens.
Directory of Open Access Journals (Sweden)
Tamrakar Sushil B
2012-03-01
Full Text Available Abstract Background Rickettsia typhi (R. mooseri is the causative agent of murine typhus. It is one of the most widely distributed flea-borne diseases with a relatively mild febrile initial illness with six to 14 days of incubation period. The bacterium is gram negative and an obligate intracellular pathogen. The disease is transmitted to humans and vertebrate host through fleabites or via contact with infected feces. This paper develops dose-response models of different routes of exposure for typhus in rodents. Methods Data from published articles were analyzed using parametric dose-response relationship models. Dose-response relationships were fit to data using the method of maximum likelihood estimation (MLE. Results Dose-response models quantifying the effects of different ages of rats and time post inoculation in BALB/c mice were analyzed in the study. Both the adult rats (inoculated intradermally and newborn rats (inoculated subcutaneously were best fit by exponential models and both distributions could be described by a single dose-response relationship. The BALB/C mice inoculated subcutaneously were best fit by Beta-Poisson models. The time post inoculation analysis showed that there was a definite time and response relationship existed in this case. Conclusions Intradermally or subcutaneously inoculated rats (adult and newborn models suggest that less than 1 plaque-forming unit (PFU (1.33 to 0.38 in 95% confidence limits of the pathogen is enough to seroconvert 50% of the exposed population on average. For the BALB/c mouse time post inoculation model, an average dose of 0.28 plaque-forming units (PFU (0.75 to 0.11 in 95% confidence limits will seroconvert 50% of the exposed mice.
El Aafi, N; Brhada, F; Dary, M; Maltouf, A Filali; Pajuelo, E
2012-03-01
The aim of this work was to test Lupinus luteus plants, inoculated with metal resistant rhizobacteria, in order to phytostabilise metals in contaminated soils. The resistance to heavy metals of strains isolated from nodules of Lupinus plants was evaluated. The strain MSMC541 showed multi-resistance to several metals (up to 13.3 mM As, 2.2 mM Cd, 2.3 mM Cu, 9 mM Pb and 30 mM Zn), and it was selected for further characterization. Furthermore, this strain was able to biosorb great amounts of metals in cell biomass. 16S rDNA sequencing positioned this strain within the genus Serratia. The presence of arsenic resistance genes was confirmed by southern blot and PCR amplification. A rhizoremediation pot experiment was conducted using Lupinus luteus grown on sand supplemented with heavy metals and inoculated with MSMC541. Plant growth parameters and metal accumulation were determined in inoculated vs. non-inoculated Lupinus luteus plants. The results showed that inoculation with MSMC541 improved the plant tolerance to metals. At the same time, metal translocation to the shoot was significantly reduced upon inoculation. These results suggest that Lupinus luteus plants, inoculated with the metal resistant strain Serratia sp. MSMC541, have a great potential for phytostabilization of metal contaminated soils.
Inoculating against Pro-Plagiarism Justifications: Rational and Affective Strategies
Compton, Josh; Pfau, Michael
2008-01-01
Student plagiarism continues to threaten academic integrity. This investigation assessed whether an inoculation message strategy could combat university plagiarism by protecting student attitudes against pro-plagiarism justification arguments. Additionally, we sought theoretical confirmation of previous findings on involvement and accessibility in…
Quilambo, OA; Weissenhorn, I.; Doddema, H; Kuiper, PJC; Stulen, I.
2005-01-01
The effect of drought stress and inoculation with an indigenous Mozambican and a commercial arbuscular mycorrhizal (AM) inoculant on root colonization and plant growth and yield was studied in two peanut (Arachis hypogaea L.) cultivars-a traditional, low-yielding Mozambican landrace (Local) and a
Directory of Open Access Journals (Sweden)
C.C. Câmara
2010-07-01
Full Text Available The objective of the present study was to describe motor behavioral changes in association with histopathological and hematological findings in Wistar rats inoculated intravenously with human T-cell lymphotropic virus type 1 (HTLV-1-infected MT2 cells. Twenty-five 4-month-old male rats were inoculated with HTLV-1-infected MT2 cells and 13 control rats were inoculated with normal human lymphocytes. The behavior of the rats was observed before and 5, 10, 15, and 20 months after inoculation during a 30-min/rat testing time for 5 consecutive days. During each of 4 periods, a subset of rats was randomly chosen to be sacrificed in order to harvest the spinal cord for histopathological analysis and to obtain blood for serological and molecular studies. Behavioral analyses of the HTLV-1-inoculated rats showed a significant decrease of climbing, walking and freezing, and an increase of scratching, sniffing, biting, licking, and resting/sleeping. Two of the 25 HTLV-1-inoculated rats (8% developed spastic paraparesis as a major behavioral change. The histopathological changes were few and mild, but in some cases there was diffuse lymphocyte infiltration. The minor and major behavioral changes occurred after 10-20 months of evolution. The long-term observation of Wistar rats inoculated with HTLV-1-infected MT2 cells showed major (spastic paraparesis and minor motor abnormalities in association with the degree of HTLV-1-induced myelopathy.
Butcher, M; Lakritz, J; Halaney, A; Branson, K; Gupta, G D; Kreeger, J; Marsh, A E
2002-07-29
Sarcocystis neurona is the parasite most commonly associated with equine protozoal myeloencephalitis (EPM). Recently, cats (Felis domesticus) have been demonstrated to be an experimental intermediate host in the life cycle of S. neurona. This study was performed to determine if cats experimentally inoculated with culture-derived S. neurona merozoites develop tissue sarcocysts infectious to opossums (Didelphis virginiana), the definitive host of S. neurona. Four cats were inoculated with S. neurona or S. neurona-like merozoites and all developed antibodies reacting to S. neurona merozoite antigens, but tissue sarcocysts were detected in only two cats. Muscle tissues from the experimentally inoculated cats with and without detectable sarcocysts were fed to laboratory-reared opossums. Sporocysts were detected in gastrointestinal (GI) scrapings of one opossum fed experimentally infected feline tissues. The study results suggest that cats can develop tissue cysts following inoculation with culture-derived Sarcocystis sp. merozoites in which the particular isolate was originally derived from a naturally infected cat with tissue sarcocysts. This is in contrast to cats which did not develop tissue cysts when inoculated with S. neurona merozoites originally derived from a horse with EPM. These results indicate present biological differences between the culture-derived merozoites of two Sarcocystis isolates, Sn-UCD 1 and Sn-Mucat 2.
Foreyt, W J; Snipes, K P; Kasten, R W
1994-04-01
In a series of three experiments, isolates of Pasteurella haemolytica biotype A, serotype 2, ribotype reference WSU-1, from healthy domestic sheep, were inoculated intratracheally into eight bighorn sheep (Ovis canadensis canadensis) and seven domestic sheep with doses of bacteria ranging from 5.3 x 10(8) to 8.6 x 10(11) colony forming units. Seven of eight inoculated bighorn sheep died from acute pneumonia within 48 hr of inoculation, whereas all seven domestic sheep inoculated with comparable or greater doses of bacteria remained healthy. One contact control bighorn sheep also died 6 days after its penmates received P. haemolytica. Three other noncontact control bighorn sheep remained healthy during the experiments. Pasteurella haemolytica biotype A, serotype 2, ribotype reference WSU-1 in the inocula was recovered from one or more tissues from all bighorns that died; whereas, it was not detected in any bighorn sheep before inoculation. Three different ribotypes of P. haemolytica A2 were recovered from bighorn sheep; however, only the ribotype reference WSU-1 in the domestic sheep-origin inoculum was recovered from all dead bighorn sheep, and was not recovered from bighorn sheep that survived the experiments. Thus, a relatively nonpathogenic and common isolate of P. haemolytica from healthy domestic sheep was lethal in bighorn sheep under experimental conditions.
Directory of Open Access Journals (Sweden)
Yusuf Madaki Lekko
2017-09-01
Conclusion The PCV significantly decrease P≤0.05 in layers vaccinated and inoculated with P. multocida but increase in unvaccinated layers inoculated P. multocida. The mean serum ALP concentration significantly increase P≤0.05 in unvaccinated layers inoculated with P. multocida when compared to layers vaccinated and inoculated with P. multocida. [J Adv Vet Anim Res 2017; 4(3.000: 234-240
Directory of Open Access Journals (Sweden)
LIU Wei-ming
2006-05-01
Full Text Available Effect of several complex inoculants on mechanical properties, process-ability and sensibility of grey cast iron used in cylinder block were investigated. The experimental results showed that the grey cast iron treated with 60%FeSi75+40%RE complex inoculants has tensile strength consistently at about 295 MPa along with good hardness and improved metallurgy quality. While the grey cast iron inoculated with 20%FeSi75+80%Sr compound inoculants has the best process-ability, the lowest cross-section sensibility and the least microhardness difference. The wear amount of the drill increases correspondingly with the increase of the microhardness difference of matrix structure, indicating the great effect of homogeneousness of matrix structure in the grey cast iron on the machinability of the grey cast iron.
[Inoculation experiments of Cistanche tubulosa on 8 introduced Tamarix species].
Yang, Tai-Xin; Lu, Yue-Xia; Zhang, Xi-Huan; Cai, Jing-Zhu; Zhao, Yu-Xin
2007-10-01
To analyze the inoculation ratio and echinacoside content of Cistanche tubulosa and provide theoretical basis for Tamarix introduction, resource protection and screening of C. tubulosa. 8 Tamarix species were introduced in the North China Plain and inoculation of C. tubulosa was conducted on all species. Phenylethanoid glycosides fingerprinting and echinacoside content of C. tubulosa were analyzed by using HPLC. The adaptability of 8 Tamarix species were significantly different, phenylethanoid glycosides component of C. tubulosa on T. gansuensis and T. austromongolica were basically identical in contrast to T. chinensis, echinacoside content showed no obvious difference in C. tubulosa plant growing 4 months. T. gansuensis and T. Austromongolica are suitable for the host introduction plant of C. tubulosa resource protection and screening in North China Plain.
International Nuclear Information System (INIS)
Lockshin, A.; Giovanella, B.C.; Quian, C.; Mendoza, J.T.; Vardeman, D.M.; Stehlin, J.S. Jr.
1984-01-01
BRO human melanoma cells were prelabeled in vitro with [125I]5-iodo-2'-deoxyuridine ([125I]IdUrd) and inoculated into NIH-II nude mice ip, im, sc, or iv. Saline or diphtheria toxin (DT), which is selectively toxic to human cells compared to those of mice, was injected, and the loss of 125I from the animals was monitored daily with a whole-body gamma scintillation detector. For most of the inoculation sites DT accelerated the rate of 125I excretion and in all cases was cytotoxic for the inoculated cells as determined by host survival or measurement of visible tumor growth. Differences between the rates of 125I loss for DT-treated mice compared to untreated mice were most evident for cells inoculated ip or im. These results indicate that [125I]IdUrd prelabeling of human tumor cells inoculated in nude mice offers a rapid method for determination of cytotoxicity in vivo
Inoculation of starter cultures in a semi-dry coffee (Coffea arabica) fermentation process.
Evangelista, Suzana Reis; Miguel, Maria Gabriela da Cruz Pedrozo; Cordeiro, Cecília de Souza; Silva, Cristina Ferreira; Pinheiro, Ana Carla Marques; Schwan, Rosane Freitas
2014-12-01
The aim of this study was to evaluate the use of yeasts as starter cultures in coffee semi-dry processing. Arabica coffee was inoculated with one of the following starter cultures: Saccharomyces cerevisiae UFLA YCN727, S. cerevisiae UFLA YCN724, Candida parapsilosis UFLA YCN448 and Pichia guilliermondii UFLA YCN731. The control was not inoculated with a starter culture. Denaturing gradient gel electrophoresis (DGGE) was used to assess the microbial population, and organic acids and volatile compounds were quantified by HPLC and HS-SPME/GC, respectively. Sensory analyses were evaluated using the Temporal Dominance of Sensations (TDS). DGGE analysis showed that the inoculated yeasts were present throughout the fermentation. Other yeast species were also detected, including Debaryomyces hansenii, Cystofilobasidium ferigula and Trichosporon cavernicola. The bacterial population was diverse and was composed of the following genera: Weissella, Leuconostoc, Gluconobacter, Pseudomonas, Pantoea, Erwinia and Klebsiella. Butyric and propionic acids, were not detected in any treatment A total of 47 different volatiles compounds have been identified. The coffee inoculated with yeast had a caramel flavor that was not detected in the control, as assessed by TDS. The use of starter cultures during coffee fermentation is an interesting alternative for obtaining a beverage quality with distinctive flavor. Copyright © 2014 Elsevier Ltd. All rights reserved.
IN VITRO INOCULATION OF ASPARAGUS OFFICINALIS TISSUE CULTURE SHOOTS WITH FUSARIUM PROLIFERA TUM
Directory of Open Access Journals (Sweden)
A.K.MoHD OMAR
1999-01-01
Full Text Available Artificially inoculated asparagus tissue culture plantlets with a virulent fungus, Fusarium proliferatum showed signs of infection as early as 4 days after inoculat ion. Macroscopic observations revealed presence of early symptoms such as necrotic lesions at the affected area and light microscopic examinations clearly revealed the post-penetration events that took place including the destruction of surrounding cells. However, little is known of the hyphal activity or advancement on the host's surface at the initial stage after inoculation. Scanning electron microscopic examination clearly revealed the hyphal advancement on the surface and the mode of entrance into the host tissues beneath. Four days after inoculation, the fungi proceeded to spread out from the inoculation point onto the host surface which eventually developed into a sparse network of both aerial and non-aerial hyphae. Non-aerial hyphae form a network of mycelium that adheres to the surface and it's movement appeared to be oriented towards the stomata. Hyphal penetration occurs more often through the stomata, natural openings or wounds. In some cases, the hyphae crossed over the stomatal opening w ithout entering the host tissues. At places where the cuticle layer is absent or not well developed the hyphae successfully grew in between the epidermal cells into the tissues beneath.
Peter R. Beckjord; Marla S. McIntosh; Edward Hacskaylo; John H. Jr. Melhuish; John H. Jr. Melhuish
1984-01-01
Basidiospores of the ectomycorrhizae-forming fungi Pisolithus tinctorius and Scleroderma auranteum incorporated into an organic hydrocolloid can be used successfully in field inoculation. Containerized loblolly pine seedlings were inoculated during outplanting by this method. This study showed that basidiospore chips were effective inocula in this investigation.
International Nuclear Information System (INIS)
Nur Fahana Jamahseri; Miradatul Najwa Mohd Rodhi; Nur Hidayah Zulkarnain; Nursyuhada Che Husain; Ahmad Fakhri Syahmi Masruddin
2014-01-01
This research aimed to discover the potential of inoculated Aquilaria malaccensis extract as a new and safe lipase inhibitor. The phenolic compounds in this plant are expected to promote inhibitory activity towards pancreatic lipase enzyme. Inoculated Aquilaria malaccensis was selected for this research, wherein the parts of this species (bark and leaves) were extracted via hydro distillation process. The extracts of this plant which are hydrosol, oil, and leaves were analyzed for phyto chemical compound via Fourier Transform Infrared Spectroscopy (FTIR). FTIR analysis of the extracts of inoculated Aquilaria malccensis revealed the presence of hydroxyl functional group in both leaves and hydrosol extracts but absence in oil. This validate the presence of phenolic compound in hydrosol and leaves extract. Therefore, the leaves and hydrosol extracts have potential as an anti-obesity agent by inhibiting pancreatic lipase. (author)
Directory of Open Access Journals (Sweden)
Paula Bianchet
2013-12-01
Full Text Available The use of diazotrophic bacteria as a biological input for the production of paddy rice can reduce nitrogen fertilizer applications and contribute to plant development. The use of mixed inoculants’ formulations can increase the efficiency of nitrogen fixation biological process. The objective of this study was to evaluate the effect of single and mixed formulations of inoculants with diazotrophic bacteria on the initial growth of paddy rice plants under different levels of N. The experiment was set in a greenhouse. Treatments consisted of four types of inoculation (no inoculation, inoculation with the isolated AI UDESC 27, inoculation with the isolated FE UDESC 22, and inoculation with the mixed formulation of isolated AI UDESC UDESC 27 and FE UDESC 22; and two levels of mineral nitrogen (30 and 60 mg kg-1 of N. The cultivar used was Epagri 109, which presents late maturity (over 140 days and high yield potential. Treatments were arranged in a factorial design (4 x 2 with five replicates. The experimental design was completely randomized. Inoculation with diazotrophic bacteria reduced by 18% and 26% shoot and root dry matter of rice plants, respectively. Plants also presented lower root area and volume when they were inoculated. There was no significant effect of inoculation and nitrogen rates on the number of leaves and tillers produced per plant or shoot nitrogen accumulation. The results showed that the isolated used in this work were not effective to stimulate shoot and root growth of cv Epagri 109, regardless of formulation type and rate of N.
International Nuclear Information System (INIS)
Layton, G; Lozano de Yunda, A; Chaparro, H
1999-01-01
In an experiment accomplished in the tree nursery Tisquesusa located in Madrid (Cundinamarca) was evaluated the effect of the inoculation with strains selected of foreign and Indigenous rhizobium and Arbuscular mycorrhizal fungi am (Glomus folescutolum) on the growth, nitrogen fixation, and micorrization of Acacia (Acacia decurrens) and Retamo (Teline monspessulana) that they are used In soils recovery by the Corporacion Autonoma Regional de Cundinamarca CAR. The studied species presented positive response to the inoculation with rhizobium; the indigenous strain DQ6-09, isolated in Guatavita (Cundinamarca), presented the better results in Retamo and also in Acacia alone and in mixture with the foreign strain T1881. The inoculation with fungi AM increased the heights, dry weights, phosphorus content and percentage of micorrization in Acacia and Retamo. The double inoculation with fungi ma and rhizobium it did not increase the nitrogen fixing of Acacia while in Retamo was presented a positive effect with the strain DQ6-09
Ważny, Rafał; Rozpądek, Piotr; Jędrzejczyk, Roman J; Śliwa, Marta; Stojakowska, Anna; Anielska, Teresa; Turnau, Katarzyna
2018-04-01
Phytoremediation of polluted sites can be improved by co-inoculation with mycorrhizal and endophytic fungi. In this study, the effects of single- and co-inoculation of Lactuca serriola with an arbuscular mycorrhizal (AM) fungus, Rhizoglomus intraradices, and endophytic fungi, Mucor sp. or Trichoderma asperellum, on plant growth, vitality, toxic metal accumulation, sesquiterpene lactone production and flavonoid concentration in the presence of toxic metals were evaluated. Inoculation with the AM fungus increased biomass yield of the plants grown on non-polluted and polluted substrate. Co-inoculation with the AM fungus and Mucor sp. resulted in increased biomass yield of plants cultivated on the polluted substrate, whereas co-inoculation with T. asperellum and the AM fungus increased plant biomass on the non-polluted substrate. In the presence of Mucor sp., mycorrhizal colonization and arbuscule richness were increased in the non-polluted substrate. Co-inoculation with the AM fungus and Mucor sp. increased Zn concentration in leaves and roots. The concentration of sesquiterpene lactones in plant leaves was decreased by AM fungus inoculation in both substrates. Despite enhanced host plant costs caused by maintaining symbiosis with numerous microorganisms, interaction of wild lettuce with both mycorrhizal and endophytic fungi was more beneficial than that with a single fungus. The study shows the potential of double inoculation in unfavourable environments, including agricultural areas and toxic metal-polluted areas.
Ceramic filters for bulk inoculation of nickel alloy castings
Directory of Open Access Journals (Sweden)
F. Binczyk
2011-07-01
Full Text Available The work includes the results of research on production technology of ceramic filters which, besides the traditional filtering function, playalso the role of an inoculant modifying the macrostructure of cast nickel alloys. To play this additional role, filters should demonstratesufficient compression strength and ensure proper flow rate of liquid alloy. The role of an inoculant is played by cobalt aluminateintroduced to the composition of external coating in an amount from 5 to 10 wt.% . The required compression strength (over 1MPa isprovided by the supporting layers, deposited on the preform, which is a polyurethane foam. Based on a two-level fractional experiment24-1, the significance of an impact of various technological parameters (independent variables on selected functional parameters of theready filters was determined. Important effect of the number of the supporting layers and sintering temperature of filters after evaporationof polyurethane foam was stated.
Directory of Open Access Journals (Sweden)
Marjatta Uosukainen
1994-05-01
Full Text Available The importance of different rooting methods and the effects of arbuscular mycorrhizal (AMF inoculation on the rooting rate, weaning survival and subsequent growth of microcuttings of Malus rootstock YP and the Finnish crab apple cultivars Hanna and Marjatta were studied in four experiments conducted at the Laukaa Research and Elite Plant Unit, Finland. Sucrose in the in vitro rooting medium gave the best support to weaning survival in comparision with glucose and fructose. Directly rooted microcuttings had a higher survival rate than in vitro rooted microcuttings. AMF inoculation did not improve the rooting rate in direct rooting. However, the Glomus hoi strain V98 caused severe rotting of microcuttings and thus lowered the rooting rate of cv. Hanna, AMF inoculation increased the mean shoot height of established plants, particularly inoculation with G. hoi V98, G. claroideum V43a or G. fistulosum V128. This effect, however, varied considerably in different host-fungus combinations. Some AMF strains, e.g. G. hoi V1O4, caused strong growth retardation. After the rooting and weaning stage, many uninoculated plants lapsed into arrest of growth. This phenomenon was less frequent in AMF inoculated plants. Optimal timing of AMF inoculation and nutritional level of rooting and weaning substrate are discussed.
International Nuclear Information System (INIS)
M-Arifin
2006-01-01
An experiment was carried out to study the immune response of cattle against fasciolopsis induced by inoculation of irradiated metacercariae of F. gigantic. Four groups of experimental cattle were used e.g: the first group (Vp) were inoculated by the unirradiated metacercariae as a positive control, the second group (Vi) were once inoculated with irradiated metacercariae and then challenged with the infected metacercariae three weeks later, the third group (Vii) were twice inoculated with irradiated metacercariae and then challenged with the infected metacercariae three weeks later, while the forth group (Vn), the negative control without any inoculation of metacercariae. Irradiation dose of 45 Gy was used, and each experimental animal received 700 live’s metacercariae of F. gigantic. The immune response towards fasciolopsis in cattle has been observed in the development of body weight, the number of red blood cells (RBC), the number of white blood cells (WBC), level of haemoglobin (Hb), percentages of Packed cell volume (PCV), the number of eosinophil cells, serological test by ELISA, pathology anatomic inspection and evaluation of the development of worm.The average every measurement of body weight development are Vp = 6 kg, Vi = 9 kg, Vii = 9 kg and Vn = 10 kg. The group of Vi, Vii and Vn were normal of their heart, but the group of Vp was disorder. The group of Vi, Vii and Vn were negative of adult worm’s, while the group of Vp was positive of adult worm’s. These results showed that inoculation of irradiated metacercariae F. gigantic could stimulate good immune response which was able to protect against the infectivity of the challenge in cattle. (author)
Effect of Microbial inoculation in combating the aluminium toxicity effect on growth of Zea mays.
Arora, P; Singh, G; Tiwari, A
2017-07-31
The present study is aimed at improving the aluminium tolerance in maize crop employing the potential of microbial inoculants in conferring resistance to these toxicities via production of certain chelating compounds like siderophores, exopolysachharides and organic acids. Acid soils have now-a-days become one of the key factors for limiting growth of many agriculturally important crops. Aluminium is one of the major elements present in acid soils and is mainly responsible for toxicity in the soil. This aluminium is rapidly soluble in soil water and hence absorbed by plant roots under conditions where soil pH is below 5. This toxicity leads to severe root growth inhibition, thereby limiting the production of maize crops. It was observed that use of microbial inoculums can be helpful in elimination of these toxic compounds and prevent the inhibition of root growth . It was found that the soils contaminated with aluminium toxicity decreased the root length of maize plant significantly by 65% but Bacillus and Burkholderia inoculation increased this root length significantly by 1.4- folds and 2- folds respectively thereby combating the effect of aluminium toxicity. Aluminium concentration was found maximum in roots of plants which were grown under aluminium stress condition. But this aluminium accumulation decreased ̴ 2-folds when Burkholderia was used as seed inoculants under aluminium stress conditions. Also, at 60mM aluminium accumulation, phosphorus solubilisation in roots was found to be increased upto 30% on Burkholderia inoculation. However, Bacillus inoculation didn't show any significant difference in either of the case. Thus, the inoculation of seeds with Burkholderia isolates could prove to be a boon in sequestering aluminium toxicity in Zea mays.
Effects of bacterial inoculation on the fermentation characteristics ...
African Journals Online (AJOL)
The effect of bacterial inoculation on the fermentation and aerobic stability of two ensiled whole plant soybean (WPSB) cultivars was determined in a 2 x 2 factorial design. Two WPSB cultivars, Link LF6466 and Pannar 522 RR, were harvested at their R6 growth stage, chopped to 25 mm and ensiled in 1.5 L anaerobic jars.
Vanessa, Álvarez-López; Ángeles, Prieto-Fernández; Sergio, Roiloa; Beatriz, Rodríguez-Garrido; Rolf, Herzig; Markus, Puschenreiter; Susan, Kidd Petra
2017-03-01
We evaluated the effect of compost amendment and/or bacterial inoculants on the growth and metal accumulation of Salix caprea (clone BOKU 01 AT-004) and Nicotiana tabacum (in vitro-bred clone NBCu10-8). Soil was collected from an abandoned Pb/Zn mine and rhizobacterial inoculants were previously isolated from plants growing at the same site. Plants were grown in untreated or compost-amended (5% w/w) soil and were inoculated with five rhizobacterial strains. Non-inoculated plants were also established as a control. Compost addition increased the shoot DW yield of N. tabacum but not S. caprea, while it decreased soil metal availability and lowered shoot Cd/Zn concentrations in tobacco plants. Compost amendment enhanced the shoot Cd/Zn removal due to the growth promotion of N. tabacum or to the increase in metal concentration in S. caprea leaves. Bacterial inoculants increased photosynthetic efficiency (particularly in N. tabacum) and sometimes modified soil metal availability, but this did not lead to a significant increase in Cd/Zn removal. Compost amendment was more effective in improving the Cd and Zn phytoextraction efficiency than bioaugmentation.
Khalid, Muhammad; Bilal, Muhammad; Hassani, Danial; Iqbal, Hafiz M N; Wang, Hang; Huang, Danfeng
2017-12-01
Salinity is one of the increasingly serious environmental problems worldwide for cultivating agricultural crops. The present study was aimed to ascertain the potential of beneficial soil bacterium Azospirillum brasilense to alleviate saline stress in Trifolium repens. Experimental plants (white clover) were grown from seeds and inoculated with or without A. brasilense bacterial strain supplemented with 0, 40, 80, or 120 mM NaCl into soil. The growth attributes including, shoot heights, root lengths, fresh and dry weights, leaf area and chlorophyll content were significantly enhanced in T. repens plants grown in A. brasilense inoculated soil than un-inoculated controls, particularly under elevated salinity conditions (40, 80 and 120 mM NaCl). Malondialdehyde content of leaf was recorded to be declined under saline conditions. Moreover, the K + /Na + ratio was also improved in bacterium-inoculated plants, since A. brasilense significantly reduced the root and shoot Na + level under high salty environment. Results revealed that soil inoculation with A. brasilense could significantly promote T. repens growth under both non-saline and saline environments, and this study might be extended to other vegetables and crops for the germination and growth enhancement.
Directory of Open Access Journals (Sweden)
Lin, XG.
1993-01-01
Full Text Available Investigation on the effect of phosphorus on vesicular-arbuscular mycorrhizal infection, and dual inoculation of vesicular-arbuscular mycorrhizae + rhizobium on growth of white clover under field microplots and pot experiments was conducted on fluvo-aquic soils of semi-arid region in north China. The results showed that 60 kg P205 ha in form of superphosphate was the most favorable phosphorus level for vesicular-arbuscular mycorrhizal infection ; mycorrhizal infection, nodulation, dry weight of shoots and roots, total uptake of nitrogen, phosphorus and other elements, the final yields and recovery of phosphorus of white clover were significantly increased by vesicular-arbuscular mycorrhizal inoculation and dual inoculation with vesicular-arbuscular mycorrhizal fungi and rhizobium. The highest response of inoculation was obtained by adding fertilizer phosphorus at the level of 60 kg P205 ha in form of superphosphate.
Effect of salinity and inoculation with Azosprillium on carbohydrate ...
African Journals Online (AJOL)
The measured parameters were chlorophyll fluorescence, photosynthesis (Ps) rates, carbohydrates, nitrate, ammonium and protein content, nitrogenase activity, yield and yield components. The results showed that salinity decreased plant height and grain yield (GY) in all levels. GY reduction in the inoculated treatment was ...
Inoculation of peritoneal dialysate fluid into blood culture bottles ...
African Journals Online (AJOL)
The aim of the study was to determine if direct inoculation of peritoneal fluid into Bactec blood culture bottles would improve the positive bacteriological yield compared with conventional techniques in continuous ambulatory peritoneal dialysis (CAPD) patients with peritonitis. All patients presenting with suspected peritonitis ...
Low pathogenicity avian influenza viruses infect chicken layers by different routes of inoculation.
Pantin-Jackwood, Mary J; Smith, Diane M; Wasilenko, Jamie L; Spackman, Erica
2012-06-01
In order to develop better control measures against avian influenza, it is necessary to understand how the virus transmits in poultry. In a previous study in which the infectivity and transmissibility of the pandemic H1N1 influenza virus was examined in different poultry species, we found that no or minimal infection occurred in chicken and turkeys intranasally (IN) inoculated with the virus. However, we demonstrated that the virus can infect laying turkey hens by the intracloacal (IC) and intraoviduct (IO) routes, possibly explaining the drops in egg production observed in turkey breeder farms affected by the virus. Such novel routes of exposure have not been previously examined in chickens and could also explain outbreaks of low pathogenicity avian influenza (LPAI) that cause a decrease in egg production in chicken layers and breeders. In the present study, 46-wk-old specific-pathogen-free chicken layers were infected by the IN, IC, or IO routes with one of two LPAI viruses: a poultry origin virus, A/chicken/CA/1255/02 (H6N2), and a live bird market isolate, A/chicken/NJ/12220/97 (H9N2). Only hens IN inoculated with the H6N2 virus presented mild clinical signs consisting of depression and anorexia. However, a decrease in number of eggs laid was observed in all virus-inoculated groups when compared to control hens. Evidence of infection was found in all chickens inoculated with the H6N2 virus by any of the three routes and the virus transmitted to contact hens. On the other hand, only one or two hens from each of the groups inoculated with the H9N2 virus shed detectable levels of virus, or seroconverted and did not transmit the virus to contacts, regardless of the route of inoculation. In conclusion, LPAI viruses can also infect chickens through other routes besides the IN route, which is considered the natural route of exposure. However, as seen with the H9N2 virus, the infectivity of the virus did not increase when given by these alternate routes.
Leaf and neck anthracnose caused by Colletotrichum coccodes is a new disease of onion in Michigan. To test the effect of inoculation method, ‘Prince’ onion seedlings were grown in the greenhouse and inoculated with either a conidial suspension of C. coccodes (alone or with an abrasive agent) or infe...
Lan, Shubin; Zhang, Qingyi; Wu, Li; Liu, Yongding; Zhang, Delu; Hu, Chunxiang
2014-01-01
Desertification has been recognized as a global environmental problem, and one region experiencing ongoing desertification is the eastern edge of Qubqi Desert (Inner Mongolia). To investigate the facilitating effects of cyanobacterial inoculation technology on the desertification control along this steppe-desert transition region, artificial cyanobacterial crusts were constructed with two filamentous cyanobacteria 3 and 8 years ago combined with Salix planting. The results showed that no crusts formed after 3 years of fixation only with Salix planting, whereas after cyanobacterial inoculation, the crusts formed quickly and gradually succeed to moss crusts. During that course, topsoil environments were gradually improved, providing the necessary material basis for the regeneration of vascular plants. In this investigation, total 27 species of vascular plants had regenerated in the experimental region, mainly belonging to Asteraceae, Poaceae, Chenopodiaceae and Leguminosae. Using space time substitution, the dominant species along with the application of cyanobacterial inoculation technology succeeded from Agriophyllum squarrosum ultimately to Leymus chinensis. In addition, it was found that the shady side of the dunes is more conducive to crust development and succession of vegetation communities. Conclusively, our results indicate artificial cyanobacterial inoculation technology is an effective and desirable path for desertification control.
Directory of Open Access Journals (Sweden)
simin irankhah
2017-02-01
Full Text Available Introduction: Fenugreek (Trigonellafoenum-graecum L. is a traditional medicinal plant belonging to the legume family Fabaceae. Diverse groups of microorganisms are symbiotic with Fenugreek roots system. This integration leads to significant increases in the development and production by increasing nitrogen fixation, phytohormones production, siderophores and phosphate solubilization. Plant growth-promoting bacteria increase plant growth byimproving nutrientuptake and phytohormones production. In addition, the beneficial effect of these bacteria could be due totheirinteractionwithArbuscularMycorrhizal fungi(VAM. Drought is one of the major limiting factors for crop production in many parts of the world including Iran. Symbiotic microorganisms can enhance plant tolerance to drought. This experiment was carried out to investigate the effect of Vesicular ArbuscularMycorrhiza (VAM and Plant Growth Promoting Rhizobacteria (PGPR on morphological and biochemical characteristics of Fenugreek in drought stress conditions. Materials and Methods: The experiment was carried out in completely random design with 3 replications.There were four treatments including inoculation with Pseudomonas putida, inoculation with Glomusintraradices, combined association of Pseudomonas putida and Glomusintraradices and untreated as a check under drought stress (40% of field capacity and non-stress conditions (80% of field capacity. In this experiment fiveseeds were sowninplastic pots. Before sowing, seeds were inoculated with microorganisms. In order to inoculation ofseed with Mycorrhizal fungi, for each kilogram of soil, 100 grams of powder containing 10 to 15 thousand spores of fungal soil (produced by the biotech company Toos was added to three centimeters of soil in the pot. For seed inoculation with Plant Growth Promoting Rhizobacteria, the growth curve of the bacteria was drawn at first and then the best time for the growth of bacteria was determined. The bacteria at
International Nuclear Information System (INIS)
TRD Larasati; N Mulyana; D Sudradjat
2016-01-01
This research was conducted to evaluate the capability of functional microbial inoculants to remediate drylands. The microbial inoculants used consist of hydrocarbon-degrading microbial inoculants and plant-growth-promoting microbial inoculants. Compost-based carrier was sterilized by a gamma irradiation dose of 25 kGy to prepare seed inoculants. The irradiated-compost-based hydrocarbon-degrading microbial inoculants and king grass (Pennisetum purpureum Schumach.) were used to remediate oil-sludge-contaminated soil using in-situ composting for 60 days. The results showed that they could reduce THP (total petroleum hydrocarbons) by up to 82.23%. Plant-growth-promoting microbial inoculants were able to increase the dry weight of king grass from 47.39 to 100.66 g/plant, N uptake from 415.53 to 913.67 mg/plant, and P uptake from 76.52 to 178.33 mg/plant. Cow dung and irradiated-compost-based plant-growth-promoting microbial inoculants were able to increase the dry weight of maize (Zea mays L.) from 5.75 to 6.63 ton/ha (12.54%) and dry weight of grain potential from 5.30 to 7.15 ton/ha (35.03%). The results indicate that irradiated-compost-based microbial inoculants are suitable for remediating a dryland and therefore increase potential resources and improve the quality of the environment. (author)
International Nuclear Information System (INIS)
ElHassan, G.A.; Focht, D.D.
1986-01-01
Soil that contained 15 N enriched organic matter (0.461 % 15 N) was used to determine competitiveness of six strains at different logarithmic inoculum densities against indigenous rhizobia and against a previous surviving inoculant (strain P132). Analyses of N content of plant tissues by direct 15 N technique showed that cowpeas (Vigna unguiculata L. Walp.) were capable of deriving 60 to 98% of shoot N from N 2 fixation. The two fast-growing strains (176A26 and 176A28) were poorer competitors and fixed less N 2 compared to the other slow-growing strains. Inoculum density had no effect upon yield response of cowpeas, but inoculation with strains P132, 401, and 22A1 effected greater seed yield, shoot dry matter, total N, and percentage of N derived from fixation (86-98%) than other strains and the uninoculated control (60-73%). By contrast, N 2 fixation and yield parameters in inoculated cowpeas were not significantly different from inoculated controls that contained residual P132 from a previous inoculum study. The higher hydrogen uptake (Hup) efficiency of nodules containing residual P132 (98 ± 2%) facilitated presumptive identification of P132 (100% ± 0 Hup efficiency axenically) as the surviving and infecting inoculant strain since nodules infected by indigenous rhizobia had lower Hup efficiencies (88 ± 2%)
Directory of Open Access Journals (Sweden)
N. Krishnakumar
2012-11-01
Full Text Available Open cast mining for bauxite at Yercaud hills (India resulted indegradation of forest ecosystem and production of large quantities of waste rocks (called mine spoils. To ameliorate mine spoils, topsoil is used to spread over before the planting of tree species, conventional method as the topsoil has a good structure, water holding capacity and beneficial microbes like Arbuscular Mycorrhizal (AM fungi essential for plant growth.However, the use of top soil is expensive and in this study bauxite mine spoils were reforestated with AM fungi instead of it. The beneficial microbes AM fungi (Glomus aggregatum Schenck & Smith, G. fasciculatum(Thatcher Gerd. & Trappe emend. Walker & Koske, G. geosporum(Nicol. & Gerd. Walker were isolated, cultured and inoculated into the seedlings of Eucalyptus tereticornis Sm. and grown in bauxite mine spoils as potting medium under nursery conditions. Then, the biomass improved seedlings of E. tereticornis with inoculation of AM fungi were directly transplanted at bauxite mine spoils. After transplantation of the seedlings at bauxite mine spoils, the growth and survival rate were monitored for two years. The AM fungi inoculated seedlings of E. tereticornis showed 95% survival over the control seedlings and their growth was also significantlyhigher. Tissue nutrients (N, P, K were also found higher inAM fungi inoculated E. tereticornis than un inoculated control seedlings.
Directory of Open Access Journals (Sweden)
A. Karthikeyan
2012-12-01
Full Text Available Open cast mining for bauxite at Yercaud hills (India resulted in degradation of forest ecosystem and production of large quantities of waste rocks (called mine spoils. To ameliorate mine spoils, topsoil is used to spread over before the planting of tree species, conventional method as the topsoil has a good structure, water holding capacity and beneficial microbes like Arbuscular Mycorrhizal (AM fungi essential for plant growth. However, the use of top soil is expensive and in this study bauxite mine spoils were reforestated with AM fungi instead of it. The beneficial microbes AM fungi (Glomus aggregatum Schenck & Smith, G. fasciculatum (Thatcher Gerd. & Trappe emend. Walker & Koske, G. geosporum (Nicol. & Gerd. Walker were isolated, cultured and inoculated into the seedlings ofEucalyptus tereticornis Sm. and grown in bauxite mine spoils as potting medium under nursery conditions. Then, the biomass improved seedlings of E. tereticornis with inoculation of AM fungi were directly transplanted at bauxite mine spoils. After transplantation of the seedlings at bauxite mine spoils, the growth and survival rate were monitored for two years. The AM fungi inoculated seedlings ofE. tereticornis showed 95% survival over the control seedlings and their growth was also significantly higher. Tissue nutrients (N, P, K were also found higher in AM fungi inoculated E. tereticornis than un inoculated control seedlings.
Directory of Open Access Journals (Sweden)
Lisa A. Beirn
2015-08-01
Full Text Available The fungus Colletotrichum cereale incites anthracnose disease on Poa annua (annual bluegrass turfgrass. Anthracnose disease is geographically widespread throughout the world and highly destructive to cool-season turfgrasses, with infections by C. cereale resulting in extensive turf loss. Comprehensive research aimed at controlling turfgrass anthracnose has been performed in the field, but knowledge of the causal organism and its basic biology is still needed. In particular, the lack of a reliable greenhouse-based inoculation protocol performed under controlled environmental conditions is an obstacle to the study of C. cereale and anthracnose disease. Our objective was to develop a consistent and reproducible inoculation protocol for the two major genetic lineages of C. cereale. By adapting previously successful field-based protocols and combining with components of existing inoculation procedures, the method we developed consistently produced C. cereale infection on two susceptible P. annua biotypes. Approximately 7 to 10 days post-inoculation, plants exhibited chlorosis and thinning consistent with anthracnose disease symptomology. Morphological inspection of inoculated plants revealed visual signs of the fungus (appressoria and acervuli, although acervuli were not always present. After stringent surface sterilization of inoculated host tissue, C. cereale was consistently re-isolated from symptomatic tissue. Real-time PCR detection analysis based on the Apn2 marker confirmed the presence of the pathogen in host tissue, with both lineages of C. cereale detected from all inoculated plants. When a humidifier was not used, no infection developed for any biotypes or fungal isolates tested. The inoculation protocol described here marks significant progress for in planta studies of C. cereale, and will enable scientifically reproducible investigations of the biology, infectivity and lifestyle of this important grass pathogen.
Directory of Open Access Journals (Sweden)
Fernando Shintate Galindo
2017-08-01
Full Text Available Azospirillum brasilense is a bacterium known for its biological nitrogen fixation (BNF in corn crops. However, there is a lack of comprehensive research defining how much mineral N should be applied to maximize the efficiency of BNF and attain high, economically sustainable yields. Moreover, it would be interesting to investigate whether adding urea with NBPT urease inhibitor might increase BNF in grasses. Therefore, the aim of this study was to determine the effect of inoculation with Azospirillum brasilense associated with N sources and doses in a Cerrado biome soil by evaluating the grain yield of irrigated corn in economic terms. The experiment was conducted in Selvíria, MS, Brazil under a no-till system on a Latossolo Vermelho distrófico (Oxisol. The experiment was set up as a randomized block design with four replications in a 2 × 5 × 2 factorial arrangement consisting of two sources of N (urea and urea with NBPT urease enzyme inhibitor and five N doses applied as top-dressing (0, 50, 100, 150, and 200 kg ha-1, with and without the inoculation of seeds with A. brasilense. Inoculation with Azospirillum brasilense makes corn growth much more profitable, irrespective of the dose and source of N. Addition of 200 kg ha-1 N in the form of conventional urea coupled with inoculation with Azospirillum brasilense increases grain yield; however, the highest economic return is obtained with N applied at 100 kg ha-1 with conventional urea and inoculation.
Directory of Open Access Journals (Sweden)
Fernando Shintate Galindo
2017-05-01
Full Text Available Azospirillum brasilense plays an important role in biological nitrogen fixation (BNF in grasses. However, further studies are needed to define how much mineral N can be applied while simultaneously maintaining BNF contribution and maximizing crop yield and to determine the impact of these practices on soil fertility. Thus, we aimed to investigate the effect of inoculation with A. brasilense, in conjunction with varying N doses and sources in a Cerrado soil, on soil chemical attributes after two years of irrigated wheat production. The experiment was initiated in Selvíria - MS under no-tillage production in an Oxisol in 2014 and 2015. The experimental design was a randomized block design with four replications, and treatments were arranged in a 2 x 5 x 2 factorial arrangement as follows: two N sources (urea and Super N - urea with inhibitor of the enzyme urease NBPT (N - (n-butyl thiophosphoric triamide, five N rates (0, 50, 100, 150 and 200 kg ha-1, and with or without seed inoculation with A. brasilense. The increase in N rates did not influence the chemical soil attributes. Super N acidified the soil more compared to urea. A. brasilense inoculation reduced the effect of soil acidification in intensive irrigated wheat cultivation; however, the base extraction was higher, resulting in a lower soil CEC after cultivation with inoculation. Therefore, the cultivation of wheat inoculated with A. brasilense was not harmful to soil fertility because it did not reduce the base saturation and organic matter content (P, K, Ca, Mg, and S.
Cell viability of mycorrhiza helper bacteria solid inoculant in different carrier material
Asyiah, Iis Nur; Hindersah, Reginawanti; Harni, Rita
2018-02-01
Roots of food crops are colonized by nonpathogenic mycorrhizal fungi which show natural ability to control plant pathogen. Mycorrhizal establishment in plant roots is affected by rhizobacteria, known as mycorrhiza helper bacteria (MHB), which has synergetic effects on mycorrhizal associations. Laboratory experiment has been conducted to assess the best carrier material to develop well-qualified MHB of Pseudomonas diminuta and Bacillus subtilis solid inoculant. Carrier materials were 100 mesh organic matter of agricultural waste. Different spore concentration of both bacterial liquid inoculants were grown on three kinds of 100-mesh organic matter and stored at room temperature up to 90 days. Cell viability of both MHB were counted by serial dilution plate method by using specific medium. The results showed that sugar cane baggase ash was the best carrier material to maintain cell viability for both MHB. However, the population of Pseudomonas diminuta and Bacillus subtilis in sugar cane baggase ash were slightly decreased after 90 days. The use of sugarcane baggase ash for solid MHB inoculant development could be suggested.
Effects of genotype x bradyrhizobium inoculation or x fertilizer n ...
African Journals Online (AJOL)
Genotype x inoculation interaction was significant only for protein and oil content in one year. .... main-plot factor. ... components and expected genetic gains invoiving yield srrnin. ... Combined analysis of the cu ltivar experiment was carried.
Bovine babesiosis. Protection of cattle by the inoculation of irradiated piroplasms
International Nuclear Information System (INIS)
Purnell, R.E.; Lewis, D.; Brocklesby, D.W.
1980-01-01
A series of experiments is described in which the effects of irradiation on the infectivity of intra-erythrocytic piroplasms of Babesia divergens and B. major for cattle were investigated. Initially blood was taken from infected animals and stabilates of strains of the parasites were made and cryopreserved in an ultra-low deep-freeze. For each experiment, an aliquot of stabilate was inoculated into a splenectomized pre-donor calf and when this animal has a patent parasitaemia, a donor calf was infected by subinoculation. Blood was taken from the donor calf when 5 to 10% of its erythrocytes contained parasites. In the first two experiments, the parasites were titrated in groups of three splenectomized calves and it was seen that the strains maintained their pathogenic identities. Increasing dilution of the infective blood simply resulted in linear extension of the prepatent period. In the next pair of experiments, infected blood from the donor calves was irradiated at doses of 24 to 40 kilorads before inoculation into splenectomized calves. In these experiments irradiation has a marked effect on the pathogenic identity of the parasites. Not only were the prepatent periods extended, but animals receiving piroplasms irradiated at 24 and 28 kilorads had mild reactions whereas those receiving piroplasms irradiated at 36 and 40 kilorads had no overt reactions. Some animals receiving blood irradiated at 32 kilorads had mild reactions, others had none. On challenge the animals which had mild reactions were solidly immune and those having no reactions had limited protection. In the final pair of experiments intact calves received parasites irradiated at these same dose levels and the results were virtually identical. It was difficult to provoke severe reactions in intact animals to inoculation of infected blood, but the protection engendered by inoculation of irradiated piroplasms was clearly demonstrable. (author)
Effects of inoculating Lachnum and Cadophora isolates on the growth of Vaccinium corymbosum.
Bizabani, Christine; Dames, Joanna
2015-12-01
The roots of ericaceous plants harbour a diversity of fungal taxa, which confer eco-physiological benefits to the host. Some of the fungi have been established to form ericoid mycorrhizal (ERM) associations and enhance plant growth in certain ericaceous genera. Although, Lachnum and Cadophora isolates have frequently been identified from the roots of this family, the status of their association and functional roles is still vague. The aims of this study were to identify Lachnum and Cadophora isolates; determine the root-fungal interactive structures formed in associations with Vaccinium corymbosum L. (blueberry) hosts and to examine inoculation effects of the fungal associates using several varieties of the blueberry. Lachnum and Cadophora were isolated and identified from Erica cerinthoides L. and Erica demmissa Klotzsch ex Benth using morphological and molecular techniques. Micropropagated blueberry varieties (Bluecrop, Elliott, Spartan, Chandler and Brightwell) were inoculated with respective fungi and plant growth evaluated. Both fungi colonised the roots and did not have any pathogenic effect. Lachnum isolate did not form any particular mycorrhizal structures whereas; Cadophora inoculated plants showed typical ericoid mycorrhizal coils. Inoculation with both fungi enhanced the shoot growth of Brightwell and Elliott varieties. However neutral effects were observed in the remaining varieties. In conclusion, Cadophora and Lachnum isolates have potential to promote growth of selected blueberry varieties. Copyright © 2015 Elsevier GmbH. All rights reserved.
Inoculant production in developing countries - Problems, potentials and success
International Nuclear Information System (INIS)
Kannaiyan, S.
2001-01-01
Sustainable agriculture is a long-term goal that seeks to overcome some of problems and constraints that confront the economic viability, environmental soundness and social acceptance of agricultural production systems. In this context, bio-fertilizers assume special significance particularly because they are 'eco-friendly', but also since their alternative, chemical fertilizers are expensive. Undoubtedly, the most commonly used bio-fertilizers are soil bacteria of the genus Rhizobium, but others like Azolla, Azospirillum, various cyanobacteria also contribute significant amounts of N to e.g. rice. Other bacteria like Frankia and Acetobacter contribute N to trees of the genus Casuarina and sugarcane, respectively. Furthermore, although they are rarely used as inoculants, vesicular arbuscular mycorrhizae (VAM) and phosphobacteria help countless plants solubilise and assimilate soil phosphorus. Despite these advantages, bio-fertilizers could be more widely used in developing countries. Contingent upon greater use is improved quality of the inoculants, and all aspects of their production are discussed here. (author)
Sohn, B.K.; Kim, K.Y.; Chung, S.J.; Kim, W.S.; Park, S.M.; Kang, J.G.; Rim, Y.S.; Cho, J.S.; Kim, T.H.; Lee, J.H.
2003-01-01
Plant growth and flower quality of an ornamental plant (Chrysanthemum morifolium Ramat) var. Baekgwang in response to the different timing of arbuscular mycorrhizal fungi (AMF) inoculation were examined. To evaluate the effects of AMF inoculation timing on growth of chrysanthemum cuttings, AMF was
Franco, Albina R; Sousa, Nadine R; Ramos, Miguel A; Oliveira, Rui S; Castro, Paula M L
2014-11-01
Ectomycorrhizal fungi (ECMF) play an important role in forest ecosystems, often mitigating stress factors and increasing seedling performance. The aim of this study was to investigate the effects of a nursery inoculation on Pinus pinaster growth and on the fungal communities established when reforesting burned areas. Inoculated P. pinaster saplings showed 1.5-fold higher stem height than the non-inoculated controls after a 5 year growth period, suggesting that fungal inoculation could potentiate tree growth in the field. Ordination analysis revealed the presence of different ECMF communities on both plots. Among the nursery-inoculated fungi, Laccaria sp., Rhizopogon sp., Suillus bovinus and Pisolithus sp. were detected on inoculated Pinus saplings on both sampling periods, indicating that they persisted after field establishment. Other fungi were also detected in the inoculated plants. Phialocephala sp. was found on the first assessment, while Terfezia sp. was detected on both sampling periods. Laccaria sp. and Rhizopogon sp. were identified in the control saplings, belonging however to different species than those found in the inoculated plot. Inocybe sp., Thelephora sp. and Paxillus involutus were present on both sampling periods in the non-inoculated plots. The results suggest that ECMF inoculation at nursery stage can benefit plant growth after transplantation to a post-fire site and that the inoculated fungi can persist in the field. This approach has great potential as a biotechnological tool to aid in the reforestation of burned areas.
Directory of Open Access Journals (Sweden)
Aleksandra Ledwoń
2014-01-01
Full Text Available Beak and feather disease virus- (BFDV- positive (naturally infected but clinically healthy budgerigars (Melopsittacus undulatus were inoculated with two isolates of Mycobacterium avium subsp. avium isolated from naturally infected golden pheasant (Chrysolophus pictus and peafowl (Pavo cristatus. During a period of more than two months after inoculation, samples of cloacal and crop swabs, faeces, and blood were obtained for BFDV and Mycobacterium avium testing with PCR. Birds were euthanized nine weeks after inoculation. All infected budgerigars developed signs typical of mycobacteriosis, but more advanced clinical and pathological changes were visible in the group infected with the pheasant isolate. Only a few cloacal and crop swab samples were positive for Mycobacterium avium subsp. avium despite advanced pathological changes in the internal organs. In the groups infected with mycobacterium isolates the frequency of BFDV-positive samples was higher than in the control group. In the infected groups the frequency of BFDV was substantially higher in the cloacal swabs of birds inoculated with the pheasant isolate than in the peafowl-isolate-infected group.
Ledwoń, Aleksandra; Sapierzyński, Rafał; Augustynowicz-Kopeć, Ewa; Szeleszczuk, Piotr; Kozak, Marcin
2014-01-01
Beak and feather disease virus- (BFDV-) positive (naturally infected) but clinically healthy budgerigars (Melopsittacus undulatus) were inoculated with two isolates of Mycobacterium avium subsp. avium isolated from naturally infected golden pheasant (Chrysolophus pictus) and peafowl (Pavo cristatus). During a period of more than two months after inoculation, samples of cloacal and crop swabs, faeces, and blood were obtained for BFDV and Mycobacterium avium testing with PCR. Birds were euthanized nine weeks after inoculation. All infected budgerigars developed signs typical of mycobacteriosis, but more advanced clinical and pathological changes were visible in the group infected with the pheasant isolate. Only a few cloacal and crop swab samples were positive for Mycobacterium avium subsp. avium despite advanced pathological changes in the internal organs. In the groups infected with mycobacterium isolates the frequency of BFDV-positive samples was higher than in the control group. In the infected groups the frequency of BFDV was substantially higher in the cloacal swabs of birds inoculated with the pheasant isolate than in the peafowl-isolate-infected group.
International Nuclear Information System (INIS)
Liu, C.Y.; Wu, Q.S.
2014-01-01
A potted experiment was conducted to evaluate the effects of an arbuscular mycorrhizal fungus (AMF), Glomus mosseae, on growth performance and superoxide dismutase (SOD) and catalase (CAT) activities of citrus (Citrus tangerina) seedlings. After five months of AMF inoculation, mycorrhizal colonization and vesicles, but not arbuscules and entry points, increased with the increase of inoculated mycorrhizal dosages among 5-40 g (32 spores/g dosage). Mycorrhizal inoculation with 10-40 g dosages significantly increased plant growth traits, including plant height, stem diameter, and shoot, root and total fresh weights. Higher leaf chlorophyll content was found in all the mycorrhizal plants, compared with the non-mycorrhizal plants. Inoculation with G. mosseae markedly decreased SOD and CAT activities of leaf and root, except an increase of either root CAT with the 20 g mycorrhizal treatment or root SOD with the 20 and 40 g mycorrhizal treatments. In addition, mycorrhizal colonization and vesicles significantly positively correlated with root SOD and without root CAT. We also discussed the relationships between mycorrhizal effects on antioxidant enzymes and growth environment of host plants. (author)
Silva, Luís R; Azevedo, Jessica; Pereira, Maria J; Carro, Lorena; Velazquez, Encarna; Peix, Alvaro; Valentão, Patrícia; Andrade, Paula B
2014-01-22
Peppers (Capsicum spp.) are consumed worldwide, imparting flavor, aroma, and color to foods, additionally containing high concentrations of biofunctional compounds. This is the first report about the effect of the inoculation of two Rhizobium strains on sterols, triterpenes, fatty acids, and volatile compounds of leaves and fruits of pepper (Capsicum annuum L.) plants. Generally, inoculation with strain TVP08 led to the major changes, being observed a decrease of sterols and triterpenes and an increase of fatty acids, which are related to higher biomass, growth, and ripening of pepper fruits. The increase of volatile compounds may reflect the elicitation of plant defense after inoculation, since the content on methyl salicylate was significantly increased in inoculated material. The findings suggest that inoculation with Rhizobium strains may be employed to manipulate the content of interesting metabolites in pepper leaves and fruits, increasing potential health benefits and defense abilities of inoculated plants.
Nabeshima, Tomoyuki; Doi, Motoaki; Hosokawa, Munetaka
2016-08-01
Agroinfiltration was tested as a method of inoculation of chrysanthemum plants with chrysanthemum stunt viroid (CSVd). Binary vectors harboring dimeric CSVd sequences in sense and antisense orientations were constructed, and Agrobacterium transfected with these binary vectors was infiltrated into chrysanthemum leaves. Northern blotting and reverse transcription polymerase chain reaction analysis showed that local infection was established within 7 days and systemic infection within 20 days. CSVd polarities showed no difference in infectivity. This study showed that agroinfiltration of chrysanthemum plants is an easy, rapid, and cost-effective method for CSVd inoculation. Copyright © 2016 Elsevier B.V. All rights reserved.
Florio, Alessandro; Pommier, Thomas; Gervaix, Jonathan; Bérard, Annette; Le Roux, Xavier
2017-08-21
Maize inoculation by Azospirillum stimulates root growth, along with soil nitrogen (N) uptake and root carbon (C) exudation, thus increasing N use efficiency. However, inoculation effects on soil N-cycling microbial communities have been overlooked. We hypothesized that inoculation would (i) increase roots-nitrifiers competition for ammonium, and thus decrease nitrifier abundance; and (ii) increase roots-denitrifiers competition for nitrate and C supply to denitrifiers by root exudation, and thus limit or benefit denitrifiers depending on the resource (N or C) mostly limiting these microorganisms. We quantified (de)nitrifiers abundance and activity in the rhizosphere of inoculated and non-inoculated maize on 4 sites over 2 years, and ancillary soil variables. Inoculation effects on nitrification and nitrifiers (AOA, AOB) were not consistent between the three sampling dates. Inoculation influenced denitrifiers abundance (nirK, nirS) differently among sites. In sites with high C limitation for denitrifiers (i.e. limitation of denitrification by C > 66%), inoculation increased nirS-denitrifier abundance (up to 56%) and gross N 2 O production (up to 84%), likely due to increased root C exudation. Conversely, in sites with low C limitation (<47%), inoculation decreased nirS-denitrifier abundance (down to -23%) and gross N 2 O production (down to -18%) likely due to an increased roots-denitrifiers competition for nitrate.
Directory of Open Access Journals (Sweden)
Xiang Gao
Full Text Available Soybean red crown rot is a major soil-borne disease all over the world, which severely affects soybean production. Efficient and sustainable methods are strongly desired to control the soil-borne diseases.We firstly investigated the disease incidence and index of soybean red crown rot under different phosphorus (P additions in field and found that the natural inoculation of rhizobia and arbuscular mycorrhizal fungi (AMF could affect soybean red crown rot, particularly without P addition. Further studies in sand culture experiments showed that inoculation with rhizobia or AMF significantly decreased severity and incidence of soybean red crown rot, especially for co-inoculation with rhizobia and AMF at low P. The root colony forming unit (CFU decreased over 50% when inoculated by rhizobia and/or AMF at low P. However, P addition only enhanced CFU when inoculated with AMF. Furthermore, root exudates of soybean inoculated with rhizobia and/or AMF significantly inhibited pathogen growth and reproduction. Quantitative RT-PCR results indicated that the transcripts of the most tested pathogen defense-related (PR genes in roots were significantly increased by rhizobium and/or AMF inoculation. Among them, PR2, PR3, PR4 and PR10 reached the highest level with co-inoculation of rhizobium and AMF.Our results indicated that inoculation with rhizobia and AMF could directly inhibit pathogen growth and reproduction, and activate the plant overall defense system through increasing PR gene expressions. Combined with optimal P fertilization, inoculation with rhizobia and AMF could be considered as an efficient method to control soybean red crown rot in acid soils.
Weinberg, Z G; Chen, Y; Volchinski, V; Sela, S; Ogunade, I M; Adesogan, A
2016-07-01
Previous studies have shown that silages treated with lactic acid bacteria (LAB) inoculants enhance ruminants' performance. The objective of the current experiments was to develop an in vitro model to study interactions between LAB silage inoculants and inoculated silages and Escherichia coli (EC) in rumen fluid (RF). Our hypothesis was that some inoculants inhibit EC in RF. For that purpose buffered RF was incubated under anaerobic conditions at 39°C with commercial strains of LAB silage inoculants or with laboratory corn and wheat silages treated with these LAB, an EC strain and with various ruminant feed ingredients. The EC strain was originally isolated from cattle manure and tagged with a plasmid expressing the green fluorescence protein and kanamycin and streptomycin resistance. Results indicate that the LAB or the treated silages did not suppress EC numbers in the RF. When the pH of the RF decreased below 5·0 the EC disappeared. We conclude that both LAB inoculants for silage and EC survived in RF for several days; however, the inoculants and silages treated with such inoculants did not inhibit EC in RF in vitro. Forage crops, silage and hay are initial stages of the food chain for humans. Cattle harbours and sheds enterobacteria regularly, some strains of which are pathogens. These can contaminate forage crops through field fertilization with cattle manure. The objective of this study was to develop an in vitro model to test whether lactic acid bacteria, which are used in silage inoculants, alone or in treated silages can inhibit Escherichia coli in rumen fluid. This study presents safety aspects and it is also part of a broad research effort aimed at finding out how LAB silage inoculants and inoculated silages enhance ruminant performance or exert probiotic effects in ruminants. © 2016 The Society for Applied Microbiology.
Miyaji, Naomi; Shimizu, Motoki; Miyazaki, Junji; Osabe, Kenji; Sato, Maho; Ebe, Yusuke; Takada, Satoko; Kaji, Makoto; Dennis, Elizabeth S; Fujimoto, Ryo; Okazaki, Keiichi
2017-12-01
Resistant and susceptible lines in Brassica rapa have different immune responses against Fusarium oxysporum inoculation. Fusarium yellows caused by Fusarium oxysporum f. sp. conglutinans (Foc) is an important disease of Brassicaceae; however, the mechanism of how host plants respond to Foc is still unknown. By comparing with and without Foc inoculation in both resistant and susceptible lines of Chinese cabbage (Brassica rapa var. pekinensis), we identified differentially expressed genes (DEGs) between the bulked inoculated (6, 12, 24, and 72 h after inoculation (HAI)) and non-inoculated samples. Most of the DEGs were up-regulated by Foc inoculation. Quantitative real-time RT-PCR showed that most up-regulated genes increased their expression levels from 24 HAI. An independent transcriptome analysis at 24 and 72 HAI was performed in resistant and susceptible lines. GO analysis using up-regulated genes at 24 HAI indicated that Foc inoculation activated systemic acquired resistance (SAR) in resistant lines and tryptophan biosynthetic process and responses to chitin and ethylene in susceptible lines. By contrast, GO analysis using up-regulated genes at 72 HAI showed the overrepresentation of some categories for the defense response in susceptible lines but not in the resistant lines. We also compared DEGs between B. rapa and Arabidopsis thaliana after F. oxysporum inoculation at the same time point, and identified genes related to defense response that were up-regulated in the resistant lines of Chinese cabbage and A. thaliana. Particular genes that changed expression levels overlapped between the two species, suggesting that they are candidates for genes involved in the resistance mechanisms against F. oxysporum.
Directory of Open Access Journals (Sweden)
Marcela Ribeiro Gasparini
Full Text Available Despite our current knowledge of the immunology, pathology, and genetics of Anaplasma marginale, prevention in cattle is currently based on old standbys, including live attenuated vaccines, antibiotic treatment, and maintaining enzootic stability in cattle herds. In the present study, we evaluated the use of an immunostimulant complex (ISCOMATRIX adjuvant, associated with a pool of recombinant major surface proteins (rMSP1a, rMSP1b, rMSP4 and rMSP5 to improve the humoral immune response triggered in calves mainly by IgG2. Ten calves were divided in three groups: 4 calves were inoculated with the ISCOMATRIX/rMSPs (G1; 2 calves were inoculated with ISCOMATRIX adjuvant (G2; and 4 calves received saline (G3. Three inoculations were administered at 21-day intervals. In G1, the calves showed significant increases in total IgG, IgG1 and IgG2 levels 21 days after the second inoculation, compared to the control group (p < 0.05, and G1 calves remained above the cut-off value 28 days after the third inoculation (p < 0.05. The post-immunized sera from calves in G1 reacted specifically for each of the rMSPs used. In conclusion, the ISCOMATRIX/rMSPs induced antigen-specific seroconversion in calves. Therefore, additional testing to explore the protection induced by rMSPs, both alone and in conjunction with proteins previously identified as subdominant epitopes, is warranted.
International Nuclear Information System (INIS)
Gadalla, A.M.; El-Ghandour, I.A.; Abdel Aziz, H.A.; Hamdy, A.; Aly, M.M.
2002-01-01
The lupine Rhizobium symbiosis and contribution of N 2 fixation under different levels of irrigation water salinity were examined. Lysimeter experiment was established under greenhouse conditions during the year 2002-2003. In this experiment, inoculated plants were imposed to different salinity levels of irrigation water and N-fertilizer treatment. Plant height was decreased under different salinity levels, nitrogen treatments and bacterial inoculation. Similar trend was noticed with leaf area. The highest leaf area was recorded with salt tolerant bacterial inoculation (SBI) and splitting N-treatment. Highest values of N-uptake occurred after 100 day intervals under the tested factors. Relative decrease in N-uptake did not exceed 40% of those recorded with the fresh water treatment as affected by experimental factors. Nitrogen uptake by the whole plant reflected an increase at 3 dS/m salinity level of irrigation water. Relative increases were 5% and 15% for normal bacteria inoculation under single dose (NI) and splitting
Fritz, B A; Thomas, C B; Yuill, T M
1992-01-01
From 1986 to 1989, sera from wild turkeys (Meleagris gallopavo), including three subspecies (M. gallopavo intermedia, M. gallopavo merriami and M. gallopavo mexicana) trapped in six western states were tested for antibody to Mycoplasma gallisepticum (MG) (n = 724), M. synoviae (MS) (n = 461) and M. meleagridis (MM) (n = 354) using the rapid plate agglutination (RPA) assay. Subsamples of these sera were also evaluated using the hemagglutination inhibition (HI) assay for antibody to MG (n = 664) and MS (n = 403). Attempts were made to isolate mycoplasmas by swabbing the trachea and cloaca of 190 live wild turkeys and from various tissues (sinus, nasal turbinates, trachea, lung, ovaries and oviduct) from 76 turkeys at necropsy. Isolates were identified using an immunobinding assay. Seroprevalence of MG, MS and MM in the RPA test was highly variable among years and geographic sites, ranging from 0 to 85%, 0 to 87%, and 0 to 83%, respectively, for each mycoplasma species. Of the 724 wild turkey sera tested, 200 (28%) were positive using the RPA assay, while only 20 (3%) of 664 sera tested using the HI assay were positive (at a titer greater than/= 1:80) for antibody to MG. Of the 461 sera tested 178 (39%) were RPA positive for MS, whereas none of the 403 samples tested by HI were positive for MS. Antibody to MM was detected in 72 (20%) of 354 turkey sera tested by RPA. Mycoplasmas were cultured from 81 (30%) of 266 wild turkeys, including 48 that were sampled live and 33 that were examined by necropsy. Mycoplasmas were isolated from every population in which culture was attempted. M. gallopavonis (MGP) was isolated from 37 (46%) of 81 birds which yielded mycoplasma, representing seven of 12 populations sampled. MG was isolated from lower respiratory tissues of one Rio Grande wild turkey trapped in Texas. M. synoviae was isolated from five of 16 Merriam's wild turkeys trapped in Arizona. Sera of birds from which MG or MS was isolated were positive to the respective
Mycorrhizal inoculation of pecan seedlings with some marketable truffles
Directory of Open Access Journals (Sweden)
Gian M. Benucci
2013-12-01
Full Text Available Pecan is the common name of Carya illinoinensis (Wangenh. K. Koch, an ectomycorrhizal tree native to North America, also frequently known as hickory. Mycorrhizal inoculations of pecan seedlings with: Tuber aestivum Vittad., T. borchii Vittad., T. indicum Cooke & Massee, and T. lyonii Butters are described and discussed.
Effect of plant-growth-promoting rhizobacteria inoculation on plant ...
African Journals Online (AJOL)
A field experiment was conducted in a wet season (Kharif) to study the effects of plant growth-promoting rhizobacteria(PGPR) inoculation on agronomic traits and productivity of Basmati rice (cv. 'Pusa Basmati 1401') in a randomized block with twelve treatments. We evaluated one bacterial (Providencia sp. PW5) and one ...
do Amaral, Fernanda P; Pankievicz, Vânia C S; Arisi, Ana Carolina M; de Souza, Emanuel M; Pedrosa, Fabio; Stacey, Gary
2016-04-01
Plant growth promoting rhizobacteria (PGPR) can associate and enhance the growth of important crop grasses. However, in most cases, the molecular mechanisms responsible for growth promotion are not known. Such research could benefit by the adoption of a grass model species that showed a positive response to bacterial inoculation and was amenable to genetic and molecular research methods. In this work we inoculated different genotypes of the model grass Brachypodium distachyon with two, well-characterized PGPR bacteria, Azospirillum brasilense and Herbaspirillum seropedicae, and evaluated the growth response. Plants were grown in soil under no nitrogen or with low nitrogen (i.e., 0.5 mM KNO3). A variety of growth parameters (e.g., shoot height, root length, number of lateral roots, fresh and dry weight) were measured 35 days after inoculation. The data indicate that plant genotype plays a very important role in determining the plant response to PGPR inoculation. A positive growth response was observed with only four genotypes grown under no nitrogen and three genotypes tested under low nitrogen. However, in contrast, relatively good root colonization was seen with most genotypes, as measured by drop plate counting and direct, microscopic examination of roots. In particular, the endophytic bacteria H. seropedicae showed strong epiphytic and endophytic colonization of roots.
Directory of Open Access Journals (Sweden)
Sanghyun Shin
2014-03-01
Full Text Available Fusarium head blight (FHB; scab caused mainly by Fusarium graminearum is a devastating disease of wheat and barley around the world. FHB causes yield reductions and contamination of grain with trichothecene mycotoxins such as deoxynivalenol (DON which are a major health concern for humans and animals. The objective of this research was to develop an easy seed or seedling inoculation assay, and to compare these assays with whole plant resistance of twenty-nine Korean winter wheat cultivars to FHB. The clip-dipping assay consists of cutting off the coleoptiles apex, dipping the coleoptiles apex in conidial suspension, covering in plastic bag for 3 days, and measuring the lengths of lesions 7 days after inoculation. There were significant cultivar differences after inoculation with F. graminearum in seedling relative to the controls. Correlation coefficients between the lesion lengths of clip-dipping inoculation and FHB Type II resistance from adult plants were significant (r=0.45; P<0.05. Results from two other seedling inoculation methods, spraying and pin-point inoculation, were not correlated with adult FHB resistance. Single linear correlation was not significant between seed germination assays (soaking and soak-dry and FHB resistance (Type I and Type II, respectively. These results showed that clip-dipping inoculation method using F. graminearum may offer a real possibility of simple, rapid, and reliable for the early screening of FHB resistance in wheat.
insect antagonistic bio-inoculants for natural control of leaf-mining
African Journals Online (AJOL)
ACSS
to planting, if leaf mining damages and associated yield losses in French beans are to ... inoculants, constituent ainsi de grands potentiels agents protecteurs de cultures et pourraient être utilisés de ... in sustaining food security and soil health.
Directory of Open Access Journals (Sweden)
Neha Khan
2015-06-01
Full Text Available Efficiency of an organic matter like Tagetes erecta and bioinoculants Azotobacter chroococcum and Glomus fasciculatum was investigated in tomato cultivar ‘Pusa Ruby’ when inoculated individually as well as concomitantly for the management of the root-knot nematode, Meloidogyne incognita in terms of growth parameters such as plant length, fresh and dry weights, chlorophyll content, per cent pollen fertility and mycorrhization. Greatest reduction in the numbers of second-stage juveniles in soil, number of root-galls, egg-masses and nematode multiplication was recorded with combined application of T. erecta and bio-inoculants A. chroococcum and G. fasciculatum as compared to untreated control and other treatments. Similarly, the greatest improvement in the plant growth and biomass of tomato was noted in the same treatments. However, individual inoculation of these bio-inoculants and organic fertilizers also showed significant enhancement but was less as compared to combined treatment. A. chroococcum was found most effective against disease incidence followed by G. fasciculatum and T. erecta. Parameters like NP and K contents were significantly enhanced in those plants which received combined treatments of organic matter and bio-inoculants. Azotobacter was found more efficacious against nematodes than Glomus fasciculatum. Organic matter also influenced the activity of bio-inoculants, more with the Azotobacter than G. fasciculatum. DOI: http://dx.doi.org/10.3126/ije.v4i2.12643 International Journal of Environment Vol.4(2 2015: 206-220
Liu, Hui; Chen, Wei; Wu, Man; Wu, Rihan; Zhou, Yong; Gao, Yubao; Ren, Anzhi
2017-11-01
Grasses can be infected simultaneously by endophytic fungi and arbuscular mycorrhizal (AM) fungi. In this study, we tested the hypothesis that endophyte-associated drought resistance of a native grass was affected by an AM fungus. In a greenhouse experiment, we compared the performance of endophyte-infected (EI) and endophyte-free (EF) Leymus chinensis, a dominant species native to the Inner Mongolia steppe, under altered water and AM fungus availability. The results showed that endophyte infection significantly increased drought resistance of the host grass, but the beneficial effects were reduced by AM fungus inoculation. In the mycorrhizal-non-inoculated (MF) treatment, EI plants accumulated significantly more biomass, had greater proline and total phenolic concentration, and lower malondialdehyde concentration than EF plants. In the mycorrhizal-inoculation (MI) treatment, however, no significant difference occurred in either growth or physiological characters measured between EI and EF plants. AM fungus inoculation enhanced drought resistance of EF plants but had no significant effect on drought resistance of EI plants, thus AM fungus inoculation reduced the difference between EI and EF plants. Our findings highlight the importance of interactions among multiple microorganisms for plant performance under drought stress.
Directory of Open Access Journals (Sweden)
Elisa Vilvert
Full Text Available ABSTRACT Grapevine decline and death caused by the pathogenic fungus Fusarium oxysporum f. sp. herbemontis is among the main phytosanitary problem for viticulture in southern Brazil. The eradication of infected plants is presently the most common procedure for disease control in vineyards. Inoculation with arbuscular mycorrhizal fungi is an option to reduce or neutralize the negative impacts of soil pathogenic microorganisms, but the mechanisms of plant response involved in this process are not yet completely elucidated. In order to better understand these mechanisms, an experiment was carried out to identify proteins related to plant defence induced by the mycorrhizal fungus after infection with the pathogenic fungus. We used the grapevine rootstocks SO4 and R110 (susceptible and resistant to the pathogenic fungus, respectively inoculated or not inoculated with the mycorrhizal fungus Rhizophagus irregularis, and inoculated or not inoculated with Fusarium oxysporum f. sp. herbemontis. Growth of the rootstocks’ shoot and root and presence of pathogenic symptoms were evaluated. The protein profiles of roots were characterized by two-dimensional electrophoresis and proteins were identified using mass spectrometry. The grapevine rootstocks inoculated with R. irregularis had higher biomass production and lower level of pathogenic symptoms. The R110 rootstock differentially accumulated 73 proteins, while SO4 accumulated 59 proteins. Nine plant-defence proteins were expressed by SO4 rootstock, and six were expressed by R110 rootstock plants. The results confirm the effect of mycorrhizal fungi in plant growth promotion and their potential for biological control against soil pathogenic fungus. Protein expression is dependent on rootstock characteristics and on the combination of plant material with the fungi.
el-Komy, H M; Saad, O A; Hetta, A M
2003-01-01
The effect of Herbaspirillum seropedicae inoculation and/or maize straw (0, 5 and 10 Mg/hm2) amendment on the growth and N2 fixation of wheat was determined in pot experiments using 15N-dilution method. Inoculation resulted in accumulation of fixed nitrogen, and % N from atmosphere being 24.6 and 26.5% in wheat shoot and grain, respectively. Straw amendment reduced % Natm to 16.1 and 20.2% at high straw level (10 Mg/hm2). Rational nitrogen fertilization (180 kg N/hm2) completely inhibited N2 fixation by H. seropedicae inoculation. Bacterial inoculation increased dry shoot and grain yield up to 23 and 31%, respectively. The highest levels of shoot and grain dry mass (46.5 and 42.4%) were obtained by N-fertilization in both inoculated and uninoculated plants. Total shoot and grain N-yield increased irrespective of organic matter amendment by inoculation up to 9 and 25%, respectively. N-fertilized plants recorded a maximum increase in N-yield (57 and 51%). H. seropedicae was reisolated from inoculated wheat histosphere after harvesting (90 d from sowing). Neither organic matter nor mineral nitrogen applications had any marked effect on bacterial total counts colonizing wheat histosphere. Moreover, no symptoms of mottled stripe disease were observed on leaves and stems of inoculated plants.
Soil inoculation method determines the strength of plant-soil interactions
Voorde, van de T.F.J.; Ruijten, M.; Putten, van der W.H.; Bezemer, T.M.
2012-01-01
There is increasing evidence that interactions between plants and biotic components of the soil influence plant productivity and plant community composition. Many plant–soil feedback experiments start from inoculating relatively small amounts of natural soil to sterilized bulk soil. These soil
Inactivation of Bacillus spores inoculated in milk by Ultra High Pressure Homogenization.
Amador Espejo, Genaro Gustavo; Hernández-Herrero, M M; Juan, B; Trujillo, A J
2014-12-01
Ultra High-Pressure Homogenization treatments at 300 MPa with inlet temperatures (Ti) of 55, 65, 75 and 85 °C were applied to commercial Ultra High Temperature treated whole milk inoculated with Bacillus cereus, Bacillus licheniformis, Bacillus sporothermodurans, Bacillus coagulans, Geobacillus stearothermophilus and Bacillus subtilis spores in order to evaluate the inactivation level achieved. Ultra High-Pressure Homogenization conditions at 300 MPa with Ti = 75 and 85 °C were capable of a spore inactivation of ∼5 log CFU/mL. Furthermore, under these processing conditions, commercial sterility (evaluated as the complete inactivation of the inoculated spores) was obtained in milk, with the exception of G. stearothermophilus and B. subtilis treated at 300 MPa with Ti = 75 °C. The results showed that G. stearothermophilus and B. subtilis have higher resistance to the Ultra High-Pressure Homogenization treatments applied than the other microorganisms inoculated and that a treatment performed at 300 MPa with Ti = 85 °C was necessary to completely inactivate these microorganisms at the spore level inoculated (∼1 × 10(6) CFU/mL). Besides, a change in the resistance of B. licheniformis, B. sporothermodurans, G. stearothermophilus and B. subtilis spores was observed as the inactivation obtained increased remarkably in treatments performed with Ti between 65 and 75 °C. This study provides important evidence of the suitability of UHPH technology for the inactivation of spores in high numbers, leading to the possibility of obtaining commercially sterile milk. Copyright © 2014 Elsevier Ltd. All rights reserved.
Serologic response of SPF chickens to live vaccines and other strains of Mycoplasma gallisepticum
Directory of Open Access Journals (Sweden)
ER do Nascimento
2006-03-01
Full Text Available False positive serologic reactions and difficulties in the diagnosis of Mycoplasma gallisepticum (MG in chickens have increased lately as a result of infection by low virulent MG strains and the use of live MG vaccines in poultry. The objective of this study was to evaluate the serologic responses of SPF chickens exposed to the three commercially available live MG vaccines, and one low virulent MG strain (MG-70, contributing to the diagnosis and monitoring of MG infection in birds. Six groups of SPF chickens were used. The control group was not infected nor challenged; one group was infected with the low virulent strain MG-70 (MG-70; three groups were immunized and named after the MG vaccine used, i.e., MG-6/85, MG-ts11, and MG-F; and finally one group was infected with the virulent MG standard strain, MGR. Random Amplification of Polymorphic DNA (RAPDPCR was used to compare the strains to each other, to the standard MG-A5969, and to MGR. All strains were found to be genetically distinguishable from each other. Birds in the control group showed negative results throughout the experiment and showed no cross-reaction with M. synoviae in any serologic test. ELISA tests at 21 days post first exposure (P1E and seven days after the second exposure (P2E, evidenced that 25% of the MG70 birds were positive, whereas vaccine groups yielded higher positivity rate, i.e., 57%, 43% and 29% for MG-6/85, MG-ts11 and MG-F, respectively. Serum plate agglutination (SPA evidenced the first positive results at 35 days P1E on birds in the MG-F group at the rate of 100%; followed by 40% of birds in the MG-70 group at 63 days P1E. Chickens in MG-ts11 and MG 6/85 groups had identical behavior and yielded 100% positive SPA at 77 days P1E. In regard to hemagglutination inhibition (HI, 14 % of the birds in MG-F and MG-ts11 reacted at 42 days P1E, while MG-70 and MG-6/85 groups yielded positive results only after challenge; MG-70 birds reacted at 56 days P1E at the rate of
Hu, Yongjin; Ge, Changrong; Yuan, Wei; Zhu, Renjun; Zhang, Wujiu; Du, Lijuan; Xue, Jie
2010-05-01
To make nutrients more accessible and further increase biological activity, cooked black soybeans were inoculated with Bacillus natto and fermented at 37 degrees C for 48 h. The changes in physiochemical properties of fermented black soybean natto were investigated. The inoculation procedure significantly increased moisture, viscosity, color, polyphenol compounds and anthocyanin, and significantly decreased hardness after 48 h fermentation. Fibrinolytic and caseinolytic protease, beta-glucosidase activities, TCA-soluble nitrogen, and ammonia nitrogen contents in the inoculated samples significantly increased as fermentation time increased. Genistin and daidzin concentrations gradually decreased with increased fermentation time. However, genistein and daidzein increased with fermentation time, which reached 316.8 and 305.2 microg g(-1) during 48 h fermentation, respectively. DPPH radical scavenging activities of the fermented black soybeans increased linearly with fermentation time and concentration. Compared with the soaked black soybeans and cooked black soybeans, the fermented black soybeans with B. natto resulted in higher scavenging activity towards DPPH radicals, which correlated well with the content of total phenols (r = 0.9254, P natto fermented by B. natto has the potential to become a functional food because of its high antioxidant activity.
Herpes simplex virus ophthalmic disease induced using two different methods of mice inoculation
Directory of Open Access Journals (Sweden)
Sílvia Regina Ferreira Gonçalves Pereira
Full Text Available Two different procedures for inoculation of HSV on corneas of BALB/c mice were evaluated. The first was by the use of HSV suspensions directly on the corneas and the other was after corneal scarification. Animals by this later method presented greater morbidity and mortality than those of first group, suggesting that inoculation of HSV without scarification of the cornea should be the method of choice for the study of HSV ophthalmic infection. This model showed also be an efficient experimental system to testing antiviral drugs.
Coyle, Natalie; Strumpf, Erin; Fiset-Laniel, Julie; Tousignant, Pierre; Roy, Yves
2014-06-01
New models of delivering primary care are being implemented in various countries. In Quebec, Family Medicine Groups (FMGs) are a team-based approach to enhance access to, and coordination of, care. We examined whether physicians' and patients' characteristics predicted their participation in this new model of primary care. Using provincial administrative data, we created a population cohort of Quebec's vulnerable patients. We collected data before the advent of FMGs on patients' demographic characteristics, chronic illnesses and health service use, and their physicians' demographics, and practice characteristics. Multivariate regression was used to identify key predictors of joining a FMG among both patients and physicians. Patients who eventually enrolled in a FMG were more likely to be female, reside outside of an urban region, have a lower SES status, have diabetes and congestive heart failure, visit the emergency department for ambulatory sensitive conditions and be hospitalized for any cause. They were also less likely to have hypertension, visit an ambulatory clinic and have a usual provider of care. Physicians who joined a FMG were less likely to be located in urban locations, had fewer years in medical practice, saw more patients in hospital, and had patients with lower morbidity. Physicians' practice characteristics and patients' health status and health care service use were important predictors of joining a FMG. To avoid basing policy decisions on tenuous evidence, policymakers and researchers should account for differential selection into team-based primary health care models. Copyright © 2014. Published by Elsevier Ireland Ltd.
Directory of Open Access Journals (Sweden)
Gergely Csima
2012-03-01
Full Text Available Rooted cuttings of geranium were grown with and without a slow release fertilizer and inoculated or not with a commercial inoculum containing AM fungi. After six weeks plants were transplanted into larger containers and one-half of the plants were inoculated with AM. Inoculation increased pelargonium growth along with nitrogen, phosphorous and potassium concentrations in shoot than caused a slight decrease in shoot growth and enhanced N concentration. Colony forming units of total fungi and bacteria in the rhizosphere were not influenced by AM; although RFLP profiles of DNA isolated from bacteria living in rhizosphere showed a more diverse community in AM-inoculated than non-inoculated plants at low nutrient supply. Our results suggest that mycorrhizal inoculation not only has an effect on plant growth and uptake of elements but it also influences directly or indirectly the bacterial community of the rhizosphere.
Effect of arbuscular mycorrhizal fungal inoculation on growth, and ...
African Journals Online (AJOL)
The aim of our work was to assess the effect of inoculation with three arbuscular mycorrhizal fungi (AMF) (Rhizoglomus aggregatum (N.C. Schenck and G.S. Sm.) Sieverd., G.A. Silva and Oeh., Funneliformis mosseae (T.H. Nicolson and Gerd.) C. Walker and A. Schüssler. and Rhizoglomus intraradices (N.C. Schenck and ...
Inoculating against eyewitness suggestibility via interpolated verbatim vs. gist testing.
Pansky, Ainat; Tenenboim, Einat
2011-01-01
In real-life situations, eyewitnesses often have control over the level of generality in which they choose to report event information. In the present study, we adopted an early-intervention approach to investigate to what extent eyewitness memory may be inoculated against suggestibility, following two different levels of interpolated reporting: verbatim and gist. After viewing a target event, participants responded to interpolated questions that required reporting of target details at either the verbatim or the gist level. After 48 hr, both groups of participants were misled about half of the target details and were finally tested for verbatim memory of all the details. The findings were consistent with our predictions: Whereas verbatim testing was successful in completely inoculating against suggestibility, gist testing did not reduce it whatsoever. These findings are particularly interesting in light of the comparable testing effects found for these two modes of interpolated testing.
Zhu, Xiaomin; Schroll, Reiner; Dörfler, Ulrike; Chen, Baoliang
2018-03-01
During pesticides degradation, biogenic non-extractable residues ("apparent NER") may not share the same environmental fate and risks with the "real NER" that are bound to soil matrix. It is not clear how microbial community (MC) inoculation for pesticides degradation would influence the NER composition. To investigate degradation efficiency of pesticides Isoproturon (IPU) and NER composition following MC inoculation, clay particles harboring MC that contains the IPU degrading strain, Sphingomonas sp., were inoculated into soil receiving 14 C-labeled IPU addition. Mineralization of IPU was greatly enhanced with MC inoculation that averagely 55.9% of the applied 14 C-IPU was consumed up into 14 CO 2 during 46 days soil incubation. Isoproturon degradation was more thorough with MC than that in the control: much less amount of metabolic products (4.6% of applied IPU) and NER (35.4%) formed in MC treatment, while the percentages were respectively 30.3% for metabolites and 49.8% for NER in the control. Composition of NER shifted with MC inoculation, that relatively larger amount of IPU was incorporated into the biogenic "apparent NER" in comparison with "real NER". Besides its well-recognized role on enhancing mineralization, MC inoculation with clay particles benefits soil pesticides remediation in term of reducing "real NER" formation, which has been previously underestimated. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Fahimeh Seraj
2016-09-01
Full Text Available In order to investigate the effect of Piriformospora indica under salt and drought stresses on some vegetative characteristics and physiological parameters of stevia (Stevia rebaudiana Bertoni medicinal plant, an experiment was conducted in factorial arrangement based on completely randomized design with three replicates at Genetics and Agricultural Biotechnology Institute in Sari Agricultural Sciences and Natural Resources University. Factors include three levels of osmatic potential (0, -5, and -10 bar and with three osmotic sources including NaCl (Na, Mannitol (M and NaCl+Mannitol (N+M and inoculation of mycorrhizae like fungi at two levels (non-inoculated and inoculation with fungi. The plantlets were treated for 30 days and then some morphological and physiological parameters were measured. Results of ANOVA showed that there was a significant interaction between osmatic source and levels with fungi inoculation for the most determined parameters. Inoculation of stevia plantlets with P. indica at osmatic level of -5 bar caused either by M or M+Na markedly improved dry weight of leaf (112 and 156%, respectively and aerial parts (49 and 144%, respectively as compared to the uninoculated control. Fungi inoculation positively improved vegetative parameters of stevia plant under most osmatic levels and sources. The most ameliorate effect, however, was observed where M as drought stress or M+Na were adjusted to -5 bar. Therefore, the results of this study represented a positive effect of P. indica inoculation in inproving osmotic tolerance of stevia medicinal plant.
Cluster-assisted nucleation of silicon phase in hypoeutectic Al–Si alloy with further inoculation
International Nuclear Information System (INIS)
Zhang, Yong; Zheng, Hongliang; Liu, Yue; Shi, Lei; Xu, Rongfu; Tian, Xuelei
2014-01-01
The paper discusses the responses of eutectic silicon and eutectic cells in Al–10Si alloy upon inoculation with an Al–10Si–2Fe master alloy. The further inoculation hardly destroys the modification effect of Sr but significantly refines the eutectic cells in Sr-modified samples, while in unmodified samples, it stimulates the occurrences of polyhedral silicon particles and divorced eutectic. Thermal analysis, scanning electron microscopy, (high-resolution) transmission electron microscopy and scanning and transmission electron microscopy have been used to elucidate the underlying mechanism. A cluster-assisted nucleation mechanism responsible for the enhanced nucleation of silicon phase upon inoculation is proposed. Icosahedral (AlFeSi) clusters are speculated to evolve from the added Al–10Si–2Fe master alloy in Al–10Si melt, around which aggregations of silicon atoms form. Through a series of structural evolutions, these clusters transform into precursors of a silicon crystal. The subsequent formation of silicon particles is achieved by the agglomerations and attachments of these precursors and individual silicon atoms. This hypothesis is further consolidated by the increased characteristic temperatures of eutectic and the anomalous appearance of a high density of nanoscale particles, as well as the abnormal disappearance of Sr-induced twins in further inoculated silicon particles. The increased characteristic temperatures are strong indications of the enhanced nucleation of the silicon phase. The high density of nanoscale particles with an indeterminate crystal structure are the survivors of these precursors. In an Sr-modified and further inoculated sample, the formation of Sr-induced twins is consequently inhibited due to the participation of these precursors during the growth of silicon particles. Furthermore, based on the proposed nucleation mechanism, the dependence of eutectic cell size on Sr level is elucidated in detail
Error affect inoculation for a complex decision-making task.
Tabernero, Carmen; Wood, Robert E
2009-05-01
Individuals bring knowledge, implicit theories, and goal orientations to group meetings. Group decisions arise out of the exchange of these orientations. This research explores how a trainee's exploratory and deliberate process (an incremental theory and learning goal orientation) impacts the effectiveness of individual and group decision-making processes. The effectiveness of this training program is compared with another program that included error affect inoculation (EAI). Subjects were 40 Spanish Policemen in a training course. They were distributed in two training conditions for an individual and group decision-making task. In one condition, individuals received the Self-Guided Exploration plus Deliberation Process instructions, which emphasised exploring the options and testing hypotheses. In the other condition, individuals also received instructions based on Error Affect Inoculation (EAI), which emphasised positive affective reactions to errors and mistakes when making decisions. Results show that the quality of decisions increases when the groups share their reasoning. The AIE intervention promotes sharing information, flexible initial viewpoints, and improving the quality of group decisions. Implications and future directions are discussed.
DEFF Research Database (Denmark)
Heiske, Stefan; Jurgutis, Linas; Kádár, Zsófia
2015-01-01
(SSAD) can be operated with low process water demands, but the technology involves operational challenges, as e.g., risk of process acidification or low degradation rates. This study aimed at developing simple methods to perform SSAD of yam peelings in low-tech applications by testing different...... inoculation strategies and evaluating the necessity of dung addition as a supportive biomass. In initial lab scale trials 143 +/- 4 mL CH4/g VS (volatile solids) were obtained from a mixture of yam peelings and dung digested in a multi-layer-inoculated batch reactor. In a consecutive incubation cycle in which...... adapted inoculum was applied, bottom inoculated digesters loaded without dung reached a yield of 140 +/- 16 mL CH4/g VS. This indicates that SSAD of yam peelings is possible with simple inoculation methods and dung addition is unnecessary after microbial adaptation. A comparison with a conventional fixed...
International Nuclear Information System (INIS)
Negi, Mahima; Tilak, K.V.B.R.; Sachdev, M.S.
1991-01-01
Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N 0 P 1 (0 kg N and 30 kg P 2 O 5 ha -1 ) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15 N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs
PLANT GROWTH-PROMOTING MICROBIAL INOCULANT FOR Schizolobium parahyba pv. parahyba
Directory of Open Access Journals (Sweden)
Priscila Jane Romano de Oliveira Gonçalves
2015-08-01
Full Text Available ABSTRACTSchizolobium parahyba pv. amazonicum (Huber ex Ducke Barneby (paricá occurs naturally in the Amazon and is significant commercial importance due to its rapid growth and excellent performance on cropping systems. The aim of this paper was to evaluate a microbial inoculants such as arbuscular mycorrhiza fungi (AMF and Rhizobium sp. that promote plant growth. The inocula was 10 g of root colonized and spores of Glomus clarum and/or 1 mL of cell suspension (107 CFU/mL of Rhizobium sp. and/or 100 g of chemical fertilizer NPK 20-05-20 per planting hole. The experimental design was complete randomized blocks with five replications and eight treatments (n = 800. Plant height, stem diameter and plant survival were measured. The results were tested for normality and homogeneity of variances and analyzed by ANOVA and Tukey test (p < 0.05. Rhizobium sp and AM fungi showed no effect on plant growth. Environmental factors probably influenced the effectiveness of symbiosis of both microorganisms and plant growth. The chemical fertilizer increased S. parahyba growth. During the first 120 days plants suffered with drought and frost, and at 180 days plants inoculated with microorganism plus chemical fertilizer showed higher survival when compared with control. The results showed that the microbial inoculants used showed an important role on plant survival after high stress conditions, but not in plant growth. Also was concluded that the planting time should be between November to December to avoid the presence of young plants during winter time that is dry and cold.
Yegorenkova, Irina V; Tregubova, Kristina V; Burygin, Gennady L; Matora, Larisa Y; Ignatov, Vladimir V
2016-03-01
Co-inoculation of associative bacteria, which have high nitrogen-fixing activity, tolerance for environmental conditions, and the ability to compete with the natural microflora, is used widely to enhance the growth and yields of agricultural plants. We evaluated the ability of 2 co-inoculated plant-growth-promoting rhizobacteria, Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245, to colonize roots of wheat (Triticum aestivum L. 'Saratovskaya 29') seedlings, and we assessed the morphometric parameters of wheat early in its development. Analysis by ELISA with polyclonal antibodies raised against the exopolysaccharide of P. polymyxa 1465 and the lipopolysaccharide of A. brasilense Sp245 demonstrated that the root-colonizing activity of A. brasilense was higher when the bacterium was co-inoculated with P. polymyxa than when it was inoculated singly. Immunofluorescence microscopy with Alexa Fluor 532-labeled antibodies revealed sites of attachment of co-inoculated P. polymyxa and A. brasilense and showed that the 2 bacteria colonized similar regions of the roots. Co-inoculation exerted a negative effect on wheat seedling development, inhibiting root length by 17.6%, total root weight by 11%, and total shoot weight by 12%. Under certain conditions, dual inoculation of wheat may prove ineffective, apparently owing to the competition between the rhizobacteria for colonization sites on the plant roots. The findings from this study may aid in developing techniques for mixed bacterial inoculation of cultivated plants.
Directory of Open Access Journals (Sweden)
Sonia Chamizo
2018-06-01
Full Text Available Cyanobacteria are ubiquitous components of biocrust communities and the first colonizers of terrestrial ecosystems. They play multiple roles in the soil by fixing C and N and synthesizing exopolysaccharides, which increase soil fertility and water retention and improve soil structure and stability. Application of cyanobacteria as inoculants to promote biocrust development has been proposed as a novel biotechnological technique for restoring barren degraded areas and combating desertification processes in arid lands. However, previous to their widespread application under field conditions, research is needed to ensure the selection of the most suitable species. In this study, we inoculated two cyanobacterial species, Phormidium ambiguum (non N-fixing and Scytonema javanicum (N-fixing, on different textured soils (from silt loam to sandy, and analyzed cyanobacteria biocrust development and evolution of physicochemical soil properties for 3 months under laboratory conditions. Cyanobacteria inoculation led to biocrust formation in all soil types. Scanning electron microscope (SEM images showed contrasting structure of the biocrust induced by the two cyanobacteria. The one from P. ambiguum was characterized by thin filaments that enveloped soil particles and created a dense, entangled network, while the one from S. javanicum consisted of thicker filaments that grouped as bunches in between soil particles. Biocrust development, assessed by chlorophyll a content and crust spectral properties, was higher in S. javanicum-inoculated soils compared to P. ambiguum-inoculated soils. Either cyanobacteria inoculation did not increase soil hydrophobicity. S. javanicum promoted a higher increase in total organic C and total N content, while P. ambiguum was more effective in increasing total exopolysaccharide (EPS content and soil penetration resistance. The effects of cyanobacteria inoculation also differed among soil types and the highest improvement in soil
International Nuclear Information System (INIS)
El-Ghandour, I. A.; Galal, Y.G; Ebraheem, Rabab M.M.; Yousef, Khayria A.
2004-01-01
Bio fertilization technology was applied for improving canola plant growth and nutrient acquisition in sandy saline soil ,as a biological mean used to develop plant growth and nutrient uptake under salinity stress. Canola was cultivated in pots packed at rate of 7 kg saline sandy soil pot -1 , and inoculated with Rhizobium leguminosarum biovar viceae, Azospirillum brasilense strain no. 40 and arbuscular mycorrhizal fungi either solely or in combinations of them. Nitrogen fertilizer was added in form ( 15 NH 4 ) 2 SO 4 with 5% 15 N atom excess at rate of 0.99 g N pot -1 . Maximum dry matter accumulation induced by composite inoculation (Rh + Azo + AM). Na concentrations were frequently affected by Rhizobium and /or mycorrhizae while K was affected by Azospirillum and /or mycorrhizae. Azospirillum enhanced Ca uptake whereas Mg content was responded well to composite inoculants of Rh + Azo + AM. Dual inoculation with Rh + Azo resulted in the highest values of N uptake by plant. Similar effect was noticed with P uptake when dual inoculums of Azo + AM were applied. Data of 15 N isotope showed that the highest portion and value of N 2 -fixed was recorded with composite inoculums followed by dual inoculations. On the other hand, the infection with AM fungi gave the highest proportion of N derived from fertilizer as compared to other inoculants or uninoculated control. In the same trend, the fertilizer use efficiency (FUE%) was enhanced by AM infection. Dual inoculums of Rh + Azo induced highest content of proline in leaves. (Authors)
Energy Technology Data Exchange (ETDEWEB)
Wu, F.Y.; Bi, Y.L.; Wong, M.H. [China University of Mining & Technology, Beijing (China)
2009-07-01
A pot experiment was conducted to investigate the effects of Glomus mosseae and Rhizobium on Medicago sativa grown on three types of coal mine substrates, namely a mixture of coal wastes and sands (CS), coal wastes and fly ash (CF), and fly ash (FA). Inoculation with Rhizobium alone did not result in any growth response but G. mosseae alone displayed a significant effect on plant growth. G. mosseae markedly increased the survival rate of M. sativa in CS substrate. In CF and FA substrates the respective oven dry weights of M. sativa inoculated with G. mosseae were 1.8 and 5.1 times higher than those without inoculation. Based on nitrogen (N), phosphorus (P) and potassium (K) uptake and legume growth, the results also show that dual inoculation in CS and CF substrates elicited a synergistic effect. This indicates that inoculation with arbuscular mycorrhizal (AM) fungi may be a promising approach for revegetation of coal mine substrates.
A Line Search Multilevel Truncated Newton Algorithm for Computing the Optical Flow
Directory of Open Access Journals (Sweden)
Lluís Garrido
2015-06-01
Full Text Available We describe the implementation details and give the experimental results of three optimization algorithms for dense optical flow computation. In particular, using a line search strategy, we evaluate the performance of the unilevel truncated Newton method (LSTN, a multiresolution truncated Newton (MR/LSTN and a full multigrid truncated Newton (FMG/LSTN. We use three image sequences and four models of optical flow for performance evaluation. The FMG/LSTN algorithm is shown to lead to better optical flow estimation with less computational work than both the LSTN and MR/LSTN algorithms.
SHIRAISHI, Rikiya; NISHIMURA, Masaaki; NAKASHIMA, Ryuji; ENTA, Chiho; HIRAYAMA, Norio
2013-01-01
ABSTRACT In Japan, the import quarantine regulation against rabies has required from 2005 that dogs and cats should be inoculated with the rabies vaccine and that the neutralizing antibody titer should be confirmed to be at least 0.5 international units (IU)/ml. The fluorescent antibody virus neutralization (FAVN) test is used as an international standard method for serological testing for rabies. To achieve proper immunization of dogs and cats at the time of import and export, changes in the neutralizing antibody titer after inoculation of the rabies vaccine should be understood in detail. However, few reports have provided this information. In this study, we aimed to determine evaluated, such changes by using sera from experimental dogs and cats inoculated with the rabies vaccine, and we tested samples using the routine FAVN test. In both dogs and cats, proper, regular vaccination enabled the necessary titer of neutralizing antibodies to be maintained in the long term. However, inappropriate timing of blood sampling after vaccination could result in insufficient detected levels of neutralizing antibodies. PMID:24389741
Directory of Open Access Journals (Sweden)
Romain J. G. PIERRON
2016-03-01
Full Text Available Defense mechanisms in woody tissue are poorly understood, especially in vine colonized by trunk pathogens. However, several investigations suggest that molecular mechanisms in the central tissue of Vitis vinifera L. may be involved in trunk-defense reactions. In this work, the perception of Phaeoacremonium aleophilum and Phaeomoniella chlamydospora alone or together were investigated in cuttings of Cabernet Sauvignon trunks. Plant responses were analyzed at the tissue level via optical microscopy and at the cellular level via plant-gene expression. The microscopy results revealed that, six weeks after pathogen inoculation, newly formed vascular tissue is less developed in plants inoculated with P. chlamydospora than in plants inoculated with P. aleophilum. Co-inoculation with both pathogens resulted in an intermediate phenotype. Further analysis showed the relative expression of the following grapevine genes: PAL, PR10.3, TL, TLb, Vv17.3, STS, STS8, CWinv, PIN, CAM, LOX at 10, 24, 48, and 120 h post-inoculation (hpi. The gene set was induced by wounding before inoculation with the different pathogens, except for the genes CAM and LOX. This response generated significant noise, but the expression of the grapevine genes (PAL, PR10.3, TL, TLb, Vv17.3, STS, STS8, CWinv, and PIN still differed due to perception of mycelium by the plant. Furthermore, at 48 hpi, the induction of PAL and STS8 differs depending on the pathogen, and a specific pattern emerges from the different inductions associated with the different treatments. Based on these results, we conclude that Vitis vinifera L. trunk perceives the presence of pathogens differently depending on the inoculated pathogen or even on the combination of co-inoculated pathogens, suggesting a defense orchestration in the perennial organs of woody plants.
Increased caries-incidence by oral inoculation of cariogenic bacteria in rats after dietary fluoride
Energy Technology Data Exchange (ETDEWEB)
Clark, W.B.; Kreitzman, S.N.; Howell, T.H.
1976-04-01
The authors had previously observed that dietary NaF administered to rats during the formative and eruptive stages of tooth development does not significantly reduce the enamel solubility in acid buffer solution. They hypothesized that NaF reduces the cariogenicity of the bacterial flora. In order to test this hypothesis, rats from the same litter were divided into three groups all of which received a cariogenic diet. Group one received no fluoride. Groups two and three were supplemented with 50 ppm NaF, from day 1 to day 21. In the first study, one of the 21-day-old NaF-supplemented groups was inoculated by smears of fecal material from the control animals that did not receive NaF supplement. The second NaF group was not inoculated and served as control. In a second study, cariogenic Strep. mutans 6715 was used as the inoculum in place of the fecal smear. In both studies, the inoculation of a NaF group increased the caries to about 70% of the control group, while the mean scores on the non-inoculated NaF group were about 50% of the control group. These results indicate that alteration of the transmissible flora may be an important factor in the cariostatic action of dietary fluoride in experimental animals. This observation supports the suggestion that fluoride may alter the cariogenic flora.
Inoculation and inter-cropping of legumes in established grass for increasing biomass of fodder
International Nuclear Information System (INIS)
Ullah, M.A.; Hussain, N.
2014-01-01
Livestock sector has become very important component of agriculture sector in the world due to variety of dairy and meat products and high income to the farmers. In Pakistan, this vast resource faces many crucial challenges like low quality and high priced feed and fodder and limited chances of increasing area under fodders due to competition for food crops. Intercropping (33%, 50% and 67%) of Panicum maximum grass and legumes (Vicia sativa and cowpeas) coupled with inoculation was studied under rainfed conditions at National Agricultural Research Centre (NARC) Islamabad, Pakistan. Intercropping significantly increased tillering of grass. Seed inoculation of legumes also gave maximum tillers. The grass and legumes biomass without any treatment were recorded as 7.09 and -18.17 t ha, respectively, during two years of study. Mixed fodder -1 production increased to 11.62, 13.6 and 14.13 t ha with 33%, 50% and 67% intercropping, respectively. Respective values of biomass were -1 observed as 13.18, 13.70 and 17.87 t ha when combined with inoculation. Intercropping of grass and legumes 67% with inoculation was assessed as the best treatment. The increases were computed as 304%, 230%, 132%, and 60% over grass alone in the first, second, third and fourth crops while respective increases were 101%, 151%, 165% and 74% over monoculture legumes. (author)
Sanchez-Zabala, Joseba; Majada, Juan; Martín-Rodrigues, Noemí; Gonzalez-Murua, Carmen; Ortega, Unai; Alonso-Graña, Manuel; Arana, Orats; Duñabeitia, Miren K
2013-11-01
Mycorrhizal inoculation of conifer roots is a key strategy to optimize establishment and performance of forest tree species under both natural and cultivated conditions and also to mitigate transplantation shock. However, despite being a common practice, inoculation in outdoor nursery conditions has been poorly studied. Here, we have evaluated effectiveness of four fungal species (Lactarius deliciosus, Lactarius quieticolor, Pisolithus arhizus, and Suillus luteus) in the production of mycorrhizal Pinus pinaster seedlings in an outdoor commercial nursery and their ability to improve seedling physiology and field performance. All inoculated seedlings showed a significant increase in growth at the end of the nursery stage and these differences remained after 3 years of growth in the field. Differences observed in the content of malondialdehyde, total chlorophyll, carotenoids, anthocyanins, and phenolic compounds from needles of mycorrhizal and control seedlings may reflect a different sensitivity to photo-oxidative damage. We conclude that ectomycorrhizal inoculation improves adaptability to changeable growing conditions of an outdoor nursery and produces a higher quality nursery stock, thereby enhancing seedling performance after planting.
Production of cell wall enzymes in pepper seedlings, inoculated with ...
African Journals Online (AJOL)
Pepper seedlings inoculated with arbuscular mycorrhizal AM fungus, Glomus etunicatum, produced cellulase, polygal-acturonase and pectin methylestrase enzymes. The activities of the enzymes increased as the pepper seedlings matured in age, showing that the activity of the enzymes in the seedlings was age mediated.
Response of butternut selections to inoculation with Sirococcus clavigignenti-juglandacearum
M.E. Ostry; M. Moore
2008-01-01
Butternut trees (Juglans cinerea) clonally propagated via grafting from source trees with putative resistance to butternut canker were inoculated monthly with two isolates of Sirococcus clavigignenti-juglandacearum in a field planting in Minnesota. Significant differences in resulting canker length were found among (i) month of...
Inoculation effects of two South African cyanobacteria strains on ...
African Journals Online (AJOL)
Two South African cyanobacteria strains (coded 3g and 7e) of the genus Nostoc were evaluated for improvement of the aggregate stability of a silty loam soil with low organic C content and compared with Nostoc strain 9v isolated from a Tanzanian soil. The soil was either cropped with maize or non-cropped and inoculated ...
Polymers selection for a liquid inoculant of Azospirillum brasilense ...
African Journals Online (AJOL)
In this study, we used a method of accelerated degradation to select a polymer and a concentration to maintain cell stability of a liquid inoculant based on the strain C16 Azospirillum brasilense. A screening at 45°C was made to compare the protectant effect of five polymers on the viability of the strain (p/v): carrageenan ...
EFFECT OF INOCULANT PIONEER 1188 IN MAIZE SILAGE ON COW MILKING CAPACITY
Directory of Open Access Journals (Sweden)
R. Zimmer
2002-12-01
Full Text Available First investigation part, started on 1 September 2001 by feeding 473 cows (401 dairy and 72 dry and finished on 13 November by feeding 474 cows (409 dairy and 65 dry, was characterized by the main ration consisting of maize silage without inoculant. This period was known for a maximum number of housed cows being 490 (423 dairy and 67 dry and minimum 469 (395 dairy and 74 dry. Daily average of stable milk production was 17.06 l with 3.48% of lactic fat on the average. Second part of the investigation, started on 14 November 2001 by feeding 474 cows (411 dairy and 63 dry and finished on 31 March 2002 by feeding 464 cows (395 dairy and 69 dry, was known for the basic ration contained maize silage enriched by inoculant Pioneer 1188.This period was characterized by a maximum number of housed cows being 482 (404 dairy and 57 dry. Daily average of stable milk production was 18.67 l and 3.58% of lactic fat. The main ration was composed of silage maize, highly wet maize, pearl barley, stock meal, sunflower cake, hay, salt and VAM. Inoculant Pioneer contained 6 strains of lactic-sour fermentation selected bacteria whose viability is basis of a successful product. In fact, it is a micro-granulated product added, by Gandy doser, to amount of 0.5 kg per green mass/t. Inoculant Pioneer 1188 was in this research added in a dose of 0.436 kg t-1 silage maize. Daily average of stable milk production increased by 1.61l i.e. 9.4% and lactic fat from 3.48% to 3.58% i.e. 2.9%.
New Native Rhizobia Strains for Inoculation of Common Bean in the Brazilian Savanna
Directory of Open Access Journals (Sweden)
Fábio Martins Mercante
Full Text Available ABSTRACT Maximization of biological nitrogen fixation in the common bean (Phaseolus vulgaris L. crop depends on the genetic characteristics related to the plant, the symbiotic efficiency of rhizobia, and environmental factors. The objective of this study was to evaluate the performance of rhizobia selected beforehand from Cerrado (Brazilian tropical savanna soils in Mato Grosso do Sul. The experiments were conducted in 2007 in the municipalities of Aquidauana, Anaurilândia, Campo Grande, and Dourados, all located in the state of Mato Grosso do Sul. All procedures established followed the current recommendations of the Brazilian Ministry of Agriculture (Ministério de Agricultura, Pecuária e Abastecimento – MAPA, in accordance with the “official protocol for assessing the feasibility and agronomic efficiency of strains, and inoculant technologies linked to the process of biological nitrogen fixation in legumes”. The program for selection of rhizobia for inoculation in bean plants resulted in identification of different strains with high symbiotic efficiency, competitiveness, and genetic stability, based on the Embrapa Agropecuária Oeste collection of multifunctional microorganism cultures. In previous studies, 630 isolates of Rhizobium were evaluated. They were obtained from nodules of leucaena (380 or dry beans (250 from 87 locations, including 34 municipalities in Mato Grosso do Sul. Three of them stood out from the others: CPAO 12.5 L2, CPAO 17.5 L2, and CPAO 56.4 L2. Inoculation of these strains in bean plants demonstrated economic viability and high potential for obtaining a more effective inoculant suitable for trading purposes.
Directory of Open Access Journals (Sweden)
Saskia Windisch
2017-06-01
Full Text Available Previous studies conducted on a unique field site comprising three contrasting soils (diluvial sand DS, alluvial loam AL, loess loam LL under identical cropping history, demonstrated soil type-dependent differences in biocontrol efficiency against Rhizoctonia solani-induced bottom rot disease in lettuce by two bacterial inoculants (Pseudomonas jessenii RU47 and Serratia plymuthica 3Re-4-18. Disease severity declined in the order DS > AL > LL. These differences were confirmed under controlled conditions, using the same soils in minirhizotron experiments. Gas chromatography-mass spectrometry (GC-MS profiling of rhizosphere soil solutions revealed benzoic and lauric acids as antifungal compounds; previously identified in root exudates of lettuce. Pathogen inoculation and pre-inoculation with bacterial inoculants significantly increased the release of antifungal root exudates in a soil type-specific manner; with the highest absolute levels detected on the least-affected LL soil. Soil type-dependent differences were also recorded for the biocontrol effects of the two bacterial inoculants; showing the highest efficiency after double-inoculation on the AL soil. However, this was associated with a reduction of shoot growth and root hair development and a limited micronutrient status of the host plants. Obviously, disease severity and the expression of biocontrol effects are influenced by soil properties with potential impact on reproducibility of practical applications.
Zhang, Xue; Wang, Li; Ma, Fang; Yang, Jixian; Su, Meng
2017-07-01
The importance of arbuscular mycorrhizal fungi (AMF) for nutrient uptake and growth in rice has been widely recognized. However, little is known about the distribution of carbon (C) and nitrogen (N) in rice under AMF inoculation, which can affect grain yield and quality. This study was conducted to investigate the distribution of C and N within rice plants under AMF inoculation and the effects on grain yield and quality. AMF inoculation significantly increased N accumulation and distribution in vegetative tissues at tillering, and N translocation into seeds from heading to maturity. Consequently, AMF inoculation more strongly impacted the distribution of N than that of C in seeds, with significantly reduced C:N ratios and increased protein content (by 7.4%). Additionally, AMF inoculation significantly increased grain yield by 28.2% through increasing the grain:straw ratio by 18.4%. In addition, the roots of inoculated rice exhibited greater change in C distribution, with significantly higher C concentrations, C accumulations, and C:N ratios at tillering and maturity. AMF inoculation affected the distribution of N in seeds and C in roots. As such, AMF inoculation may be a potential method for improving grain yield and quality. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
DEFF Research Database (Denmark)
Alexandersen, Søren; Wernery, U.; Nagy, P.
2008-01-01
Two sheep and five dromedaries were inoculated with a highdose of a cattle-passaged type O strain of foot-and-mouth disease virus (FMDV). The sheep developed typical FMD. The inoculated camels, which were placed in contact with five further dromedaries and four sheep, showed no visible sign......,,; of illness or vesicular lesions. However, one of them had a raised body temperature at 3 days post-inoculation (pi) and a viraemia from days 2 to 10; probang samples from this animal were negative for infections virus, but a low level of FMDV RNA was detected in a sample taken on day 6 pi, five other samples...... taken front days 3 to 28 being negative. Examination of mouth swabs indicated a low level of FMDV RNA at days 1-5 pi in four of the five inoculated camels, but no infectious FMDN7 or FMDV RNA was detected in serum, probang or month swab samples front contact-exposed animals (camels and sheep). All...
Directory of Open Access Journals (Sweden)
Yassine MABROUK
2016-05-01
Full Text Available This study examined the capacity of Rhizobium sp. strain PchAZM to reduce parasitism of chickpea by Orobanche foetida under greenhouse conditions, and assessed the relative impact of rhizobia on the expression of chickpea defense response against broomrape. Growth chamber experiments using Petri dishes revealed that rhizobia infection on chickpea roots reduced broomrape seed germination, and restricted the broomrape attachment to host roots while retarding tubercle formation and development by the parasite. In pot experiments, chickpea roots inoculated with rhizobia reduced the total number of broomrape by up to 90%. Broomrape necrosis was observed both before and after parasite attachment to inoculated chickpea roots in Petri dishes and pot experiments. Reduction in infection was accompanied by enhanced levels of the defence-related enzymes phenylalanine ammonia lyase (PAL and peroxidase (POX. Increased levels of phenolics were recorded in the roots of rhizobia-inoculated plants grown in the presence of broomrape. The results suggest that rhizobia could be used for protection of chickpea against O. foetida.
Nalca, Aysegul; Rossi, Franco D.; Miller, Lynn J.; Wiley, Michael R.; Perez-Sautu, Unai; Washington, Samuel C.; Norris, Sarah L.; Wollen-Roberts, Suzanne E.; Shamblin, Joshua D.; Kimmel, Adrienne E.; Bloomfield, Holly A.; Valdez, Stephanie M.; Sprague, Thomas R.; Principe, Lucia M.; Bellanca, Stephanie A.; Cinkovich, Stephanie S.; Lugo-Roman, Luis; Cazares, Lisa H.; Pratt, William D.; Palacios, Gustavo F.; Bavari, Sina; Pitt, M. Louise; Nasar, Farooq
2017-01-01
Unprotected sexual intercourse between persons residing in or traveling from regions with Zika virus transmission is a risk factor for infection. To model risk for infection after sexual intercourse, we inoculated rhesus and cynomolgus macaques with Zika virus by intravaginal or intrarectal routes. In macaques inoculated intravaginally, we detected viremia and virus RNA in 50% of macaques, followed by seroconversion. In macaques inoculated intrarectally, we detected viremia, virus RNA, or both, in 100% of both species, followed by seroconversion. The magnitude and duration of infectious virus in the blood of macaques suggest humans infected with Zika virus through sexual transmission will likely generate viremias sufficient to infect competent mosquito vectors. Our results indicate that transmission of Zika virus by sexual intercourse might serve as a virus maintenance mechanism in the absence of mosquito-to-human transmission and could increase the probability of establishment and spread of Zika virus in regions where this virus is not present. PMID:28548637
Haddow, Andrew D; Nalca, Aysegul; Rossi, Franco D; Miller, Lynn J; Wiley, Michael R; Perez-Sautu, Unai; Washington, Samuel C; Norris, Sarah L; Wollen-Roberts, Suzanne E; Shamblin, Joshua D; Kimmel, Adrienne E; Bloomfield, Holly A; Valdez, Stephanie M; Sprague, Thomas R; Principe, Lucia M; Bellanca, Stephanie A; Cinkovich, Stephanie S; Lugo-Roman, Luis; Cazares, Lisa H; Pratt, William D; Palacios, Gustavo F; Bavari, Sina; Pitt, M Louise; Nasar, Farooq
2017-08-01
Unprotected sexual intercourse between persons residing in or traveling from regions with Zika virus transmission is a risk factor for infection. To model risk for infection after sexual intercourse, we inoculated rhesus and cynomolgus macaques with Zika virus by intravaginal or intrarectal routes. In macaques inoculated intravaginally, we detected viremia and virus RNA in 50% of macaques, followed by seroconversion. In macaques inoculated intrarectally, we detected viremia, virus RNA, or both, in 100% of both species, followed by seroconversion. The magnitude and duration of infectious virus in the blood of macaques suggest humans infected with Zika virus through sexual transmission will likely generate viremias sufficient to infect competent mosquito vectors. Our results indicate that transmission of Zika virus by sexual intercourse might serve as a virus maintenance mechanism in the absence of mosquito-to-human transmission and could increase the probability of establishment and spread of Zika virus in regions where this virus is not present.
Dryburgh, E L; Marsh, A E; Dubey, J P; Howe, D K; Reed, S M; Bolten, K E; Pei, W; Saville, W J A
2015-08-01
Sarcocystis neurona is considered the major etiologic agent of equine protozoal myeloencephalitis (EPM), a neurological disease in horses. Raccoon ( Procyon lotor ) is considered the most important intermediate host in the life cycle of S. neurona in the United States; S. neurona sarcocysts do mature in raccoon muscles, and raccoons also develop clinical signs simulating EPM. The focus of this study was to determine if sarcocysts would develop in raccoons experimentally inoculated with different host-derived strains of in vitro-cultivated S. neurona merozoites. Four raccoons were inoculated with strains derived from a raccoon, a sea otter, a cat, and a horse. Raccoon tissues were fed to laboratory-raised opossums ( Didelphis virginiana ), the definitive host of S. neurona . Intestinal scraping revealed sporocysts in opossums who received muscle tissue from raccoons inoculated with the raccoon-derived or the sea otter-derived isolates. These results demonstrate that sarcocysts can mature in raccoons inoculated with in vitro-derived S. neurona merozoites. In contrast, the horse and cat-derived isolates did not produce microscopically or biologically detected sarcocysts. Immunoblot analysis revealed both antigenic and antibody differences when testing the inoculated raccoons. Immunohistochemical staining indicated differences in staining between the merozoite and sarcocyst stages. The successful infections achieved in this study indicates that the life cycle can be manipulated in the laboratory without affecting subsequent stage development, thereby allowing further purification of strains and artificial maintenance of the life cycle.
Freeman, S.; Rodriguez, R.J.
1993-01-01
A continuous-dip inoculation technique for rapid assessment of pathogenicity of Fusarium oxysporum f. sp. niveum and F. o. melonis was developed. The method, adapted from a similar procedure for determining pathogenicity of Colletotrichum magna (causal agent of anthracnose of cucurbits), involves constant exposure of seedlings and cuttings (seedlings with root systems excised) of watermelon and muskmelon to conidial suspensions contained in small scintillation vials. Disease development in intact seedlings corresponded well to disease responses observed with the standard root-dip inoculation/pot assay. The continuous-dip inoculation technique resulted in rapid disease development, with 50% of watermelon cuttings dying after 4–6 days of exposure to F. o. niveum. A mortality of 30% also was observed in watermelon cuttings exposed to conidia of F. o. melonis, as opposed to only a 0–2.5% mortality in seedlings with intact roots. Disease response was similar with muskmelon seedlings and cuttings continuously dip-inoculated with F. o. melonis isolates. However, no disease symptoms were observed in muskmelon seedlings or cuttings inoculated with F. o. niveum. Four nonpathogenic isolates of F. oxysporum did not cause disease symptoms in either watermelon or muskmelon cuttings and seedlings when assayed by this technique. The proposed method enables a rapid screening of pathogenicity and requires less time, labor, and greenhouse space than the standard root-dip inoculation/pot assay. The reliability of the continuous-dip inoculation technique is limited, however, to exposure of intact seedlings at a concentration of 1 × 106conidia per milliliter; the method is not accurate at this range for excised seedlings.
Directory of Open Access Journals (Sweden)
I. Prihantoro
2014-12-01
Full Text Available Buffalo’s rumen bacteria (BRB are potential in digesting fiber feed. BRB already adapted well with low quality forages and agricultural byproducts. The aim of this study was to determine the effect of buffalo’s rumen bacteria (BRB consortium inoculated into preweaning Frisian Holstein calves on nutrient digestibility, physiological status, mineral uptake, and blood profile. This study used 14 isolates of bacteria isolated from rumen fluid of four local buffalos. The research units consisted of seven Frisian Holstein calves at two weeks old with the average body weight of 43.6±4.5 kg. Calves were inoculated with 20 mL of buffalo’s rumen bacteria isolates [4.56 x 109 cfu/mL] every morning for 10 weeks. The calves were divided into two groups i.e., three calves received bacterial inoculation and four calves without any inoculation. The variables which were analyzed in the preweaning and weaning period were feed intake, digestibility, average daily gain (ADG, feed conversion ratio (FCR, rumen fermentation characteristics, body weight, physiological status, blood profile, and mineral status. Data were analyzed statistically using t-test. The results showed that inoculation of buffalo’s rumen bacteria into Frisian Holstein calves effectively increased feed intake, characteristics of leukocytes and neutrophils, and cobalt (Co uptake during the weaning period. Inoculation of rumen bacteria improved rumen pH during preweaning and weaning periods. Inoculation of rumen bacteria also had no negative effects on digestibility, feed conversion (FCR, average daily gain (ADG, and physiological status.
Directory of Open Access Journals (Sweden)
Mestre María Victoria
2016-01-01
Full Text Available Decreasing ethanol content in wines has become one of the main objectives of winemakers in different areas of the world. The use of selected wine yeasts can be considered one of the most effective and simple tools. The aim of this study was to evaluate the effect of co-inoculation times of selected non-Saccharomyces/Saccharomyces yeasts on the reduction of ethanol levels in wines. Hanseniaspora uvarum BHu9, Starmerella bacillaris BSb55 and Candida membranaefasciens BCm71 were co-inoculate with Saccharomyces cerevisiae under fermentative conditions. Treatments assayed were: pure fermentations of S. cerevisiae BSc203 and non-Saccharomyces yeasts BHu9, BSb55 and BCm71; -co-fermentations: A-BHu9/BSc203; B-BSb55/BSc203 and C-BCm71/BSc203. These co-inoculations were carried out under mixed (simultaneous inoculation, and sequential conditions (non-Saccharomyces yeasts inoculated at initial time and S. cerevisiae at 48, 96 and 144 h. Lower fermentative efficiencies were registered when BHu9 and BSb55 remained pure more time. Conversely, the conversion efficiency was reduced in co-inocula of BCm71/BSc203, when both yeasts interact more time. Metabolites produced during all vinification processes were within acceptable concentration ranges according to the current legislations. Conclusion Time interaction during fermentation processes of non-Saccharomyces and Saccharomyces yeasts showed influence on ethanol production, and this effect would be dependent on the co-inoculated species.
Directory of Open Access Journals (Sweden)
Su-Yeon Son
2014-12-01
Full Text Available The objective of this study was to evaluate the virulence of geographically different isolates of oak wilt pathogen, Raffaelea quercus-mongolicae and other Raffaelea species. In this study, mature trees of Quercus mongolica were inoculated with the various isolates of Raffaelea spp. and their virulence was evaluated by measuring the extent of sapwood discoloration resulting from the inoculation. The average length of discolored sapwood in a lateral direction was longest in the trees inoculated with the isolates from Korea (8.69 cm followed by R. quercivora (7.51 cm and the other Raffaelea spp. (3.35 cm. The lateral length of discolored sapwood caused by the inoculation with Korean strains varied from 4.71 to 14.90 cm indicating their differences in virulence. The area of discolored sapwood caused by the inoculation with Raffaelea spp. varied from 1.57 to 8.42 cm2 indicating their differences in virulence. Based on the length and area of the discolored sapwoods, isolated YY and wj43 appeared to have the highest virulence among all the Raffaelea isolates tested. Each of the two isolates was obtained from Gangwon Province and Jeonbuk Province, respectively.
Before beginning a study that involves a large number of birds, it may be helpful to know what method of inoculation would be best for the experiment in question. The objective of this study was to compare several methods of Salmonella challenge (oral gavage, intracloacal inoculation and the seeder ...
Klei, T R; Turk, M A; McClure, J R; Holmes, R A; Dennis, V A; Chapman, M R
1990-04-01
Eight of 10 pony foals reared under helminth-free conditions were inoculated PO with 50 Strongylus vulgaris infective larvae/week for 4 weeks, at which time 1 foal died of acute verminous arteritis. Inoculation of 7 remaining foals continued at 2-week intervals for 20 weeks. Of the 7 foals, 3 were treated with ivermectin (0.2 mg/kg of body weight) in an oral paste formulation at experiment weeks 8, 16, 24; 4 foals were not treated. Two foals were not inoculated or treated and served as controls. After the first ivermectin treatment, ivermectin-treated foals had fewer days (12 +/- 2.9) with rectal temperatures greater than 38.6 C than did nontreated foals (23.3 +/- 3.8). Mean baseline rectal temperatures were 38 +/- 0.2 C. Adverse clinical reactions to ivermectin treatment were not observed in foals. Foals were euthanatized and necropsied 3 weeks after the last ivermectin treatment (week 24). Ivermectin was effective in reducing S vulgaris arterial larval and intestinal adult parasite numbers by 100% in 3 treated foals. Strongylus vulgaris arterial larvae and/or adults were recovered from all 4 nontreated inoculated foals. One nontreated inoculated foal lacked arterial larvae or active arterial lesions, indicating that protective resistance had developed in this individual. Marked gross and histopathologic lesions typical of chronic S vulgaris infection were observed in the 3 nontreated inoculated foals with arterial larvae. Repeated killing of intra-arterial S vulgaris fourth-stage larvae in ivermectin-treated foals did not exacerbate lesions associated with verminous arteritis or induce unique lesions associated with repeated destruction of arterial larvae.(ABSTRACT TRUNCATED AT 250 WORDS)
DEFF Research Database (Denmark)
Kristensen, Niels Bastian; Sloth, Karen Helle; Højberg, Ole
2010-01-01
of acetic acid, propionic acid, propanol, propyl acetate, 2-butanol, propylene glycol, ammonia, and free AA. The contents and ratios of dl-lactic acid, l-lactic acid relative to dl-lactic acid, free glucose, and dl-lactic acid relative to acetic acid decreased with Lalsil Fresh inoculation. Lalsil Fresh...... inoculation increased the silage counts of total lactic acid bacteria and reduced yeast counts. The Fusarium toxins deoxynivalenol, nivalenol, and zearalenone were detected in all silages at all collections, but the contents were not affected by ensiling time or by inoculation treatment. The effect...
Removal of Calcium from Scheelite Leaching Solution by Addition of CaSO4 Inoculating Crystals
Liu, Wenting; Li, Yongli; Zeng, Dewen; Li, Jiangtao; Zhao, Zhongwei
2018-04-01
In this work, the solubility behaviors of gypsum and anhydrite in the H2SO4-H3PO4-H2O system were investigated over the temperature range T = 30-80°C, and the results showed that the solubility of anhydrite was considerably lower than that of gypsum. On the basis of the differential solubilities of gypsum and anhydrite, a method was developed to remove calcium from the scheelite leaching solution by adding anhydrite as an inoculating crystal. The effects of the reaction time, concentration of the CaSO4 inoculating crystals, and temperature were investigated. With an addition of CaSO4 inoculating crystals at a concentration of 60 g/L, the Ca2+ concentration of the scheelite leaching solution decreased to a low level of approximately 0.76 g/L after 10 h at 70°C.
Directory of Open Access Journals (Sweden)
OLUSEGUN SAMUEL BALOGUN
2008-07-01
Full Text Available The pathogenic response of two tomato cultivars to races of Fusarium oxysporum f. sp.. lycopersici (cv. Momotaro, insensitive to race 1 of the pathogen, and cv. Ponderosa sensitive to race 1, was studied in greenhouse and laboratory experiments by inoculating the cultivars singly with race 1 or race 2, and in mixed inoculation with the two races of the pathogen. A pre-symptom PCR assay two weeks after inoculation showed that a fragment of the intergenic spacer region (IGS of ribosomal DNA was amplifi ed by DNA templates from leaf samples of cv. Momotaro tomato plants inoculated with only race 2, or with race 1+2, but in the cv. Ponderosa the fragment was amplifi ed only in plants inoculated with race 1+2. Race-specifi c analysis using the sp13 and sp23 primers confi rmed that the amplifi ed fragment was from race 2 in cv. Momotaro and from races 1+2 in cv. Ponderosa. Later wilt symptoms mirrored the pre-symptom and post-symptom molecular analytical results: cv. Momotaro plants inoculated with only race 1 remained symptomless, while the ‘Momotaro’ plants inoculated with both races (1+2 did not manifest more severe wilt symptoms than plants inoculated with race 2 alone; cv. Ponderosa plants that were mixed-inoculated with race 1+2 manifested more severe symptoms, and at an earlier date than plants inoculated with only race 2. Growth parameters such as number of leaves and plant height showed the race 1+2 infected cv. Ponderosa were significantly retarded in growth, suggesting that significant synergism between the fungal races in tomato pathosystem can occur only when the host cultivar is sensitive to both races. An additional important finding is that pre-symptom leaf sampling of apparently healthy plants is useful in PCR diagnostic analysis to predict impending fusarial wilt outbreaks in tomato especially in infested soil.
Energy Technology Data Exchange (ETDEWEB)
Liu, Gang; Yu, Haiyang [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, No. 71 East Beijing Road, Nanjing 210008 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Ma, Jing [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, No. 71 East Beijing Road, Nanjing 210008 (China); Xu, Hua, E-mail: hxu@issas.ac.cn [State Key Laboratory of Soil and Sustainable Agriculture, Institute of Soil Science, Chinese Academy of Sciences, No. 71 East Beijing Road, Nanjing 210008 (China); Wu, Qinyan; Yang, Jinghui; Zhuang, Yiqing [Zhenjiang Institute of Agricultural Science of Hilly Regions in Jiangsu, Jurong 212400 (China)
2015-06-15
Incorporation of straw together with microbial inoculant (a microorganism agent, accelerating straw decomposition) is being increasingly adopted in rice cultivation, thus its effect on greenhouse gas (GHG) emissions merits serious attention. A 3-year field experiment was conducted from 2010 to 2012 to investigate combined effect of straw and microbial inoculant on methane (CH{sub 4}) and nitrous oxide (N{sub 2}O) emissions, global warming potential (GWP) and greenhouse gas intensity (GHGI) in a rice field in Jurong, Jiangsu Province, China. The experiment was designed to have treatment NPK (N, P and K fertilizers only), treatment NPKS (NPK plus wheat straw), treatment NPKSR (NPKS plus Ruilaite microbial inoculant) and treatment NPKSJ (NPKS plus Jinkuizi microbial inoculant). Results show that compared to NPK, NPKS increased seasonal CH{sub 4} emission by 280–1370%, while decreasing N{sub 2}O emission by 7–13%. When compared with NPKS, NPKSR and NPKSJ increased seasonal CH{sub 4} emission by 7–13% and 6–12%, respectively, whereas reduced N{sub 2}O emission by 10–27% and 9–24%, respectively. The higher CH{sub 4} emission could be attributed to the higher soil CH{sub 4} production potential triggered by the combined application of straw and microbial inoculant, and the lower N{sub 2}O emission to the decreased inorganic N content. As a whole, the benefit of lower N{sub 2}O emission was completely offset by increased CH{sub 4} emission, resulting in a higher GWP for NPKSR (5–12%) and NPKSJ (5–11%) relative to NPKS. Due to NPKSR and NPKSJ increased rice grain yield by 3–6% and 2–4% compared to NPKS, the GHGI values for NPKS, NPKSR and NPKSJ were comparable. These findings suggest that incorporating straw together with microbial inoculant would not influence the radiative forcing of rice production in the terms of per unit of rice grain yield relative to the incorporation of straw alone. - Highlights: • This paper presents 3-year measurements of CH
Intercropping Urochloa brizantha and sorghum inoculated with Azospirillum brasilense for silage
Directory of Open Access Journals (Sweden)
Allan Hisashi Nakao
Full Text Available ABSTRACT Livestock performance in the Brazilian Cerrado has been limited by the low availability of good quality fodder, especially during periods of low rainfall. The aim of this study was to evaluate growth and dry matter production in two cultivars of sorghum, inoculated or not with diazotrophic bacteria, and as a monocrop or intercropped with palisade grass under a system of crop-livestock integration. The experiments were carried out in the field in the Cerrado region during the autumn-winter period of 2015 and 2016, on the experimental farm of the Faculty of Engineering at Ilha Solteira, UNESP, in Selvíria, in the State of Mato Groso do Sul, Brazil (MS. A randomised complete block experimental design was used in a 2 x 2 x 2 factorial scheme with four replications. The treatments corresponded to two agricultural years (2015 and 2016; the cultivation of dual-purpose grain sorghum, alone or intercropped with palisade grass; with or without inoculation of the sorghum seeds with the bacterium Azospirillum brasilense. The dry matter production of the plant components and plant growth were evaluated for the preparation of silage. Inoculation of sorghum seeds with the bacterium Azospirillum brasilense increases the production of plant dry matter for silage, irrespective of the cultivar or intercrop. Dual-purpose grain sorghum intercropped with palisade grass is a viable agronomic system for producing plant matter for silage during the autumn season.
Skåra, Torstein; Valdramidis, Vasilis P; Rosnes, Jan Thomas; Noriega, Estefanía; Van Impe, Jan F M
2014-12-01
Steam surface pasteurization is a promising decontamination technology for reducing pathogenic bacteria in different stages of food production. The effect of the artificial inoculation type and initial microbial load, however, has not been thoroughly assessed in the context of inactivation studies. In order to optimize the efficacy of the technology, the aim of this study was to design and validate a model system for steam surface pasteurization, assessing different inoculation methods and realistic microbial levels. More specifically, the response of Listeria innocua, a surrogate organism of Listeria monocytogenes, on a model fish product, and the effect of different inoculation levels following treatments with a steam surface pasteurization system was investigated. The variation in the resulting inoculation level on the samples was too large (77%) for the contact inoculation procedure to be further considered. In contrast, the variation of a drop inoculation procedure was 17%. Inoculation with high levels showed a rapid 1-2 log decrease after 3-5 s, and then no further inactivation beyond 20 s. A low level inoculation study was performed by analysing the treated samples using a novel contact plating approach, which can be performed without sample homogenization and dilution. Using logistic regression, results from this method were used to model the binary responses of Listeria on surfaces with realistic inoculation levels. According to this model, a treatment time of 23 s will result in a 1 log reduction (for P = 0.1). Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
André L. M. Oliveira
2017-09-01
Full Text Available Although Azospirillum strains used in commercial inoculant formulations presents diazotrophic activity, it has been reported that their ability to produce phytohormones plays a pivotal role in plant growth-promotion, leading to a general recommendation of its use in association with regular N-fertilizer doses. In addition, a high variability in the effectiveness of Azospirillum inoculants is still reported under field conditions, contributing to the adoption of the inoculation technology as an additional management practice rather than its use as an alternative practice to the use of chemical inputs in agriculture. To investigate whether the content of stress-resistance biopolymers would improve the viability and performance of Azospirillum inoculants when used as substitute of N-fertilizers, biomass of A. brasilense strain Ab-V5 enriched in exopolysaccharides (EPS and polyhydroxybutirate (PHB was produced using a new culture medium developed by factorial mixture design, and the effectiveness of resulting inoculants was evaluated under field conditions. The culture medium formulation extended the log phase of A. brasilense cultures, which presented higher cell counts and increased EPS and PHB contents than observed in the cultures grown in the OAB medium used as control. An inoculation trial with maize conducted under greenhouse conditions and using the biopolymers-enriched Ab-V5 cells demonstrated the importance of EPS and PHB to the long term bacterial viability in soil and to the effectiveness of inoculation. The effectiveness of liquid and peat inoculants prepared with Ab-V5 cells enriched with EPS and PHB was also evaluated under field conditions, using maize as target crop along different seasons, with the inoculants applied directly over seeds or at topdressing under limiting levels of N-fertilization. No additive effect on yield resulted from inoculation under high N fertilizer input, while inoculated plants grown under 80% reduction in
Oliveira, André L. M.; Santos, Odair J. A. P.; Marcelino, Paulo R. F.; Milani, Karina M. L.; Zuluaga, Mónica Y. A.; Zucareli, Claudemir; Gonçalves, Leandro S. A.
2017-01-01
Although Azospirillum strains used in commercial inoculant formulations presents diazotrophic activity, it has been reported that their ability to produce phytohormones plays a pivotal role in plant growth-promotion, leading to a general recommendation of its use in association with regular N-fertilizer doses. In addition, a high variability in the effectiveness of Azospirillum inoculants is still reported under field conditions, contributing to the adoption of the inoculation technology as an additional management practice rather than its use as an alternative practice to the use of chemical inputs in agriculture. To investigate whether the content of stress-resistance biopolymers would improve the viability and performance of Azospirillum inoculants when used as substitute of N-fertilizers, biomass of A. brasilense strain Ab-V5 enriched in exopolysaccharides (EPS) and polyhydroxybutirate (PHB) was produced using a new culture medium developed by factorial mixture design, and the effectiveness of resulting inoculants was evaluated under field conditions. The culture medium formulation extended the log phase of A. brasilense cultures, which presented higher cell counts and increased EPS and PHB contents than observed in the cultures grown in the OAB medium used as control. An inoculation trial with maize conducted under greenhouse conditions and using the biopolymers-enriched Ab-V5 cells demonstrated the importance of EPS and PHB to the long term bacterial viability in soil and to the effectiveness of inoculation. The effectiveness of liquid and peat inoculants prepared with Ab-V5 cells enriched with EPS and PHB was also evaluated under field conditions, using maize as target crop along different seasons, with the inoculants applied directly over seeds or at topdressing under limiting levels of N-fertilization. No additive effect on yield resulted from inoculation under high N fertilizer input, while inoculated plants grown under 80% reduction in N fertilizer
International Nuclear Information System (INIS)
Zhi, W.F.; Can, C.S.; Ling, C.; Hui, X.W.
2015-01-01
Fusarium oxysporum f. sp. niveum (FON), a soil-borne pathogen of watermelon (Citrullus lanatus), can cause substantial production losses worldwide. In this study, plate culture and PCR-denaturing gradient gel electrophoresis (DGGE) methods were used to evaluate the effects of inoculation of Fusarium oxysporum f.sp. niveum on rhizosphere microbial communities of different watermelon cultivars to FON. Two methods indicated that the effects of watermelon rhizosphere microbial community of different resistance cultivars to FON were much different. Populations of culturable bacteria and actinomycetes in the rhizosphere of susceptible watermelon cultivar were significantly lower than in the resistant cultivar after inoculation (P<0.05), but the opposite result was observed for fungi. Principal component analysis of bacterial and fungal community structure also showed that the cultivar of FON-inoculated soil treatment were separated from the non-inoculated controls after inoculation, and there was clear discrimination between the susceptible cultivars and the resistant cultivars. Sequence analysis of specific bands from DGGE profiles showed that specific rhizosphere bacterial and fungal groups differed between watermelon cultivars after inoculation . Both methods demonstrated that different resistant watermelon cultivars occupied different rhizosphere microbial communities, and and disease suppression might be correlated with high microbial diversity. F. oxysporum f. sp. Niveum alters the structure and functional diversity of microbial communities associated with watermelon rhizosphere. (author)
Directory of Open Access Journals (Sweden)
V.S. Harikumar
2017-08-01
Full Text Available The aim of the study was to assess the effect of inoculation with arbuscular mycorrhizal fungi (AMF and rock phosphate (RP fertilization on biometric parameters and mycorrhizal colonization of field grown sesame under rainfed and irrigated conditions. Inoculation of AMF Funneliformis dimorphicus improved the biometric parameters of the crop such as leaf area (LA, leaf area index (LAI, specific leaf weight (SLW, net assimilation rate (NAR, oil index (OI as well as mycorrhizal colonization (%F in roots. Mycorrhizal inoculation however, did not give any positive response on harvest index (HI. LA, LAI and OI and %F showed a general increment in treatments of no added P (P0, while the other parameters such as SLW and NAR were improved by the application of RP at half the recommended dose (P50. HI did not respond to RP fertilization. Most of the parameters (LA, LAI, NAR, %F showed higher values under rainfed condition than irrigated condition whereas, SLW, HI and OI improved significantly under irrigated condition. Results indicated that the inoculation of AMF to field grown sesame can compensate for 50% of the recommended P fertilizer under a need based irrigation schedule, without affecting the biometric parameters.
Directory of Open Access Journals (Sweden)
Nan Lu
2016-12-01
Full Text Available The tree species Pinus tabulaeformis Carr. (P. tabulaeformis is commonly planted in China due to its economic and ecological value. In order to identify one or more ectomycorrhizal (ECM fungal species for future P. tabulaeformis afforestation, we investigated the effects of five ECM fungal species: Laccaria laccata, Boletus edulis, Gomphidius viscidus, Suillus grevillei, and Suillus luteus on the growth of P. tabulaeformis seedlings under greenhouse conditions. The growth parameters of P. tabulaeformis seedlings were evaluated 90 days following fungal colonisation. The majority of seedlings were significantly affected by ECM inoculation. Mycorrhizal inoculated seedlings were taller, had more lateral roots, and a greater biomass compared with the non-mycorrhizal (CK seedlings. With the exception of G. viscidus, inoculated seedlings exhibited higher phosphorus, potassium, and nitrogen content compared with the CK seedlings. In addition, ECM colonisation increased the enzymatic activity of catalase, acidic phosphatase, protease, and the urease content in the rhizosphere soil. Our study showed that Laccaria laccata, Suillus grevillei, and Suillus luteus may be useful for improving the growth and cultivation of P. tabulaeformis seedlings. Furthermore, we observed that S. luteus inoculation increased the gas exchange parameters of P. tabulaeformis seedlings under field conditions.
Joint use of fungicides, insecticides and inoculants in the treatment of soybean seeds
Directory of Open Access Journals (Sweden)
Yara Cristiane Buhl Gomes
Full Text Available ABSTRACT The interference of the joint application of pesticides with seed inoculation on the survival of Bradyrhizobium has been reported in the last years. So, the objective of this study was to evaluate the joint use of fungicides, insecticides and inoculant in the treatment of soybean seeds on various parameters of Bradyrhizobium nodulation in soybean as well as on crop productivity parameters. The experiment was conducted during the 2013/2014 crop in the experimental field of the Instituto Federal de Educação, Ciência e Tecnologia de Mato Grosso - Campo Novo do Parecis Campus. The seeds of TMG 133 RR variety were sown in pots. It was used a randomized block design in a 4 x 4 + 1 factorial, four fungicides (1: fludioxonil + metalaxyl-M, 2: carboxine + thiram, 3: difeconazole and 4: carbendazim + thiram, four insecticides (1: fipronil 250 SC, 2: thiamethoxam, 3: imidacloprid + thiodicarpe and 4: imodacloprid 600 FC and an inoculant (SEMIA 5079 and SEMIA 5080, common to all treatments, with three replications. The experiment was not repeated. The joint application of fungicide and insecticide with inoculant does not affect nodulation, foliar N content and vegetative growth of the plants as well as the masses of grains per plant and 100-grain mass. The use of the carbendazim + thiram mixed with fipronil and carbendazim + thiram mixed with imidacloprid provides less number of pods per plant and grains per plant, reflecting in reductions in the production of soybean grains. In this way, the fungicide carbendazim + thiram, regardless of the combined applied insecticide, is the most harmful to Bradyrhizobium spp.
Energy Technology Data Exchange (ETDEWEB)
Wang Fayuan [Agricultural College, Henan University of Science and Technology, 70 Tianjin Road, Luoyang, Henan Province 471003 (China) and Institute of Soil Science, Chinese Academy of Sciences, Nanjing, Jiangsu Province 210008 (China)]. E-mail: wfy1975@163.com; Lin Xiangui [Institute of Soil Science, Chinese Academy of Sciences, Nanjing, Jiangsu Province 210008 (China); Yin Rui [Institute of Soil Science, Chinese Academy of Sciences, Nanjing, Jiangsu Province 210008 (China)
2007-05-15
A field experiment was carried out to study the effect of microbial inoculation on heavy metal phytoextraction by Elsholtzia splendens and whether chitosan could have a synergistic effect with the microbial inocula. The microbial inocula consisted of a consortium of arbuscular mycorrhizal fungi and two Penicillium fungi. Three treatments were included: the control, inoculation with microbial inocula, and the inoculation combined with chitosan. Microbial inoculation increased plant biomass especially shoot dry weight, enhanced shoot Cu, Zn and Pb concentrations but did not affect Cd, leading to higher shoot Cu, Zn, Pb and Cd uptake. Compared with microbial inoculation alone, chitosan application did not affect plant growth but increased shoot Zn, Pb and Cd concentrations except Cu, which led to higher phytoextraction efficiencies and partitioning to shoots of Zn, Pb and Cd. These results indicated synergistic effects between microbial inocula and chitosan on Zn, Pb and Cd phytoextraction. - Co-application of microbial inocula and chitosan enhanced heavy metal phytoextraction by E. splendens.
International Nuclear Information System (INIS)
Wang Fayuan; Lin Xiangui; Yin Rui
2007-01-01
A field experiment was carried out to study the effect of microbial inoculation on heavy metal phytoextraction by Elsholtzia splendens and whether chitosan could have a synergistic effect with the microbial inocula. The microbial inocula consisted of a consortium of arbuscular mycorrhizal fungi and two Penicillium fungi. Three treatments were included: the control, inoculation with microbial inocula, and the inoculation combined with chitosan. Microbial inoculation increased plant biomass especially shoot dry weight, enhanced shoot Cu, Zn and Pb concentrations but did not affect Cd, leading to higher shoot Cu, Zn, Pb and Cd uptake. Compared with microbial inoculation alone, chitosan application did not affect plant growth but increased shoot Zn, Pb and Cd concentrations except Cu, which led to higher phytoextraction efficiencies and partitioning to shoots of Zn, Pb and Cd. These results indicated synergistic effects between microbial inocula and chitosan on Zn, Pb and Cd phytoextraction. - Co-application of microbial inocula and chitosan enhanced heavy metal phytoextraction by E. splendens
Joe, M M; Saravanan, V S; Islam, M R; Sa, T
2014-02-01
To develop co-aggregated bacterial inoculant comprising of Methylobacterium oryzae CBMB20/Methylobacterium suomiense CBMB120 strains with Azospirillum brasilense (CW903) strain and testing their efficiency as inoculants for plant growth promotion (PGP). Biofilm formation and co-aggregation efficiency was studied between A. brasilense CW903 and methylobacterial strains M. oryzae CBMB20 and M. suomiense CBMB120. Survival and release of these co-aggregated bacterial strains entrapped in alginate beads were assessed. PGP attributes of the co-aggregated bacterial inoculant were tested in tomato plants under water-stressed conditions. Results suggest that the biofilm formation efficiency of the CBMB20 and CBMB120 strains increased by 15 and 34%, respectively, when co-cultivated with CW903. Co-aggregation with CW903 enhanced the survivability of CBMB20 strain in alginate beads. Water stress index score showed least stress index in plants inoculated with CW903 and CBMB20 strains maintained as a co-aggregated inoculant. This study reports the development of co-aggregated cell inoculants containing M. oryzae CBMB20 and A. brasilense CW903 strains conferred better shelf life and stress abatement in inoculated tomato plants. These findings could be extended to other PGP bacterial species to develop multigeneric bioinoculants with multiple benefits for various crops. © 2013 The Society for Applied Microbiology.
Directory of Open Access Journals (Sweden)
Shuangchen Chen
2017-12-01
Full Text Available Mycorrhizal inoculation stimulates growth, photosynthesis and nutrient uptake in a wide range of host plants. However, the ultimate effects of arbuscular mycorrhyzal (AM symbiosis vary with the plants and fungal species involved in the association. Therefore, identification of the appropriate combinations of AM fungi (AMF that interact synergistically to improve their benefits is of high significance. Here, three AM fungal compositions namely VT (Claroideoglomus sp., Funneliformis sp., Diversispora sp., Glomus sp., and Rhizophagus sp. and BF (Glomus intraradices, G. microageregatum BEG and G. Claroideum BEG 210, and Funneliformis mosseae (Fm were investigated with respect to the growth, gas exchange parameters, enzymes activities in Calvin cycles and related gene expression in cucumber seedlings. The results showed that VT, BF and Fm could successfully colonize cucumber root to a different degree with the colonization rates 82.38, 74.65, and 70.32% at 46 days post inoculation, respectively. The plant height, stem diameter, dry weight, root to shoot ratio of cucumber seedlings inoculated with AMF increased significantly compared with the non-inoculated control. Moreover, AMF colonization greatly increased the root activity, chlorophyll content, net photosynthetic rate, light saturated rate of the CO2 assimilation (Asat, maximum carboxylation rate (Vcmax and maximum ribulose-1,5-bis-phosphate (RuBP regeneration rate (Jmax, which were increased by 52.81, 30.75, 58.76, 47.00, 69.15, and 65.53% when inoculated with VT, respectively. The activities of some key enzymes such RuBP carboxylase/oxygenase (RuBisCO, D-fructose-1,6-bisphosphatase (FBPase, D-fructose-6-phosphatase (F6P and ribulose-5-phosphate kinase (Ru5PK, and related gene expression involved in the Calvin cycle including RCA, FBPase, FBPA, SBPase, rbcS and rbcL were upregulated by AMF colonization. AMF inoculation also improved macro- and micro nutrient contents such as N, P, K, S, Ca, Cu
Sun, Wei; Qian, Xun; Gu, Jie; Wang, Xiao-Juan; Li, Yang; Duan, Man-Li
2017-05-01
Three different organic-phosphorus-mineralizing bacteria (OPMB) strains were inoculated to soil planted with soybean (Glycine max), and their effects on soybean growth and indigenous bacterial community diversity were investigated. Inoculation with Pseudomonas fluorescens Z4-1 and Brevibacillus agri L7-1 increased organic phosphorus degradation by 22% and 30%, respectively, compared with the control at the mature stage. Strains P. fluorescens Z4-1 and B. agri L7-1 significantly improved the soil alkaline phosphatase activity, average well color development, and the soybean root activity. Terminal restriction fragment length polymorphism analysis demonstrated that P. fluorescens Z4-1 and B. agri L7-1 could persist in the soil at relative abundances of 2.0%-6.4% throughout soybean growth. Thus, P. fluorescens Z4-1 and B. agri L7-1 could potentially be used in organic-phosphorus-mineralizing biofertilizers. OPMB inoculation altered the genetic structure of the soil bacterial communities but had no apparent influence on the carbon source utilization profiles of the soil bacterial communities. Principal components analysis showed that the changes in the carbon source utilization profiles of bacterial community depended mainly on the plant growth stages rather than inoculation with OPMB. The results help to understand the evolution of the soil bacterial community after OPMB inoculation.
International Nuclear Information System (INIS)
Afrasayab, S.; Hasnain, S.
2005-01-01
Salt tolerant bacterial strains isolated from rhizosphere of Mazus plant (inhabitant of salt range) were used singly (ST -1; ST -2; ST -3; ST -4) and in mixed combinations (ST -1,3,4; ST -2,3,4) to improve the growth to Tricticum aestivum in the pot experiments. Growth and yield of T. aestivum var. Inqlab-91 plants exposed to NaCl stress (0.75% NaCl) was markedly affected. Na/sup +//K/sup +/ ratios in shoots and roots were profoundly increased under NaCl stress. Bacterial inoculations improved plant growth under salt stress. Bacterial combinations ST - 1,3,4 and ST -2,3,4 were more effective in stimulating growth and showed prominent results as compared to their pure cultures. Mono and mixed bacterial inoculations improved yield parameters of wheat. ST -1,3,4 mixed culture inoculation maximally improved yield under salt stress. Generally bacterial inoculations resulted in increase in Na/sup +//K/sup +/ ratios in shoots and roots under salt free and salt stress conditions. Overall ST -1,3,4 mixed inoculation yielded promising results under NaCl stress, hence 168 rRNA gene sequence analysis of its pure cultures was obtained for their identification to genus level. (author)
International Nuclear Information System (INIS)
Yasin, M.; Faisal, M.
2012-01-01
Here we reported the effect of four strains Bacillus pumilus-CrK08, Cellulosimicrobium cellulans-CrK16, Exiguobacterium-CrK19 and Bacillus cereus-CrK20 and tannery contaminated soil on Helianthus annuus L. var Hysun-33 growth parameters. Plants growing in tannery effluent contaminated soil have shown slowed leaf growth, reduced shoot length, burning of leaf margins and tips compared to plants growing in normal garden soil. The inoculated plants had shown overall increase in root length (15%), shoot length (33%) and fresh weight shoot (135%) compared to un-inoculated plants growing in stress conditions. Plants growing in tannery contaminated soil have shown increase in soluble proteins contents (9%), acid phosphatase activity (200%), peroxidase activity (203%) and decrease in chlorophyll a (39%), chlorophyll b (23%) and carotenoids contents (28%) compare to plants growing in normal control soil. Inoculated plants grown in contaminated soil have shown an increased in peroxidase activity, soluble proteins contents, acid phosphatase activity, chlorophyll a, b and carotenoid contents compare to respective un-inoculated plants. (author)
Potential of Azotobacter vinelandii Khsr1 as bio-inoculant | Naz ...
African Journals Online (AJOL)
The present study deals with the isolation and characterization of Azotobacter vinelandii Khsr1 from roots of the weed, Chrysopogon aucheri, commonly known as golden beard grass indigenous to Khewra salt range, Pakistan and its evaluation as bio-inoculant. The population of the isolate varied from 107 to 108 cfu/g fresh ...
Directory of Open Access Journals (Sweden)
Cleiton J. Alves
Full Text Available ABSTRACT The use of Azospirillum brasilense in the wheat crop still presents contradictory results; thus, it is necessary to identify ideal conditions to obtain satisfactory results. The objective of this study was to investigate the interaction between Azospirillum brasilense and nitrogen doses in a wheat cultivar, conducted with irrigation in the Cerrado region of Mato Grosso do Sul. The experimental design was randomized blocks with a 4 x 2 factorial scheme, four nitrogen doses (0, 40, 80 and 120 kg ha-1 applied as top-dressing, associated or not with inoculation of wheat seeds with Azospirillum brasilense. The results show that there was no interaction between N and inoculation. The isolated effect of Azospirillum brasilense promotes an increase in plant height and number of grains per spike. Nitrogen doses promotes significant increases in leaf N content, plant height, number of grains per spike, number of spikes per square meter and grain yield. The conditions under which the experiment was conducted favored the development of the crop, not interfering with grain yield due the inoculation with Azospirillum brasilense.
Xylella fastidiosa (Xf) is a foregut-borne bacterium that is inoculated into xylem cells of a healthy plant during feeding by sharpshooter vectors. Inoculation occurs during salivation and egestion behaviors that are likely represented by the sharpshooter X wave. The objective of this study was to t...
A two-year field study was conducted to determine the effects of inoculation techniques on the aggressiveness of Aspergillus niger kernel infection in A. flavus resistant and susceptible maize hybrids. Ears were inoculated with the silk-channel, side-needle, and spray techniques 7 days after midsilk...
Pellegrino, M; Berardo, N; Giraudo, J; Nader-Macías, M E F; Bogni, C
2017-08-24
The use of lactic acid bacteria (LAB) in animal feed, constitute an alternative tool for bovine mastitis prevention. Previously, two LAB strains were isolated from bovine milk and selected for their probiotics properties. So far, immune response of inoculating LAB in bovine udders at dry-off period has not been investigated. The immunoglobulin isotype levels and memory cell proliferation in blood and milk of animals inoculated with Lactobacillus lactis subsp. lactis CRL1655 and Lactobacillus perolens CRL1724 at dry-off period was studied. Ten animals were inoculated intramammarily with 10 6 cells of each LAB (IG) and 2 animals used as control (NIG). Milk and blood samples were taken before inoculation and 1, 2, 4, 6, 12 and 24 h and 7 and 14 days after inoculation. Somatic cell count (SCC) in milk, the presence of bovine mastitis pathogens, the levels of antibodies and lymphocyte proliferation were determined. In the IG, the SCC was bovine mastitis pathogens after 24-48 h of incubation. In general, LAB inoculation increased the amount of IgG isotypes in blood and milk, and these antibodies were able to recognise Staphylococcus aureus epitopes. Lymphocytes proliferation was significantly higher in the IG at all time points assayed, following LAB or S. aureus stimulation. The lymphocytes of animals inoculated with LAB do not react in vitro to the presence of S. aureus antigen.. The results showed that probiotic microorganisms could be a natural and effective alternative in the prevention of bovine mastitis at dry-off period and act as immunomodulatory stimulating local and systemic defence lines.
Wei, Yuquan; Zhao, Yue; Wang, Huan; Lu, Qian; Cao, Zhenyu; Cui, Hongyang; Zhu, Longji; Wei, Zimin
2016-12-01
The study was conducted to investigate the influence of biochar and/or phosphate-solubilizing bacteria (PSB) inoculants on microbial biomass, bacterial community composition and phosphorus (P) fractions during kitchen waste composting amended with rock phosphate (RP). There were distinct differences in the physic-chemical parameters, the proportion of P fractions and bacterial diversity in different treatments. The contribution of available P fractions increased during composting especially in the treatment with the addition of PSB and biochar. Redundancy analysis showed that bacterial compositions were significantly influenced by P content, inoculation and biochar. Variance partitioning further showed that synergy of inoculated PSB and indigenous bacterial communities and the joint effect between biochar and bacteria explained the largest two proportion of the variation in P fractions. Therefore, the combined application of PSB and biochar to improve the inoculation effect and an optimized regulating method were suggested based on the distribution of P fractions. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Iwan Prihantoro
2012-12-01
Full Text Available Fiber-digesting bacteria are the main rumen bacteria that play an important role in digesting feed. These bacteria are adapted to low quality forage from agricultural byproduct. The aim of these study was to determine the potency of fiber-digesting bacteria consortium obtained from buffalo rumen inoculated to Frisian Holstein calves during preweaning on feed consumption, utilization, mineral uptake and physiological status. This study used 14 isolates of bacteria obtained from collection of Faculty of Animal Science, Bogor Agricultural University. The experimental unit consisted of six Frisian Holstein calves at two week old with the average body weight of 38.00 ± 6.23 kg. Calves were inoculated by 20 ml of fiber-digesting rumen bacterial isolates [4.56 x 109 cfu/ml] every morning for four weeks. Experimental design used was based on a completly randomized design with three calves received the respective inoculation (treatment group and three calves without any inoculation (control group. Data were analyzed statistically using t-test method with α = 0.05 and 0.01. The results showed that fiber-digesting bacteria (FDB from rumen buffalo have adapted in the calves rumen since preweaning periode. Inoculation FDB increased the number of rumen bacteria, digestibility of protein and P uptake calves at eight weeks old. Increased feed intake, uptake of Mg and cobalt calves at 14 weeks old. Without causing any negative effects on ADG, physiological status and rumen fermentability.
Directory of Open Access Journals (Sweden)
YANG Zhen-ya
2016-07-01
Full Text Available The correlations of glomalin contents and removal of phenanthrene and pyrene as representative polycyclic aromatic hydrocarbons (PAHs in soils with inoculation of arbuscular mycorrhizal fungi(AMF were investigated. The test AMF included Glomus etunicatum(Ge, Glomus mosseae(Gm, and Glomus lamellosum(Gla, and the host plant was alfalfa(Medicago sativa L.. The AMF hyphal density and contents of easily extractable glomalin and total glomalin in AMF-inoculated soils were observed to increase with cultivation time from 35 d to 75 d. Comparing with the control treatment(CK without AMF inoculation, the contents of easily extractable glomalin in soil increased 48.58%, 55.99% and 50.23%, and total glomalin contents increased 38.75%, 50.95% and 46.12% with Ge, Gm and Gla inoculation after 75 d, respectively. AMF inoculation promoted the removal of test PAHs in soils. The removal rates of phenanthrene and pyrene in soils with AMF enhanced in 35~75 d. 83.4%~92.7%, 82.1%~93.8% and 86.9%~93.4% of phenanthrene and 42.2%~63.5%, 43.7%~69.2% and 44.6%~66.4% of pyrene in soils with Ge, Gm, Gla were removed in 75 d respectively. AMF hyphal density and total glomalin contents were observed to be significantly positively correlated with the removal rates of PAHs in soils, indicating that the colonization of AMF enhanced hyphal density and total glomalin contents and thus promoted the degradation of PAHs in the soil environments.
Effects of bacterial inoculants and an enzyme on the fermentation ...
African Journals Online (AJOL)
... the effects of bacterial inoculation and cellulase on the fermentation quality of ensiled whole-crop sweet sorghum (WCSS, Sorghum bicolor L. Moench). The WCSS (323 g dry matter (DM)/kg, 251 g water soluble carbohydrates (WSC)/kg DM, 43 g crude protein (CP)/kg DM and 439 g neutral detergent fibre (NDF)/kg DM) ...
Directory of Open Access Journals (Sweden)
John Bako Baon
2006-08-01
Full Text Available Arachis pintoiis potentially as a cover crop for cocoa (Theobroma cacaoL. farm, however information regarding its effect on the growth of cocoa plants in the field is very limited. The objective of this experiment is to investigate the combined influence of ground cover crop A. pintoi, rhizobial bacterial inoculation and phosphorus (P fertilizer on the growth of cocoa in the field and nutrient status. This experiment laid out in split-split plot design consisted of three levels of cover crop (without, A. pintoiand Calopogonium caeruleum, two levels of rhizobium inoculation (not inoculated and inoculated and two levels of phosphorus application (no P added and P added. The results showed that in field condition the presence of A. pintoias cover crop did not affect the growth of cocoa. On the other hand, C. caeruleumas cover crop tended to restrict cocoa growth compared to A. pintoi. Application of P increased leaf number of cocoa plant. Biomass production of A. pintoiwas 40% higher than C. caeruleum. Soil organic carbon and nitrogen contents were not affected by ground cover crops, though higher value (0.235% N and 1.63% organic C was obtained from combined treatments of inoculation and P addition or neither inoculation nor P addition. In the case of no rhizobium inoculation, soil N content in cocoa farm with A. pintoicover crop was lower than that of without cover crop or with C. caeruleum. Cover crop increased plant N content when there was no inoculation, on the other hand rhizobium inoculation decreased N content of cocoa tissue. Tissue P content of cocoa plant was not influenced by A. Pintoicover crop or by rhizobium inoculation, except that the P tissue content of cocoa was 28% higher when the cover crop was C. caeruleumand inoculated. Key words : Arachis pintoi, Theobroma cacao, Calopogonium caeruleum, rhizobium, nitrogen, phosphorus.
Zhang, Xin; Wu, Songlin; Ren, Baihui; Chen, Baodong
2016-05-01
A pot experiment was carried out to investigate the effects of water management and mycorrhizal inoculation on arsenic (As) uptake by two rice varieties, the As-resistant BRRI dhan 47 (B47) and As-sensitive BRRI dhan 29 (B29). Grain As concentration of B47 plants was significantly lower than that of B29, and grain As concentration of B47 was higher under flooding conditions than that under aerobic conditions. In general, mycorrhizal inoculation (Rhizophagus irregularis) had no significant effect on grain As concentrations, but decreased the proportion of inorganic arsenic (iAs) in grains of B47. The proportion of dimethylarsinic acid (DMA) in the total grain As was dramatically higher under flooding conditions. Results demonstrate that rice variety selection and appropriate water management along with mycorrhizal inoculation could be practical countermeasures to As accumulation and toxicity in rice grains, thus reducing health risks of As exposure in rice diets.
Fenu, A; Roels, J; Van Damme, S; Wambecq, T; Weemaes, M; Thoeye, C; De Gueldre, G; Van De Steene, B
2012-01-01
This study analyzes the effect of inoculating membrane bioreactor (MBR) sludge in a parallel-operated overloaded conventional activated sludge (CAS) system. Modelling studies that showed the beneficial effect of this inoculation were confirmed though full scale tests. Total nitrogen (TN) removal in the CAS increased and higher nitrate formation rates were achieved. During MBR sludge inoculation, the TN removal in the CAS was proven to be dependent on MBR sludge loading. Special attention was given to the effect of inoculation on sludge quality. The MBR flocs, grown without selection pressure, were clearly distinct from the more compact flocs in the CAS system and also contained more filamentous bacteria. After inoculation the MBR flocs did not evolve into good-settling compact flocs, resulting in a decreasing sludge quality. During high flow conditions the effluent CAS contained more suspended solids. Sludge volume index, however, did not increase. Laboratory tests were held to determine the threshold volume of MBR sludge to be seeded into the CAS reactor. Above 16-30%, supernatant turbidity and scum formation increased markedly.
Entomologic Inoculation Rates of Anopheles arabiensis in Southwestern Ethiopia
Ulesido, Fekadu Massebo; Balkew, Meshesha; Gebre-Michael, Teshome; Lindtjørn, Bernt
2013-01-01
We collected anophelines every second week for one year from randomly selected houses in southwestern Ethiopia by using Centers for Disease Control (CDC) light traps, pyrethrum spray catches, and artificial pit shelter constructions to detect circumsporozoite proteins and estimate entomologic inoculation rates (EIRs). Of 3,678 Anopheles arabiensis tested for circumsporozoite proteins, 11 were positive for Plasmodium falciparum and three for P. vivax. The estimated annual P. falciparum EIR of ...
Gumus, Tuncay; Şukru Demirci, A.; Murat Velioglu, H.; Velioglu, Serap D.; Yilmaz, Ismail; Sagdic, Osman
2008-09-01
In this research, the effect of gamma irradiation on the inactivation of Escherichia coli O157:H7 (ATCC 33150), Staphylococcus aureus (ATCC 2392) and Salmonella typhimurium (NRRL 4463) inoculated into Tekirdag meatballs was investigated. The meatball samples were inoculated with pathogens and irradiated at the absorbed doses of 1, 2.2, 3.2, 4.5 and 5.2 kGy. E. coli O157:H7 count in 1 kGy irradiated meatballs stored in the refrigerator for 7 days was detected to be 4 log cfu/g lower than the count in nonirradiated samples ( pmeatballs. However, none of the test organisms were detected in the samples after irradiation with 4.5 kGy doses.
Effects of bacterial silage inoculants on whole-crop maize silage ...
African Journals Online (AJOL)
This study evaluated the effects of ensiling whole-crop maize with bacterial inoculants, Lactococcus lactis (LL) and Lactobacillus buchneri (LB), on the fermentation and nutrient digestibility in rams. Whole-crop maize (265 DM g/kg) was ensiled for 90 days in 210 L drums with no additive, or with LL or LB. After three months ...
Directory of Open Access Journals (Sweden)
Sri Murtini
2006-06-01
Full Text Available Tea mistlestoe extract (Scurrula oortiana has cytotoxic activity which is potential to be used in preventing viral induced-chicken tumor. The following study was designed to evaluate the effects of different inoculation routes, dosage levels, and strains of embryonated chicken eggs as media for testing the tea mistlestoe extract (Scurrula oortiana antiviral activity. Proper inoculation route was examined by inoculation of the extract at dose level of 0,2 mg/egg into embryonated layer eggs via allantoic cavity, chorio-allantoic membrane, and yolk sac. Effect of dose level of tea mistlestoe extract on embryo development was examined in groups of embryonated broiler eggs inoculated with the extract at 0.02, 0.2, 2, 20, or 200 mg/egg. Inoculation of tea mistlestoe extract into allantoic cavity was the safest procedure as indicated by the absence of embryos mortality, and faster embryo growth compared to those of chorio-allantoic membrane and yolk sac-inoculated eggs. The extract induced different growth effects when inoculated into embryonated layer or broiler eggs. Administration of the extract at dose levels between 0,02–200 mg/egg reduced significantly the weight of broiler embryoes, but not the relative weights of liver, heart and spleen. Administration of similar dosage in layer embryoes did not cause any significant difference in the embryoes weight. This study suggests that the study of antiviral activity of tea mistlestoe extract in embryonated chicken eggs should be carried out on embryonated eggs of layer breeds and the extract should be inoculated via allantoic cavity.
Directory of Open Access Journals (Sweden)
M.N Seiedi
2014-03-01
Full Text Available In order to study the effects of seed inoculation with rhizobium and nitrogen application on yield and some agronomic characterstics of soybean (Glycine max L., a spilt plot experiment based on randomized complete block design with three replications was conducted in 2011 at the research farm of the Islamic Azad University, Ardabil Branch. Factors were inorganic nitrogen fertilizer urea at four levels (0, 30, 60 and 90 kg urea/ha in the main plot and two levels of inoculation with Rhizobium japanicum bacteria (with and without inoculation assigned to the sub plots. Study the growth indices showed that the maximum total dry matter (435.4 gr/m2 , crop growth rate (6.75 gr/m2.day and relative growth rate (0.1003 gr/gr.day were obtained from compound of treatments high levels of urea application × inoculation with rhizobium while, the minimum values of these indices recorded in without nitrogen application×non inoculation with rhizobium. The highest plant height, number of pod per plant and grain yield were obtained from the highest level of nitrogen fertilizer (90 kg/ha urea and seed inoculation with rhizobium. Number and dry weight of nodules per plant increased significantly with increasing nitrogen application till 60 kg/ha in seed inoculation with rhizobium. The lowest values of these traits recorded in non application of urea×non inoculation with rhizobium. Inoculation with rhizobium bacteria increased the number and dry weight of nodules per plant. Thus, it can be suggested that in order to increasing of grain yield, seed can be inoculated with rhizobium bacteria × application of 60 kg urea/ha in conditions of Ardabil region.
Effect of adding sour yoghurt and dough as bacterial inoculant on ...
African Journals Online (AJOL)
Inoculation of whole-crop corn with sourdough and sour yoghurt significantly decreased pH, ash content and ammonia nitrogen, while dry matter determined using toloen distillation (DMT), Flieg point, crude protein (CP), and total nitrogen increased (P<0.05). Key words: Silage, sour yoghurt, sourdough, corn forage.
DEFF Research Database (Denmark)
Woolsey, Ian David; Webster, P.; Thamsborg, Stig Milan
2017-01-01
The French heartworm Angiostongylus vasorum is found in European red fox (Vulpes vulpes) and dog populations, where it appears to be spreading geographically. Once introduced into new areas, it establishes in local fox populations, typically to over 50% prevalence in a few years. High...... and elevated excretion of L1 in feces. Experimentally infected foxes were subsequently inoculated via stomach tube once (9 weeks post initial inoculation) or twice (9 and 13 weeks post inoculation (wpi)) with 100 third stage A. vasorum larvae (L3) previously isolated from aquatic snails infected with L1 from...... a naturally infected dog. Despite large variation in fecal larval excretion for the individual animals within the groups, excretion of L1 was significantly higher in foxes twice inoculated as compared to foxes inoculated only once. With an outlier in the once inoculated group removed, excretion became...
Sandeep Varma, R.; Johnson George, K.; Balaji, S.; Parthasarathy, V.A.
2009-01-01
Plant chitinases have been of particular interest since they are known to be induced upon pathogen invasion. Inoculation of Piper colubrinum leaves with the foot rot fungus, Phytophthora capsici leads to increase in chitinase activity. A marked increase in chitinase activity in the inoculated leaves was observed, with the maximum activity after 60 h of inoculation and gradually decreased thereafter. Older leaves showed more chitinase activity than young leaves. The level of chitinase in black pepper (Piper nigrum L.) upon inoculation was found to be substantially high when compared to P. colubrinum. RT–PCR using chitinase specific primers revealed differential accumulation of mRNA in P. colubrinum leaves inoculated with P. capsici. However, hyphal extension assays revealed no obvious differences in the ability of the protein extracts to inhibit growth of P. capsici in vitro. PMID:23961037
Directory of Open Access Journals (Sweden)
Rita de Cássia Nunes Marinho
2014-05-01
Full Text Available The objective of this work was to evaluate the contribution of efficient nitrogen-fixing rhizobial strains to grain yield of new cowpea cultivars, indicated for cultivation in the Brazilian Semiarid region, in the sub-medium of the São Francisco River Valley. Two experiments were set up at the irrigated perimeters of Mandacaru (Juazeiro, state of Bahia and Bebedouro (Petrolina, state of Pernambuco. The treatments consisted of single inoculation of five rhizobial strains - BR 3267, BR 3262, INPA 03-11B, UFLA 03-84 (Bradyrhizobium sp., and BR 3299T (Microvirga vignae -, besides a treatment with nitrogen and a control without inoculation or N application. The following cowpea cultivars were evaluated: BRS Pujante, BRS Tapaihum, BRS Carijó, and BRS Acauã. A randomized complete block design, with four replicates, was used. Inoculated plants showed similar grain yield to the one observed with plants fertilized with 80 kg ha-1 N. The cultivars BRS Tapaihum and BRS Pujante stood out in grain yield and protein contents when inoculated, showing their potential for cultivation in the sub-medium of the São Francisco River Valley.
International Nuclear Information System (INIS)
Galal, Y.G.; El-Ghandour, I.A.; Abdel Raouf, A.M.; Osman, M.E.
2003-01-01
Pot experiment was carried out with wheat that cultivated in virgin sandy soil and inoculated with Rhizobium (Rh), mycorrhizea (VAM) and mixture of both. The objective of this work was to verify the potential of these inoculum on wheat production, nutrient acquisition and microbial biomass N (MBN) contribution as affected by N and P fertilizers levels. MBN was detected through the fumigation-extraction method. Nitrogen and phosphorus fertilizers were applied at three levels, 0; 25 ppm N and 3.3 ppm P and 50 ppm N and 6.6 ppm P in the form of ( 15 NH 4 ) 2 SO 4 , 5% atom excess and super-phosphate, respectively. The effect of inoculation and chemical fertilizers on dry matter (DM), N and P uptake (shoot and grain) and MBN were traced. The obtained data revealed that the highest DM and N uptake by wheat shoot were recorded with the dual inoculation (Rh + VAM) at the highest level of N and P fertilizers. The highest grain yield was detected with single inoculum of AM fungi while N and P uptake were with dual inoculation at the same rate of fertilizers. Inoculation with Rh either alone or in combination with VAM have a positive and stimulative effect on wheat growth and N and P uptake indicating the possibilities of extending the use of symbiotic microorganisms to be applied with cereals. The fluctuation in the soil microbial biomass N did not gave a chance to recognize, exactly, the impact of inoculation and/or fertilization levels
Effect of white mustard essential oil on inoculated Salmonella sp. in a sauce with particulates.
David, Jairus R D; Ekanayake, Athula; Singh, Indarpal; Farina, Brian; Meyer, Michael
2013-04-01
White mustard essential oil (WMEO), from white mustard seed (Sinapis alba L.), is obtained by solvent extraction of defatted and wetted ground mustard; endogenous myrosinase catalyzes the hydrolysis of the glucosinolate sinalbin to yield 4-hydroxybenzyl isothiocyanate (4-HBITC), the antimicrobial component of WMEO. Sauce with particulates was made by mixing sauce, which served as the carrier for WMEO, with frozen vegetable and chicken particulates inoculated with Salmonella sp. WMEO (at 250 to 750 ppm of 4-HBITC) was able to reduce inoculated Salmonella counts by 0.8 to 2.7 log (CFU/g) in a frozen sauce with particulates in a dose-dependent manner, starting from the point of formulating the sauce through the microwave cooking step. High-pressure liquid chromatography-based analytical data confirmed that 4-HBITC was present in all of the samples in the expected concentrations and was completely hydrolyzed after the recommended cooking time in microwave ovens. In another experiment simulating unintentional abuse conditions, where the WMEO containing sauce with particulates was kept at room temperature for 5 h, WMEO (at 250 to 750 ppm of 4-HBITC) was able to reduce inoculated Salmonella counts from the point of first contact and up to 5 h by 0.7 to 2.4 log (CFU/g). Despite the known hydrolytic instability of the active component 4-HBITC, particularly at close to neutral pH values, WMEO was effective in controlling deliberately inoculated Salmonella sp. in a frozen sauce with particulates.
Directory of Open Access Journals (Sweden)
Aansa Rukya Saleem
Full Text Available Drought is one of the major constraints limiting agricultural production worldwide and is expected to increase in the future. Limited water availability causes significant effects to plant growth and physiology. Plants have evolved different traits to mitigate the stress imposed by drought. The presence of plant growth-promoting rhizobacteria (PGPR could play an important role in improving plant performances and productivity under drought. These beneficial microorganisms colonize the rhizosphere of plants and increase drought tolerance by lowering ethylene formation. In the present study, we demonstrate the potential to improve the growth of velvet bean under water deficit conditions of two different strains of PGPR with ACCd (1-Aminocyclopropane-1-Carboxylate deaminase activity isolated from rainfed farming system. We compared uninoculated and inoculated plants with PGPR to assess: a photosynthetic performance and biomass; b ACC content and ethylene emission from leaves and roots; c leaf isoprene emission. Our results provided evidence that under drought conditions inoculation with PGPR containing the ACCd enzyme could improve plant growth compared to untreated plants. Ethylene emission from roots and leaves of inoculated velvet bean plants was significantly lower than uninoculated plants. Moreover, isoprene emission increased with drought stress progression and was higher in inoculated plants compared to uninoculated counterparts. These findings clearly illustrate that selected PGPR strains isolated from rainfed areas could be highly effective in promoting plant growth under drought conditions by decreasing ACC and ethylene levels in plants.
Saleem, Aansa Rukya; Brunetti, Cecilia; Khalid, Azeem; Della Rocca, Gianni; Raio, Aida; Emiliani, Giovanni; De Carlo, Anna; Mahmood, Tariq; Centritto, Mauro
2018-01-01
Drought is one of the major constraints limiting agricultural production worldwide and is expected to increase in the future. Limited water availability causes significant effects to plant growth and physiology. Plants have evolved different traits to mitigate the stress imposed by drought. The presence of plant growth-promoting rhizobacteria (PGPR) could play an important role in improving plant performances and productivity under drought. These beneficial microorganisms colonize the rhizosphere of plants and increase drought tolerance by lowering ethylene formation. In the present study, we demonstrate the potential to improve the growth of velvet bean under water deficit conditions of two different strains of PGPR with ACCd (1-Aminocyclopropane-1-Carboxylate deaminase) activity isolated from rainfed farming system. We compared uninoculated and inoculated plants with PGPR to assess: a) photosynthetic performance and biomass; b) ACC content and ethylene emission from leaves and roots; c) leaf isoprene emission. Our results provided evidence that under drought conditions inoculation with PGPR containing the ACCd enzyme could improve plant growth compared to untreated plants. Ethylene emission from roots and leaves of inoculated velvet bean plants was significantly lower than uninoculated plants. Moreover, isoprene emission increased with drought stress progression and was higher in inoculated plants compared to uninoculated counterparts. These findings clearly illustrate that selected PGPR strains isolated from rainfed areas could be highly effective in promoting plant growth under drought conditions by decreasing ACC and ethylene levels in plants.
International Nuclear Information System (INIS)
Vinichuk, M.; Mårtensson, A.; Rosén, K.
2013-01-01
Methods for cleaning up radioactive contaminated soils are urgently needed. In this study we investigated whether the use of arbuscular mycorrhizal (AM) fungi can improve 137 Cs uptake by crops. Barley, cucumber, perennial ryegrass, and sunflower were inoculated with AM fungi and grown in low-level radionuclide contaminated soils in a field experiment 70 km southwest of Chernobyl, Ukraine, during two successive years (2009–2010). Roots of barley, cucumber and sunflower plants were slightly or moderately infected with AM fungus and root infection frequency was negatively or non-correlated with 137 Cs uptake by plants. Roots of ryegrass were moderately infected with AM fungus and infection frequency was moderately correlated with 137 Cs uptake by ryegrass. The application of AM fungi to soil in situ did not enhance radionuclide plant uptake or biomass. The responsiveness of host plants and AM fungus combination to 137 Cs uptake varied depending on the soil, although mycorrhization of soil in the field was conditional and did not facilitate the uptake of radiocesium. The total amount of 137 Cs uptake by plants growing on inoculated soil was equal to amounts in plant cultivated on non-inoculated soil. Thus, the use of AM fungi in situ for bioremediation of soil contaminated with a low concentration of 137 Cs could not be recommended. -- Highlights: • Effect of mycorrhization on 137 Cs uptake by crops was studied in a field experiment. • AM fungi did not enhance radionuclide plant uptake or biomass. • Plants growing on inoculated and non-inoculated soil accumulate 137 Cs equally
Zhou Nong; Ding, Bo; Feng, Yuan; Qi, Wen-hua; Zhang, Hua; Guo, Dong-qin; Xiang, Jun
2015-08-01
After 28 foreign species of AM fungi were inoculated in sterilized soil, the effects of the AM mycorrhizal colonization and the medicine quality of Paris polyphylla var. yunnanensis were observed by combination of inoculation test in pot at room temperature and instrumental analysis. The results showed that, compared with control group (CK), the inoculation of foreign AM fungi in the soil influenced the spore density, mycorrhizal infection rate, and colonization intensity of AM fungi in root system of P. polyphylla var. yunnanensis. The inoculation of foreign AM fungi enhanced the mycorrhiza viability of P. polyphylla var. yunnanensis by increasing the activity of succinic dehydrogenase (SDH) and alkaline phosphatase (ALP) in intraradical hyphae. The content of single steroid saponin in rhizome of P. polyphylla var. yunnanensis showed variation after P. polyphylla var. yunnanensis was inoculated by different foreign species of AM fungi, which was beneficial for increasing the medicine quality; however, the kinds of steroid saponin showed no difference. In a degree, there was a selectivity of symbiosis between P. polyphylla var. yunnanensis and foreign AM fungi. And we found that the Claroideoglomus claroideum and Racocetra coralloidea were best foreign AM fungi species for cultivating P. polyphylla var. yunnanensis under field condition.
Réponse du fonio blanc (Digitaria exilis Stapf) à l'inoculation avec ...
African Journals Online (AJOL)
SARAH
2016-07-31
Jul 31, 2016 ... (2004) a montré que l'inoculation avec des .... fasciculatum - Go: G. mosseae - Gm: G. manihotis - Ge : G. etunicatum - Gv : G. verriculosum. Les barres ..... dépendantes de la symbiose mycorhizienne car leurs ..... hybrid cv.
Hernández, Anabel González; de Moura, Ginaini Doin; Binati, Renato Leal; Nascimento, Francisco Xavier Inês; Londoño, Diana Morales; Mamede, Ana Carolina Peixoto; da Silva, Emanuela Pille; de Armas, Rafael Dutra; Giachini, Admir José; Rossi, Márcio José; Soares, Cláudio Roberto Fonsêca Sousa
2017-09-01
Coal open pit mining in the South of Santa Catarina state (Brazil) was inappropriately developed, affecting approximately 6.700 ha. Re-vegetation is an alternative for the recovery of these areas. Furthermore, the use of herbaceous legumes inoculated with nitrogen fixing bacteria is motivated due to the difficulty implementing a vegetation cover in these areas, mainly due to low nutrient availability. Therefore, the aim of this work was to evaluate, among 16 autochthonous rhizobia isolated from the coal mining areas, those with the greatest potential to increase growth of the herbaceous legumes Vicia sativa and Calopogonium mucunoides. Tests were conducted in greenhouse containing 17 inoculation treatments (16 autochthonous rhizobia + Brazilian recommended strain for each plant species), plus two treatments without inoculation (with and without mineral nitrogen). After 60 days, nodulation, growth, N uptake, and symbiotic efficiency were evaluated. Isolates characterization was assessed by the production of indole acetic acid, ACC deaminase, siderophores, and inorganic phosphate solubilization. The classification of the isolates was performed by 16 S rDNA gene sequencing. Only isolates UFSC-M4 and UFSC-M8 were able to nodulate C. mucunoides. Among rhizobia capable of nodulating V. sativa, only UFSC-M8 was considered efficient. It was found the presence of more than one growth-promoting attributes in the same organism, and isolate UFSC-M8 presented all of them. Isolates were classified as belonging to Rhizobium, Burkholderia and Curtobacterium. The results suggest the inoculation of Vicia sativa with strain UFSC-M8, classified as Rhizobium sp., as a promising alternative for the revegetation of coal mining degraded areas.
Directory of Open Access Journals (Sweden)
Shalome A. Bassett
2015-03-01
Full Text Available Human inflammatory bowel disease (IBD is a chronic intestinal disease where the resident microbiota contributes to disease development, yet the specific mechanisms remain unclear. Interleukin-10 gene-deficient (Il10-/- mice develop inflammation similar to IBD, due in part to an inappropriate response to commensal bacteria. We have previously reported changes in intestinal morphology and colonic gene expression in Il10-/- mice in response to oral bacterial inoculation. In this study, we aimed to identify specific changes in the caecal microbiota associated with colonic inflammation in these mice. The microbiota was evaluated using pyrotag sequencing, denaturing gradient gel electrophoresis (DGGE and quantitative real-time PCR. Microbiota profiles were influenced by genotype of the mice and by bacterial inoculation, and a strong correlation was observed between the microbiota and colonic inflammation scores. Although un-inoculated Il10-/- and C57 mice had similar microbiota communities, bacterial inoculation resulted in different changes to the microbiota in Il10-/- and C57 mice. Inoculated Il10-/- mice had significantly less total bacteria than un-inoculated Il10-/- mice, with a strong negative correlation between total bacterial numbers, relative abundance of Escherichia/Shigella, microbiota diversity, and colonic inflammation score. Our results show a putative causative role for the microbiota in the development of IBD, with potentially key roles for Akkermansia, or for Bacteroides, Helicobacter, Parabacteroides, and Alistipes, depending on the composition of the bacterial inoculum. These data support the use of bacterially-inoculated Il10-/- mice as an appropriate model to investigate human IBD.
Seed inoculation with Azospirillum brasilense and N fertilization of corn in the Cerrado biome
Directory of Open Access Journals (Sweden)
Ana Carolina Pereira de Vasconcelos
Full Text Available ABSTRACT There is a great interest to reduce doses and increase efficiency of inputs in agriculture. One alternative to lower doses of N fertilizers in corn is seed inoculation with diazotrophic bacteria, which can fix atmospheric N in soil. This study aimed to evaluate the effect of N doses-in the absence and presence of Azospirillum brasilense-on plant nutritional status at different growth stages and on seed yield of corn. The experiment was conducted during the 2011/2012 production season on a typical cerrado soil in Uberlândia, Triângulo Mineiro. The experimental design was randomized blocks with six repetitions. The treatments consisted of five N doses and the absence or presence of Azospirillum brasilense (100 mL ha-1 as a seed inoculant. A commercial product with minimum concentration of 2x108 CFU mL-1 100 mL ha-1 was used. Inoculation with Azospirillum brasilense did not significantly affect corn macronutrient content and yield, except for foliar calcium and potassium at 200 kg N ha-1 at the V8 stage. Corn yield increased with N doses up to 150 kg N ha-1.
Energy Technology Data Exchange (ETDEWEB)
Estes, B.L.; Enebak, S.A.; Chappelka, A.H. [Auburn Univ., Auburn, AL (United States). School of Forestry and Wildlife Sciences
2004-07-01
The conifer tree species with the greatest economic importance in south eastern United States plantations is Loblolly pine. Plantations require intensive fertilization, pesticide application, and irrigation. In these cases growth-promoting rhizobacteria are useful in pest control. While it was once thought that ozone in the troposphere was limited to urban areas, it is now known that it is transported far from its place of origin. Ozone is known to impact plant growth negatively. There have been no previous studies on whether growth-promoting rhizobacteria can decrease the negative effects of ozone. In this study seedlings of Loblolly pine were inoculated with either Bacillus subtilis (Ehrenberg) Cohn or Paenibacillus macerans (Schardinger) Ash. These were exposed to controlled amounts of ozone for 8-12 weeks. All plants showed decreased biomass and increased foliar damage compared to plants that were not exposed to ozone. B. subtilis inoculated plants showed less foliar damage than un-inoculated ones and root dimensions were increased. The use of growth-promoting rhizobacteria is not ready for large-scale commercial application in forestry, but this demonstration of the possible beneficial effects on ozone exposure warrants further investigation. 44 refs., 3 tabs., 2 figs.
Directory of Open Access Journals (Sweden)
Uppalapati Srinivasa R
2011-10-01
Full Text Available Abstract Background The Arabidopsis thaliana-Pseudomonas syringae model pathosystem is one of the most widely used systems to understand the mechanisms of microbial pathogenesis and plant innate immunity. Several inoculation methods have been used to study plant-pathogen interactions in this model system. However, none of the methods reported to date are similar to those occurring in nature and amicable to large-scale mutant screens. Results In this study, we developed a rapid and reliable seedling flood-inoculation method based on young Arabidopsis seedlings grown on MS medium. This method has several advantages over conventional soil-grown plant inoculation assays, including a shorter growth and incubation period, ease of inoculation and handling, uniform infection and disease development, requires less growth chamber space and is suitable for high-throughput screens. In this study we demonstrated the efficacy of the Arabidopsis seedling assay to study 1 the virulence factors of P. syringae pv. tomato DC3000, including type III protein secretion system (TTSS and phytotoxin coronatine (COR; 2 the effector-triggered immunity; and 3 Arabidopsis mutants affected in salicylic acid (SA- and pathogen-associated molecular pattern (PAMPs-mediated pathways. Furthermore, we applied this technique to study nonhost resistance (NHR responses in Arabidopsis using nonhost pathogens, such as P. syringae pv. tabaci, pv. glycinea and pv. tomato T1, and confirmed the functional role of FLAGELLIN-SENSING 2 (FLS2 in NHR. Conclusions The Arabidopsis seedling flood-inoculation assay provides a rapid, efficient and economical method for studying Arabidopsis-Pseudomonas interactions with minimal growth chamber space and time. This assay could also provide an excellent system for investigating the virulence mechanisms of P. syringae. Using this method, we demonstrated that FLS2 plays a critical role in conferring NHR against nonhost pathovars of P. syringae, but not to
90SR uptake by Pinus ponderosa and Pinus radiata seedlings inoculated with ectomycorrhizal fungi
International Nuclear Information System (INIS)
Entry, J.A.; Emmingham, W.H.; Rygiewicz, P.T.
1994-01-01
Strontium-90 ( 90 Sr) is a radionuclide characteristic of fallout from nuclear reactor accidents and nuclear weapons testing. Prior studies have shown that Pinus ponderosa and P. radiata seedlings can remove appreciable quantities of 90 Sr from soil and store it in plant tissue. In this study, we inoculated P. ponderosa and P. radiata seedlings with one of five isolates of ectomycorrhizal fungi. Inoculated and noninoculated (control) seedlings were compared for their ability to remove 90 Sr from an organic growth medium. Ectomycorrhizal P. ponderosa and P. radiata seedlings are able to remove 3-5 times more 90 Sr from contaminated soil than seedlings without ectomycorrhizae. (Author)
Directory of Open Access Journals (Sweden)
Vienna R Brown
Full Text Available Francisella tularensis is a highly virulent bacterium that is capable of causing severe disease (tularemia in a wide range of species. This organism is characterized into two distinct subspecies: tularensis (type A and holarctica (type B which vary in several crucial ways, with some type A strains having been found to be considerably more virulent in humans and laboratory animals. Cottontail rabbits have been widely implicated as a reservoir species for this subspecies; however, experimental inoculation in our laboratory revealed type A organisms to be highly virulent, resulting in 100% mortality following challenge with 50-100 organisms. Inoculation of cottontail rabbits with the same number of organisms from type B strains of bacteria was found to be rarely lethal and to result in a robust humoral immune response. The objective of this study was to characterize the protection afforded by a prior challenge with type B strains against a later inoculation with a type A strain in North American cottontail rabbits (Sylvilagus spp. Previous infection with a type B strain of organism was found to lengthen survival time and in some cases prevent death following inoculation with a type A2 strain of F. tularensis. In contrast, inoculation of a type A1b strain was uniformly lethal in cottontail rabbits irrespective of a prior type B inoculation. These findings provide important insight about the role cottontail rabbits may play in environmental maintenance and transmission of this organism.
International Nuclear Information System (INIS)
Chen Ming; Zhang Wei; Lin Min
1999-01-01
It showed that Alcaligenes faecalis could produce plant hormone (IAA) in LW medium. The pot experiment results showed that inoculation with A1501 and A1513 could promote the growth and grain yield of rice. Comparison with the non-inoculation, the grain yield of rice treated with A1501 and A1513 increased by 8.5% and 10.3% respectively. And %Ndfa of rice shoot and grain estimated by 15 N-isotope dilution method was 9.00% and 11.5%, respectively, which was consistent with the increment of the total N(8.5% and 11.6%, respectively). The study indicated that ammonia resistant engineering strain A1513 had more stimulative effect on the growth of rice and grain yield than A1501
Directory of Open Access Journals (Sweden)
Martha Viviana Torres Cely
2016-05-01
Full Text Available Nutrient availability is an important factor in crop production, and regular addition of chemical fertilizers is the most common practice to improve yield in agrosystems for intensive crop production. The use of some groups of microorganisms that have specific activity providing nutrients to plants is a good alternative, and arbuscular mycorrhizal fungi (AMF enhance plant nutrition by providing especially phosphorus (P, improving plant growth and increasing crop production. Unfortunately, the use of AMF as an inoculant on a large scale is not yet widely used, because of several limitations in obtaining a large amount of inoculum due to several factors, such as low growth, the few species domesticated under in vitro conditions, and high competition with native AMF. The objective of this work was to test the infectivity of a Rhizophagus clarus inoculum and its effectiveness as an alternative for P supply in soybean (Glycine max L. and cotton (Gossypium hirsutum L.. The experiments were carried out in plots and the treatments were: Fertilizer; AMF, AMF + Fertilizer and AMF + ½ Fertilizer; non-inoculated and non-fertilized plants were considered the control. The parameters evaluated were AMF root colonization and effect of inoculation on plant growth and yield under a field conditions. The results showed that AMF inoculation increased the effect of fertilizer application in soybean, and that in cotton R. clarus was more effective than chemical fertilizer
Force Myography to Control Robotic Upper Extremity Prostheses: A Feasibility Study
Directory of Open Access Journals (Sweden)
Erina eCho
2016-03-01
Full Text Available Advancement in assistive technology has led to the commercial availability of multi-dexterous robotic prostheses for the upper extremity. The relatively low performance of the currently used techniques to detect the intention of the user to control such advanced robotic prostheses, however, limits their use. This article explores the use of force myography (FMG as a potential alternative to the well-established surface electro-myography (sEMG. Specifically, the use of FMG to control different grips of a commercially available robotic hand, Bebionic3, are investigated. Four male transradially amputated subjects participated in the study and a protocol was developed to assess the prediction accuracy of eleven grips. Different combinations of grips were examined ranging from six up to eleven grips. The results indicate that it is possible to classify six primary grips important in activities of daily living using FMG with an accuracy of above 70% in the residual limb. Additional strategies to increase classification accuracy, such as using the available modes on the Bebionic3, allowed results to improve up to 88.83% and 89.00% for opposed thumb and non-opposed thumb modes respectively.
International Nuclear Information System (INIS)
Dhinakaran, R.; Savithri, P.
1997-01-01
A pot experiment was conducted on tomato (Lycopersicon esculentum L.var. CO3) grown in red non-calcareous soil (Paralythic Ustochrept) to study the effect of different P treatments involving single superphosphate (SSP) and Mussoorie rock phosphate (MRP) added at different levels, viz. 100 and 75 kg P 2 O 5 /ha along with and without vesicular arbuscular mycorrhizal (VAM) fungi inoculation. The results revealed that the P application as superphosphate at 100 kg P 2 O 5 /ha significantly increased the yield of tomato but the application of VAM fungi did not have any pronounced effect on tomato yield. The 32 P studies confirmed the increased uptake of P by the plants at higher level of P application. P content and its uptake by tomato fruit increased with the increasing levels of P application and VAM inoculation. The VAM fungi inoculation was also helpful in increasing the fertilizer use efficiency and also per cent P derived from fertilizer. (author)
Overall, Lisa M; Rebek, Eric J
2015-12-01
Xylella fastidiosa is the causative agent of diseases of perennial plants including peach, plum, elm, oak, pecan, and grape. This bacterial pathogen is transmitted by xylem-feeding insects. In recent years, Pierce's disease of grape has been detected in 10 counties in central and northeastern Oklahoma, prompting further investigation of the disease epidemiology in this state. We surveyed vineyards and tree nurseries in Oklahoma for potential insect vectors to determine species composition, infectivity, and natural inoculativity of commonly captured insect vectors. Yellow sticky cards were used to sample insect fauna at each location. Insects were removed from sticky cards and screened for X. fastidiosa using immunocapture-PCR to determine their infectivity. A second objective was to test the natural inoculativity of insect vectors that are found in vineyards. Graphocephala versuta (Say), Graphocephala coccinea (Forster), Paraulacizes irrorata (F.), Oncometopia orbona (F.), Cuerna costalis (F.), and Entylia carinata Germar were collected from vineyards and taken back to the lab to determine their natural inoculativity. Immunocapture-PCR was used to test plant and insect samples for presence of X. fastidiosa. The three most frequently captured species from vineyards and tree nurseries were G. versuta, Clastoptera xanthocephala Germar, and O. orbona. Of those insects screened for X. fastidiosa, 2.4% tested positive for the bacterium. Field-collected G. versuta were inoculative to both ragweed and alfalfa. Following a 7-d inoculation access period, a higher percentage of alfalfa became infected than ragweed. Results from this study provide insight into the epidemiology of X. fastidiosa in Oklahoma. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Salwani S.
2012-06-01
Full Text Available Biological Nitrogen Fixation (BNF process benefits the agriculture sector especially for reducing cost of nitrogenfertilizer. In the process, the diazotrophs convert N2 into ammonia (NH3 which is useable by plants. The BNF process iscatalysed by nitrogenase enzyme that involved protons and electrons together with evolution of H2 therefore, theassessment of N2 fixation is also available via H2 production and electron allocation analysis. Thus, the aims of thisexperiment were to estimate the nitrogenase enzyme activities and observe the influence of diazothrophs on growth oflegume (soybean and non legume (rice plants. Host plants were inoculated with respective inocula; Bradyrhizobiumjaponicum (strain 532C for soybean while Azospirillum brasilense (Sp7 and locally isolated diazotroph (isolate 5 forrice. At harvest, the plants were observed for plant growth parameters, H2 evolution, N2 fixation and electron allocationcoefficient (EAC values. The experiment recorded N2 fixation activities of inoculated soybean plants at 141.2 μmol N2 h-1g-1 dry weight nodule, and the evolution of H2 at 144.4 μmol H2 h-1 g-1 dry weight nodule. The electron allocationcoefficient (EAC of soybean was recorded at 0.982. For inoculated rice plants, none of the observations was successfully recorded. However, results for chlorophyll contents and plant dry weight of both plants inoculated with respective inocula were similar to the control treatments supplied with full nitrogen fertilization (+N. The experiment clearly showed that inoculation of diazotrophic bacteria could enhance growth of the host plants similar to plants treated with nitrogenous fertilizer due to efficient N2 fixation process
Towle, Dana; Callan, Deborah A; Farrel, Patricia A; Egan, Marie E; Murray, Thomas S
2013-09-01
Contaminated nebulizers are a potential source of bacterial infection but no single method is universally accepted for disinfection. We hypothesized that baby-bottle steam sterilizers effectively disinfect home nebulizers. Home nebulizers were inoculated with the common CF respiratory pathogens methicillin resistant Staphylococcus aureus, Burkholderia cepacia, Haemophilus influenzae, mucoid and non mucoid Pseudomonas aeruginosa, and Stenotrophomonas maltophilia. The nebulizers were swabbed for bacterial growth, treated with either the AVENT (Philips), the NUK Quick & Ready (Gerber) or DRY-POD (Camera Baby) baby bottle steam sterilizer and reswabbed for bacterial growth. All steam sterilizers were effective at disinfecting all home nebulizers. Viable bacteria were not recovered from any inoculated site after steam treatment, under any conditions tested. Steam treatment is an effective disinfection method. Additional studies are needed to confirm whether these results are applicable to the clinical setting. Copyright © 2012 European Cystic Fibrosis Society. Published by Elsevier B.V. All rights reserved.
Thermal Inactivation of Salmonella Enteritidis Inoculated to Cake and Chicken
Directory of Open Access Journals (Sweden)
Ceyda Dadalı
2018-04-01
Full Text Available In this study, thermal inactivation of Salmonella Enteritidis inoculated to the cake dough and a whole raw chicken was investigated. The cake dough was inoculated with 6.15 log-cfu/g S. Enteritidis then, thermal treatment was applied at 160°C top-bottom fan cooking mode. The initial count of S. Enteritidis showed reductions 1.49 log-cfu/g, 2.06 log-cfu/g and 4.29 log-cfu/g in the samples from the cold point location from the geometric center of the cake at 5, 7 and 10 minutes of thermal treatment, respectively. Although S. Enteritidis is not detected at the end of 15 minutes of heat treatment, the center of the cake temperature has reached 85.69°C and the cake sample is uncooked and its sensory properties are not acceptable. The cake that is safe and favorable with the sensory properties to the consumers was obtained by heat treatment for 30 minutes. After the cold point of a whole raw chicken was inoculated with 7.29 log-cfu/g S. Enteritidis, thermal treatment was applied at 220°C top-bottom fan cooking mode. The temperature at the cold point of 35 and 45 minutes heat-treated chickens reached 59.33 and 74.08°C, respectively, and 1.93 log-cfu/g and 5.33 log-cfu /g S. Enteritidis reduction caused in the samples respectively. S. Enteritidis cells were not detected in the whole chicken heat treated at 220°C for 60 minutes. The cakes, heat treated at 160°C top-bottom fan cooking mode for 30 minutes, were stored at two different storage temperatures as 4°C and 25°C for 72 hours. The whole chicken, heat treated at 220°C top-bottom fan cooking mode for 60 minutes, was stored at 4°C for 72 hours. S. Enteritidis cells were not detected in the cake and the whole chicken samples after the storage period.
Directory of Open Access Journals (Sweden)
Hamed Hadi
2016-04-01
Full Text Available Effect of free and symbiotic nitrogen fixing bacteria on seed and seedling produced seeds under deficit irrigation was conducted in laboratory and field experiments in 2006. In laboratory of karaj’s Seed and Plant Research and Certificate Institute an experiment was conducted based on factorial in form of completely randomized design with four replications and in field’s of Islamic Azad University, Varamin Branch were split factorial in form of randomized completely block design with three replications. Treatments included water stress [Irrigation after 50 (Normal irrigation, 100 (Middle stress, 150 (Severe stress mm evaporation from pan class A], Cultivar [Manokin & Williams and SRF×T3 Line] and inoculation [Inoculation with Bradyrhizobium japonicum, Bradyrhizobium japonicum co-inoculated with Azotobacter chroococcum, No seed inoculation]. Results showed that drought stress decreased the uniformity and germination speed and seedling emergence. Bacteria increased leaf dry weight, stem dry weight, leaf area and seedling vigor index but had no effect on emergence. In irrigation levels inoculated treatments had higher seedling length, leaf, stem, seedling dry weight and seedling vigor. Severs stress seeds inoculated with Bradyrhizobium japonicum had higher root dry weight than control. Therefore in seeds which were produced under deficit irrigation conditions, bacteria increased seedlings vigor.
YANG Zhen-ya; ZONG Jiong; ZHU Xue-zhu; LING Wan-ting
2016-01-01
The correlations of glomalin contents and removal of phenanthrene and pyrene as representative polycyclic aromatic hydrocarbons (PAHs) in soils with inoculation of arbuscular mycorrhizal fungi(AMF) were investigated. The test AMF included Glomus etunicatum(Ge), Glomus mosseae(Gm), and Glomus lamellosum(Gla), and the host plant was alfalfa(Medicago sativa L.). The AMF hyphal density and contents of easily extractable glomalin and total glomalin in AMF-inoculated soils were observed to increase...
Directory of Open Access Journals (Sweden)
Tatiane M. Rocha
2013-07-01
Full Text Available AbAns etxrpaecritment was carried out with 630 one-day-old chicks to evaluate the effects of organic acids when birds were experimentally inoculated with Salmonella Typhimurium. Liver damage and the persistence of the bacterium in the organs were evaluated as well. Broilers were distributed in a completely randomised experimental design in a 3×2 factorial arrangement of six treatments with seven replicates of 15 birds each. Birds were inoculated with saline solution or the bacterium via gavage at 1 day of age, or were offered a feed containing or not the organic acid blend for the period of 7 to 14 days of age. A dose of 5.0x102 colony-forming units (CFU/0.5 mL of Salmonella Typhimurium was used for inoculation both via gavage and feed. The parameters evaluated are weight, liver histopathology, liver and serum biochemistry, and bacteriological analyses of the caeca, crop, spleen, and liver and heart pool. At 21 and 28 days of age, the liver of the non-inoculated groups was significantly lighter as compared to the other treatments. Birds fed organic acids presented lower bacterial isolation rates in all organs tested. Birds inoculated in the crop and treated with organic acids presented lower E. coli CFU counts (P<0.05. Birds inoculated with Salmonella presented significant changes (P<0.05 in liver enzymes, as detected by serum biochemistry, and in liver histopathology. It was concluded that organic acids effectively controlled Salmonella Typhimurium and did not cause any liver damage.
Antibody response to equine coronavirus in horses inoculated with a bovine coronavirus vaccine.
Nemoto, Manabu; Kanno, Toru; Bannai, Hiroshi; Tsujimura, Koji; Yamanaka, Takashi; Kokado, Hiroshi
2017-11-17
A vaccine for equine coronavirus (ECoV) is so far unavailable. Bovine coronavirus (BCoV) is antigenically related to ECoV; it is therefore possible that BCoV vaccine will induce antibodies against ECoV in horses. This study investigated antibody response to ECoV in horses inoculated with BCoV vaccine. Virus neutralization tests showed that antibody titers against ECoV increased in all six horses tested at 14 days post inoculation, although the antibody titers were lower against ECoV than against BCoV. This study showed that BCoV vaccine provides horses with antibodies against ECoV to some extent. It is unclear whether antibodies provided by BCoV vaccine are effective against ECoV, and therefore ECoV challenge studies are needed to evaluate efficacy of the vaccine in the future.
Silva, Luís R; Pereira, Maria J; Azevedo, Jessica; Mulas, Rebeca; Velazquez, Encarna; González-Andrés, Fernando; Valentão, Patrícia; Andrade, Paula B
2013-12-15
Soybean (Glycine max (L.) Merrill) is one of the most important food crops for human and animal consumption, providing oil and protein at relatively low cost. The least expensive source of nitrogen for soybean is the biological fixation of atmospheric nitrogen by the symbiotic association with soil bacteria, belonging mainly to the genus Bradyrhizobium. This study was conducted to assess the effect of the inoculation of G. max with Bradyrhizobium japonicum on the metabolite profile and antioxidant potential of its seeds. Phenolic compounds, sterols, triterpenes, organic acids, fatty acids and volatiles profiles were characterised by different chromatographic techniques. The antioxidant activity was evaluated against DPPH, superoxide and nitric oxide radicals. Inoculation with B. japonicum induced changes in the profiles of primary and secondary metabolites of G. max seeds, without affecting their antioxidant capacity. The increase of organic and fatty acids and volatiles suggest a positive effect of the inoculation process. These findings indicate that the inoculation with nodulating B. japonicum is a beneficial agricultural practice, increasing the content of bioactive metabolites in G. max seeds owing to the establishment of symbiosis between plant and microorganism, with direct effects on seed quality. Copyright © 2013 Elsevier Ltd. All rights reserved.
Zhang, Guozhuang; Sun, Yonglin; Sheng, Hao; Li, Haichao; Liu, Xiping
2018-04-01
Crop growth and productivity are often impacted by the increased ethylene content induced by adverse environmental conditions such drought. Inoculations with bacteria producing ACC deaminase is considered as a potential biological approach to improve the growth and tolerance of stressed plants by lowering endogenous ethylene level. In this study, germinated wheat seeds were inoculated using three species of the rhizobacteria, which were isolated from the rhizosphere of wheat growing in dryland, and sown in pots. After three weeks, wheat seedlings were exposed to non-limiting water condition, medium drought and severe drought, respectively, for six weeks. The results showed that, irrespective of rhizobacterial inoculations, decreased soil water contents stimulated wheat ethylene metabolism, which was reflected by the significantly increased activity of ACC synthetase and ACC oxidase, besides an increased content of ACC both in the roots and leaves, and an enhanced capacity of leaves to release ethylene, concomitant with a significant decline in shoot and roots biomass. The inoculations of all three rhizobacterial species under each water condition reduced ACC content in wheat leaves, but effects of the inoculations on ACC synthase and ACC oxidase activity in the leaves and roots, ACC content in the roots, the capacity of leaves to release ethylene, and wheat growth varied with water conditions and bacterial species. Hence, both soil water conditions and rhizobacterial inoculations acted on all the processes of ethylene metabolism, with the former being dominant. The inoculations under non-limiting water condition and medium drought promoted shoot and root growth of wheat plants. Copyright © 2018 Elsevier Masson SAS. All rights reserved.
International Nuclear Information System (INIS)
Tveito, K O; M'Hamdi, M; Bedel, M; Zaloz'nik, M; Combeau, H; Kumar, A; Dutta, P
2012-01-01
We investigate the impact of the nucleation law for nucleation on Al-Ti-B inoculant particles, of the motion of inoculant particles and of the motion of grains on the predicted macrosegregation and microstructure in a grain-refined Al-22 wt.% Cu alloy casting. We conduct the study by numerical simulations of a casting experiment in a side-cooled 76×76×254 mm sand mould. Macrosegregation and microstructure formation are studied with a volume-averaged two-phase model accounting for macroscopic heat and solute transport, melt convection, and transport of inoculant particles and equiaxed grains. On the microscopic scale it accounts for nucleation on inoculant particles with a given size distribution (and corresponding activation undercooling distribution)and for the growth of globular solid grains. The growth kinetics is described by accounting for limited solute diffusion in both liquid and solid phases and for convective effects. We show that the consideration of a size distribution of the inoculants has a strong impact on the microstructure(final grain size) prediction. The transport of inoculants significantly increases the microstructure heterogeneities and the grain motion refines the microstructure and reduces the microstructure heterogeneities.
Influence of red wine fermentation oenological additives on inoculated strain implantation.
Duarte, Filomena L; Alves, Ana Claudia; Alemão, Maria Filomena; Baleiras-Couto, M Margarida
2013-06-01
Pure selected cultures of Saccharomyces cerevisiae starters are regularly used in the wine industry. A survey of S. cerevisiae populations during red wine fermentations was performed in order to evaluate the influence of oenological additives on the implantation of the inoculated strain. Pilot scale fermentations (500 L) were conducted with active dry yeast (ADY) and other commercial oenological additives, namely two commercial fermentation activators and two commercial tannins. Six microsatellite markers were used to type S. cerevisiae strains. The methodology proved to be very discriminating as a great diversity of wild strains (48 genotypes) was detected. Statistical analysis confirmed a high detection of the inoculated commercial strain, and for half the samples an effective implantation of ADY (over 80 %) was achieved. At late fermentation time, ADY strain implantation in fermentations conducted with commercial additives was lower than in the control. These results question the efficacy of ADY addition in the presence of other additives, indicating that further studies are needed to improve knowledge on oenological additives' use.
International Nuclear Information System (INIS)
Achakzai, A.K.K.; Liasu, M.O.; Popoola, O.J.
2011-01-01
Pot experiments were conducted to investigate the effect of AM (Glomus mosseae ) fungi inoculation (M) on the growth of maize and phyto extraction of selected heavy metals from a soil contaminated with crude oil (C). Four soil treatments, each with three replicates i.e., C/sup +/M/sup +/, M/sup +/, C/sup +/ and control (without oil and inoculum) were conducted. Half of the pots with the soil treatments were planted with singly sown (SS) and the other half with densely sown i.e., four maize seedlings (DS). Various plant growth attributes were measured at weekly intervals Cu/sup 2+/, Ni/sup 2+/, Pb/sup 2+/ and Cd/sup 2+/ in the soil, root and shoot of maize plants were determined separately. Inoculation by AM promoted the vegetative growth attributes in both treatments viz., C/sup +/M/sup +/ and M/+. AM inoculation also promoted the hyper extraction of heavy metals from C/sup +/M/sup +/ soils, but inhibited by soils treated with M/sup +/. High planting density i.e., DS also promoted phyto extraction of heavy metals from uncontaminated (M/sup +/) soils, but had minimal effect on phyto extraction from oil contaminated soils (C/sup +/). Planting density complemented the promotive effect of AM inoculation on phyto extraction of heavy metals from C/sup +/ soils. The hyper extraction of selected metals from soil is more favored by planting density in C/sup +/ soils, whereas AM inoculation tends to exclude heavy metals from potted plants. However, in case of C/sup +/M/sup +/ soils, AM inoculation promotes the hyper extraction of metals more than planting density. While the combination of the two phenomena act synergistically to promote metal hyper extraction from C/sup +/M/sup +/ as well as M/sup +/ soils. (author)
Directory of Open Access Journals (Sweden)
Di Bonito P
2017-06-01
Full Text Available Paola Di Bonito,1 Chiara Chiozzini,2 Claudia Arenaccio,2 Simona Anticoli,2 Francesco Manfredi,2 Eleonora Olivetta,2 Flavia Ferrantelli,2 Emiliana Falcone,3 Anna Ruggieri,3 Maurizio Federico2 1Department of Infectious, Parasitic and Immunomediated Diseases, Istituto Superiore di Sanità, Rome, Italy; 2National AIDS Center, Istituto Superiore di Sanità, Rome, Italy; 3Department of Veterinary Public Health and Food Safety, Istituto Superiore di Sanità, Rome, Italy Abstract: We recently proved that exosomes engineered in vitro to deliver high amounts of HPV E7 upon fusion with the Nefmut exosome-anchoring protein elicit an efficient anti-E7 cytotoxic T lymphocyte immune response. However, in view of a potential clinic application of this finding, our exosome-based immunization strategy was faced with possible technical difficulties including industrial manufacturing, cost of production, and storage. To overcome these hurdles, we designed an as yet unproven exosome-based immunization strategy relying on delivery by intramuscular inoculation of a DNA vector expressing Nefmut fused with HPV E7. In this way, we predicted that the expression of the Nefmut/E7 vector in muscle cells would result in a continuous source of endogenous (ie, produced by the inoculated host engineered exosomes able to induce an E7-specific immune response. To assess this hypothesis, we first demonstrated that the injection of a Nefmut/green fluorescent protein-expressing vector led to the release of fluorescent exosomes, as detected in plasma of inoculated mice. Then, we observed that mice inoculated intramuscularly with a vector expressing Nefmut/E7 developed a CD8+ T-cell immune response against both Nef and E7. Conversely, no CD8+ T-cell responses were detected upon injection of vectors expressing either the wild-type Nef isoform of E7 alone, most likely a consequence of their inefficient exosome incorporation. The production of immunogenic exosomes in the DNA
Directory of Open Access Journals (Sweden)
Joelma da Silva Santos
2015-02-01
Full Text Available Maize is among the most important crops in the world. This plant species can be colonized by diazotrophic bacteria able to convert atmospheric N into ammonium under natural conditions. This study aimed to investigate the effect of inoculation of the diazotrophic bacterium Herbaspirillum seropedicae (ZAE94 and isolate new strains of plant growth-promoting bacteria in maize grown in Vitória da Conquista, Bahia, Brazil. The study was conducted in a greenhouse at the Experimental Area of the Universidade Estadual do Sudoeste da Bahia. Inoculation was performed with peat substrate, with and without inoculation containing strain ZAE94 of H. seropedicae and four rates of N, in the form of ammonium sulfate (0, 60, 100, and 140 kg ha-1 N. After 45 days, plant height, dry matter accumulation in shoots, percentage of N, and total N (NTotal were evaluated. The bacteria were isolated from root and shoot fragments of the absolute control; the technique of the most probable number and identification of bacteria were used. The new isolates were physiologically characterized for production of indole acetic acid (IAA and nitrogenase activity. We obtained 30 isolates from maize plants. Inoculation with strain ZAE94 promoted an increase of 14.3 % in shoot dry mass and of 44.3 % in NTotal when associated with the rate 60 kg ha-1 N. The strains N11 and N13 performed best with regard to IAA production and J06, J08, J10, and N15 stood out in acetylene reduction activity, demonstrating potential for inoculation of maize.
Soil inoculation with microbial communities - can this become a useful tool in soil remediation?
Krug, Angelika; Wang, Fang; Dörfler, Ulrike; Munch, Jean Charles; Schroll, Reiner
2010-05-01
We artificially loaded different type of agricultural soils with model 14C-labelled chemicals, and we inoculated such soils with different microbial communities as well as isolated strains to enhance the mineralization of such chemicals. Inocula were introduced by different approaches: (i) soil inocula, (ii) application of isolated strain as well as microbial community via media, (iii) isolated strain as well as microbial community attached to a carrier material. Most of the inoculation experiments were conducted in laboratory but we also tested one of these approaches under real environmental conditions in lysimeters and we could show that the approach was successful. We already could show that inoculating soils with microbial communities attached on a specific carrier material shows the highest mineralization effectiveness and also the highest sustainability. Microbes attached on clay particles preserved their function over a long time period even if the specific microbial substrate was already degraded or at least not detectable any more. Additionally we already could show that in specific cases some soil parameters might reduce the effectiveness of such an approach. Results on isoproturon as a model for phenylurea-herbicides and 1,2,4-trichlorobenzene as an example for an industrially used chemical as well as the corresponding chemicals` degrading microbial communities and isolated strain will be presented.
Energy Technology Data Exchange (ETDEWEB)
Ronen, Z; Bollag, J M [Pennsylvania State Univ., University Park, PA (United States). Lab. of Soil Biochemistry
1992-05-01
A denitrifying bacterium capable of pyridine mineralization under anaerobic conditions was isolated from polluted soil. The bacterium, identified as Alcaligenes sp., was used in inoculation experiments. A subsurface sediment from a polluted site was amended with 10 {mu}g/g {sup 14}C-labeled pyridine, and 250 {mu}g/g nitrate, and then inoculated with the bacterium at an inoculum size of 4.5x10{sup 7} cells/g. After 44 h incubation at 28deg C under anaerobic conditions, 67% of the radioactivity was recovered as {sup 14}CO{sub 2}: 2% was extracted with 50% methanol, and 24% was recovered by combustion of the sediment. Analysis of the methanol extract revealed that no pyridine could be detected in the inoculated sediment. In contrast, mineralization of pyridine by the native microflora in the sediment occurred much more slowly: After 7 days of incubation only 10% of the added radioactivity was recovered as {sup 14}CO{sub 2}. At an inoculum size of 2x10{sup 3} cells/g pyridine mineralization was not as effective as at an inoculum size of 2x10{sup 7} cells/g. It is presumed that suppression of the introduced bacteria by the native microflora of the sediment prevents degradation at a low inoculum size. Amending the sediment with nitrate and phosphate improved pyridine mineralization by the introduced bacterium. These findings demonstrate the feasibility of using soil inoculation anaerobically for the bioremediation of pyridine-polluted soils. (orig.).
Directory of Open Access Journals (Sweden)
Sarah Aherfi
2018-03-01
Full Text Available The presence of the giant virus of amoeba Marseillevirus has been identified at many different sites on the human body, including in the bloodstream of asymptomatic subjects, in the lymph nodes of a child with adenitis, in one adult with Hodgkin's disease, and in the pharynx of an adult. A high seroprevalence of the Marseillevirus has been recorded in the general population. Whether Marseillevirus can disseminate and persist within a mammal after entry remains unproven. We aimed to assess the ability of the virus to disseminate and persist into healthy organisms, especially in the lymphoid organs. Parenteral inoculations were performed by intraperitoneal injection (in rats and mice or intravenous injection (in rats. Airway inoculation was performed by aerosolization (in mice. Dissemination and persistence were assessed by using PCR and amebal co-culture. Serologies were performed by immunofluorescent assay. Pathological examination was conducted after standard and immunohistochemistry staining. After intraperitoneal inoculation in mice and rats, Marseillevirus was detected in the bloodstream during the first 24 h. Persistence was noted until the end of the experiment, i.e., at 14 days in rats. After intravenous inoculation in rats, the virus was first detected in the blood until 48 h and then in deep organs with infectious virus detected until 14 and 21 days in the liver and the spleen, respectively. Its DNA was detected for up to 30 days in the liver and the spleen. After aerosolization in mice, infectious Marseillevirus was present in the lungs and nasal associated lymphoid tissue until 30 days post inoculation but less frequently and at a lower viral load in the lung than in the nasal associated lymphoid tissue. No other site of dissemination was found after aerosol exposure. Despite no evidence of disease being observed, the 30-day long persistence of Marseillevirus in rats and mice, regardless of the route of inoculation, supports the
Wiersma, Lidewij C M; Vogelzang-van Trierum, Stella E; van Amerongen, Geert; van Run, Peter; Nieuwkoop, Nella J; Ladwig, Mechtild; Banneke, Stefanie; Schaefer, Hubert; Kuiken, Thijs; Fouchier, Ron A M; Osterhaus, Albert D M E; Rimmelzwaan, Guus F
2015-03-01
To elucidate the pathogenesis and transmission of influenza virus, the ferret model is typically used. To investigate protective immune responses, the use of inbred mouse strains has proven invaluable. Here, we describe a study with isogenic guinea pigs, which would uniquely combine the advantages of the mouse and ferret models for influenza virus infection. Strain 2 isogenic guinea pigs were inoculated with H1N1pdm09 influenza virus A/Netherlands/602/09 by the intranasal or intratracheal route. Viral replication kinetics were assessed by determining virus titers in nasal swabs and respiratory tissues, which were also used to assess histopathologic changes and the number of infected cells. In all guinea pigs, virus titers peaked in nasal secretions at day 2 after inoculation. Intranasal inoculation resulted in higher virus excretion via the nose and higher virus titers in the nasal turbinates than intratracheal inoculation. After intranasal inoculation, infectious virus was recovered only from nasal epithelium; after intratracheal inoculation, it was recovered also from trachea, lung, and cerebrum. Histopathologic changes corresponded with virus antigen distribution, being largely limited to nasal epithelium for intranasally infected guinea pigs and more widespread in the respiratory tract for intratracheally infected guinea pigs. In summary, isogenic guinea pigs show promise as a model to investigate the role of humoral and cell-mediated immunities to influenza and their effect on virus transmission. Copyright © 2015 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.
Oliveira, Rui S; Carvalho, Patrícia; Marques, Guilhermina; Ferreira, Luís; Nunes, Mafalda; Rocha, Inês; Ma, Ying; Carvalho, Maria F; Vosátka, Miroslav; Freitas, Helena
2017-10-01
Chickpea (Cicer arietinum L.) is a widely cropped pulse and an important source of proteins for humans. In Mediterranean regions it is predicted that drought will reduce soil moisture and become a major issue in agricultural practice. Nitrogen (N)-fixing bacteria and arbuscular mycorrhizal (AM) fungi have the potential to improve plant growth and drought tolerance. The aim of the study was to assess the effects of N-fixing bacteria and AM fungi on the growth, grain yield and protein content of chickpea under water deficit. Plants inoculated with Mesorhizobium mediterraneum or Rhizophagus irregularis without water deficit and inoculated with M. mediterraneum under moderate water deficit had significant increases in biomass. Inoculation with microbial symbionts brought no benefits to chickpea under severe water deficit. However, under moderate water deficit grain crude protein was increased by 13%, 17% and 22% in plants inoculated with M. mediterraneum, R. irregularis and M. mediterraneum + R. irregularis, respectively. Inoculation with N-fixing bacteria and AM fungi has the potential to benefit agricultural production of chickpea under water deficit conditions and to contribute to increased grain protein content. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Medina-Trujillo Laura
2016-01-01
Full Text Available In a previous study we reported that sequential inoculation of Torulaspora delbrueckii and Saccharomyces cerevisiae during the first fermentation increased the protein concentration and improved the foaming properties of a base wine. Since effervescence and foam of sparkling wines are key quality factors, the interest of this practice for sparkling wine industry is obvious. In this paper we study whether the foaming properties of the sparkling wines produced from the base wines obtained by sequential inoculation with T. delbrueckii and S. cerevisiae remains better than those of their controls produced from base wines fermented only with S. cerevisiae. The obtained results confirmed that sequential inoculation in the production of the base wine originated sparkling wines with significantly higher maximum heights of foam than conventional inoculation, probably because autolysis of the T. delbrueckii cells in the base wine released higher amounts of proteins, especially of the low molecular weight fraction.
Govindarajan, Munusamy; Balandreau, Jacques; Kwon, Soon-Wo; Weon, Hang-Yeon; Lakshminarasimhan, Cunthipuram
2008-01-01
During a survey of endophytic diazotrophic bacteria associated with different rice varieties in Tamilnadu, some "endophytes" were obtained. Thirteen bacterial isolates from surface-sterilized roots and shoots were obtained in pure culture, which produced indole acetic acid (IAA) and reduced acetylene to ethylene. Polymerase chain reaction (PCR) amplification confirmed the presence of nif-H gene in all the isolates. Morphological, biochemical, and molecular characteristics indicated that all of them belonged to the genus Burkholderia One of them, MGK3, was consistently more active in reducing acetylene, and 16S rDNA sequences of isolate MGK3 confirmed its identification as Burkholderia vietnamiensis. Colonization of rice root was confirmed by strain MGK3 marked with gusA gene. The inoculated roots showed a blue color, which was most intense at the points of lateral root emergence and at the root tip. Transverse sections of roots, 15 days after inoculation, revealed beta-glucuronidase (GUS) activity within many of the cortical intercellular spaces next to the stele and within the aerenchyma. Nitrogen fixation was quantified by using (15)N isotope dilution method with two different cultivars grown in pot and field experiments. Higher nitrogen fixation was observed in variety Ponni than in ADT-43, where nearly 42% (field) and 40% (pot) of the nitrogen was derived from the atmosphere (% Ndfa). Isolate MGK3 was used to inoculate rice seedlings in a comparison with four other diazotrophs, viz., Gluconacetobacter diazotrophicus LMG7603, Herbaspirillum seropedicae LMG6513, Azospirillum lipoferum 4B LMG4348, and B. vietnamiensis LMG10929. They were used to conduct two pot and four field inoculation experiments. MGK3 alone, and combined with other diazotrophs, performed best under both pot and field conditions: combined inoculation produced yield increases between 9.5 and 23.6%, while MGK3 alone increased yield by 5.6 to 12.16% over the uninoculated control treatment.
Pathogenesis of avian pneumovirus infection in turkeys.
Jirjis, F F; Noll, S L; Halvorson, D A; Nagaraja, K V; Shaw, D P
2002-05-01
Avian pneumovirus (APV) is the cause of a respiratory disease of turkeys characterized by coughing, ocular and nasal discharge, and swelling of the infraorbital sinuses. Sixty turkey poults were reared in isolation conditions. At 3 weeks of age, serum samples were collected and determined to be free of antibodies against APV, avian influenza, hemorrhagic enteritis, Newcastle disease, Mycoplasma gallisepticum, Mycoplasma synoviae, Mycoplasma meleagridis, Ornithobacterium rhinotracheale, and Bordetella avium. When the poults were 4 weeks old, they were inoculated with cell culture-propagated APV (APV/Minnesota/turkey/2a/97) via the conjunctival spaces and nostrils. After inoculation, four poults were euthanatized every 2 days for 14 days, and blood, swabs, and tissues were collected. Clinical signs consisting of nasal discharge, swelling of the infraorbital sinuses, and frothy ocular discharge were evident by 2 days postinoculation (PI) and persisted until day 12 PI. Mild inflammation of the mucosa of the nasal turbinates and infraorbital sinuses was present between days 2 and 10 PI. Mild inflammatory changes were seen in tracheas of poults euthanatized between days 4 and 10 PI. Antibody to APV was detected by day 7 PI. The virus was detected in tissue preparations and swabs of nasal turbinates and infraorbital sinuses by reverse transcription polymerase chain reaction, virus isolation, and immunohistochemical staining methods between days 2 and 10 PI. Virus was detected in tracheal tissue and swabs between days 2 and 6 PI using the same methods. In this experiment, turkey poults inoculated with tissue culture-propagated APV developed clinical signs similar to those seen in field cases associated with infection with this virus.
Alter, Thomas; Bori, Anouchka; Hamedi, Ahmad; Ellerbroek, Lüppo; Fehlhaber, Karsten
2006-10-01
This study investigated the influence of inoculum levels and manufacturing methods on the survival of Campylobacter (C.) jejuni in raw fermented turkey sausages. Sausages were prepared and inoculated with C. jejuni. After inoculation, these sausages were processed and ripened for 8 days. Samples were taken throughout the ripening process. The presence of C. jejuni was established bacteriologically. Additionally, lactic acid bacteria were enumerated, pH values and water activity were measured to verify the ripening process. To detect changes in genotype and verify the identity of the recovered clones, AFLP analysis was carried out on the re-isolated strains. Whereas no C. jejuni were detectable when inoculating the sausages with the lowest inoculum (0.08-0.44 log(10) cfu/g sausage emulsion), C. jejuni were detectable for 12-24h by enrichment when inoculated with approximately 2 log(10) cfu/g. After inoculation with 4 and 6 log(10) cfu/g respectively, C. jejuni were detectable without enrichment for 12-48 h and by enrichment for 144 h at the most. The greatest decrease of the C. jejuni population occurred during the first 4 h of ripening. Only a very high inoculum level allowed the survival of the organism during a fermentation process and during ripening to pose a potential risk for consumers. Lower initial Campylobacter inoculums will be eliminated during proper ripening of the sausages, if sufficient decrease in water activity and pH-value is ensured.
Wei, Yuquan; Zhao, Yue; Shi, Mingzi; Cao, Zhenyu; Lu, Qian; Yang, Tianxue; Fan, Yuying; Wei, Zimin
2018-01-01
Enriched phosphate-solubilizing bacteria (PSB) agent were acquired by domesticated cultivation, and inoculated into kitchen waste composting in different stages. The effect of different treatments on organic acids production, tricalcium phosphate (TCP) solubilization and their relationship with bacterial community were investigated during composting. Our results pointed out that inoculation affected pH, total acidity and the production of oxalic, lactic, citric, succinic, acetic and formic acids. We also found a strong advantage in the solubilization of TCP and phosphorus (P) availability for PSB inoculation especially in the cooling stage. Redundancy analysis and structural equation models demonstrated inoculation by different methods changed the correlation of the bacterial community composition with P fractions as well as organic acids, and strengthened the cooperative function related to P transformation among species during composting. Finally, we proposed a possible mechanism of P solubilization with enriched PSB inoculation, which was induced by bacterial community and organic acids production. Copyright © 2017 Elsevier Ltd. All rights reserved.
Reavy, B; Arif, M; Kashiwazaki, S; Webster, K D; Barker, H
1995-01-01
Nicotiana benthamiana stem tissue was transformed with Agrobacterium tumefaciens harboring a binary vector containing the potato mop-top virus (PMTV) coat protein (CP) gene. PMTV CP was expressed in large amounts in some of the primary transformants. The five transgenic lines which produced the most CP were selected for resistance testing. Flowers on transformed plants were allowed to self-fertilize. Transgenic seedlings selected from the T1 seed were mechanically inoculated with two strains of PMTV. Virus multiplication, assayed by infectivity, was detected in only one transgenic plant of 98 inoculated. T1 plants were also highly resistant to graft inoculation; PMTV multiplied in only one plant of 45 inoculated. Transgenic T1 seedlings were challenged in a bait test in which they were grown in soil containing viruliferous spores of the vector fungus Spongospora subterranea. In these tests only two plants out of 99 became infected. Of the five transgenic lines tested, plants of three lines were immune to infection following manual, graft, or fungal inoculation.
Directory of Open Access Journals (Sweden)
H. Nazarly
2016-05-01
Full Text Available In order to study the qualitative and quantitative yield and some agronomic characteristics of sunflower (Helianthus annus L. in response to seed inoculation with PGPR under various levels of nitrogen fertilizer, a factorial experiment was conducted based on a randomized complete block design with three replications in field experimental University of Mohaghegh Ardabili during growing season of 2009-2010. Factors were nitrogen fertilizer in three levels (0, 80 and 160 kg N ha-1 as urea and seed inoculation with plant growth promoting rhizobacteria in four levels containing, without inoculation (as control, seed inoculation with Azotobacter chroococcum strain 5, Azospirillum lipoferum strain OF, Psedomunas strain 186. Results indicated that nitrogen levels and seed inoculation with Plant Growth Promoting Rhizobacteria (PGPR had significant effects on all of characteristics studied (except grain 1000 weight and stem diameter. Grain yield, plant height, head diameter, seed number per head, , yield and oil percentage, yield and protein percentage increased with increasing of nitrogen fertilizer and application of seed inoculation with PGPR. Response of grain yield wasn't the same for various levels of nitrogen fertilizer and seed inoculation with PGPR. The highest grain yield belonged to application of 160 kg N ha-1 and seed inoculation with Azotobacter. Means comparison showed that treatment compounds N160 × without inoculation with PGPR and N80 × seed inoculation with PGPR Azotobacter had similar grain yields. Thus, it can be suggested that in order to increasing of grain yield seed should be inoculated with Azotobacter bacteria × 80 kg N/ha in conditions of Ardabil region.
Ferraretto, L F; Fredin, S M; Shaver, R D
2015-10-01
Exogenous protease addition may be an option to increase proteolysis of zein proteins and thus starch digestibility in rehydrated and high-moisture corn (HMC) ensiled for short periods. In addition, microbial inoculation may accelerate fermentation and increase acid production and thus increase solubilization of zein proteins. Four experiments were performed to evaluate the effect on fermentation profile, N fractions, and ruminal in vitro starch digestibility (ivSD) of the following: (1) rehydration and ensiling of dry ground corn; (2) exogenous protease addition to rehydrated un-ensiled and ensiled corn; (3) exogenous protease addition or inoculation in rehydrated ensiled corn; and (4) exogenous protease addition or inoculation in HMC. Experiments 1, 2, and 3 were performed with 7 treatments: dry ground corn (DGC); DGC rehydrated to a targeted dry matter content of 70% (REH); REH treated with exogenous protease (REH+); REH ensiled for 30 d (ENS); ENS treated with exogenous protease (ENS+); ENS treated with a microbial inoculant containing Lactobacillus plantarum, Lactobacillus casei, Enterococcus faecium, and Pediococcus sp. (ENSI); and ENS treated with exogenous protease and microbial inoculant (ENSI+). Experiment 1 compared DGC, REH, and ENS with ivSD being greater for ENS (64.9%) than DGC and REH (51.7% on average). Experiment 2 compared REH and ENS without or with exogenous protease addition (REH+ and ENS+, respectively). Ensiling and exogenous protease addition increased ivSD, but exogenous protease addition was more effective in ENS than REH (6.4 vs. 2.6 percentage unit increase). Experiment 3 compared the effects of exogenous protease addition and inoculation in ENS corn (ENS, ENS+, ENSI, and ENSI+). The addition of protease, but not inoculant, increased ivSD. Inoculation reduced pH and acetate, propionate, and ethanol concentrations, and increased lactate and total acid concentrations. In experiment 4, 8 treatments were a combination of HMC noninoculated
Directory of Open Access Journals (Sweden)
Nurudeen ADEYEMI
2017-06-01
Full Text Available Variations in yield components and grain yield of arbuscular mycorrhizal fungi (AMF inoculated soybean varieties (Glycine max L. Merrill grown in CO2 enriched environment in the humid rainforest were tested. A screen house trial was established with soybean varieties (‘TGx 1448-2E’, ‘TGx 1440-1E’ and ‘TGx 1740-2F’, AMF inoculation (with and without and CO2 enrichment (350±50 ppm and 550±50 ppm in open top chamber, arranged in completely randomised design, replicated three times. A field trial was also conducted; the treatments were arranged in a split-split plot configuration fitted into randomised complete block design. In the main plot the variant was CO2 enrichment, the sub-plot consisted of AMF inoculation (with and without, while the sub-sub plot consisted of soybean varieties, replicated three times. Both trials had significantly higher grain yield at elevated CO2 than ambient. This could be attributed to improved yield attributes, more spore count and root colonisation. In both trials, inoculated soybean had significantly higher dry pod weight than un-inoculated, which could suggest the increased grain yield observed on the field. AMF inoculated soybean varieties outperformed un-inoculated in both CO2 enriched and ambient concentrations. AMF inoculated soybean variety ‘TGx 1740-2F’ is most preferable in CO2 enriched environment, while variety ‘TGx 1448-2E’ had the most stable grain yield in all growth environments.
Effects of inoculation of plant growth-promoting rhizobacteria on metal uptake by Brassica juncea
International Nuclear Information System (INIS)
Wu, S.C.; Cheung, K.C.; Luo, Y.M.; Wong, M.H.
2006-01-01
A greenhouse study was carried out with Brassica juncea to critically evaluate effects of bacterial inoculation on the uptake of heavy metals from Pb-Zn mine tailings by plants. Application of plant growth-promoting rhizobacteria, including nitrogen-fixing bacteria and phosphate and potassium solubilizers, might play an important role in the further development of phytoremediation techniques. The presence of these beneficial bacteria stimulated plant growth and protected the plant from metal toxicity. Inoculation with rhizobacteria had little influence on the metal concentrations in plant tissues, but produced a much larger above-ground biomass and altered metal bioavailability in the soil. As a consequence, higher efficiency of phytoextraction was obtained compared with control treatments. - Rhizobacteria promoted growth above normal biomass, but did not influence plant metal concentrations
Effects of inoculation of plant growth-promoting rhizobacteria on metal uptake by Brassica juncea
Energy Technology Data Exchange (ETDEWEB)
Wu, S.C. [Department of Biology and Croucher Institute for Environmental Sciences, Hong Kong Baptist University, Kowloon Tong, Hong Kong (China); Joint Open Laboratory on Soil and Environment between HKBU and ISSCAS (China); Cheung, K.C. [Department of Biology and Croucher Institute for Environmental Sciences, Hong Kong Baptist University, Kowloon Tong, Hong Kong (China); Joint Open Laboratory on Soil and Environment between HKBU and ISSCAS (China); Luo, Y.M. [Institute of Soil Science, Chinese Academy of Sciences, Nanjing (China); Joint Open Laboratory on Soil and Environment between HKBU and ISSCAS (China); Wong, M.H. [Department of Biology and Croucher Institute for Environmental Sciences, Hong Kong Baptist University, Kowloon Tong, Hong Kong (China) and Joint Open Laboratory on Soil and Environment between HKBU and ISSCAS (China)]. E-mail: mhwong@hkbu.edu.hk
2006-03-15
A greenhouse study was carried out with Brassica juncea to critically evaluate effects of bacterial inoculation on the uptake of heavy metals from Pb-Zn mine tailings by plants. Application of plant growth-promoting rhizobacteria, including nitrogen-fixing bacteria and phosphate and potassium solubilizers, might play an important role in the further development of phytoremediation techniques. The presence of these beneficial bacteria stimulated plant growth and protected the plant from metal toxicity. Inoculation with rhizobacteria had little influence on the metal concentrations in plant tissues, but produced a much larger above-ground biomass and altered metal bioavailability in the soil. As a consequence, higher efficiency of phytoextraction was obtained compared with control treatments. - Rhizobacteria promoted growth above normal biomass, but did not influence plant metal concentrations.
Kim, Dong Hyeon; Amanullah, Sadar M; Lee, Hyuk Jun; Joo, Young Ho; Han, Ouk Kyu; Adesogan, Adegbola T; Kim, Sam Churl
2018-01-01
This study estimated the effects of hybrid and bacterial inoculant on fermentation quality and fatty acid profile of barley silages. Yuyeon (Silkless) and Youngyang (Silking) barley hybrids were harvested at 24.9 and 27.1% dry matter, respectively, and chopped to 10 cm lengths. Each hybrid was treated with or without an inoculant (2 × 10 4 colony-forming units/g of Lactobacillus plantarum). A total of 48 silos were prepared in an experiment with a 2 × 2 (hybrid × inoculant) treatment arrangement with four replications and three ensiling durations (2, 7 and 100 days). After 100 days of ensiling, Yuyeon silage had higher (P hybrids and increased (P hybrid might have better potential benefits on animal performances due to its smooth awn and silkless nature, and higher in vitro dry matter digestibility. Its higher C18:3n-3 would be better for improving fatty acid profile of meat or milk than Youngyang hybrid. © 2017 Japanese Society of Animal Science.
Directory of Open Access Journals (Sweden)
Darko Uher
2007-06-01
Full Text Available Two year field trials (1999 - 2001 were performed to determine theinoculation seed winter pea and nitrogen top-dressing effect on number and active nodules of pea root and also on the green mass and dry matter yield of winter pea cv. Maksimirski ozimi and wheat cv. Sana mixture. Immediately before sowing the inoculation of pea seeds was accomplished by the indigenous variety of Rhizobium leguminosarum bv. viciae which belongs to the collection of Department of Microbiology at the Faculty of Agriculture University of Zagreb. The highest total nodule number on pea root (159 was determined on the inoculated variant as well as active nodule 144. Average mixture green mass yield were ranging from 24,65 t ha-1 (control up to 35,50 t ha-1 (inoculation. Total dry matter yields were ranging from 3,93 t ha-1 (control up to 5,66 t ha-1 (inoculation. Yields crude proteins pea in 2001 were ranging from 692 kg ha-1 (control up to 1058 kg ha-1 (inoculation and for wheat, those values ranged from 199 kg ha-1 (control up to 454 kg ha-1 (nitrogen top-dressing. Total crude proteins mixture yields were in range from 891 kg ha-1 (control up to 1360 kg ha-1 (inoculation.
Directory of Open Access Journals (Sweden)
Côté Luc
2007-11-01
Full Text Available Abstract Background In North America, although it varies according to the specific type of acute respiratory infections (ARI, use of antibiotics is estimated to be well above the expected prevalence of bacterial infections. The objective of this pilot clustered randomized controlled trial (RCT is to assess the feasibility of a larger clustered RCT aiming at evaluating the impact of DECISION+, a continuing professional development (CPD program in shared decision making, on the optimal use of antibiotics in the context of ARI. Methods/design This pilot study is a cluster RCT conducted with family physicians from Family Medicine Groups (FMG in the Quebec City area, Canada. Participating FMG are randomised to an immediate DECISION+ group, a CPD program in shared decision making, (experimental group, or a delayed DECISION+ group (control group. Data collection involves recruiting five patients consulting for ARI per physician from both study groups before (Phase 1 and after (Phase 2 exposure of the experimental group to the DECISION+ program, and after exposure of the control group to the DECISION+ program (Phase 3. The primary outcome measures to assess the feasibility of a larger RCT include: 1 proportion of contacted FMG that agree to participate; 2 proportion of recruited physicians who participate in the DECISION+ program; 3 level of satisfaction of physicians regarding DECISION+; and 4 proportion of missing data in each data collection phase. Levels of agreement of the patient-physician dyad on the Decisional Conflict Scale and physicians' prescription profile for ARI are performed as secondary outcome measures. Discussion This study protocol is informative for researchers and clinicians interested in designing and/or conducting clustered RCT with FMG regarding training of physicians in shared decision making. Trial Registration ClinicalTrials.gov Identifier: NCT00354315
Kontopoulou, Charis-Konstantina; Liasis, Epifanios; Iannetta, Pietro Pm; Tampakaki, Anastasia; Savvas, Dimitrios
2017-10-01
Testing rhizobial inoculation of common bean (Phaseolus vulgaris L.) in hydroponics enables accurate quantification of biological N 2 fixation (BNF) and provides information about the potential of reducing inorganic N fertilizer use. In view of this background, common bean grown on pumice was inoculated with Rhizobium tropici CIAT899 (Rt) and supplied with either full-N (total nitrogen 11.2 mmol L -1 ), 1/3 of full-N or N-free nutrient solution (NS). BNF was quantified at the early pod-filling stage using the 15 N natural abundance method. Full-N supply to Rt-inoculated plants resulted in markedly smaller nodules than less- or zero-N supply, and no BNF. Rt inoculation of full-N-treated plants did not increase biomass and pod yield compared with non-inoculation. Restriction (1/3 of full-N) or omission of inorganic N resulted in successful nodulation and BNF (54.3 and 49.2 kg N ha -1 , corresponding to 58 and 100% of total plant N content respectively) but suppressed dry shoot biomass from 191.7 (full-N, +Rt) to 107.4 and 43.2 g per plant respectively. Nutrient cation uptake was reduced when inorganic N supply was less or omitted. Rt inoculation of hydroponic bean provides no advantage when full-N NS is supplied, while 1/3 of full-N or N-free NS suppresses plant biomass and yield, partly because the restricted NO 3 - supply impairs cation uptake. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Guerrero-Molina, M F; Lovaisa, N C; Salazar, S M; Martínez-Zamora, M G; Díaz-Ricci, J C; Pedraza, R O
2015-05-01
The plant growth-promoting strain REC3 of Azospirillum brasilense, isolated from strawberry roots, prompts growth promotion and systemic protection against anthracnose disease in this crop. Hence, we hypothesised that A. brasilense REC3 can induce different physiological, structural and molecular responses in strawberry plants. Therefore, the aim of this work was to study these traits activated in Azospirillum-colonised strawberry plants, which have not been assessed until now. Healthy, in vitro micropropagated plants were root-inoculated with REC3 under hydroponic conditions; root and leaf tissues were sampled at different times, and oxidative burst, phenolic compound content, malondialdehyde (MDA) concentration, callose deposition, cell wall fortification and gene expression were evaluated. Azospirillum inoculation enhanced levels of soluble phenolic compounds after 12 h post-inoculation (hpi), while amounts of cell wall bound phenolics were similar in inoculated and control plants. Other early responses activated by REC3 (at 24 hpi) were a decline of lipid peroxidation and up-regulation of strawberry genes involved in defence (FaPR1), bacterial recognition (FaFLS2) and H₂O₂ depuration (FaCAT and FaAPXc). The last may explain the apparent absence of oxidative burst in leaves after bacterial inoculation. Also, REC3 inoculation induced delayed structural responses such as callose deposition and cell wall fortification (at 72 hpi). Results showed that A. brasilense REC3 is capable of exerting beneficial effects on strawberry plants, reinforcing their physiological and cellular characteristics, which in turns contribute to improve plant performance. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.
International Nuclear Information System (INIS)
Rehman, A.; Hamid, N.; Jawaid, F.
2010-01-01
Seeds of Glycine max (soybean) were inoculated with N-fixing bacterium Bradyrhizobium japonicum and grown in growth chamber to investigate interactive effects of atmospheric CO/sub 2/ and plants Nitrogen status on root and shoot length and biomass, nodule formation and Nitrogen concentration. Plants were grown with CO/sub 2/ at 3500 and 1000 ppm with or without Bradyrhizobium japonicum inoculation. Root and shoot length and dry mass of Glycine max increased significantly with CO/sub 2/ enrichment provided with Bradyrhizobium japonicum as compared to deficient Nitrogen fixing bacterium. While ambient and enriched CO/sub 2/ levels resulted in increased Nitrogen concentration of Glycine max shoot and root which is inoculated with N-fixing bacterium. Nodule formation was also enhanced in plants supplied with Bradyrhizobium japonicum as compared to plants which is Bradyrhizobium japonicum deficient at both CO/sub 2/ concentrations. (author)
Directory of Open Access Journals (Sweden)
SF Eto
2012-03-01
Full Text Available Recent studies have reported the use of IgY antibody in the prevention or treatment of diseases in animals. IgY can be obtained in large amounts from the yolk of chicken eggs through a low-cost process. This study evaluated the effect of different routes of inoculation on antibody production and spleen morphological characteristics of laying hens (White Leghorn inoculated with sheep red blood cells. The analysis of the results showed that the intramuscular route is the most efficient for total antibody production in the primary immune response, while the intravenous route is the most efficient in producing IgY antibodies in the secondary immune response. No histological changes were observed in the spleen of laying hens. This study could be useful for developing protocols of antigen inoculation in laying hens for IgY antibody production.
DEFF Research Database (Denmark)
Leifsson, Pall S.; Iburg, Tine; Jensen, Henrik E.
2010-01-01
Nine pigs were inoculated intravenously once or twice with 108 Staphylococcus aureus per kilogram body weight and sacrificed 12, 24 and 48 h after inoculation. Three sham-infected pigs served as controls. Blood samples were taken for bacteriology, haematology and clinical chemistry. A necropsy...... was carried out and tissue samples were collected for bacteriology and histology. The onset of clinical disease was seen at 7-8 h after inoculation. The blood bacterial counts remained low throughout the study. All infected pigs developed sepsis characterized by fever, neutrophilia, increased levels of C......-reactive protein (CRP) and IL-6, and decreased levels of serum iron. The CRP and IL-6 levels peaked at 36 h, whereas IL-1 beta and tumour necrosis factor-alpha showed no obvious changes. Thromboelastography showed increasing hypercoagulability from 12 h and onwards, whereas the platelet numbers declined slightly...
Ghorbani, A; Razavi, S M; Ghasemi Omran, V O; Pirdashti, H
2018-03-25
Salinity is now an increasingly serious environmental issue that affects the growth and yield of many plants. In the present work, the influence of inoculation with the symbiotic fungus, Piriformospora indica, on gas exchange, water potential, osmolyte content, Na/K ratio and chlorophyll fluorescence of tomato plants under three salinity levels (0, 50, 100 and 150 mm NaCl) and three time periods (5, 10 and 15 days after exposure to salt) was investigated. Results indicate that P. indica inoculation improved growth parameters of tomato under salinity stress. This symbiotic fungus significantly increased photosynthetic pigment content under salinity, and more proline and glycine betaine accumulated in inoculated roots than in non-inoculated roots. P. indica further significantly improved K + content and reduced Na + level under salinity treatment. After inoculation with the endophytic fungus, leaf physiological parameters, such as water potential, net photosynthesis, stomatal conductance and transpiration, were all higher under the salt concentrations and durations compared with controls without P. indica. With increasing salt level and salt treatment duration, values of F 0 and qP increased but F m , F v /F m , F' v /F' m and NPQ declined in the controls, while inoculation with P. indica improved these values. The results indicate that the negative effects of NaCl on tomato plants were alleviated after P. indica inoculation, probably by improving physiological parameters such as water status and photosynthesis. © 2018 German Society for Plant Sciences and The Royal Botanical Society of the Netherlands.
Dicky Pamungkas; Cesar C Sevilla; Ulysses M Lustria
2006-01-01
The research was done to identify changes in rumen ecosystem of buffalo which received rumen content of cattle. As much as three head of fistulated male buffaloes (live weight of 450-550 kg) and three fistulated female cattle (live weight 250-380 kg) were used. This experiment was done three stage as follows: pre-inoculation, inoculation and post-inoculation. In Pre-inoculation, the sample of rumen content was taken two hours before morning feeding and directly observed for pH rumen liquor, a...
9 CFR 113.36 - Detection of pathogens by the chicken inoculation test.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of pathogens by the chicken... REQUIREMENTS Standard Procedures § 113.36 Detection of pathogens by the chicken inoculation test. The test for...,000 doses. (b) At least 25 healthy susceptible young chickens, properly identified and obtained from...
Imagery and Verbal Counseling Methods in Stress Inoculation Training for Pain Control.
Worthington, Everett L., Jr.; Shumate, Michael
1981-01-01
Pleasant imagery relieves pain and may account for much of the effectiveness of stress inoculation training. Women who used imagery controlled their pain better; women who did not use imagery had longer tolerance when they heard pain conceptualized as a multistage process. Self-instruction did not affect pain control. (Author)
Directory of Open Access Journals (Sweden)
Michel Leiva-Mora
2003-01-01
Full Text Available Some foliar pathogens colonize intercellular spaces of damage tissues during infection process, mediated by toxins production and diffusion to kill adjacent healthy cells. Due to the absence of reliable bioassays, the physiologic effects of several phytotoxins are still ignored on cellular membranous systems of the affected cells. In the present work it was extracted the intercellular content from not inoculated and inoculated banana leaves with different Mycosphaerella fijiensis strains. Their effects on chloroplasts of Grande naine cv were evaluated by the absorbance evolution (595 nm of Hill reactive (DCPIP, mixture with 810 ì l of chloroplasts suspension and 99 ì l of the intercellular contents. The electronic exchange on chloroplasts suspension was inhibited by intercellular contents of inoculated leaves. The intercellular contents from leaves inoculated with I1 (high virulence strain had a major inhibiter effect respect to leaves inoculates with G1 strain (low virulence, showing a correspondence between the inhibiter effect of intercellular contents and the affection levels of affected tissues. The procedures used in this work will let to make studies concerned with Mycosphaerella fijiensis-Musa spp interactions and the future breeding programs. Key words: banana breeding, black Sigatoka, host pathogen interaction, physiological bioassays
Effect of combined inoculations of Rhizobium-Arbuscular Mycorrhiza in Leucaena leucocephala CV: Perú
Directory of Open Access Journals (Sweden)
Lázaro Jesús Ojeda Quintana
2014-07-01
Full Text Available The work was conducted at the Experimental Station of Soil and Fertilizer “Escambray” land of farmers and associated rural extension. The experimental design was randomized blocks, and treatments: Rizhobium loti V-4033 (Research Institute of Pastures and Forages, mycorrhizal fungi trainers, Rhizobium +mycorrhiza fungi trainers, nitrogen and total control. Inoculation with my corrhiza forming fungi was performed at 10 g/bag Certificate MicoFert Strain the Institute of Ecology and Systematics-3: Glomus spurcum, Topes de Collantes, 85 % colonization of rootlets, while the Rhizobium was inoculated in a dose of 50 g/kg of seed. Variant was nitrogen at 25 kg/ha of urea. The plots occupied 18m2 , with an area of 9 m2 evaluable. When the plants reached 7.5 months and an average height of 143.4 cm proceeded to make the Court of establishment and then four foliage cuts were made every 90 days. Each cut dry biomass yield, and phosphorus content was determined crude protein. The combined inoculation of Rhizobium and mycorrhiza fungi Makers increased the yield of dry biomass, and phosphorus content of crude protein. We conclude proposing the adoption of an alternative methodology using mycorrhiza formers Fungi and Rhizobium in Leucaena leucocephala as a way to increase the yield of dry biomass, decreasing mineral fertilization and contribute to environmental protection
Directory of Open Access Journals (Sweden)
Ian David Woolsey
2017-12-01
Full Text Available The French heartworm Angiostongylus vasorum is found in European red fox (Vulpes vulpes and dog populations, where it appears to be spreading geographically. Once introduced into new areas, it establishes in local fox populations, typically to over 50% prevalence in a few years. High susceptibility and constant excretion of first stage larvae (L1 by the definitive hosts are prerequisites for sustaining high parasite biomass in a particular habitat. The present study explores the hypothesis that repeated ingestion of gastropods in nature will result in accumulation of adult worms and elevated excretion of L1 in feces. Experimentally infected foxes were subsequently inoculated via stomach tube once (9 weeks post initial inoculation or twice (9 and 13 weeks post inoculation (wpi with 100 third stage A. vasorum larvae (L3 previously isolated from aquatic snails infected with L1 from a naturally infected dog. Despite large variation in fecal larval excretion for the individual animals within the groups, excretion of L1 was significantly higher in foxes twice inoculated as compared to foxes inoculated only once. With an outlier in the once inoculated group removed, excretion became significantly higher in the three times inoculated group. Establishment of adult worms varied and only a trend to higher worm burdens was found in the group of foxes inoculated three times. However, this became significant with the same single outlier removed. Overall, it appears that protective immunity to A. vasorum does not appear to occur in V. vulpes with animals exhibiting high infection intensities without obvious clinical signs. The increasing larval excretion in foxes being repeatedly exposed to A. vasorum L3 support the hypothesis that foxes under natural conditions may repeatedly ingest infected gastropods and remain a source of environmental contamination for several months, potentially contributing to the establishment of endemic foci through increasing L1
Whan, Jennifer A; Dann, Elizabeth K; Aitken, Elizabeth A B
2016-08-01
Silicon has been shown to enhance the resistance of plants to fungal and bacterial pathogens. Here, the effect of potassium silicate was assessed on two cotton (Gossypium hirsutum) cultivars subsequently inoculated with Fusarium oxysporum f. sp. vasinfectum (Fov). Sicot 189 is moderately resistant whilst Sicot F-1 is the second most resistant commercial cultivar presently available in Australia. Transmission and light microscopy were used to compare cellular modifications in root cells after these different treatments. The accumulation of phenolic compounds and lignin was measured. Cellular alterations including the deposition of electron-dense material, degradation of fungal hyphae and occlusion of endodermal cells were more rapidly induced and more intense in endodermal and vascular regions of Sicot F-1 plants supplied with potassium silicate followed by inoculation with Fov than in similarly treated Sicot 189 plants or in silicate-treated plants of either cultivar not inoculated with Fov. Significantly more phenolic compounds were present at 7 d post-infection (dpi) in root extracts of Sicot F-1 plants treated with potassium silicate followed by inoculation with Fov compared with plants from all other treatments. The lignin concentration at 3 dpi in root material from Sicot F-1 treated with potassium silicate and inoculated with Fov was significantly higher than that from water-treated and inoculated plants. This study demonstrates that silicon treatment can affect cellular defence responses in cotton roots subsequently inoculated with Fov, particularly in Sicot F-1, a cultivar with greater inherent resistance to this pathogen. This suggests that silicon may interact with or initiate defence pathways faster in this cultivar than in the less resistant cultivar. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Lynn Soong
2016-08-01
Full Text Available Scrub typhus is a neglected tropical disease, caused by Orientia tsutsugamushi, a Gram-negative bacterium that is transmitted to mammalian hosts during feeding by Leptotrombidium mites and replicates predominantly within endothelial cells. Most studies of scrub typhus in animal models have utilized either intraperitoneal or intravenous inoculation; however, there is limited information on infection by the natural route in murine model skin or its related early host responses. Here, we developed an intradermal (i.d. inoculation model of scrub typhus and focused on the kinetics of the host responses in the blood and major infected organs. Following ear inoculation with 6 x 104 O. tsutsugamushi, mice developed fever at 11-12 days post-infection (dpi, followed by marked hypothermia and body weight loss at 14-19 dpi. Bacteria in blood and tissues and histopathological changes were detected around 9 dpi and peaked around 14 dpi. Serum cytokine analyses revealed a mixed Th1/Th2 response, with marked elevations of MCP-1/CCL2, MIP-1α/CCL3 and IL-10 at 9 dpi, followed by increased concentrations of pro-inflammatory markers (IL-6, IL-12, IFN-γ, G-CSF, RANTES/CCL5, KC/CCL11, IL-1α/β, IL-2, TNF-α, GM-CSF, as well as modulatory cytokines (IL-9, IL-13. Cytokine levels in lungs had similar elevation patterns, except for a marked reduction of IL-9. The Orientia 47-kDa gene and infectious bacteria were detected in several organs for up to 84 dpi, indicating persistent infection. This is the first comprehensive report of acute scrub typhus and persistent infection in i.d.-inoculated C57BL/6 mice. This is a significant improvement over current murine models for Orientia infection and will permit detailed studies of host immune responses and infection control interventions.
Grounta, Athena; Doulgeraki, Agapi I; Nychas, George-John E; Panagou, Efstathios Z
2016-06-01
The potential of biofilm formation of multifunctional starters Lactobacillus pentosus B281 and Pichia membranifaciens M3A during inoculated fermentation of Conservolea natural black olives according to Greek-style processing was investigated. Olives were directly brined in 8% (w/v) NaCl following three fermentation procedures namely, i) spontaneous fermentation, ii) inoculated fermentation with L. pentosus B281, and iii) co-inoculated fermentation with L. pentosus B281 and P. membranifaciens M3A. Lactic acid bacteria (LAB) and yeasts were monitored on olives by plate counting for a period of 153 days, whereas the survival of the inoculated strains was confirmed by Pulsed Field Gel Electrophoresis (PFGE) and Restriction Fragment Length Polymorphism (RFLP) analysis. Inoculated fermentation with L. pentosus B281 with/without the presence of the yeast resulted in higher acidification of the brine compared to the spontaneous process where no indigenous LAB could be enumerated. The population of LAB on olives ranged between 5.5 and 6.5 log CFU/g and it was maintained at higher levels compared to yeasts (3.5-4.5 log CFU/g) throughout the process. PFGE analysis revealed that L. pentosus B281 could successfully colonize the surface of black olives presenting high recovery rate (100%) at the end of fermentation in contrast to P. membranifaciens M3A that was successfully recovered (42%) only after 72 days of the process. The obtained results provide interesting perspectives for the production of natural black olives with functional properties. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
M.M. Abdullah-Al-Mamun
2015-09-01
Full Text Available Solid waste disposal and management became one of the major environmental concerns in Bangladesh. Realising the problem, the present study has been undertaken with a view to find a sound and effective way of bio-degradable solid waste management. The study was carried out in the nursery of Institute of Forestry and Environmental Sciences at University of Chittagong to determine the effects of solid waste and waste inoculated with mycorrhizal soil on initial growth performance of Acacia auriculiformis and Cedrela toona. Before planting the seedlings, decomposable waste and mycorrhiza inoculated decomposable waste were placed on the planting holes. Physical growth parameters of seedlings (shoot and root length, leaf and branch number, fresh and dry weight of shoot and root and nodulation status and the macro nutrients (N, P and K were recorded after six months of planting. The highest performance of physical parameters was recorded in the soil treated by mycorrhiza inoculated waste. Cedrela toona was represented by maximum nutrients uptake (N-2.60%, P-0.21% and K-2.34% respectively in the soil treated with mycorrhiza. In case of Acacia auriculiformis, N uptake was maximum (3.02% in control while K uptake was highest (1.27% in soil with waste and P (0.18% uptake was highest in the soil treated with mycorrhiza inoculated waste. Highest initial growth performance was revealed by seedlings treated with mycorrhiza inoculated waste. This study suggested to use mycorrhiza and waste for plantation purposes for hygienic disposal of solid waste and to reduce cost of cultivation.
Kiselica, Mark S.; And Others
1994-01-01
Examined effectiveness of preventive stress inoculation program for adolescents (n=48) that consisted of progressive muscle relaxation, cognitive restructuring, and assertiveness training. Compared with control subjects, trainees showed significantly greater improvements on self-report measures of trait anxiety and stress-related symptoms at…
Directory of Open Access Journals (Sweden)
Susheel Kumar
Full Text Available Previous studies with Paenibacillus lentimorbus B-30488" (hereafter referred as B-30488, a plant growth promoting rhizobacteria (PGPR isolated from cow's milk, revealed its capabilities to improve plant quality under normal and stress conditions. Present study investigates its potential as a biocontrol agent against an economically important virus, Cucumber mosaic virus (CMV, in Nicotiana tabacum cv. White Burley plants and delineates the physical, biophysical, biochemical and molecular perturbations due to the trilateral interactions of PGPR-host-CMV. Soil inoculation of B-30488 enhanced the plant vigor while significantly decreased the virulence and virus RNA accumulation by ~12 fold (91% in systemic leaves of CMV infected tobacco plants as compared to the control ones. Histology of these leaves revealed the improved tissue's health and least aging signs in B-30488 inoculated tobacco plants, with or without CMV infection, and showed lesser intercellular spaces between collenchyma cells, reduced amount of xyloglucans and pectins in connecting primary cells, and higher polyphenol accumulation in hypodermis layer extending to collenchyma cells. B-30488 inoculation has favorably maneuvered the essential biophysical (ion leakage and photosynthetic efficiency and biochemical (sugar, proline, chlorophyll, malondialdehyde, acid phosphatase and alkaline phosphatase attributes of tobacco plants to positively regulate and release the virus stress. Moreover, activities of defense related enzymes (ascorbate peroxidase, guaiacol peroxidase, superoxide dismutase and catalase induced due to CMV-infection were ameliorated with inoculation of B-30488, suggesting systemic induced resistance mediated protection against CMV in tobacco. The quantitative RT-PCR analyses of the genes related to normal plant development, stress and pathogenesis also corroborate well with the biochemical data and revealed the regulation (either up or down of these genes in favor of
Cook, John; Lewandowsky, Stephan; Ecker, Ullrich K H
2017-01-01
Misinformation can undermine a well-functioning democracy. For example, public misconceptions about climate change can lead to lowered acceptance of the reality of climate change and lowered support for mitigation policies. This study experimentally explored the impact of misinformation about climate change and tested several pre-emptive interventions designed to reduce the influence of misinformation. We found that false-balance media coverage (giving contrarian views equal voice with climate scientists) lowered perceived consensus overall, although the effect was greater among free-market supporters. Likewise, misinformation that confuses people about the level of scientific agreement regarding anthropogenic global warming (AGW) had a polarizing effect, with free-market supporters reducing their acceptance of AGW and those with low free-market support increasing their acceptance of AGW. However, we found that inoculating messages that (1) explain the flawed argumentation technique used in the misinformation or that (2) highlight the scientific consensus on climate change were effective in neutralizing those adverse effects of misinformation. We recommend that climate communication messages should take into account ways in which scientific content can be distorted, and include pre-emptive inoculation messages.
Bossard-Giannesini, Léo; Cruguel, Hervé; Lacaze, Emmanuelle; Pluchery, Olivier
2016-09-01
Gold nanoparticles (AuNPs) are known for their localized surface plasmon resonance (LSPR) that can be measured with UV-visible spectroscopy. AuNPs are often deposited on silicon substrates for various applications, and the LSPR is measured in reflection. In this case, optical spectra are measured by surface differential reflectance spectroscopy (SDRS) and the absorbance exhibits a negative peak. This article studies both experimentally and theoretically on the single layers of 16 nm diameter spherical gold nanoparticles (AuNPs) grafted on silicon. The morphology and surface density of AuNPs were investigated by atomic force microscopy (AFM). The plasmon response in transmission on the glass substrate and in reflection on the silicon substrate is described by an analytical model based on the Fresnel equations and the Maxwell-Garnett effective medium theory (FMG). The FMG model shows a strong dependence to the incidence angle of the light. At low incident angles, the peak appears negatively with a shallow intensity, and at angles above 30°, the usual positive shape of the plasmon is retrieved. The relevance of the FMG model is compared to the Mie theory within the dipolar approximation. We conclude that no Fano effect is responsible for this derivative shape. An easy-to-use formula is derived that agrees with our experimental data.
Serological reactions in Rhesus monkeys inoculated with the 17D strain of yellow fever virus.
GROOT, H
1962-01-01
Haemagglutination-inhibition tests, which depend on the appearance of haemagglutination-inhibiting antibodies in the serum in virus infections, are in common use in the study of arthropod-borne diseases. This paper contains the results of an investigation into the appearance and pattern of haemagglutination-inhibiting antibodies in the serum of rhesus monkeys inoculated intracerebrally with the 17D strain of yellow fever virus during the testing of seed lots of yellow fever vaccine. These antibodies appeared on the tenth day after inoculation, and were still demonstrable four years later. In all of the eight monkeys tested complement-fixing and neutralizing antibodies against yellow fever antigens also developed, and in six out of the eight heterologous antigens developed.
Effect of Bio-inoculants Applied to M 5 Mulberry Under Rain-fed ...
African Journals Online (AJOL)
The present investigation was carried out at the department of sericulture, GKVK, UAS, Bangalore, India in 2007 with an objective to determine the effect of three bio-inoculants application to M5 mulberry plant on silkworm (PM x CSR2) growth, development and coocoon traits. The feeding experiment was laid-out in ...
Arruda, Bailey L; Arruda, Paulo H; Magstadt, Drew R; Schwartz, Kent J; Dohlman, Tyler; Schleining, Jennifer A; Patterson, Abby R; Visek, Callie A; Victoria, Joseph G
2016-01-01
Congenital tremors is a sporadic disease of neonatal pigs characterized by action-related repetitive myoclonus. A majority of outbreaks of congenital tremors have been attributed to an unidentified virus. The objectives of this project were to 1) detect potential pathogen(s) in samples from piglets with congenital tremors and 2) develop an infection model to reproduce disease. Using next-generation sequencing, a divergent lineage pestivirus was detected in piglets with congenital tremors. The virus was originally most closely related to a bat pestivirus but is now more closely related to a recently published novel porcine pestivirus provisionally named atypical porcine pestivirus. A quantitative real-time PCR detected the virus in samples from neonatal piglets with congenital tremors from two separate farms, but not in samples from unaffected piglets from the same farm. To fulfill the second objective, pregnant sows were inoculated with either serum containing the pestivirus or PBS (control) by intravenous and intranasal routes simultaneously with direct inoculation of fetal amniotic vesicles by ultrasound-guided surgical technique. Inoculations were performed at either 45 or 62 days of gestation. All sows inoculated with the novel pestivirus farrowed piglets affected with congenital tremors while PBS-inoculated control piglets were unaffected. Tremor severity for each piglet was scored from videos taken 0, 1 and 2 days post-farrowing. Tremor severity remained relatively constant from 0 to 2 days post-farrowing for a majority of piglets. The prevalence of congenital tremors in pestivirus-inoculated litters ranged from 57% (4 out of 7 affected piglets) to 100% (10 out of 10 affected piglets). The virus was consistently detected by PCR in tissues from piglets with congenital tremors but was not detected in control piglets. Samples positive by PCR in greater than 90% of piglets sampled included brainstem (37 out of 41), mesenteric lymph node (37 out of 41
Directory of Open Access Journals (Sweden)
Bailey L Arruda
Full Text Available Congenital tremors is a sporadic disease of neonatal pigs characterized by action-related repetitive myoclonus. A majority of outbreaks of congenital tremors have been attributed to an unidentified virus. The objectives of this project were to 1 detect potential pathogen(s in samples from piglets with congenital tremors and 2 develop an infection model to reproduce disease. Using next-generation sequencing, a divergent lineage pestivirus was detected in piglets with congenital tremors. The virus was originally most closely related to a bat pestivirus but is now more closely related to a recently published novel porcine pestivirus provisionally named atypical porcine pestivirus. A quantitative real-time PCR detected the virus in samples from neonatal piglets with congenital tremors from two separate farms, but not in samples from unaffected piglets from the same farm. To fulfill the second objective, pregnant sows were inoculated with either serum containing the pestivirus or PBS (control by intravenous and intranasal routes simultaneously with direct inoculation of fetal amniotic vesicles by ultrasound-guided surgical technique. Inoculations were performed at either 45 or 62 days of gestation. All sows inoculated with the novel pestivirus farrowed piglets affected with congenital tremors while PBS-inoculated control piglets were unaffected. Tremor severity for each piglet was scored from videos taken 0, 1 and 2 days post-farrowing. Tremor severity remained relatively constant from 0 to 2 days post-farrowing for a majority of piglets. The prevalence of congenital tremors in pestivirus-inoculated litters ranged from 57% (4 out of 7 affected piglets to 100% (10 out of 10 affected piglets. The virus was consistently detected by PCR in tissues from piglets with congenital tremors but was not detected in control piglets. Samples positive by PCR in greater than 90% of piglets sampled included brainstem (37 out of 41, mesenteric lymph node (37 out of 41
Woolsey, Ian David; Webster, P; Thamsborg, S; Schnyder, Manuela; Monrad, Jesper; Kapel, C M O
2017-12-01
The French heartworm Angiostongylus vasorum is found in European red fox ( Vulpes vulpes ) and dog populations, where it appears to be spreading geographically. Once introduced into new areas, it establishes in local fox populations, typically to over 50% prevalence in a few years. High susceptibility and constant excretion of first stage larvae (L1) by the definitive hosts are prerequisites for sustaining high parasite biomass in a particular habitat. The present study explores the hypothesis that repeated ingestion of gastropods in nature will result in accumulation of adult worms and elevated excretion of L1 in feces. Experimentally infected foxes were subsequently inoculated via stomach tube once (9 weeks post initial inoculation) or twice (9 and 13 weeks post inoculation (wpi)) with 100 third stage A. vasorum larvae (L3) previously isolated from aquatic snails infected with L1 from a naturally infected dog. Despite large variation in fecal larval excretion for the individual animals within the groups, excretion of L1 was significantly higher in foxes twice inoculated as compared to foxes inoculated only once. With an outlier in the once inoculated group removed, excretion became significantly higher in the three times inoculated group. Establishment of adult worms varied and only a trend to higher worm burdens was found in the group of foxes inoculated three times. However, this became significant with the same single outlier removed. Overall, it appears that protective immunity to A. vasorum does not appear to occur in V. vulpes with animals exhibiting high infection intensities without obvious clinical signs. The increasing larval excretion in foxes being repeatedly exposed to A. vasorum L3 support the hypothesis that foxes under natural conditions may repeatedly ingest infected gastropods and remain a source of environmental contamination for several months, potentially contributing to the establishment of endemic foci through increasing L1 excretion.
Energy Technology Data Exchange (ETDEWEB)
Mohamedzein, Ekhlas Mohamedzein M [Department of Biochemistry and Soil Science, Faculty of agriculture, University of Khartoum, Khartoum (Sudan)
1996-11-01
A local and introduced Bradyrhizobium strains and a locally-isolated VAM fungi were used to study their effects on groundnut in clay (Shambat) and sandy (El-Rwakeeb) soil in a pot experiment. A field experiment was carried out at El-Rwakeeb to study the effect of urea, superphosphate and chicken manure on inoculated or uninoculated groundnut. Inoculation significantly increased number of nodules, dry weight of shoot, root and nodules, plant N and P content, number and dry weight of pods, yield and seed composition and quality in both pot and field experiments. Introduced strain (TAL 1000) was more effective than locally- isolated strain (ENRRI 16). All fertilizers added to inoculated or uninoculated groundnut significantly increased all measured parameters. Chiken manure reflected good results than rea and superphosphate, which showed comparable results. All treatents significantly improved the seed composition especially protein and oil content. (Author) 89 refs. , 25 tabs.
International Nuclear Information System (INIS)
Mohamedzein, Ekhlas Mohamedzein M.
1996-11-01
A local and introduced Bradyrhizobium strains and a locally-isolated VAM fungi were used to study their effects on groundnut in clay (Shambat) and sandy (El-Rwakeeb) soil in a pot experiment. A field experiment was carried out at El-Rwakeeb to study the effect of urea, superphosphate and chicken manure on inoculated or uninoculated groundnut. Inoculation significantly increased number of nodules, dry weight of shoot, root and nodules, plant N and P content, number and dry weight of pods, yield and seed composition and quality in both pot and field experiments. Introduced strain (TAL 1000) was more effective than locally- isolated strain (ENRRI 16). All fertilizers added to inoculated or uninoculated groundnut significantly increased all measured parameters. Chiken manure reflected good results than rea and superphosphate, which showed comparable results. All treatents significantly improved the seed composition especially protein and oil content. (Author)
Directory of Open Access Journals (Sweden)
Marcos da Silva Brum
2016-09-01
Full Text Available The objective of this study was to evaluate the agronomic characteristics of corn seed inoculated with Azospirillum brasilense, grown on black oat and ryegrass straw, and managed under different grazing strategies and doses of nitrogen. The experiment was conducted in Santa Maria, Rio Grande do Sul State, Brazil, during two agricultural seasons (2012/2013 and 2013/2014 in a randomized, complete block design with three replications. In the winter period, black oat and ryegrass straw were managed at different grazing heights by sheep (0.30, 0.20, 0.10 m, conventional grazing, and no grazing with three doses of nitrogen (0, 50, and 100 kg ha-1, with or without inoculation by A. brasilense. We used the hybrid Pioneer (P1630H® in 2012 and the hybrid Agroeste (AS 1551® in 2013. The height of corn plants was greater when they were grown on black oat and ryegrass straw, and the absence of grazing favored productivity. Under drought conditions, the application of nitrogen to the pasture favored corn development, increasing plant height, ear height, and stem diameter. Inoculation with A. brasilense had a positive effect on the characteristics of yield and productivity of corn, independent of growing season and hybrid used.
International Nuclear Information System (INIS)
Achakzai, A.K.K.; Kayani, S.A.
2004-01-01
A pot culture experiment in response to different levels of added N fertilizer on soybean cv.Williams-82 was conducted in clay loam soil under the climatic conditions of Quetta. Fertilizer treatments were applied at the rate zero (control); 23; 25; 50; 75; 100 and 125 kg N/ha plus a constant dose of 60 kg P/sub 2/O/sub 5/ha and 30 kg K/sub 2/O/ha in all treatments (except control). These seven fertilizer treatments were applied to both non-inoculated and inoculated pot culture crop. Results showed that nodules were found to be absent in both set of experiments which could be indirectly attributed to either sufficient level of soil NO/sub 3/ (5.10 mm) or deficient level of total Fe (8.25 ppm) and Cu (below detection limit) or might be directly due to any other edaphic or climatic factor(s). Results also showed that in general petiole length, middle leaflet area,' plant height, yield, 100 seed weight (except inoculated fertilized), total number of pods/plant (except non-inoculated fertilized) and pod both set of experiment are significantly different (P > 0.05) as compared with their respective control treatment. While remaining yield attributes viz., one-seeded, two-seeded and three-seeded pods are found as non-significantly different in response to both fertilizer and inoculum treatments. Results further revealed that pots receiving N fertilizer without inoculum mathematically out-yielded (1718 kg/ha) in fertilizer dose of 100+60+30 kg NPK/ha, but inoculated pots out-yielded (1912 kg/ha) in fertilizer dose of 125+60+30 kg NPK/ha. It was also revealed that all growth parameters and most of the yield attributes exhibited significant positive correlation with yield. However, number of seedless and one-seeded pods also exhibited significant but negative association with yield. (author)
Directory of Open Access Journals (Sweden)
Saadia NASSIK
2014-03-01
Full Text Available Les mycoplasmoses aviaires, particulièrement Mycoplasma gallisepticum (MG et Mycoplasma synoviae (MS sont des infections insidieuses respiratoires, génitales ou articulaires, entraînant de lourdes pertes économiques dans les différents types d’élevage avicole.L’objectif de cette étude est de tracer l’évolution des infections mycoplasmiques aviaires dues à MG et MS à partir d’une synthèse des enquêtes sérologiques réalisées au Maroc et d’évaluer les retombées de la nouvelle loi sanitaire. Ces enquêtes ont concerné 12, 13 et 15 élevages de poules reproductrices situés dans différentes régions, notamment les principaux axes de productions avicoles réalisées respectivement en 1983, 2002 et 2005. Les sérums recueillis ont été testés par Agglutination Rapide sur Lame (ARL afin d’identifier les élevages positifs. Les résultats sérologiques ont révélé la présence des anticorps contre MG et MS avec des taux d’infection variables en fonction de l’année d’étude et du germe. En effet, Les prévalences obtenues sont très importantes surtout pour MS qui dépassent les 50% ; un pic a été noté en 2002 (MG:30,76% et (MS:76,92%, avec une légère régression en 2005 (MG:26,67% et (MS:66,67 %.Ces taux d’infections non négligeables incitent à l’amélioration des normes d’hygiène et de biosécurité avec un accompagnement vétérinaire rigoureux conformément aux directives de la loi.
Seeding Stress Resilience through Inoculation
Directory of Open Access Journals (Sweden)
Archana Ashokan
2016-01-01
Full Text Available Stress is a generalized set of physiological and psychological responses observed when an organism is placed under challenging circumstances. The stress response allows organisms to reattain the equilibrium in face of perturbations. Unfortunately, chronic and/or traumatic exposure to stress frequently overwhelms coping ability of an individual. This is manifested as symptoms affecting emotions and cognition in stress-related mental disorders. Thus environmental interventions that promote resilience in face of stress have much clinical relevance. Focus of the bulk of relevant neurobiological research at present remains on negative aspects of health and psychological outcomes of stress exposure. Yet exposure to the stress itself can promote resilience to subsequent stressful episodes later in the life. This is especially true if the prior stress occurs early in life, is mild in its magnitude, and is controllable by the individual. This articulation has been referred to as “stress inoculation,” reminiscent of resilience to the pathology generated through vaccination by attenuated pathogen itself. Using experimental evidence from animal models, this review explores relationship between nature of the “inoculum” stress and subsequent psychological resilience.
Directory of Open Access Journals (Sweden)
R. Seyed Sharifi
2016-02-01
Full Text Available Introduction Utilizing biological fertilizer is a proper and cheap method for crop production. Potentially, soybean can be used as biological fertilizers and seed inoculation. Zinc is an essential element that have positive effects on plant growth and its development. Canola, sunflower, soybean and safflower are the main cultivated oilseeds in Iran. Soybean production in Iran is very low as compared to other countries. One of the most effective factor in increasing the soybean yield is seed inoculation with plant growth promoting rhizobacteria (PGPR and application of Zinc fertilizer. Some of the benefits provided by PGPR are the ability to produce gibberellic acid, cytokinins and ethylene, N2 fixation, solubilization of mineral phosphates and other nutrients (56. Numerous studies have shown a substantial increase in dry matter accumulation and seed yield following inoculation with PGPR. Seyed Sharifi (45 reported that seed inoculation with Azotobacter chroococcum strain 5 increased all of the growth indices such as total dry matter, crop growth rate and relative growth rate. Increasing and extending the role of biofertilizers such as Rhizobium can reduce the need for chemical fertilizers and decrease adverse environmental effects. Therefore, in the development and implementation of sustainable agricultural techniques, biofertilization has great importance in alleviating environmental pollution and deterioration of the nature. As a legume, soybean can obtain a significant portion (4-85% of its nitrogen requirement through symbiotic N2 fixation when grown in association with effective and compatible Rhizobium strains. Since there is little available information on nano-zinc oxide and seed inoculation by plant growth promoting rhizobacteria (PGPR on yield in the agro-ecological growing zones of Ardabil province of Iran. Therefore, this research was conducted to investigate the effects of nano-zinc oxide and seed inoculation with plant growth
Induction of the immune response suppression in mice inoculated with Candida albicans.
Valdez, J C; Mesón, D E; Sirena, A; de Petrino, S F; Eugenia, M; de Jorrat, B B; de Valdex, M G
1986-03-01
There is a controversy in respect to the immunological response (humoral or cellular) concerning the defense against Candida albicans. Candidosis would induce sub-populations of suppressor cells in the host cell-immune response. This report tries to show the effect of different doses of C. albicans (alive or heat-killed) on the expression of cell-mediated and humoral immunity. The effect upon cell immunity was determined by inoculating different lots of singeneic mice, doses of varied concentration of C. albicans and checking for delayed-type hipersensitivity (D.T.H.). D.T.H. was also controlled in syngeneic normal mice which had previously been injected with inoculated mice spleen cells. Humoral immunity was assayed by measuring the induced blastogenesis by Pokeweed Mitogen on spleen mononuclear cells with different doses of C. albicans. Results obtained show that the different doses gave origin to: Suppression of humoral and cell response (10(8) alive); Suppression of only humoral response (10(6) alive); Suppression of cell response and increase of humoral response (10(9) dead); Increase of both responses (10(8) dead).
Rentería-Chávez, María C; Pérez-Moreno, Jesús; Cetina-Alcalá, Víctor M; Ferrera-Cerrato, Ronald; Xoconostle-Cázares, Beatriz
An ectomycorrhiza is a mutualistic symbiosis of paramount importance in forestry and tree production. One of the selection criteria of ectomycorrhizal fungi that has currently gained importance is their edibility due to the economic, ecological and cultural relevance of edible ectomycorrhizal mushrooms as a non-timber forest product. The effect of the inoculation with three edible ectomycorrhizal mushrooms: Laccaria laccata, Laccaria bicolor y Hebeloma leucosarx, which are widely sold in Mexico, on the growth and nutrient contents of Pinus greggii grown in an experimental substrate and a commercial substrate enriched with a slow-release fertilizer, was evaluated. Two years after sowing, differences in terms of shoot and root biomass and macro and micronutrient contents between inoculated and non-inoculated plants, were recorded independently of the fungal species and the substrate. Despite the fact that plants grown in the commercial substrate had higher growth and nutrient contents, their ectomycorrhizal colonization percentages were smaller than those of the plants grown in the experimental substrate. The differences in the nutrient transfer to the inoculated plant shoots among the evaluated fungal species were recorded. Ca mobilization by L. laccata, Na by L. bicolor and Mn by H. leucosarx were observed in the plants growing in the experimental substrate. It has been demonstrated that the selection of substrates constitutes an important factor in the production of ectomycorrhizal plants and that the three evaluated species of edible ectomycorrhizal mushrooms have an enormous potential in the controlled mycorrhization of P. greggii. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
Atmospheric pressure plasma jet treatment of Salmonella Enteritidis inoculated eggshells.
Moritz, Maike; Wiacek, Claudia; Koethe, Martin; Braun, Peggy G
2017-03-20
Contamination of eggshells with Salmonella Enteritidis remains a food safety concern. In many cases human salmonellosis within the EU can be traced back to raw or undercooked eggs and egg products. Atmospheric pressure plasma is a novel decontamination method that can reduce a wide range of pathogens. The aim of this work was to evaluate the possibility of using an effective short time cold plasma treatment to inactivate Salmonella Enteritidis on the eggshell. Therefore, artificially contaminated eggshells were treated with an atmospheric pressure plasma jet under different experimental settings with various exposure times (15-300s), distances from the plasma jet nozzle to the eggshell surface (5, 8 or 12mm), feed gas compositions (Ar, Ar with 0.2, 0.5 or 1.0% O 2 ), gas flow rates (5 and 7slm) and different inoculations of Salmonella Enteritidis (10 1 -10 6 CFU/cm 2 ). Atmospheric pressure plasma could reduce Salmonella Enteritidis on eggshells significantly. Reduction factors ranged between 0.22 and 2.27 log CFU (colony-forming units). Exposure time and, particularly at 10 4 CFU/cm 2 inoculation, feed gas had a major impact on Salmonella reduction. Precisely, longer exposure times led to higher reductions and Ar as feed gas was more effective than ArO 2 mixtures. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Tótola Marcos Rogério
2000-01-01
Full Text Available The growth of Cedrella fissilis Vell. (Cedro Rosa and of Anadenanthera peregrina Benth (Angico Vermelho in bauxite spoil was studied to evaluate their response to substrate amendment or to inoculation with arbuscular mycorrhizal fungi (AMF. The plants were grown in bauxite spoil, topsoil or spoil amended with either topsoil or compost, and inoculated with the AMF Acaulospora scrobiculata, Gigaspora margarita or Glomus etunicatum. Root colonization was highly dependent on the interaction plant-fungus-substrate. In C. fissilis, root colonization by Gigaspora margarita dropped from 75% in bauxite spoil to only 4% in topsoil. Contrarily, root colonization of A. peregrina by the same fungus increased from 48% in spoil to 60% in topsoil. Root colonization of C. fissilis in topsoil was lower than in the three other substrates. The opposite was observed for A. peregrina. Inoculation of the plants with Acaulospora scrobiculata or Glomus etunicatum was very effective in promoting plant growth. Plants of both C. fissilis and A. peregrina did not respond to amendments of bauxite spoil unless they were mycorrhizal. Also, a preferential partitioning of photosynthates to the shoots of A. peregrina inoculated with G. etunicatum or A. scrobiculata, and of C. fissilis inoculated with any of the three species of AMF was observed. C. fissilis showed a greater response to mycorrhizal inoculation than A. peregrina. The mean mycorrhizal efficiency (ME for dry matter production by C. fissilis was 1,847% for A. scrobiculata, 1,922% for G. etunicatum, and 119% for G. margarita. In A. peregrina, the ME was 249% for A. scrobiculata, 540% for G. etunicatum, and 50% for G. margarita. The effect of mycorrhizal inoculation on plant growth seems to be related in part to an enhanced phosphorus absorption by inoculated plants. Moreover, the efficiency with which the absorbed nutrients were used to produce plant biomass was much greater in plants inoculated with A. scrobiculata or
Wong, Wai-Tak; Tseng, Ching-Han; Hsu, Shu-Hua; Lur, Huu-Sheng; Mo, Chia-Wei; Huang, Chu-Ning; Hsu, Shu-Chiung; Lee, Kung-Ta; Liu, Chi-Te
2014-09-17
Several Rhodopseudomonas palustris strains have been isolated from rice paddy fields in Taiwan by combining the Winogradsky column method and molecular marker detection. These isolates were initially screened by employing seed germination and seedling vigor assays to evaluate their potential as inoculants. To fulfill the demand in the present farming system for reducing the application of chemical fertilizers, we assessed the plant growth-promoting effects of the R. palustris YSC3, YSC4, and PS3 inoculants on Brassica rapa chinensis (Chinese cabbage) cultivated under a half quantity of fertilizer. The results obtained showed that supplementation with approximately 4.0×10(6) CFU g(-1) soil of the PS3 inoculant at half the amount of fertilizer consistently produced the same plant growth potential as 100% fertility, and also increased the nitrogen use efficiency of the applied fertilizer nutrients. Furthermore, we noted that the plant growth-promotion rate elicited by PS3 was markedly higher with old seeds than with new seeds, suggesting it has the potential to boost the development of seedlings that were germinated from carry-over seeds of poor quality. These beneficial traits suggest that the PS3 isolate may serve as a potential PGPR inoculant for integrated nutrient management in agriculture.
Directory of Open Access Journals (Sweden)
ABDUL GAFUR
2007-06-01
Full Text Available Peroxidase activity of the hybrid poplar Populus×canescens (Ait. Sm. (= P. tremula L. × P. alba L. inoculated with compatible and incompetent isolates of Paxillus involutus (Batsch Fr. was investigated. Screening of the ectomycorrhizal fungal isolates was initiated with exploration of mycelial growth characteristics and mycorrhizal ability in vitro with poplar. Both traits varied within the fungus although they did not seem to be genetically correlated. While isolates SCO1, NAU, and 031 grew faster than others, only isolates MAJ, SCO1, and 031 were able to form ectomycorrhiza with poplar. Isolates MAJ (compatible and NAU (incompetent were subsequently selected for further experiments. Activity of peroxidase, one of the defense-related enzymes, was examined in pure culture and short root components of compatible and incompetent interactions between poplar and P. involutus. Peroxidase activities increased significantly in poplar inoculated with incompetent isolate of the fungus compared to control, while induction of the same enzyme was not detected in compatible associations.
Directory of Open Access Journals (Sweden)
Armin Saed-Moucheshi
2013-01-01
Full Text Available Multivariate statistical techniques were used to compare the relationship between yield and its related traits under noninoculated and inoculated cultivars with mycorrhizal fungus (Glomus intraradices; each one consisted of three wheat cultivars and four water regimes. Results showed that, under inoculation conditions, spike weight per plant and total chlorophyll content of the flag leaf were the most important variables contributing to wheat grain yield variation, while, under noninoculated condition, in addition to two mentioned traits, grain weight per spike and leaf area were also important variables accounting for wheat grain yield variation. Therefore, spike weight per plant and chlorophyll content of flag leaf can be used as selection criteria in breeding programs for both inoculated and noninoculated wheat cultivars under different water regimes, and also grain weight per spike and leaf area can be considered for noninoculated condition. Furthermore, inoculation of wheat cultivars showed higher value in the most measured traits, and the results indicated that inoculation treatment could change the relationship among morphological traits of wheat cultivars under drought stress. Also, it seems that the results of stepwise regression as a selecting method together with principal component and factor analysis are stronger methods to be applied in breeding programs for screening important traits.
Directory of Open Access Journals (Sweden)
Ruth eSchmidt
2014-02-01
Full Text Available Plant-associated bacteria fulfil important functions for plant growth and health of their host. However, our knowledge about the impact of bacterial treatments on the host’s microbiome and physiology is limited. The present study was conducted to assess the impact of bacterial inoculants on the microbiome of chamomile plants Chamomilla recutita (L. Rauschert grown in a field under organic management in Egypt. Chamomile seedlings were inoculated with three indigenous Gram-positive strains (Streptomyces subrutilus Wbn2-11, Bacillus subtilis Co1-6, Paenibacillus polymyxa Mc5Re-14 from Egypt and three European Gram-negative strains (Pseudomonas fluorescens L13-6-12, Stenotrophomonas rhizophila P69, Serratia plymuthica 3Re4-18 already known for their beneficial plant-microbe interaction. Molecular fingerprints of 16S rRNA gene as well as real-time PCR analyses did not show statistically significant differences for all applied bacterial antagonists compared to the control. In contrast, a pyrosequencing analysis of the 16S rRNA gene libraries revealed significant differences in the community structure of bacteria between the treatments. These differences could be clearly shown by a shift within the community structure and corresponding beta-diversity indices. Moreover, B. subtilis Co1-6 and P. polymyxa Mc5Re-14 showed an enhancement of the bioactive secondary metabolite apigenin-7-O-glucoside. This indicates a possible new function of bacterial inoculants: to interact with the plant microbiome as well as with the plant metabolome.
Directory of Open Access Journals (Sweden)
Adauton Vilela de Rezende
2015-08-01
Full Text Available Our objective was to evaluate the chemical composition, fermentation profile, and aerobic stability of cabbage silages treated with ground corn and inoculant. The evaluated treatments were: addition of 200, 300, 400, 500, and 600 g of ground corn per kilogram of cabbage (fresh matter basis, with or without a bacterial inoculant composed of Lactobacillus plantarumand Pediococcus pentosaceus. As expected, ground corn additions increased the dry matter (DM content of cabbage silage, and high values were observed for the highest level of addition (540 g kg−1. Conversely, the crude protein, neutral detergent fiber, acid detergent fiber, and lignin contents decreased with ground corn additions. The in vitro dry matter digestibility coefficients increased slightly with ground corn additions, but all cabbage silages had digestibility higher than 740 g kg−1 of DM. In the fermentation process, the pH values of cabbage silages increased linearly because of the high levels of ground corn addition. Cabbage ensiled with 200 and 300 g kg−1 of ground corn had high ammonia N production and fermentative losses (effluent and gas. Cabbage silage treated with 600 g kg−1 of ground corn had lower maximum pH values during aerobic exposure, but all silages had constant temperature during aerobic exposure. The ensiling of wasted cabbage is possible and we recommend the application of 400 g kg−1ground corn to improve the silage quality, whereas the use of the inoculant is unnecessary.
Nakasaki, Kiyohiko; Araya, Shogo; Mimoto, Hiroshi
2013-09-01
In this study, the yeast strain Pichia kudriavzevii RB1 was used as an inoculum to accelerate organic matter degradation of rabbit food with added organic acids, which was used as a model food waste for composting. The RB1 strain rapidly degraded the organic acids present in the raw compost material, leading to an increase in pH beyond the neutral level, within 2 days. Both mesophilic and thermophilic bacteria proliferated faster in the compost with RB1 inoculation than in that without inoculation. Although the yeast died with the increase in compost temperature, it affected the early stages of composting prior to the thermophilic stage and accelerated the composting process by 2 days by eliminating the initial lag phase seen in the growth of other microorganisms. Moreover, populations of Bacillus thermoamylovorans, Bacillus foraminis, and Bacillus coagulans became dominant during the thermophilic stages of both composting with and without RB1 inoculation. Copyright © 2013 Elsevier Ltd. All rights reserved.
Despite several decades of study, the mechanism of inoculation of X. fastidiosa (Xf) to grapevines by its sharpshooter vectors still is not fully understood. Recent research showed that Xf is inoculated into or onto artificial diets by a combination of egestion and salivation. However, the salivatio...
Guerrero-Molina, M F; Lovaisa, N C; Salazar, S M; Díaz-Ricci, J C; Pedraza, R O
2014-07-01
The elemental composition of strawberry plants (Fragaria ananassa cv. Macarena) inoculated with the plant growth-promoting bacterium Azospirillum brasilense REC3, and non-inoculated controls, was studied using scanning electron microscopy (SEM) and energy dispersive X-ray (EDS) analysis. This allowed simultaneous semi-quantification of different elements in a small, solid sample. Plants were inoculated and grown hydroponically in 50% or 100% Hoagland solution, corresponding to limited or optimum nutrient medium, respectively. Bacteria-inoculated plants increased the growth index 45% and 80% compared to controls when grown in 100% and 50% Hoagland solution, respectively. Thus, inoculation with A. brasilense REC3 in a nutrient-limited medium had the strongest effect in terms of increasing both shoot and root biomass and growth index, as already described for Azospirillum inoculated into nutrient-poor soils. SEM-EDS spectra and maps showed the elemental composition and relative distribution of nutrients in strawberry tissues. Leaves contained C, O, N, Na, P, K, Ca and Cu, while roots also had Si and Cl. The organic fraction (C, O and N) accounted for over 96.3% of the total chemical composition; of the mineral fraction, Na had higher accumulation in both leaves and roots. Azospirillum-inoculated and control plants had similar elemental quantities; however, in bacteria-inoculated roots, P was significantly increased (34.33%), which constitutes a major benefit for plant nutrition, while Cu content decreased (35.16%). © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.
Directory of Open Access Journals (Sweden)
Michel Leiva-Mora
2011-01-01
Full Text Available Plant pathogen fungi required favorable conditions to invade and colonize plant tissues, which may change according to the season of the year. This work is aimed to evaluate the influence of different seasons (June-August and August-October in the development of symptoms in ‘Grande naine’ artificially inoculated with Mycosphaerella fijiensis in greenhouse. Inoculation assays were done during three consecutive years (2005, 2006 and 2007. None differences in attack intensity between different seasons were observed, at 14, 21, 35, 49 y 63 days post inoculation (dpi. This shows that the development of symptoms in greenhouse was similar in the period from June to October. Temperature and humidity have not been controlled by all laboratories that conduct studies related to M. fijiensis. Then, to choose the appropriate season for artificial inoculations is a prerequisite for effective development of M. fijiensis infective cycle and to avoid masking in the phenotype of resistance. Key words: attack intensity, Black Sigatoka, mycelia
Cagide, Celica; Riviezzi, Braulio; Minteguiaga, Manuel; Morel, Maria; Castro-Sowinski, Susana
2018-05-30
Delftia sp. JD2 is a Betaproteobacterium characterized as a plant growth-promoting bacterium with a "helper" function, enhancing the performance of rhizobial inoculant strains during the co-inoculation of alfalfa and clover. In this work we analyzed: (i) the effect of the co-inoculation with Bradyrhizobium elkanii and Delftia sp. JD2 strains on the performance of soybean plants and, (ii) the production of a few secondary plant metabolites that would explain the positive effect of co-inoculation on the growth and development of soybean plants. The results showed a beneficial effect of co-inoculation on soybean growth, nodulation rate and pulse yield, with the concomitant benefit for the agricultural economy. In addition, based on a metabolomics approach, we demonstrated that a different pattern of plant metabolites is being produced at different stages of plant growth. The new information suggests that the co-inoculation of soybean changes the primary and secondary metabolism of the plant, including changes in the metabolic status of main and secondary nodules within the plant. The relevance of producing a different pattern of photosynthetic and photoprotective pigments, flavonoids, organic acids and carbohydrates are discussed. Finally, we propose that JD2 could be used, together with bradyrhizobia, to manipulate the chemical composition of plant tissues, promoting the nutritional benefits and health of soybean.
Growth and nutrition of eucalyptus clones seedlings inoculated with mycorrhizal fungi
Directory of Open Access Journals (Sweden)
Francisco de Sousa Lima
2014-06-01
Full Text Available Eucalyptus is one of the most planted forest species, in Brazil, due to its rapid growth and high economic yield. Arbuscular mycorrhizal fungi improve the seedlings nutritional and phytosanitary status, besides increasing their resistance to biotic and abiotic stress. This study aimed to evaluate the effect of inoculation with arbuscular mycorrhizal fungi species on the growth and nutrition of different eucalyptus clones seedlings. The experiment was conducted under greenhouse conditions, in a randomized blocks design and a 5x5 factorial scheme (five fungal species and five eucalyptus clones, with five replications. In general, the mycorrhizal symbiosis significantly increased the growth and nutrition of eucalyptus seedlings, when compared to the non-inoculated seedlings. The most efficient interaction occured between the 2361 clone and the Entrophospora infrequens fungus, with increases of 107.3% and 120.6%, for the shoot and root dry biomass yield, and 107.7%, 94.1% and 103.3%, respectively for the accumulation of N, P and K in the seedlings shoots. All the fungal species studied showed a high absolute compatibility index with eucalyptus clones. The Glomus manihots and E. infrequens fungi presented a higher functional compatibility index with the clones tested. The 5204 clone showed 75% of compatibility with the fungi evaluated.
Gamma radiation effect on Bacillus cereus spores inoculated in black pepper
International Nuclear Information System (INIS)
Froehlich, Angela; Axeredo, Raquel M.C.; Vanetti, Maria Cristina D.
2000-01-01
It had been analyzed 37 samples of worn out black pepper and in 85% of these samples was observed the presence of Bacillus cereus in numbers of up to 4,6 x 10 4 UFC/g. The population of aerobic mesofilis bacteria varied of 2,8 x 10 5 the 1,9 x 10 8 UFC/g. The black pepper used during the experiment was evaluated, evidencing the aerobic presence of one aerobic mesofilis microbiota of, approximately, 2,6 x 10 6 UFC/g, consisting, mainly, for species of the Bacillus sort. It was observed that the absence of B. cereus, coliforms, filamentous fungus and leavenings. The evaluation of the irradiation of the black pepper inoculated with 10 6 UFC/g of B. cereus spores of with doses of gamma radiation varying between 2 and 10 kGy evidenced that doses up to 5 kGy had been enough to reduce the counting of, approximately, 10 6 UFC/g of aerobic mesofilis organisms and 10 4 UFC/g of B. cereus spores the not detectable numbers by the used methodology. The dose of reduction decimal (D 10 ) for the inoculated B. cereus spores in black pepper was of 1,78 kGy
Schreiter, Susanne; Sandmann, Martin; Smalla, Kornelia; Grosch, Rita
2014-01-01
Rhizosphere competence of bacterial inoculants is assumed to be important for successful biocontrol. Knowledge of factors influencing rhizosphere competence under field conditions is largely lacking. The present study is aimed to unravel the effects of soil types on the rhizosphere competence and biocontrol activity of the two inoculant strains Pseudomonas jessenii RU47 and Serratia plymuthica 3Re4-18 in field-grown lettuce in soils inoculated with Rhizoctonia solani AG1-IB or not. Two independent experiments were carried out in 2011 on an experimental plot system with three soil types sharing the same cropping history and weather conditions for more than 10 years. Rifampicin resistant mutants of the inoculants were used to evaluate their colonization in the rhizosphere of lettuce. The rhizosphere bacterial community structure was analyzed by denaturing gradient gel electrophoresis of 16S rRNA gene fragments amplified from total community DNA to get insights into the effects of the inoculants and R. solani on the indigenous rhizosphere bacterial communities. Both inoculants showed a good colonization ability of the rhizosphere of lettuce with more than 106 colony forming units per g root dry mass two weeks after planting. An effect of the soil type on rhizosphere competence was observed for 3Re4-18 but not for RU47. In both experiments a comparable rhizosphere competence was observed and in the presence of the inoculants disease symptoms were either significantly reduced, or at least a non-significant trend was shown. Disease severity was highest in diluvial sand followed by alluvial loam and loess loam suggesting that the soil types differed in their conduciveness for bottom rot disease. Compared to effect of the soil type of the rhizosphere bacterial communities, the effects of the pathogen and the inoculants were less pronounced. The soil types had a surprisingly low influence on rhizosphere competence and biocontrol activity while they significantly affected
Directory of Open Access Journals (Sweden)
Susanne Schreiter
Full Text Available Rhizosphere competence of bacterial inoculants is assumed to be important for successful biocontrol. Knowledge of factors influencing rhizosphere competence under field conditions is largely lacking. The present study is aimed to unravel the effects of soil types on the rhizosphere competence and biocontrol activity of the two inoculant strains Pseudomonas jessenii RU47 and Serratia plymuthica 3Re4-18 in field-grown lettuce in soils inoculated with Rhizoctonia solani AG1-IB or not. Two independent experiments were carried out in 2011 on an experimental plot system with three soil types sharing the same cropping history and weather conditions for more than 10 years. Rifampicin resistant mutants of the inoculants were used to evaluate their colonization in the rhizosphere of lettuce. The rhizosphere bacterial community structure was analyzed by denaturing gradient gel electrophoresis of 16S rRNA gene fragments amplified from total community DNA to get insights into the effects of the inoculants and R. solani on the indigenous rhizosphere bacterial communities. Both inoculants showed a good colonization ability of the rhizosphere of lettuce with more than 10(6 colony forming units per g root dry mass two weeks after planting. An effect of the soil type on rhizosphere competence was observed for 3Re4-18 but not for RU47. In both experiments a comparable rhizosphere competence was observed and in the presence of the inoculants disease symptoms were either significantly reduced, or at least a non-significant trend was shown. Disease severity was highest in diluvial sand followed by alluvial loam and loess loam suggesting that the soil types differed in their conduciveness for bottom rot disease. Compared to effect of the soil type of the rhizosphere bacterial communities, the effects of the pathogen and the inoculants were less pronounced. The soil types had a surprisingly low influence on rhizosphere competence and biocontrol activity while they
Schreiter, Susanne; Sandmann, Martin; Smalla, Kornelia; Grosch, Rita
2014-01-01
Rhizosphere competence of bacterial inoculants is assumed to be important for successful biocontrol. Knowledge of factors influencing rhizosphere competence under field conditions is largely lacking. The present study is aimed to unravel the effects of soil types on the rhizosphere competence and biocontrol activity of the two inoculant strains Pseudomonas jessenii RU47 and Serratia plymuthica 3Re4-18 in field-grown lettuce in soils inoculated with Rhizoctonia solani AG1-IB or not. Two independent experiments were carried out in 2011 on an experimental plot system with three soil types sharing the same cropping history and weather conditions for more than 10 years. Rifampicin resistant mutants of the inoculants were used to evaluate their colonization in the rhizosphere of lettuce. The rhizosphere bacterial community structure was analyzed by denaturing gradient gel electrophoresis of 16S rRNA gene fragments amplified from total community DNA to get insights into the effects of the inoculants and R. solani on the indigenous rhizosphere bacterial communities. Both inoculants showed a good colonization ability of the rhizosphere of lettuce with more than 10(6) colony forming units per g root dry mass two weeks after planting. An effect of the soil type on rhizosphere competence was observed for 3Re4-18 but not for RU47. In both experiments a comparable rhizosphere competence was observed and in the presence of the inoculants disease symptoms were either significantly reduced, or at least a non-significant trend was shown. Disease severity was highest in diluvial sand followed by alluvial loam and loess loam suggesting that the soil types differed in their conduciveness for bottom rot disease. Compared to effect of the soil type of the rhizosphere bacterial communities, the effects of the pathogen and the inoculants were less pronounced. The soil types had a surprisingly low influence on rhizosphere competence and biocontrol activity while they significantly affected
A methodology for designing flexible multi-generation systems
DEFF Research Database (Denmark)
Lythcke-Jørgensen, Christoffer Ernst; Viana Ensinas, Adriano; Münster, Marie
2016-01-01
An FMG (flexible multi-generation system) consists of integrated and flexibly operated facilities that provide multiple links between the various layers of the energy system. FMGs may facilitate integration and balancing of fluctuating renewable energy sources in the energy system in a cost...... is based on consideration of the following points: Selection, location and dimensioning of processes; systematic heat and mass integration; flexible operation optimization with respect to both short-term market fluctuations and long-term energy system development; global sensitivity and uncertainty...... analysis; biomass supply chains; variable part-load performance; and multi-objective optimization considering economic and environmental performance. Tested in a case study, the methodology is proved effective in screening the solution space for efficient FMG designs, in assessing the importance...
International Nuclear Information System (INIS)
Jackson, Cheryl A.; Messinger, Jeff; Palmer, Matthew T.; Peduzzi, Jean D.; Morrow, Casey D.
2003-01-01
The spread of intramuscularly inoculated poliovirus to the central nervous system (CNS) has been documented in humans, monkeys, and mice transgenic for the human poliovirus receptor. Poliovirus spread is thought to be due to infection of the peripheral nerve and retrograde transport of poliovirus through the axon to the neuron cell body, where final virus uncoating occurs and translation/replication ensues. In previous studies, we have shown that polio-based vectors (replicons) can be used for gene delivery to motor neurons of the CNS. Using a replicon that encodes green fluorescent protein (GFP), we found that following intrathecal inoculation, GFP expression was confined to motorneurons of the spinal cord. To further characterize the gene expression of poliovirus in the periphery and CNS, we have intramuscularly inoculated transgenic mice with poliovirus replicons encoding GFP. Expression of GFP was demonstrated in the muscle, sciatic nerve, dorsal root ganglion, and the ventral horn motorneurons following intramuscular inoculation. There was no evidence of paralysis or behavioral abnormalities in the mice following intramuscular inoculation of the replicon encoding GFP. Injection of replicon RNA alone (naked RNA) into the muscle of transgenic mice or rats, which do not express the poliovirus receptor, also resulted in expression of GFP in the muscle, sciatic nerve, dorsal root ganglion, and ventral horn motorneurons, indicating that transport of the replicon RNA from the periphery to CNS had occurred. GFP expression was found in the muscles and sciatic nerve as early as 6 h after injection of replicons or replicon RNA, even after sciatic nerve section. Analysis at longer times postinjection revealed GFP expression similar to 6 h levels in the cut sciatic nerves and robust expression in the nerves of uncut animals. The infection and expression of GFP in the CNS following intramuscular inoculation of encapsidated replicons encoding GFP occurred in juvenile or
International Nuclear Information System (INIS)
Kothari, S.K.; Saraf, C.S.
1988-01-01
A greenhouse experiment was conducted with four types of bacterial inoculation (Rhizobium alone; Rhizobium along with Azotobacter chroococcum; Rhizobium along with Azospirillum brasilense and no inoculation) and three levels of phosphorus ( 32 P labelled SSP) application (O, 6.5 ppm and 13.0 ppm P). Inoculation with Rhizobium along with Azotobacter chroococcum was found to be better than Rhizobium alone or Rhizobium along with Azospirillum brasilense in respect of leaf, stem, root and nodule dry weight, phosphorus uptake and utilization efficiency. P application upto 6.5 ppm significantly increased leaf, stem, root and nodule dry weight and phosphorus uptake. Per cent phosphorus derived from fertilizer (per cent pdff) and fertilizer P uptake significantly increased while P utilization efficiency significantly decreased with increasing levels of P application. (author). 12 refs., 2 tables
Su, Shiming; Zeng, Xibai; Bai, Lingyu; Williams, Paul N; Wang, Yanan; Zhang, Lili; Wu, Cuixia
2017-05-01
Arsenic (As)-contaminated agricultural soils threaten crop yields and pose a human health risk. Augmentation of exogenous microorganisms exhibiting plant-growth promoting and As speciation changing shows potential to improve crop growth and change soil As availability. Trichoderma asperellum SM-12F1 exhibiting both traits was developed into chlamydospores to improve its persistence in contaminated soils. After inoculation, As availability and enzyme activity in two types of soils and the growth as well as As uptake of water spinach (Ipomoea aquatic Forsk.) were investigated. The results indicated that inoculation significantly improved water spinach growth in both soils. Inoculating chlamydospores at 5% significantly increased As concentration (139%), bioconcentration factor (150%), and translocation factor (150%) in water spinach grown in Chenzhou (CZ) soils, while no significant change for these in Shimen (SM) soils. Inoculating chlamydospores at 5% caused a significant increase (16%) of available As content in CZ soils, while a significant decrease (13%) in SM soils. Inoculation significantly caused As methylation in both soils, while significant As reduction merely observed in CZ soils. The differential changes in available As contents in both soils were attributed to the soil pH, As fractionations and speciation characteristics. Furthermore, Inoculating chlamydospores at 5% significantly improved the activities of β-glucosidase (155%), chitinase (211%), and phosphatase (108%) in SM soils, while significant decreases in β-glucosidase (81%), phosphatase (54%), aminopeptidase (60%), and catalase (67%) in CZ soils. Bioaugmentation and As availability change were responsible for this result. These observations will be helpful for the application of fungal chlamydospores in the future bioremediation. Copyright © 2017. Published by Elsevier Ltd.
Costa, Gustavo Henrique Nogueira; da Costa, Alvimar José; Lopes, Welber Daniel Zanetti; Bresciani, Katia Denise Saraiva; dos Santos, Thais Rabelo; Esper, César Roberto; Santana, Aureo Evangelista
2011-01-01
Two studies, of a natural infection and an experimental infection, were performed in order to study congenital transmission of Toxoplasma gondii in cattle. In the first study, 50 fetuses were harvested from gestating cows that were eutanasied at a municipal slaughterhouse in Jaboticabal, São Paulo state, Brazil. In the second study, 11 gestating cows were divided into four groups for inoculation with T. gondii: GI consisted of three cows inoculated with 1.0 × 10(5) oocysts during their first trimester of gestation; GII consisted of three cows inoculated with 1.0 × 10(5) oocysts during their second trimester of gestation; GIII consisted of three cows inoculated with 1.0 × 10(5) oocysts during their last trimester of gestation; and GIV consisted of two control cows, one during its first and the other during its second trimester of gestation. In both studies, the presence of T. gondii was confirmed both indirectly by immunofluorescence assay (IFAT). In the natural infection experiment, 18% (9/50) of the gestating cows were confirmed to have specific antibodies (IFAT--1:64) against T. gondii. The bioassay was able to diagnose the presence of T. gondii in the tissue samples from three calves. In the second experiment, the nine cows from groups I, II and III presented with specific antibodies (IFAT) against T. gondii. In contrast, T. gondii could not be detected by IFAT, histopathological examination or the bioassay in any of the nine calves born to cows experimentally infected with T. gondii oocysts. Based on the results from both studies, we conclude that congenital infection of T. gondii in cattle, while infrequent, does occur naturally. The pathogenicity of the strain of T. gondii may influence the likelihood of this route of transmission. Copyright © 2010 Elsevier Inc. All rights reserved.
Wang, Rui-ning; Wang, Ya-bin; Geng, Jing-wei; Guo, Dong-hui; Liu, Fang; Chen, Hong-ying; Zhang, Hong-ying; Cui, Bao-an; Wei, Zhan-yong
2012-07-27
Inactivated porcine parvovirus (PPV) vaccines are available commercially and widely used in the breeding herds. However, inactivated PPV vaccines have deficiencies in induction of specific cellular immune response. Transfer factor (TF) is a material that obtained from the leukocytes, and is a novel immune-stimulatory reagent that as a modulator of the immune system. In this study, the immunogenicity of PPV oil emulsion vaccine and the immuno-regulatory activities of TF were investigated. The inactivated PPV oil emulsion vaccines with or without TF were inoculated into BALB/c mice by subcutaneous injection. Then humoral and cellular immune responses were evaluated by indirect enzyme-linked immunosorbent assays (ELISA), fluorescence-activated cell sorter analyses (FACS). The results showed that the PPV specific immune responses could be evoked in mice by inoculating with PPV oil emulsion vaccine alone or by co-inoculation with TF. The cellular immune response levels in the co-inoculation groups were higher than those groups receiving the PPV oil emulsion vaccine alone, with the phenomena of higher level of IFN-γ, a little IL-6 and a trace of IL-4 in serum, and a vigorous T-cell response. However, there was no significant difference in antibody titers between TF synergy inactivated vaccine and the inactivated vaccine group (P>0.05). In conclusion, these results suggest that TF possess better cellular immune-enhancing capability and would be exploited into an effective immune-adjuvant for inactivated vaccines. Copyright © 2012 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Tian Yongqiang; Chen Liming; Gao Lihong; Michel, Frederick C.; Wan Caixia; Li Yebo; Dick, Warren A.
2012-01-01
Melamine formaldehyde resins have hard and durable properties and are found in many products, including automobile paints. These resins contain high concentrations of nitrogen and, if properly composted, can yield valuable products. We evaluated the effects of starter compost, nutrients, gypsum and microbial inoculation on composting of paint sludge containing melamine resin. A bench-scale composting experiment was conducted at 55 °C for 91 days and then at 30 °C for an additional 56 days. After 91 days, the composts were inoculated with a mixed population of melamine-degrading microorganisms. Melamine resin degradation after the entire 147 days of composting varied between 73 and 95% for the treatments with inoculation of microorganisms compared to 55–74% for the treatments without inoculation. Degradation was also enhanced by nutrients and gypsum additions. Our results infer that large scale composting of melamine resins in paint sludge is possible. - Highlights: ► Melamine resin in waste paint sludges could be efficiently composted at bench scale. ► Melamine resin degradation after 147 days of composting was 73–95% complete. ► Nutrients, gypsum and melamine-degrading microorganisms increased composting rate. ► Melamine degradation products first increased and then decreased in the compost. ► Final compost was enriched in nitrogen and other essential plant nutrients. - Melamine resin in waste paint sludges was efficiently composted at bench scale, with finished composts having low levels of heavy metals and enriched in plant nutrients.
Casal, Carmen; Alvarez, Julio; Bezos, Javier; Quick, Harrison; Díez-Guerrier, Alberto; Romero, Beatriz; Saez, Jose L; Liandris, Emmanouil; Navarro, Alejandro; Perez, Andrés; Domínguez, Lucas; de Juan, Lucía
2015-09-01
The official technique for diagnosis of bovine tuberculosis (bTB) worldwide is the tuberculin skin test, based on the evaluation of the skin thickness increase after the intradermal inoculation of a purified protein derivative (PPD) in cattle. A number of studies performed on experimentally infected or sensitized cattle have suggested that the relative sensitivity of the cervical test (performed in the neck) may vary depending on the exact location in which the PPD is injected. However, quantitative evidence on the variation of the test accuracy associated to changes in the site of inoculation in naturally infected animals (the population in which performance of the test is most critical for disease eradication) is lacking. Here, the probability of obtaining a positive reaction (>2 or 4 millimeters and/or presence of local clinical signs) after multiple inoculations of bovine PPD in different cervical and scapular locations was assessed in animals from five bTB-infected herds (818 cattle receiving eight inoculations) using a hierarchical Bayesian logistic regression model and adjusting for the potential effect of age and sex. The effect of the inoculation site was also assessed qualitatively in animals from four officially tuberculosis free (OTF) herds (two inoculations in 210 animals and eight inoculations in 38 cattle). Although no differences in the qualitative outcome of the test were observed in cattle from OTF herds, a statistically important association between the test outcome and the inoculation site in animals from infected herds was observed, with higher probabilities of positive results when the test was performed in the neck anterior area. Our results suggest that test sensitivity may be maximized by considering the area of the neck in which the test is applied, although lack of effect of the inoculation site in the specificity of the test should be confirmed in a larger sample. Copyright © 2015 Elsevier B.V. All rights reserved.
The effect of Bacillus sp. OSU-142 inoculation at various levels of ...
African Journals Online (AJOL)
STORAGESEVER
2009-09-15
Sep 15, 2009 ... The effect of Bacillus sp. OSU-142 inoculation at various levels of nitrogen fertilization on growth, tuber distribution and yield of potato (Solanum tuberosum L.) Zehra Ekin1*, Faruk Oğuz1, Murat Erman1 and Erdal Öğün2. 1Yüzüncü Yıl University, Faculty of Agriculture, Department of Field Crops, Van, ...
9 CFR 113.37 - Detection of pathogens by the chicken embryo inoculation test.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of pathogens by the chicken... VECTORS STANDARD REQUIREMENTS Standard Procedures § 113.37 Detection of pathogens by the chicken embryo...-serum mixture shall be inoculated into each of at least 20 fully susceptible chicken embryos. (1) Twenty...
International Nuclear Information System (INIS)
Du, Qiang; Li, Yanjun
2015-01-01
In this paper, a multi-scale as-cast grain size prediction model is proposed to predict as-cast grain size of inoculated aluminum alloys melt solidified under non-isothermal condition, i.e., the existence of temperature gradient. Given melt composition, inoculation and heat extraction boundary conditions, the model is able to predict maximum nucleation undercooling, cooling curve, primary phase solidification path and final as-cast grain size of binary alloys. The proposed model has been applied to two Al-Mg alloys, and comparison with laboratory and industrial solidification experimental results have been carried out. The preliminary conclusion is that the proposed model is a promising suitable microscopic model used within the multi-scale casting simulation modelling framework. (paper)