WorldWideScience

Sample records for frog rana sphenocephala

  1. Effects of predatory fish on survival and behavior of larval gopher frogs (Rana capito) and Southern Leopard Frogs (Rana sphenocephala)

    Science.gov (United States)

    Gregoire, D.R.; Gunzburger, M.S.

    2008-01-01

    Southern Leopard Frogs, Rana sphenocephala, are habitat generalists occurring in virtually all freshwater habitats within their geographic range, whereas Gopher Frogs, Rana capito, typically breed in ponds that do not normally contain fish. To evaluate the potential for predation by fish to influence the distribution of these species, we conducted a randomized factorial experiment. We examined the survival rate and behavior of tadpoles when exposed to Warmouth Sunfish, Lepomis gulosus, Banded Sunfish, Enneacanthus obesus, and Eastern Mosquitofish, Gambusia holbrooki. We also conducted a choice experiment to examine the survival rate of the two species of tadpoles when a predator is given a choice of both species simultaneously. Lepomis gulosus consumed the most tadpoles and ate significantly more tadpoles of R. capito than R. sphenocephala. Gambusia holbrooki injured the most tadpoles, especially R. capito. Enneacanthus obesus did not have an effect on behavior or survival of either anuran species. Tadpoles of both anurans increased hiding when in the presence of L. gulosus and G. holbrooki, but a greater proportion of R. capito hid than did R. sphenocephala. Our results suggest that R. capito are more vulnerable to predation by fish than are R. sphenocephala. The introduction of fish may play a role in population declines of certain anurans breeding in normally fish-free wetlands, and even small fish, such as mosquitofish, may have significant negative effects on the tadpoles of R. capito. Copyright 2008 Society for the Study or Amphibians and Reptiles.

  2. Toxic effects of endrin and toxaphene on the southern leopard frog Rana sphenocephala

    Science.gov (United States)

    Hall, R.J.; Swineford, D.

    1980-01-01

    Eggs, larvae and sub-adults of the southern leopard frog Rana sphenocephala were exposed to endrin and toxaphene. Exposure was in water by a continuous-flow technique, following standards that have been used successfully in the study of fish and invertebrates. R. sphenocephala is more sensitive to both pesticides than are higher vertebrates but is slightly less sensitive than fish. Eggs seem to be resistant to the effects of both pesticides and are probably poor indicators of environmental hazard. The toxic level of endrin is about equal in larvae and transformed frogs (LC50, 0?005-0?015 ppm). Toxaphene is less toxic to sub-adults (LC50, 0?37-0?790 ppm) than to larvae (LC50, 0?032-0?054 ppm). Delayed mortality, behavioural aberrations and effects on growth have been seen in toxaphene-dosed larvae observed over 30-day periods. Behavioural effects are more severe than those reported in other groups of animals. Effects on growth resulting from a 96-h exposure begin in the 0?013-0?018 ppm range. The maximum accumulation of residues observed for each chemical represented bioconcentration factors of about 100. Endrin residues are apparently lost more readily than toxaphene residues; relative depuration rates correlate well with the time course of toxic action in each chemical. Although less sensitive to these pesticides than fish, amphibians may not be protected in their natural habitats. Future studies of the effects of toxicants on amphibians should employ larvae if only one stage can be tested, should expose subjects for at least 96 h and should continue observations for a total of at least 30 days.

  3. Temporal occurrence and community structure of helminth parasites in southern leopard frogs, Rana sphenocephala, from north central Oklahoma.

    Science.gov (United States)

    Vhora, M Suhail; Bolek, Matthew G

    2015-03-01

    Currently, little information is available about the temporal recruitment of helminth communities in amphibian hosts. We examined the helminth community structure and temporal recruitment of helminth parasites in southern leopard frogs, Rana sphenocephala. Specifically, we were interested in how host life history such as habitat, age and/or size, diet, sex, and temporal variation in abiotic factors (precipitation and temperature) were important in determining monthly infection patterns of helminth populations and communities in southern leopard frogs. From May to September 2011, 74 southern leopard frogs were collected from Teal Ridge in Stillwater Payne County, OK, USA. Sixty-nine (93 %) of 74 frogs were infected with 1 or more helminth species. During our collecting period, the average monthly temperature was lowest in May and highest in July, and monthly precipitation was highest in May and lowest during the first week of September. The component community consisted of 11 species of helminth, including 1 larval and 1 adult cestode, 2 larval and 3 adult trematodes, and 1 juvenile and 3 adult nematodes. Of the 1790 helminths recovered, 51 % (911) were nematodes, 47 % (842) were cestodes, and 2 % (37) were trematodes. There were significant differences in the total abundance and mean species richness of helminths acquired by skin contact or through frog diet in monthly component communities of southern leopard frogs. A positive correlation existed for percentage of all helminths acquired by skin contact and monthly precipitation (r = 0.94, P < 0.01). Conversely, a negative correlation existed for monthly precipitation and percentage of helminths acquired by diet (r = -0.94, P < 0.01). Our results indicate that abiotic conditions such as precipitation have a major influence on the avenues for and constraints on the transmission of helminths with life cycles associated with water/moisture or terrestrial intermediate/paratenic hosts and are important in structuring

  4. Effects of lead-contaminated sediment on Rana sphenocephala tadpoles

    Science.gov (United States)

    Sparling, D.W.; Krest, S.K.; Ortiz-Santaliestra, M.

    2006-01-01

    We exposed larval southern leopard frogs (Rana sphenocephala) to lead-contaminated sediments to determine the lethal and sublethal effects of this metal. Tadpoles were laboratory-raised from early free-swimming stage through metamorphosis at lead concentrations of 45, 75, 180, 540, 2360, 3940, 5520, and 7580 mg/kg dry weight in sediment. Corresponding pore water lead concentrations were 123, 227, 589, 1833, 8121, 13,579, 19,038, and 24,427 ug/L. Tadpoles exposed to lead concentrations in sediment of 3940 mg/kg or higher died within 2 to 5 days of exposure. At lower concentrations, mortality through metamorphosis ranged from 3.5% at 45 mg/kg lead to 37% at 2360 mg/kg lead in sediment. The LC50 value for lead in sediment was 3728 mg/kg (95% CI=1315 to 72,847 mg/kg), which corresponded to 12,539 ug/L lead in pore water (95% CI= 4000 to 35,200 ug/L). Early growth and development were depressed at 2,360 mg/kg lead in sediment (8100 ug/L in pore water) but differences were not evident by the time of metamorphosis. The most obvious effect of lead was its pronounced influence on skeletal development. Whereas tadpoles at 45 mg/kg lead in sediment did not display permanent abnormalities, skeletal malformations increased in frequency and severity at all higher lead concentrations. By 2360 mg/kg, 100% of surviving metamorphs displayed severe spinal problems, reduced femur and humerus lengths, deformed digits, and other bone malformations. Lead concentrations in tissues correlated positively with sediment and pore water concentrations.

  5. Final Critical Habitat for Oregon Spotted Frog (Rana pretiosa)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas of FINAL critical habitat for Rana pretiosa (Oregon Spotted Frog). Maps published in the Federal Register 2016.

  6. Final Critical Habitat for Oregon Spotted Frog (Rana pretiosa)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These data identify, in general, the areas of FINAL critical habitat for Rana pretiosa (Oregon Spotted Frog). Maps published in the Federal Register 2016.

  7. Oregon Spotted Frog (Rana pretiosa) Monitoring at Jack Creek 2015

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains information from mark-recapture surveys conducted in 2015 by USGS as part of an ongoing Oregon spotted frog (Rana pretiosa) monitoring effort...

  8. Pesticide Distributions and Population Declines of California Alpine Frogs, Rana Muscosa and Rana Sierrae

    Science.gov (United States)

    Atmospherically deposited pesticides from the intensively cultivated Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the frogs Rana muscosa and Rana sierrae at high elevation in th...

  9. Pesticide Distributions and Population Declines of California Alpine Frogs, Rana Muscosa and Rana Sierrae

    Science.gov (United States)

    Atmospherically deposited pesticides from the intensively cultivated Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the frogs Rana muscosa and Rana sierrae at high elevation in th...

  10. Helminths of the two mountain frogs, banded frog, Rana camerani Boulenger, 1886 and Uludağ frog Rana macrocnemis Boulenger, 1885 (Anura: Ranidae), collected from the Antalya province.

    Science.gov (United States)

    Düşen, Serdar

    2007-01-01

    In this study, two mountain frogs (Rana camerani and Rana macrocnemis) were collected in the Antalya Province in south-western Turkey during 2001 and 2002 and were examined for helminths. Out of 15 Rana camerani, 10 (66.7%) were infected with 1 or more helminths and out of 20 Rana macrocnemis, 17 (85%) were infected with 1 or more helminths. The helminth fauna of Rana camerani included 4 species of which were 3 trematode species (Haplometra cylindracea, Pleurogenoides medians, Opisthioglyphe rastellus), and 1 nematode species (Cosmocerca ornata). The helminth fauna of Rana macrocnemis included 3 species with 1 trematode species (H. cylindracea), 1 nematode species (C. ornata), and 1 acanthocephalan species (Acanthocephalus ranae). H. cylindracea and C. ornata were observed in both of the mountain frogs.

  11. Density dependent growth in adult brown frogs Rana arvalis and Rana temporaria - A field experiment

    Science.gov (United States)

    Loman, Jon; Lardner, Björn

    2009-11-01

    In species with complex life cycles, density regulation can operate on any of the stages. In frogs there are almost no studies of density effects on the performance of adult frogs in the terrestrial habitat. We therefore studied the effect of summer density on the growth rate of adult frogs during four years. Four 30 by 30 m plots in a moist meadow were used. In early summer, when settled after post-breeding migration, frogs ( Rana arvalis and Rana temporaria that have a very similar ecology and potentially compete) were enclosed by erecting a fence around the plots. Frogs were captured, measured, marked and partly relocated to create two high density and two low density plots. In early autumn the frogs were again captured and their individual summer growth determined. Growth effects were evaluated in relation to two density measures: density by design (high/low manipulation), and actual (numerical) density. R. arvalis in plots with low density by design grew faster than those in high density plots. No such effect was found for R. temporaria. For none of the species was growth related to actual summer density, determined by the Lincoln index and including the density manipulation. The result suggests that R. arvalis initially settled according to an ideal free distribution and that density had a regulatory effect (mediated through growth). The fact that there were no density effects on R. temporaria (and a significant difference in its response to that of R. arvalis) suggests it is a superior competitor to R. arvalis during the terrestrial phase. There were no density effects on frog condition index, suggesting that the growth rate modifications may actually be an adaptive trait of R. arvalis. The study demonstrates that density regulation may be dependent on resources in frogs' summer habitat.

  12. The wood frog (Rana sylvatica): a technical conservation assessment

    Science.gov (United States)

    Muths, E.; Rittmann, S.; Irwin, J.; Keinath, D.; Scherer, R.

    2005-01-01

    Overall, the wood frog (Rana sylvatica) is ranked G5, secure through most of its range (NatureServe Explorer 2002). However, it is more vulnerable in some states within the USDA Forest Service Region 2: S3 (vulnerable) in Colorado, S2 (imperiled) in Wyoming, and S1 (critically imperiled in South Dakota (NatureServe Explorer 2002); there are no records for wood frogs in Kansas or Nebraska. Primary threats to wood frog populations are habitat fragmentation (loss of area, edge effects, and isolation) and habitat loss due to anthropogenic causes (e.g., wetland draining, grazing) and natural changes as habitat succession occurs. Wood frogs are most conspicuous at breeding sites early in the spring, when snow and ice are often still present at pond margins. They tolerate frezzing and hibernate terrestrially in shallow depressions, under leaf litter, grasses, logs, or rocks (Bagdonas 1968, Bellis 1961a); there are no reports of aquatic hibernation for this species (Licht 1991, Pinder et al. 1992). Wood frogs require semi-permanent and temporary pools of natural origin and adjacent wet meadows, and landscape alterations that shorten the hydroperiod of ponds can result in catastrophic tadpole mortality. Plant communities utilized by wood frogs in the Rocky Mountains are hydric to mesic and include sedge and grass meadows, willow hummocks, aspen groves, lodgepole pine forests, and woodlands with leaf litter and/or herbaceous understory (Maslin 1947, Bellis 1961a, Roberts and Lewin 1979, Haynes and Aird 1981). Wood frogs are likely to disperse into surrounding marsh and woodlands soon after oviposition (Heatwole 1961, Haynes and Aird 1981). In the arly fall, wood frogs begin to seek hibernacula at or just below the ground surface, generally in upland forest habitat (Regosin et al. 2003). Licht (1991) demonstrated shelter-seeking behavior at 1.5 [degrees] C. Once they have concealed themselves for hibernation, wood frogs are very difficult to detecta?|

  13. Structural study of the frog Rana temporaria larval stomach.

    Science.gov (United States)

    Rovira, J; Villaro, A C; Bodegas, M E; Valverde, E; Sesma, P

    1993-10-01

    The gastric wall of Rana temporaria tadpoles consists of a well-developed mucosa and thin muscular and serosa layers. Three cellular types--mucous, ciliated and endocrine cells--make up the lining epithelium. Different types of endocrine cells exist. Argyrophylic endocrine cells can be recognized in semithin sections of plastic-embedded material while non-argyrophylic endocrine cells can only be identified under the electron microscope. Glands are composed mainly of well-differentiated oxyntic cells and, occasionally, scarce endocrine cells. Oxyntic cells show abundant mitochondria and smooth endoplasmic reticulum, but do not contain zymogen granules as do those present in adults. Secretory canaliculi with microvilli are also well-developed. The lamina propria contains numerous vascular sinuses and nerve bundles which innervate the endothelium and some endocrine cells. The neuroendocrine regulation of frog gastric functions seems therefore to have developed in young tadpoles. Nerve fibers also innervate the muscular propria, which is composed of a single layer of smooth muscle cells. Underlying the muscle, connective fibers and a flattened layer of mesothelial cells make up the serosa. In summary, the structure of the frog larval stomach shows a well-differentiated histological pattern, especially referring to surface epithelium and glands. Some of the histological traits will also be present in adult frogs while others are characteristic of the tadpole's stage.

  14. Western spotted frog (Rana pretiosa) distribution in the Bonneville Basin of western Utah: Research in progress

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report provides information on the western spotted frog (Rana pretiosa) which occurs in Tule Valley, Utah. The following topics are discussed; general...

  15. The Developmental Effects Of A Municipal Wastewater Effluent On The Northern Leopard Frog, Rana pipiens

    Science.gov (United States)

    Wastewater effluents are complex mixtures containing a variety of anthropogenic compounds, many of which are known endocrine disruptors. In order to characterize the development and behavorial effects of such a complex mixture, northern leopard frogs, Rana pipiens, were e...

  16. Octylphenol induced gene expression in testes of Frog, Rana chensinensis.

    Science.gov (United States)

    Li, Xinyi; Liu, Jia; Zhang, Yuhui

    2016-06-01

    Octylphenol (OP) is an endocrine-disrupting chemical (EDC), which can disrupt the reproductive system. To understand the effect of OP, a subtractive cDNA library was constructed using suppression subtractive hybridization (SSH) to identify alterations of gene transcription in the testes of the frog Rana chensinensis after OP exposure. Two hundred positive clones were selected and 134 sequences of gene fragments were produced from the subtractive library randomly. These genes were identified to be involved in metabolic process, cellular process, biological regulation, stimulus, immune system and female pregnancy process. In order to verify the efficiency of the subtractive cDNA library, PSG9 and PAPP-A were analyzed further as two representatives of differentially expressed transcription genes using semi-quantitative RT-PCR. Our result was the first successful construction of the subtractive cDNA library in frog testes after OP treatment. Based on this cDNA library, OP was shown to affect multiple physiological processes including inducing immune response, disrupting the steroid hormone synthesis and influencing spermatogenesis in the testis by up-regulation of specific genes.

  17. Ultrastructure of venom glands in the frog (Rana esculenta).

    Science.gov (United States)

    De Perez, G; Hindelang, C

    1985-01-01

    Electron microscopic study of skin venom glands in the frog, Rana esculenta, revealed the syncytial structure of the inner (secretory) wall which presents two distinct zones: a basal (juxtamuscular) one, which contains nuclei and major cytoplasmic organelles, and an apical one where large electron-dense granules form and accumulate. Granules are seen to arise inside clusters of tightly packed smooth endoplasmic reticulum (SER) elements, which suggests that the SER system is mainly involved in synthesis of this material. A high glutaraldehyde concentration (5%) also reveals a poorly defined material filling the intergranular cytoplasm. No apical limits to the syncytium could be traced, which suggests massive holocrine secretion. Nerves insinuate between the muscle cells and occur all along the internal face of the muscular layer, sometimes in close contact with the syncytium. The gland duct, the wall of which consists of epidermal cells, is blocked, in contact with the gland, by an epidermal bud linked externally to the muscle layer surrounding the gland. Thus, only strong muscle tension such as to expel all or part of the epidermal bud can trigger granule release. This phenomenon can be induced by the subcutaneous injection of epinephrine, but the high and distressing dose needed to provoke appreciable changes in venom glands renders unlikely any natural intense venom release triggered by epinephrine in the frog.

  18. Oregon spotted frog (Rana pretiosa) monitoring at Jack Creek 2015-2016

    Science.gov (United States)

    Adams, Michael J.; Pearl, Christopher A.; Mccreary, Brome; Galvan, Stephanie; Rowe, Jennifer

    2017-01-01

    This dataset contains information from mark-recapture and egg mass surveys conducted 2015-2016 by USGS as part of an ongoing Oregon spotted frog (Rana pretiosa) monitoring effort at Jack Creek, Klamath County, Oregon. Data consist of spotted frog counts aggregated by date, location, life stage, and sex, as well as data on environmental conditions at the time each survey.

  19. Helminth communities of two green frogs (Rana perezi and Rana saharica from both shores of the Alboran Sea

    Directory of Open Access Journals (Sweden)

    Navarro P.

    2006-12-01

    Full Text Available The helminth communities of two populations of green frogs from both shores of the Alborán Sea (Western Mediterranean were studied. Of the 79 frogs examined for helminths, 39 individuals of the species Rana saharica were collected from Bab-Taza (Morocco, and 40 of the species Rana perezi were collected from the Natural Park of the Sierra de Grazalema (Spain. Although the species richness of helminths was identical in the two sampled areas, the differences observed in the structure of the helminth infracommunities were quite important. Statistically, significant differences were found between the species richness and the diversity of the infracommunities of R. perezi female population and the other three studied statistical populations. The helminth component communities of these two green frogs can be considered as depauperate, although their infracommunities present interactive features.

  20. A microsatellite-based method for genotyping diploid and triploid water frogs of the Rana esculenta hybrid complex

    DEFF Research Database (Denmark)

    Christiansen, Ditte Guldager

    2005-01-01

    Rana esculenta is a hybrid between Rana lessonae (LL) and Rana ridibunda (RR), and hybrids may be diploid (LR) or triploid (LLR or LRR). Genotypes can be roughly determined from erythrocyte size and morphometry in adult frogs, but accurate genotyping requires more labourious methods. Here I...

  1. THE MOCHE BOTANICAL FROG (La rana botánica mochica

    Directory of Open Access Journals (Sweden)

    Donna McClelland †

    2011-06-01

    Full Text Available Plants and animals with features which identify them as supernaturals characterize the art of the Precolumbian Moche culture of northern Peru. Among these animals is a frog with feline attributes and a consistent association with manioc tubers, stalks, and plants, the Botanical Frog. The Botanical Frog appears to have been patterned on Leptodactylus pentadactylus. It is shown copulating with felines. Fine line painted vessels and ones with low relief decoration show the Botanical Frog performing as part of a ritual involving other animals and cultivated crops, suggesting that the Botanical Frog was associated with agriculture. ESPAÑOL: El arte de la cultura mochica de la costa norte del Perú presenta plantas y animales mostrando rasgos sobrenaturales. Uno de los animales es una rana con elementos felinos y asociada con tubérculos, ramas y plantas de yuca. La Rana Botánica probablemente tiene su origen en Leptodactylus pentadactylus, una rana carnívora de la selva amazónica. La Rana Botánica copula con felinos y, en vasijas pintadas con líneas finas o con escenarios representados en bajorrelieve, toma parte en ceremonias involucrando a otros animales y cosechas domésticas. Parece ser que la Rana Botánica era un ser sobrenatural asociado con la agricultura.

  2. Reproduction and hybrid load in all-hybrid populations of Rana esculenta water frogs in Denmark

    DEFF Research Database (Denmark)

    Christiansen, Ditte Guldager; Fog, Kåre; Pedersen, Bo Vest;

    2005-01-01

    All-hybrid populations of the water frog, Rana esculenta, are exceptional in consisting of independently and to some extent sexually reproducing interspecific hybrids. In most of its range R. esculenta reproduces hemiclonally with one of the parental species, R. lessonae or R. ridibunda, but viable...... gametogenesis and mating between frogs with incompatible gametes induce a significant hybrid load in all-hybrid populations of R. esculenta, and we discuss compensating advantages and potential evolutionary trajectories to reduce this hybrid load....

  3. Phylogenetic relationships of leopard frogs (Rana pipiens complex) from an isolated coastal mountain range in southern Sonora, Mexico.

    Science.gov (United States)

    Pfeiler, E; Markow, T A

    2008-10-01

    Mitochondrial DNA sequence data from the control region and 12S rRNA in leopard frogs from the Sierra El Aguaje of southern Sonora, Mexico, together with GenBank sequences, were used to infer taxonomic identity and provide phylogenetic hypotheses for relationships with other members of the Rana pipiens complex. We show that frogs from the Sierra El Aguaje belong to the Rana berlandieri subgroup, or Scurrilirana clade, of the R. pipiens group, and are most closely related to Rana magnaocularis from Nayarit, Mexico. We also provide further evidence that Rana magnaocularis and R. yavapaiensis are close relatives.

  4. Glycation of wood frog (Rana sylvatica) hemoglobin and blood proteins: in vivo and in vitro studies

    Science.gov (United States)

    MacDonald, Justin A.; Degenhardt, Thorsten; Baynes, John W.; Storey, Kenneth B.

    2010-01-01

    The effects of in vivo freezing and glucose cryoprotectant on protein glycation were investigated in the wood frog, Rana sylvatica. Our studies revealed no difference in the fructoselysine content of blood plasma sampled from control, 27 h frozen and 18 h thawed wood frogs. Glycated hemoglobin (GHb) decreased slightly with 48 h freezing exposure and was below control levels after 7 d recovery, while glycated serum albumin was unchanged by 48 h freezing but did increase after 7 d of recovery. In vitro exposure of blood lysates to glucose revealed that the GHb production in wood frogs was similar to that of the rat but was lower than in leopard frogs. We conclude that wood frog hemoglobin was glycated in vitro; however, GHb production was not apparent during freezing and recovery when in vivo glucose is highly elevated. It is possible that wood frog blood proteins have different in vivo susceptibilities to glycation. PMID:19540217

  5. Glycation of wood frog (Rana sylvatica) hemoglobin and blood proteins: in vivo and in vitro studies.

    Science.gov (United States)

    MacDonald, Justin A; Degenhardt, Thorsten; Baynes, John W; Storey, Kenneth B

    2009-10-01

    The effects of in vivo freezing and glucose cryoprotectant on protein glycation were investigated in the wood frog, Rana sylvatica. Our studies revealed no difference in the fructoselysine content of blood plasma sampled from control, 27 h frozen and 18 h thawed wood frogs. Glycated hemoglobin (GHb) decreased slightly with 48 h freezing exposure and was below control levels after 7d recovery, while glycated serum albumin was unchanged by 48 h freezing but did increase after 7d of recovery. In vitro exposure of blood lysates to glucose revealed that the GHb production in wood frogs was similar to that of the rat but was lower than in leopard frogs. We conclude that wood frog hemoglobin was glycated in vitro; however, GHb production was not apparent during freezing and recovery when in vivo glucose is highly elevated. It is possible that wood frog blood proteins have different in vivo susceptibilities to glycation.

  6. Complete mitochondrial genomes of two brown frogs, Rana dybowskii and Rana cf. chensinensis (Anura: Ranidae).

    Science.gov (United States)

    Li, Jiao; Lei, Guangchun; Fu, Cuizhang

    2016-01-01

    We first determined complete mitochondrial genomes of Rana dybowskii and Rana cf. chensinensis (Anura: Ranidae). The mitogenomic lengths of R. dybowskii and R. cf. chensinensis were 18,864 and 18,808 bp, respectively. The two mitogenomes have similar gene compositions including 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and a control region. Rana dybowskii and R. cf. chensinensis mitogenomes displayed same gene order arrangements and similar base compositions with an A + T bias. Mitogenomic data of the two species contributed to provide molecular marker for their conservative genetics and clarified their phylogenetic position under mitogenome-based phylogeny of the genus Rana.

  7. Parasites of the mink frog (rana septentrionalis) from minnesota, U.S.A.

    Science.gov (United States)

    Schotthoefer, A.M.; Bolek, M.G.; Cole, R.A.; Beasley, V.R.

    2009-01-01

    Twenty-two mink frogs, Rana septentrionalis, collected from two locations in Minnesota, United States, were examined for helminth and protozoan blood parasites in July 1999. A total of 16 parasite taxa were recovered including 5 larval digenean trematodes, 7 adult digenean trematodes, 3 nematodes, and I Trypanosorna species. Infracommunities were dominated by the digeneans in terms of richness and abundance. In particular, echinostomatid metacercariae in the kidneys of frogs were the most common parasites found, infecting 100% of the frogs and consisting of about 90% of all helminth individuals recovered. Gorgodera amplicava, Gorgoderina multilohata, Haernaroloechus pan'iplexus, Haernatoloechus breviplexus, Cosnwcercoides dukae, and Oswaldocruzia pipiens represent new host records. The survey presented here represents the second known helminth survey of mink frogs conducted in North America. A summary of metazoan parasites reported from mink frogs is included.

  8. Altitudinal variation in body size and age structure of the Sauter’s frog Rana sauteri in Taiwan

    National Research Council Canada - National Science Library

    Hsu, Fu-Hsiung; Hsieh, Yi-Shan; Wu, Sheng-Hai; Kam, Yeong-Choy

    2014-01-01

    .... Altitudinal variations in body size, age, and growth rate of the Sauter’s frog Rana sauteri were investigated with skeletochronology at six sites along the altitudinal gradients from 330 to 2,320...

  9. Cocaine- and amphetamine-regulated transcript (CART) peptide as an in vivo regulator of cardiac function in Rana ridibunda frog

    National Research Council Canada - National Science Library

    Iliyana V. Ivanova; Rudolf Schubert; Dessislava B. Duridanova; Thomas B. Bolton; Lubomir T. Lubomirov; Hristo S. Gagov

    2007-01-01

    The aim of this study was to investigate the effect of CART peptide on cardiac performance and on the physiological signalling pathways involved using Rana ridibunda frog heart preparations in vivo...

  10. [Involution of gonadotrophic cells of the pituitary gland in the male frog, Rana esculenta, after section of the pituitary stem].

    Science.gov (United States)

    Legait, H; Helas, G

    1976-01-01

    One and two months after section of the hypophyseal stalk in the male frog. Rana esculenta, and involution of numerous gonadotrophic cells, contrasting with the normal aspect of the eosinophilic cells can be observed.

  11. Morphometric discrimination of wild from farmed Dybowski's frog (Rana dybowskii) based on hindlimb length

    Institute of Scientific and Technical Information of China (English)

    XIA Rui; HUANG Xiao-ming; YANG Shu-hui; XU Yan-chun; Ying Lu; Thomas D.Dahmer

    2011-01-01

    Commercial farming of anuran species that arc declining in the wild raises a need to discriminate wild from farmed frogs. We hypothesized wild frogs might have extended hindlimbs due to greater frequency or intensity of jumping relative to farmed frogs, highlighting a morphometric approach to discrimination of wild from farmed frogs using hindiimb length. In the present study, Dybowski's frog (Rana dybowskii) was used to test this hypothesis. We measured body mass (Mb)and hindlimb length (Lh) of 2-year old farmed frogs and wild frogs aged 2 to 5 years. Dybowski's frog demonstrated significant dimorphism in Mb and Lh. Mb was significantly greater among farmed 2-year old frogs in both sexes (p=0.000), while only among females w as Lh significantly greater for wild frogs (p=0.000). Lh/Mb was used as an index for origin discrimination to eliminate the influence of Mb due to variation of husbandry conditions among farms. Mean Lh/Mb for fanned frogs was significantly lower than for wild frogs (p=0.000) in the 2-year old age class.Discrimination correctly classified 84.4% of fanned and 96.3% of wild male frogs. Among females, 92.9% of farmed frogs and 90.1% wild frogs were correctly classified. The ovcrall correctness of classification was 92.1% and 90.8% for males and females, respectively. However, Lh/Mb revealed variation with age, resulting in reduced discriminative power for frogs ≥3 years old. We introduced a coefficient Ce to adjust the Lh/Mb of frogs ≥3 years to the level equivalent to 2-year frogs. Thc adjustment achieved 89.5% for overall correctness of origin for wild males and 92.4% for wild females ≥3 years old. These results show that Lh/Mb is an effective index to discriminate wild from fanned Dybowski's frog. Since the physical demands ofjumping are common among anurans, this index is also potentially applicable to other anuran species.

  12. Population estimates for the Toiyabe population of the Columbia spotted frog (Rana luteiventris), 2004–10

    Science.gov (United States)

    Adams, Michael J.; Mellison, Chad; Galvan, Stephanie K.

    2013-01-01

    The Toiyabe population of Columbia spotted frogs (Rana luteiventris, hereafter "Toiyabe frogs") is a geographically isolated population located in central Nevada (fig. 1). The Toiyabe population is part of the Great Basin Distinct Population Segment of Columbia spotted frogs, and is a candidate for listing under the Endangered Species Act (U.S. Fish and Wildlife Service, 2011). The cluster of breeding sites in central Nevada represents the southernmost extremity of the Columbia spotted frogs' known range (Funk and others, 2008). Toiyabe frogs are known to occur in seven drainages in Nye County, Nevada: Reese River, Cow Canyon Creek, Ledbetter Canyon Creek, Cloverdale Creek, Stewart Creek, Illinois Creek, and Indian Valley Creek. Most of the Toiyabe frog population resides in the Reese River, Indian Valley Creek, and Cloverdale Creek drainages (fig. 1; Nevada Department of Wildlife, 2003). Approximately 90 percent of the Toiyabe frogs' habitat is on public land. Most of the public land habitat (95 percent) is managed by the U.S. Forest Service (USFS), while the Bureau of Land Management (BLM) manages the remainder. Additional Toiyabe frog habitat is under Yomba Shoshone Tribal management and in private ownership (Nevada Department of Wildlife, 2003). The BLM, USFS, Nevada Department of Wildlife (NDOW), Nevada Natural Heritage Program (NNHP), Nye County, and U.S Fish and Wildlife Service (USFWS) have monitored the Toiyabe population since 2004 using mark and recapture surveys (Nevada Department of Wildlife, 2004). The USFWS contracted with the U.S. Geological Survey (USGS) to produce population estimates using these data.

  13. Hematological, Biochemical and Histopathological Studies on Marsh Frog, Rana ridibunda, Naturally Infected with Waltonella duboisi

    Directory of Open Access Journals (Sweden)

    A.M. Al-Attar

    2010-01-01

    Full Text Available The present study was aimed to evaluate the impact of Waltonella duboisi naturally infection in the marsh frog, Rana ridibunda. Healthy and infected frogs of both sexes were collected from Al-Qatif and Al-Hassa farms, Eastern Province, Saudi Arabia. The hematological, biochemical and histopathological changes were estimated in infected male and female frogs compared with healthy frogs. The values of red blood cell count, hemoglobin concentration, hematocrit, mean cell volume, mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration and white blood cell count were statistically decreased in infected frogs. Infection with Waltonella duboisi induced significant reduction in the levels of serum glucose and total proteins, while the values of triglycerides cholesterol, creatinine, glutamic pyruvic acid transaminase and glutamic oxaloacetic acid transaminase were significantly elevated. Histopathological examination of stomach, small intestine, liver showed the larval developmental stages of Waltonella duboisi. A partially abnormal of testis and ovary structures with pronounced disturbance in quantity and quality of spermatogenesis and oogenesis processes were noted in infected of both sexes of frogs. From the present study, it is obviously that Waltonella duboisi caused many severe physiological and histopathological alterations in both sexes of the marsh frogs. Thus, more sincere ecological and scientific efforts are required to rescue the marsh frog population from parasitic infection, pathogenic factors and increases of mortality rate.

  14. Food Habits of the Endemic Long Legged Wood Frog, Rana Pseudodalmatina (Amphibia, Ranidae, in Northern Iran

    Directory of Open Access Journals (Sweden)

    Najibzadeh M.

    2016-08-01

    Full Text Available Iranian long legged wood frog, Rana pseudodalmatina Eiselt & Schmidtler, 1971 is a brown frog species endemic to the Hyrcanian forest. The objective of the present study is to collect detailed information on the feeding habits of 44 specimens of this species (24 ♂, 20 ♀ by analyzing the stomach contents of individuals from 10 populations inhabiting range. The food habit of R. pseudodalmatina generally varies by the availability of surrounding prey items, and it is a foraging predator, the food of which consists largely of Coleoptera (mainly Carabidae, Dytiscidae and Haliplidae, Diptera (Muscidae and Hymenoptera (Formicidae, and no difference was found between females and males in the stomach content.

  15. Oregon spotted frog (Rana pretiosa) monitoring in the Oregon Cascades 2012-2016

    Science.gov (United States)

    Adams, Michael J.; Pearl, Christopher A.; Mccreary, Brome; Galvan, Stephanie; Rowe, Jennifer

    2017-01-01

    This dataset contains information from visual encounter surveys conducted between 2012 and 2016 by USGS as part of an ongoing Oregon spotted frog (Rana pretiosa) monitoring effort in the Oregon Cascade Mountain Range. We surveyed 91 sites using a rotating frame design in the Klamath and Deschutes Basins, Oregon, which encompass most of the species' core extant range. Data consist of spotted frog counts aggregated by date, location, and life stage, as well as data on environmental conditions at the time of each survey.

  16. Distribution and postbreeding environmental relationships of Northern leopard frogs (Rana [Lithobates] pipiens) in Washington

    Science.gov (United States)

    Germaine, S.S.; Hays, D.W.

    2009-01-01

    Northern leopard frogs (Rana [Lithobates] pipiens) are considered sensitive, threatened, or endangered in all western states and western Canadian provinces. Historically present in eastern Washington in 6 major river drainages, leopard frogs are now only known to occur at 2 localized areas in the Crab Creek drainage in Grant County. During the summers of 2002-2005, we surveyed both areas to document extent of leopard frog distributions and to describe habitat and vertebrate community characteristics associated with leopard frog site occupancy. At Gloyd Seeps, 2 juvenile leopard frogs were observed in a total of 8.2 person-days of searching along a 5-km stream reach. At Potholes Reservoir, we surveyed 243 wetland sites in 7 management units known to have been occupied by leopard frogs during the 1980s. We confirmed leopard frog presence at only 87 sites (36%) in 4 management units. Site occupancy models for individual ponds indicated that, compared to unoccupied sites, occupied sites had slightly greater pond depths, less tall emergent vegetation, more herbaceous vegetative cover, and fewer neighboring ponds containing nonnative predatory fish. Models developed at the 1-km2 scale indicated that occupied areas had greater average midsummer pond depths, fewer ponds occupied by bullfrogs (Rana [Lithobates] catesbeiana) and carp (Cyprinus carpio), and more herbaceous vegetation surrounding ponds. The Gloyd Seeps population now appears defunct, and the Potholes Reservoir population is in sharp decline. Unless management actions are taken to reduce nonnative fish and bullfrogs and to enhance wetland vegetation, leopard frogs may soon be extirpated from both sites and possibly, therefore, from Washington.

  17. Cutaneous transport of Ca2+ in the frog Rana pipiens: significance and specificity.

    Science.gov (United States)

    Stiffler, D F; Eskandari, S; Dejbakhsh, S

    1997-04-01

    Rana pipiens were divided into four groups: controls; hypocalcemic frogs, depleted of salts by acclimation to deionized water; hypercalcemic frogs, calcium-loaded by the introduction of 40 mumol calcium gluconate; and frogs exposed to the potential competing ions Mg2+, Sr2+, and Ba2+. All groups displayed calcium influx that was proportional to external [Ca2+]; however, the group acclimated to deionized water also displayed hypocalcemia (P 0.3 mM) external [Ca2+]. Ca2+ efflux was depressed in hypocalcemic frogs, and thus net Ca2+ flux shifted from net loss in control frogs to net uptake in hypocalcemic frogs. Hypocalcemia also resulted in increased skin Ca2+ deposits which may be related to a decreased Ca2+ (and other ions) permeability as a consequence of the acclimation to deionized water. Another group of frogs was Ca(2+)-loaded by injecting calcium gluconate: Sodium gluconate controls did not significantly alter Ca2+ fluxes. The frogs that received calcium gluconate treatments became hypercalcemic (P < 0.01) and did not display significant changes in calcium fluxes, nor did they show significant changes in skin calcium deposits. We conclude that hypocalcemia leads to regulatory responses that stimulate active Ca2+ transport in Rana pipiens skin and possibly inhibits cutaneous and renal efflux. We also conclude that hypercalcemia does not alter calcium fluxes across skin. The ions from Group IIA of the Periodic Table of Elements had little effect on Ca2+ fluxes at concentrations ranging from 0.5-4.0 mM; neither Sr2+ or Ba2+ affected Ca2+ influx. The only divalent ion tested that influenced Ca2+ was Mg2+, which significantly inhibited Ca2+ influx but only at 4.0 mM or eight times the external [Ca2+]. We conclude, therefore, that the Ca2+ transport mechanism is fairly specific for Ca2+ within Group IIA.

  18. Disentangling genetic vs. environmental causes of sex determination in the common frog, Rana temporaria

    OpenAIRE

    Merilä Juha; Miura Ikuo; Matsuba Chikako

    2008-01-01

    Abstract Background Understanding of sex ratio dynamics in a given species requires understanding its sex determination system, as well as access for reliable tools for sex identification at different life stages. As in the case of many other amphibians, the common frogs (Rana temporaria) do not have well differentiated sex chromosomes, and an identification of individuals' genetic sex may be complicated by sex reversals. Here, we report results of studies shedding light on the sex determinat...

  19. Dynamics of testis-ova in a wild population of Japanese pond frogs, Rana nigromaculata.

    Science.gov (United States)

    Kobayashi, Tohru; Kumakura, Masahiko; Yoshie, Sumio; Sugishima, Tomomi; Horie, Yoshifumi

    2015-02-01

    Although many studies have reported the occurrence of testis-ova in wild frog populations, the origin and trigger of testis-ova differentiation/development remain unclear. A high frequency of testis-ova has been previously reported for wild populations of the Japanese pond frog, Rana nigromaculata (cf. Iwasawa and Asai, '59). In the present study, we aimed to clarify the dynamics of testis-ova in this frog species, including the origin and artificial induction of testis-ova. Testis-ova were observed in both mature frogs and puberty-stage frogs (i.e., 0- and 1-year-old frogs). However, the early stages of testis-ova (~pachytene stage) were mostly observed in puberty-stage male frogs at the onset of spermatogenesis. The early stages of testis-ova were observed in the cysts of early secondary spermatogonia and the single cysts of the primary spermatogonium. This finding indicates that testis-ova differentiation occurs during spermatogonial proliferation and that it is correlated with the initiation of spermatogenesis. We also examined whether estrogen exposure induced testis-ova differentiation and how it is correlated with the progression of spermatogenesis. When 1-year-old frogs were exposed to estradiol-17β during spring (i.e., when spermatogenesis was initiated), testis-ova differentiation was induced in a dose-dependent manner. However, this phenomenon did not occur in 1-year-old frogs during summer, (i.e., when the transition from spermatogonia to spermatocytes mainly occurs). These results present the first evidence that testis-ova of the Japanese pond frog are derived from primary and early secondary spermatogonia, and that estrogen exposure induces testis-ova differentiation accompanied by the initiation of spermatogenesis.

  20. Behavioral Responses of Northern Leopard Frogs (Rana pipiens to Roads and Traffic: Implications for Population Persistence

    Directory of Open Access Journals (Sweden)

    Julie Bouchard

    2009-12-01

    Full Text Available A key goal in road ecology is to determine which species are most vulnerable to the negative effects of roads on population persistence. Theory suggests that species that avoid roads are less likely to be negatively affected by roads than those that do not avoid roads. The goal of this study was to take a step toward testing this prediction by evaluating the behavioral response to roads and traffic of a species whose populations are known to be negatively affected by roads and traffic, the northern leopard frog (Rana pipiens. We studied the movement patterns of northern leopard frogs during their spring migration from overwintering sites in a river to various breeding ponds that were disconnected from the river by roads. We performed short-distance translocations of migrating frogs, followed them visually, and documented their movement coordinates following each hop, both near the roads and in non-roaded areas. We found that frogs took longer to move near roads with more traffic and that their movement was quickest in areas without roads nearby. Frogs tended to deviate more from a straight-line course when they were released near roads than compared with control areas, but this response was independent of traffic volume. All frogs released near roads attempted to cross the road. On very low traffic roads (10.86 mean vehicles per hour, 94% of frogs crossed the road successfully, whereas at higher traffic roads (58.29 mean vehicles per hour 72% were successful. Our results suggest that frog's inability to avoid going onto roads and their slow movement combine to make them particularly vulnerable to road mortality, which likely explains the strong negative effects of roads on frog population abundance. Conservation efforts should focus on preventing frogs from accessing the road surface through the use of drift fencing and culverts.

  1. Columbia spotted frog (Rana luteiventris) in southeastern Oregon: A survey of historical localities, 2009

    Science.gov (United States)

    Pearl, Chistopher A.; Galvan, Stephanie K.; Adams, Michael J.; McCreary, Brome

    2010-01-01

    The Columbia spotted frog (Rana luteiventris) occupies a large range in western North America and is comprised of at least three genetic units. Concern exists regarding the status of the Great Basin populations in Oregon, Idaho, and Nevada. We surveyed target and nearby alternate sites on public lands in southeastern Oregon where there was evidence that Columbia spotted frogs were historically present. We found the species at 59.5 percent (25 of 42) of target or nearby alternate sites. They were in 15 of 23 permanent streams and 8 of 13 intermittent streams. Our surveys do not provide evidence of widespread population losses in our sites. Interpretation of status of Columbia spotted frogs in this study is limited by a lack of precision in some of the historical locations and by our inability to determine if locations where only adults were indicated in the historical record once had breeding populations. Our results support the need for continued investigation of these populations.

  2. Range-wide phylogeographic analysis of the spotted frog complex (Rana luteiventris and Rana pretiosa) in northwestern North America

    Science.gov (United States)

    Funk, W.C.; Pearl, C.A.; Draheim, H.M.; Adams, M.J.; Mullins, T.D.; Haig, S.M.

    2008-01-01

    The dynamic geological and climatic history of northwestern North America has made it a focal region for phylogeography. We conducted a range-wide phylogeographic analysis of the spotted frog complex (Rana luteiventris and Rana pretiosa) across its range in northwestern North America to understand its evolutionary history and the distribution of clades to inform conservation of R. pretiosa and Great Basin R. luteiventris, candidates for listing under the US Endangered Species Act. Mitochondrial DNA sequence data from a segment of the cytochrome b gene were obtained from 308 R. luteiventris and R. pretiosa from 96 sites. Phylogenetic analysis revealed one main R. pretiosa clade and three main R. luteiventris clades, two of which overlapped in southeastern Oregon. The three R. luteiventris clades were separated from each other by high levels of sequence divergence (average of 4.75-4.97%). Two divergent clades were also uncovered within the Great Basin. Low genetic variation in R. pretiosa and the southeastern Oregon clade of R. luteiventris suggests concern about their vulnerability to extinction. ?? 2008 Elsevier Inc.

  3. Frogs on the beach: Ecology of California Red-legged Frogs (Rana draytonii) in coastal dune drainages

    Science.gov (United States)

    Halstead, Brian J.; Kleeman, Patrick M.

    2017-01-01

    California Red-legged Frogs (Rana draytonii) are typically regarded as inhabitants of permanent ponds, marshes, and slow-moving streams, but their ecology in other habitats, such as drainages among coastal dunes, remains obscure. Because coastal dune ecosystems have been degraded by development, off-highway vehicle use, stabilization, and invasive species, these unique ecosystems are the focus of restoration efforts. To better understand the ecology of California Red-legged Frogs in coastal dune ecosystems and to avoid and minimize potential negative effects of dune restoration activities on these rare frogs, we studied their spatial ecology, habitat selection, and survival in coastal dune drainages at Point Reyes National Seashore, California, USA. All 22 radio-marked frogs remained in their home drainages throughout the spring and summer of 2015 and, with some notable exceptions, most remained close to water. Local convex hull home ranges of four out of five California Red-legged Frogs with > 20 observations in dunes were < 1,600 m2 . At the population level, frogs were 1.7 (95% credible interval, 1.2‒4.4) times more likely to select sites 1 m closer to water, and were 83 (2.0‒17,000) times more likely to select sites with 10% greater percentage cover of logs that served as refuges from environmental extremes and predators. On average, California Red-legged Frogs avoided the invasive plants Iceplant (Carpobrotus edulis) and European Beachgrass (Ammophila arenaria). Frogs were 0.68 (0.32‒0.89) and 0.55 (0.24‒0.75) times as likely to select areas that had 10% greater cover of these plants, respectively. Assuming constant risk of mortality, California Redlegged Frogs had an annual survival rate of 0.70 (0.27‒0.96) in coastal dune drainages. Our results indicate that coastal dune drainages provide a locally important habitat for California Red-legged Frogs. Restoration practices that maintain wetted drainages with logjams are likely to benefit California

  4. California red-legged frog (Rana draytonii) movement and habitat use: Implications for conservation

    Science.gov (United States)

    Fellers, G.M.; Kleeman, P.M.

    2007-01-01

    Nonbreeding habitats are critically important for Rana draytonii, especially for individuals that breed in temporary bodies of water. We radiotracked 123 frogs to evaluate seasonal habitat use. Individual frogs were continuously tracked for up to 16 months. Some individuals remained at breeding ponds all year, but 66% of female and 25% of male frogs moved to nonbreeding areas, even when the breeding site retained water. Frogs at our main study site moved 150 m (median), roughly the distance to the nearest suitable nonbreeding area. The greatest straight-line distance traveled was 1.4 km, although the presumed distance traveled was 2.8 km. Females were more likely than males to move from permanent ponds (38% of females, 16% of males), but among dispersing frogs, males and females did not differ in distance moved. Some frogs left breeding sites shortly after oviposition (median = 12 days for females, 42.5 days for males), but many individuals remained until the site was nearly dry. Fog provided moisture for dispersal or migration throughout the summer. Our data demonstrate that maintaining populations of pond-breeding amphibians requires that all essential habitat components be protected; these include (1) breeding habitat, (2) nonbreeding habitat, and (3) migration corridors. In addition, a buffer is needed around all three areas to ensure that outside activities do not degrade any of the three habitat components. Copyright 2007 Society for the Study of Amphibians and Reptiles.

  5. Acute Toxicity of a Heavy Metal Cadmium to an Anuran, the Indian Skipper Frog Rana cyanophlyctis

    Directory of Open Access Journals (Sweden)

    Ajai Kumar Srivastav

    2016-08-01

    Full Text Available Background: There has been increasing awareness throughout the world regarding the remarkable decrease in amphibian population. For such amphibian population decline several causes have been given. Cadmium, a heavy metal is released both from natural sources (leaching of cadmium rich soils and anthropogenic activities to the aquatic and terrestrial environments. This study evaluated the toxicity of heavy metal cadmium to Indian skipper frog Rana cyanophlyctis. Methods: For the determination of LC50 values for cadmium, four-day static renewal acute toxicity test was used. Five replicates each containing ten frogs were subjected to each concentration of cadmium chloride (15, 20, 25, 30, 35, 40, 45 and 50 mg/L. At different exposure periods (24, 48, 72 and 96 h, the mortality of the frog was subjected to Probit analysis with the POLO-PC software (LeOra Software to calculate the LC50 and 95% confidence level. Results: The LC50 values of cadmium chloride for the frog R. cyanophlyctis at 24, 48, 72, and 96 h are 32.586, 29.994, 27.219 and 23.048 mg/L, respectively. The results have been discussed with the toxicity reported for other aquatic vertebrate --fish. Conclusion: Cadmium caused mortality to the frog and this could be one of the reasons for population decline of frogs which inhabit water contaminated with heavy metals.

  6. Rana

    DEFF Research Database (Denmark)

    Jørgensen, Søren Vissing

    The aim of this work is the development of an open-source software tool, Rana, which enables real-time constrained simulation of multi-agent systems. Multi-agent systems research is a branch in the field of AI where focus is not on single agents, but rather on the emergent properties that arises...... from societies of agents. Rana represents the event driven simulation. This means that it has a focus on representation of perceivable agent actions, called events. The Rana event is a flexible information construct that can be set to propagate across the environment in simulated physical time. Rana......'s modelling paradigm offers flexible design of agent behaviour, which allows for separation of behavioural definitions for event handling and internal agent actions, both of which can be constrained by a real-time precision level. Each agent has a number af Rana specific modules at its disposal, these enable...

  7. Surveys for presence of Oregon spotted frog (Rana pretiosa): background information and field methods

    Science.gov (United States)

    Pearl, Christopher A.; Clayton, David; Turner, Lauri

    2010-01-01

    The Oregon spotted frog (Rana pretiosa) is the most aquatic of the native frogs in the Pacific Northwest. The common name derives from the pattern of black, ragged-edged spots set against a brown or red ground color on the dorsum of adult frogs. Oregon spotted frogs are generally associated with wetland complexes that have several aquatic habitat types and sizeable coverage of emergent vegetation. Like other ranid frogs native to the Northwest, Oregon spotted frogs breed in spring, larvae transform in summer of their breeding year, and adults tend to be relatively short lived (3-5 yrs). Each life stage (egg, tadpole, juvenile and adult) has characteristics that present challenges for detection. Breeding can be explosive and completed within 1-2 weeks. Egg masses are laid in aggregations, often in a few locations in large areas of potential habitat. Egg masses can develop, hatch, and disintegrate in <2 weeks during warm weather. Tadpoles can be difficult to identify, have low survival, and spend most of their 3-4 months hidden in vegetation or flocculant substrates. Juveniles and adults are often difficult to capture and can spend summers away from breeding areas. Moreover, a substantial portion of extant populations are of limited size (<100 breeding adults), and field densities of all life stages are often low. An understanding of the biology of the species and use of multiple visits are thus important for assessing presence of Oregon spotted frogs. This report is meant to be a resource for USDA Region 6 Forest Service (FS) and OR/WA Bureau of Land Management (BLM) personnel tasked with surveying for the presence of Oregon spotted frogs. Our objective was to summarize information to improve the efficiency of field surveys and increase chances of detection if frogs are present. We include overviews of historical and extant ranges of Oregon spotted frog. We briefly summarize what is known of Oregon spotted frog habitat associations and review aspects of behavior and

  8. Complete mitochondrial genome of the Seoul frog Rana chosenica (Amphibia, Ranidae): comparison of R. chosenica and R. plancyi.

    Science.gov (United States)

    Ryu, Shi Hyun; Hwang, Ui Wook

    2011-06-01

    Here, we have sequenced the complete mitochondrial genome of the Seoul frog Rana chosenica (Amphibia, Ranidae), which is known as a Korean endemic species. It is listed as a vulnerable species by IUCN Red List and also an endangered species in South Korea. The complete mitochondrial genome of R. chosenica consists of 18,357 bp. Its gene arrangement pattern was identical with those of other Rana frogs. We compared the mitochondrial genome of R. chosenica with that of the Peking frog Rana plancyi that has been known closely related to R. chosenica. Nucleotide sequence similarity between the two whole mitochondrial genomes was 95.7%, and the relatively low similarity seems to indicate that the two species are distinctly separated on the species level. The information of mitochondrial genome comparison of the two species was discussed in detail.

  9. Diversity and phylogeography of Northeast Asian brown frogs allied to Rana dybowskii (Anura, Ranidae).

    Science.gov (United States)

    Yang, Bao-Tian; Zhou, Yu; Min, Mi-Sook; Matsui, Masafumi; Dong, Bing-Jun; Li, Pi-Peng; Fong, Jonathan J

    2017-07-01

    We investigated the species diversity and phylogeography of the Northeast Asian brown frogs allied to Rana dybowskii (the R. dybowskii species complex: R. dybowskii, R. pirica, and R. uenoi) using four mitochondrial and three nuclear loci. Phylogenetic analyses confirmed the existence of three distinct species in this complex; using extensive molecular data, we confirm the validity of Rana uenoi recognized as a distinct species, and infer R. dybowskii and R. pirica to be sister species. Also, we included populations from previously unsampled regions in Northeast China, and identified them to be R. dybowskii. While many species in Northeast Asia diverged due to Pleistocene glaciation, divergence-dating analyses inferred older, Miocene speciation in the R. dybowskii species complex. Ancestral area reconstruction identified the orogenic movement of the Changbai Mountain Range and the opening of the Sea of Japan/East Sea being major events influencing allopatric speciation. Copyright © 2017 Elsevier Inc. All rights reserved.

  10. Redescription of the Frog Bladder Fluke Gorgoderina attenuata from the Northern Leopard Frog, Rana pipiens

    National Research Council Canada - National Science Library

    Matthew G. Bolek; Scott D. Snyder; John Janovy Jr

    2009-01-01

    .... Morphological comparisons between gravid G. attenuata recovered from bullfrogs and northern leopard frogs indicated statistically significant differences in 11 of 28 morphological characters examined...

  11. Characteristics of Columbia spotted frog (Rana luteiventris) oviposition sites in northeastern Oregon, USA

    Science.gov (United States)

    Pearl, C.A.; Adams, M.J.; Wente, W.H.

    2007-01-01

    Several western ranid frogs possess a unique strategy of breeding communally over a short temporal window and reusing oviposition sites between years. However, little is published on the characteristics of oviposition sites selected by these explosive breeders. The Columbia spotted frog (Rana luteiventris) is native to northwestern North America and is of conservation concern in the southern portions of its range. As part of a study examining relationships between livestock grazing and R. luteiventris habitat, we assessed characteristics of the species' oviposition sites in 25 fishless ponds in northeastern Oregon. Oviposition sites were generally in shallow water (<25 cm) close to shore and tended to be in the northeastern portion of ponds. Oviposition sites were found more frequently over heavily vegetated substrates and in areas of less substrate slope and shade than random points in littoral zones. We did not quantify temperature differences within ponds, but the patterns we documented are consistent with preferential use of warmer microhabitats for oviposition.

  12. Modelling the impact of roads on regional population of Moor frogs (Rana arvalis)

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt

    as well as on how habitat quality is affected by patch structure. Although fragmentation is generally thought to have negative effects on connectivity, the results suggest that, depending on patch structure and habitat quality, positive effects on connectivity may occur. The second manuscript uses a light...... for decisions concerning road lay-out and mitigation measures. As model species was chosen the Moor frog (Rana arvalis). Populations of Moor frogs are assumed to follow a pattern of metapopulation dynamics, with colonisation, extinction and recolonisation of suitable habitat patches. Thus, road constructions...... must be expected to have implication on both local and regional persistence; the former due to habitat destruction, the latter because of disrupted dispersal between subpopulations due to barrier effects. The result of the project was the development of the model presented in this thesis. The model...

  13. Rangewide phylogeography of the western U.S. endemic frog Rana boylii (Ranidae): Implications for the conservation of frogs and rivers

    Science.gov (United States)

    A.J. Lind; H.B. Shaffer; P.Q. Spinks; G.M. Fellers

    2011-01-01

    Genetic data are increasingly being used in conservation planning for declining species. We sampled both the ecological and distributional limits of the foothill yellow-legged frog, Rana boylii to characterize mitochondrial DNA (mtDNA) variation in this declining, riverine amphibian. We evaluated 1525 base pairs (bp) of cytochrome b...

  14. Clinal patterns in genetic variation for northern leopard frog (Rana pipiens): Conservation status and population histories

    Science.gov (United States)

    Stockwell, Craig A.; Fisher, Justin D.L.; McLean, Kyle I.

    2016-01-01

    The security of the northern leopard frog (Rana pipiens) varies spatially with populations east and west of North Dakota considered as secure and at risk, respectively. We used genetic markers to characterize the conservation status of northern leopard frog populations across North Dakota. We used multiple regression analyses and model selection to evaluate correlations of expected heterozygosity (HE) with the direct and additive effects of: i) geographic location,ii) wetland density and iii) average annual precipitation. There was lower genetic diversity in the western portion of the state due to lower levels of diversity for populations southwest of the Missouri River. This may reflect a refugial/colonization signature for the only non-glaciated area of North Dakota. Genetic diversity was also positively associated with wetland densities which is consistent with the reliance of this species on a mosaic of wetlands. Our findings suggest that populations in the southwestern part of North Dakota are of higher conservation concern, a finding consistent with the higher risk noted for northern leopard frog populations in most states west of North Dakota. Our findings also pose the hypothesis that climate change induced changes in wetland densities will reduce genetic diversity of northern leopard frog populations.

  15. BIOMETRIC STUDY TO RANA RIDIBUNDA FROG SPECIES NEARNESS TO TIMISOARA LOCALITY

    Directory of Open Access Journals (Sweden)

    M. BURA

    2013-12-01

    Full Text Available Speciality literature provides little informations regarding Rana ridibunda frogbiometry. For supply this gap we studied the size and weight of 54 frogs sampled fromnearby Timişoara area ponds.The mean body lenght was 8,08 ± 0,54 cm for the females and respectively 6,17 ± 0,45cm for the males. Before evisceration on a par females weighted 62,28 ± 12,87 g andthe males 22,46 ± 5,3 g whereas after this action the carcase weighted 43,89 ± 8,91 gin the case of females and respectively 18,45 ± 4,42 g in the case of male lake frog. Themean leg lenght measured 12,59 ± 0,68 cm for female frogs and 9,78 ± 0,66 cm in thecase of male frogs. The hind stylopodium was estimated on a par as 13,23 ± 2,57 g forfemales and 5,33 ± 1,26 g for the males.

  16. Receptor-mediated endocytosis of lysozyme in renal proximal tubules of the frog Rana temporaria

    Directory of Open Access Journals (Sweden)

    E.V. Seliverstova

    2015-04-01

    Full Text Available The mechanism of protein reabsorption in the kidney of lower vertebrates remains insufficiently investigated in spite of raising interest to the amphibian and fish kidneys as a useful model for physiological and pathophysiological examinations. In the present study, we examined the renal tubular uptake and the internalization rote of lysozyme after its intravenous injection in the wintering frog Rana temporaria using immunohisto- and immunocytochemistry and specific markers for some endocytic compartments. The distinct expression of megalin and cubilin in the proximal tubule cells of lysozyme-injected frogs was revealed whereas kidney tissue of control animals showed no positive immunoreactivity. Lysozyme was detected in the apical endocytic compartment of the tubular cells and colocalized with clathrin 10 min after injection. After 20 min, lysozyme was located in the subapical compartment negative to clathrin (endosomes, and intracellular trafficking of lysozyme was coincided with the distribution of megalin and cubilin. However, internalized protein was retained in the endosomes and did not reach lysosomes within 30 min after treatment that may indicate the inhibition of intracellular trafficking in hibernating frogs. For the first time, we provided the evidence that lysozyme is filtered through the glomeruli and absorbed by receptor-mediated clathrin-dependent endocytosis in the frog proximal tubule cells. Thus, the protein uptake in the amphibian mesonephros is mediated by megalin and cubilin that confirms a critical role of endocytic receptors in the renal reabsorption of proteins in amphibians as in mammals.

  17. Effects of habitat fragmentation and road density on the distribution pattern of the moor frog Rana arvalis.

    NARCIS (Netherlands)

    Vos, C.C.; Chardon, P.

    1998-01-01

    1. The effects of habitat fragmentation on the distribution pattern of the moor frog Rana arvalis were investigated. Also, the possible isolation effects of the road network were taken into account. 2. Indications were found that habitat fragmentation partly explains the distribution pattern of the

  18. Effects of environmental and natural estrogens on vitellogenin production in hepatocytes of the brown frog (Rana temporaria)

    NARCIS (Netherlands)

    Rouhani Rankouhi, T.; Sanderson, J.T.; Holsteijn, van I.; Kooten, van P.; Bosveld, A.T.C.; Berg, van den M.

    2005-01-01

    The objective of this study was to investigate the ability of the natural estrogens and synthetic estrogens as well as the estrogen mimics to induce estrogen-receptor mediated vitellogenesis in primary hepatocytes of the brown frog (Rana temporaria). Based on EC50 values the following order was dete

  19. Water velocity tolerance in tadpoles of the foothill yellow-legged frog (Rana boylii): Swimming performance, growth, and survival

    Science.gov (United States)

    S. Kupferberg; A. Lind; V. Thill; S. Yarnell

    2011-01-01

    We explored the effects of large magnitude flow fluctuations in rivers with dams, commonly referred to as pulsed flows, on tadpoles of the lotic-breeding Foothill Yellow-legged Frog, Rana boylii. We quantified the velocity conditions in habitats occupied by tadpoles and then conducted experiments to assess the tolerance to values at the upper limit...

  20. Effects of habitat fragmentation and road density on the distribution pattern of the moor frog Rana arvalis.

    NARCIS (Netherlands)

    Vos, C.C.; Chardon, P.

    1998-01-01

    1. The effects of habitat fragmentation on the distribution pattern of the moor frog Rana arvalis were investigated. Also, the possible isolation effects of the road network were taken into account. 2. Indications were found that habitat fragmentation partly explains the distribution pattern of the

  1. A new species of leopard frog (Anura: Ranidae) from the urban northeastern US.

    Science.gov (United States)

    Newman, Catherine E; Feinberg, Jeremy A; Rissler, Leslie J; Burger, Joanna; Shaffer, H Bradley

    2012-05-01

    Past confusion about leopard frog (genus Rana) species composition in the Tri-State area of the US that includes New York (NY), New Jersey (NJ), and Connecticut (CT) has hindered conservation and management efforts, especially where populations are declining or imperiled. We use nuclear and mitochondrial genetic data to clarify the identification and distribution of leopard frog species in this region. We focus on four problematic frog populations of uncertain species affiliation in northern NJ, southeastern mainland NY, and Staten Island to test the following hypotheses: (1) they are conspecific with Rana sphenocephala or R. pipiens, (2) they are hybrids between R. sphenocephala and R. pipiens, or (3) they represent one or more previously undescribed cryptic taxa. Bayesian phylogenetic and cluster analyses revealed that the four unknown populations collectively form a novel genetic lineage, which represents a previously undescribed cryptic leopard frog species, Rana sp. nov. Statistical support for R. sp. nov. was strong in both the Bayesian (pp=1.0) and maximum-likelihood (bootstrap=99) phylogenetic analyses as well as the Structure cluster analyses. While our data support recognition of R. sp. nov. as a novel species, we recommend further study including fine-scaled sampling and ecological, behavioral, call, and morphological analyses before it is formally described.

  2. [Bio-acoustic investigations in the green frog, rana esculenta (L.)].

    Science.gov (United States)

    Wahl, Manfred

    1969-07-01

    1. At a pond near Tübingen, West-Germany, the calling period of the green frog, Rana esculenta, lasts for a period ranging from the middle to the end of April, to the beginning to the end of July. The calling period is parted because of two changes in the behavior of calling and the changing number of the calling groups in: pre spawning period, spawning period and post spawning period. 2. Male frogs form calling groups. The males of each group cry in a rhythmic chorus. 3. The calling activity is influenced by 3 external factors, weather, water temperature and temperature of the air. The dependance of calling activity by these factors is not linear. During a period of good weather the calling activity increases daily. During a period of bad weather there is a daily decrease. The highest calling activity is on sunny days with a water temperature of between 17.5 and 22°C plus or minus 1 degree. From this level the activity falls with decreasing or increasing water temperature asymptotic to zero. The lower limit of calling activity ranges from 10 to 12°C, the upper one by 36.5 plus or minus 0.5°C. With the growing increase of air temperature the number of calls per time period falls asymptotic to zero. 4. The male green frog emits 6 calls; one mating call, two territorial calls, two release calls and one distress call. The calls consist of impulses, which, in the case of the mating call, are arranged to characteristic impulse-groups. The female green frog also emits calls, but no mating calls. 5. The parameters of mating and territorial calls are influenced by the water temperature. With increasing water temperature the duration of calls decreases linear, on the other hand the sequence of impulses and the repetition rate of impulse-groups show a positive linear regression. Also the size of the frog influences the calling parameters. With the increase of body length the duration of mating calls and territorial calls decreases and the sequence of impulses increases

  3. Widespread occurrence of the chytrid fungus batrachochytrium dendrobatidis on oregon spotted frogs (rana pretiosa)

    Science.gov (United States)

    Pearl, C.A.; Bowerman, J.; Adams, M.J.; Chelgren, N.D.

    2009-01-01

    The pathogen Batrachochytrium dendrobatidis (Bd) has been associated with amphibian declines in multiple continents, including western North America. We investigated Bd prevalence in Oregon spotted frog (Rana pretiosa), a species that has declined across its range in the Pacific Northwest. Polymerase chain reaction analysis of skin swabs indicated that Bd was prevalent within populations (420 of 617 juvenile and adults) and widespread among populations (36 of 36 sites) where we sampled R. pretiosa in Oregon and Washington. We rarely detected Bd in R. pretiosa larvae (2 of 72). Prevalence of Bd in postmetamorphic R. pretiosa was inversely related to frog size. We found support for an interactive effect of elevation and sampling date on Bd: prevalence of Bd generally increased with date, but this effect was more pronounced at lower elevations. We also found evidence that the body condition of juvenile R. pretiosa with Bd decreased after their first winter. Our data indicate that some Oregon spotted frog populations are currently persisting with relatively high Bd prevalence, but the risk posed by Bd is unknown. ?? 2010 International Association for Ecology and Health.

  4. Population structure of Columbia spotted frogs (Rana luteiventris) is strongly affected by the landscape

    Science.gov (United States)

    Funk, W.C.; Blouin, M.S.; Corn, P.S.; Maxell, B.A.; Pilliod, D.S.; Amish, S.; Allendorf, F.W.

    2005-01-01

    Landscape features such as mountains, rivers, and ecological gradients may strongly affect patterns of dispersal and gene flow among populations and thereby shape population dynamics and evolutionary trajectories. The landscape may have a particularly strong effect on patterns of dispersal and gene flow in amphibians because amphibians are thought to have poor dispersal abilities. We examined genetic variation at six microsatellite loci in Columbia spotted frogs (Rana luteiventris) from 28 breeding ponds in western Montana and Idaho, USA, in order to investigate the effects of landscape structure on patterns of gene flow. We were particularly interested in addressing three questions: (i) do ridges act as barriers to gene flow? (ii) is gene flow restricted between low and high elevation ponds? (iii) does a pond equal a 'randomly mating population' (a deme)? We found that mountain ridges and elevational differences were associated with increased genetic differentiation among sites, suggesting that gene flow is restricted by ridges and elevation in this species. We also found that populations of Columbia spotted frogs generally include more than a single pond except for very isolated ponds. There was also evidence for surprisingly high levels of gene flow among low elevation sites separated by large distances. Moreover, genetic variation within populations was strongly negatively correlated with elevation, suggesting effective population sizes are much smaller at high elevation than at low elevation. Our results show that landscape features have a profound effect on patterns of genetic variation in Columbia spotted frogs.

  5. Disentangling genetic vs. environmental causes of sex determination in the common frog, Rana temporaria.

    Science.gov (United States)

    Matsuba, Chikako; Miura, Ikuo; Merilä, Juha

    2008-01-08

    Understanding of sex ratio dynamics in a given species requires understanding its sex determination system, as well as access for reliable tools for sex identification at different life stages. As in the case of many other amphibians, the common frogs (Rana temporaria) do not have well differentiated sex chromosomes, and an identification of individuals' genetic sex may be complicated by sex reversals. Here, we report results of studies shedding light on the sex determination system and sex ratio variation in this species. A microsatellite locus RtSB03 was found to be sex-linked in four geographically disparate populations, suggesting male heterogamy in common frogs. However, in three other populations examined, no or little evidence for sex-linkage was detected suggesting either ongoing/recent recombination events, and/or frequent sex-reversals. Comparison of inheritance patterns of alleles in RtSB03 and phenotypic sex within sibships revealed a mixed evidence for sex-linkage: all individuals with male phenotype carried a male specific allele in one population, whereas results were more mixed in another population. These results make sense only if we assume that the RtSB03 locus is linked to male sex determination factor in some, but not in all common frog populations, and if phenotypic sex-reversals - for which there is earlier evidence from this species - are frequently occurring.

  6. Polychlorinated biphenyls, sex steroid hormones and liver retinoids in adult male European common frogs Rana temporaria.

    Science.gov (United States)

    Mikkelsen, Mattis; Jenssen, Bjørn Munro

    2006-05-01

    Declines in amphibian populations and species biodiversity during the last decades has called for an assessment of possible threats to these animals. Polychlorinated biphenyls (PCBs) are known endocrine disrupting contaminants and are found in high levels in some populations of wild living amphibians. To evaluate the endocrine disrupting potential of PCBs in adult frogs, Aroclor 1,254 were subcutaneously injected into male European common frogs Rana temporaria. The injected doses ranged from 0.01 to 100 mg/kg body mass, resulting in liver concentrations between 74 and 133,619 microg/kg ww. After 14 days, serum testosterone (T), estradiol (E) and hepatic retinol (R) and retinylpalmitate (RP) were easured. No dose dependent effects were found on levels of hormones or retinoids. However, a significantly higher within-group variation in the E-T ratio in the exposed groups may indicate that the sex-hormone homeostasis of male R. temporaria is affected by PCBs shortly after arousal from hibernation, but that the effects are subtle and that several different mechanisms are involved. The lack of direct effect on T, E, R and RP may be due to the timing of exposure (shortly after arousal from hibernation), or due to a relatively short exposure time to Aroclor 1,254. Based on the results, we propose that future research should focus on effects of PCBs in relation to the different physiological phases frogs experience throughout the year (hibernation, reproduction etc.).

  7. Neuronal intermediate filaments in the developing tongue of the frog Rana esculenta

    Directory of Open Access Journals (Sweden)

    K Zuwala

    2009-06-01

    Full Text Available The expression of several neuronal intermediate filament (NIF proteins was investigated in the tongue of metamorphosing tadpoles (stage 38-45 of Gosner and in adult individuals of the frog, Rana esculenta by means of immunohistochemistry. Results showed that nerve fibres at early stages of tongue development expressed peripherin (a NIF protein usually found in differentiating neurones as well as the light- and medium molecular weight NIF polypeptide subunits (NF-L and NF-M, respectively; in the adult frog, peripherin was still found in nerve fibres reaching the fungiform papilla together with NF-M, but NF-L immunoreactivity was absent therein. Clusters of epithelial cells expressing peripherin were found in the early developing tongue before differentiation of taste organs, and NF-L and NF-H immunoreactivities were present in basal (Merkel cells of the adult frog taste disc. Results indicate that neurones innervating the adult frog’s taste disc maintain a certain plasticity in their cytoskeleton and that neuronal-like cells are present in the undifferentiated and differentiated tongue epithelium possibly playing a role in the developing and mature taste organ.

  8. Antimicrobial peptides with atypical structural features from the skin of the Japanese brown frog Rana japonica.

    Science.gov (United States)

    Isaacson, Todd; Soto, AnaMaria; Iwamuro, Shawichi; Knoop, Floyd C; Conlon, J Michael

    2002-03-01

    Japonicin-1 (FFPIGVFCKIFKTC) and japonicin-2 (FGLPMLSILPKALCILLKRKC), two peptides with differential growth-inhibitory activity against the Gram-negative bacterium, Escherichia coli and the Gram-positive bacterium Staphylococcus aureus, were isolated from an extract of the skin of the Japanese brown frog Rana japonica. Both peptides show little amino acid sequence similarity to previously characterized antimicrobial peptides isolated from the skins of Ranid frogs. Circular dichroism studies, however, demonstrate that japonicin-2 adopts an alpha-helical conformation in 50% trifluoroethanol in common with many other cationic antimicrobial peptides synthesized in amphibian skin. Peptides belonging to the brevinin-1, brevinin-2, and tigerinin families, previously identified in the skins of Asian Ranid frogs, were not detected but a temporin-related peptide (ILPLVGNLLNDLL.NH(2); temporin-1Ja), that atypically bears no net positive charge, was isolated from the extract. The minimum inhibitory concentrations (MICs) of the peptides against E. coli were japonicin-1, 30 microM; japonicin-2, 12 microM; and temporin-1Ja > 100 microM. The MICs against S. aureus were japonicin-1, > 100 microM; japonicin-2, 20 microM; and temporin-1Ja, > 100 microM.

  9. A Threshold Dosage of Testosterone for Female-to-Male Sex Reversal in Rana rugosa Frogs.

    Science.gov (United States)

    Oike, Akira; Kodama, Maho; Nakamura, Yoriko; Nakamura, Masahisa

    2016-10-01

    Androgens play a critical role in testicular differentiation in many species of vertebrates. While female-to-male sex reversal can be induced by testosterone (T) in some species of amphibians, the mechanism still remains largely unknown even at the histological level. In this study, we determined a threshold dosage of T to induce female-to-male sex reversal in the Japanese frog Rana (R.) rugosa. Tadpoles were allowed to metamorphose into frogs with T present in the rearing water. At 0.2 ng/mL T, female frogs formed tissue comprising a mixture of ovary and testis, the so-called ovotestis, the size of which was significantly smaller than the wild-type ovary. Histological changes occurring in the oocytes of T-treated ovaries induced oocyte degeneration in the masculinizing ovaries leading to their final disappearance. In parallel, many germ cells emerged in the cortex of the ovotestis and, later, in the medulla as well. RT-PCR analysis revealed upregulated expression of CYP17 and Dmrt1 but not 17βHSD in the ovotestis, and downregulation of Pat1a expression. Furthermore, immunohistology revealed CYP17-positive signals in the cortex of the masculinizing ovary, spreading throughout the whole area as the testis developed. These results indicate that oocytes are sensitive to T in the ovary of R. rugosa and that male-type germ cells expand in the masculinizing gonad (testis) contemporaneous with oocyte disappearance. © 2016 Wiley Periodicals, Inc.

  10. Disentangling genetic vs. environmental causes of sex determination in the common frog, Rana temporaria

    Directory of Open Access Journals (Sweden)

    Merilä Juha

    2008-01-01

    Full Text Available Abstract Background Understanding of sex ratio dynamics in a given species requires understanding its sex determination system, as well as access for reliable tools for sex identification at different life stages. As in the case of many other amphibians, the common frogs (Rana temporaria do not have well differentiated sex chromosomes, and an identification of individuals' genetic sex may be complicated by sex reversals. Here, we report results of studies shedding light on the sex determination system and sex ratio variation in this species. Results A microsatellite locus RtSB03 was found to be sex-linked in four geographically disparate populations, suggesting male heterogamy in common frogs. However, in three other populations examined, no or little evidence for sex-linkage was detected suggesting either ongoing/recent recombination events, and/or frequent sex-reversals. Comparison of inheritance patterns of alleles in RtSB03 and phenotypic sex within sibships revealed a mixed evidence for sex-linkage: all individuals with male phenotype carried a male specific allele in one population, whereas results were more mixed in another population. Conclusion These results make sense only if we assume that the RtSB03 locus is linked to male sex determination factor in some, but not in all common frog populations, and if phenotypic sex-reversals – for which there is earlier evidence from this species – are frequently occurring.

  11. Pathophysiology in mountain yellow-legged frogs (Rana muscosa during a chytridiomycosis outbreak.

    Directory of Open Access Journals (Sweden)

    Jamie Voyles

    Full Text Available The disease chytridiomycosis is responsible for declines and extirpations of amphibians worldwide. Chytridiomycosis is caused by a fungal pathogen (Batrachochytrium dendrobatidis that infects amphibian skin. Although we have a basic understanding of the pathophysiology from laboratory experiments, many mechanistic details remain unresolved and it is unknown if disease development is similar in wild amphibian populations. To gain a better understanding of chytridiomycosis pathophysiology in wild amphibian populations, we collected blood biochemistry measurements during an outbreak in mountain yellow-legged frogs (Rana muscosa in the Sierra Nevada Mountains of California. We found that pathogen load is associated with disruptions in fluid and electrolyte balance, yet is not associated with fluctuations acid-base balance. These findings enhance our knowledge of the pathophysiology of this disease and indicate that disease development is consistent across multiple species and in both laboratory and natural conditions. We recommend integrating an understanding of chytridiomycosis pathophysiology with mitigation practices to improve amphibian conservation.

  12. Description of a new brown frog from Tsushima Island, Japan (Anura: Ranidae: Rana).

    Science.gov (United States)

    Matsui, Masafumi

    2014-09-01

    Because all available evidence from allozymes, mtDNA sequences, and artificial hybridization suggests presence of high genetic differentiation between populations of East Asian brown frogs currently assigned to Rana dybowskii Günther, 1876, I compared morphological characters between specimens from Tsushima Island of Japan and Maritime territory of Russia. The population from Tsushima is slightly, but significantly different from R. dybowskii from Russia, including the holotype. I therefore consider the Tsushima population to be specifically distinct, and describe it as a new species R. uenoi. The new species also occurs in the Korean Peninsula and adjacent islands, but the distributional relationships with R. dybowskii are unclear, as detailed distribution in northern Korea is lacking.

  13. Variations of intestinal calcium absorption in adult frogs (Rana esculenta). Effect of lysine.

    Science.gov (United States)

    el Maraghi-Ater, H; Hourdry, J; Mesnard, J; Dupuis, Y

    1987-01-01

    Intestinal calcium absorption was investigated in an adult frog (Rana esculenta) by injecting a CaCl2 solution containing 45Ca into the lumen. The 45Ca absorption coefficient in the proximal loop was higher than in the distal loop, only when the CaCl2 solution was left for 4 h. This coefficient increased both in the proximal and distal loops when a 4-h treatment was substituted for a 1-h treatment. The coefficient increased in the whole intestine during the first 2 h of treatment (1 h: 21%; 2 h: 55%) and remained stable afterwards in our experimental conditions. The intestinal calcium absorption increase occurred early in the presence of L-lysine (100 mM), since the coefficient already reached its maximum value (52%) after a 1-h treatment.

  14. Oxidative stress induced in PCB 126-exposed northern leopard frogs, Rana pipiens

    Science.gov (United States)

    Huang, Y.-W.; Hoffman, D.J.; Karasov, W.H.

    2007-01-01

    Northern leopard frogs Rana pipiens exposed to PCB 126 (3,3',4,4',5-pentachlorobiphenyl) were examined for hepatic oxidative stress. In a dose-response study, northern leopard frogs were injected intraperitoneally with either PCB 126 in corn oil (0.2, 0.7, 2.3, or 7.8 mg/kg body weight) or corn oil alone. In a time-course study, frogs received 7.8 mg/kg or corn oil alone, and were examined at 1, 2, 3, and 4 wk after dosing. Hepatic concentrations of reduced glutathione (GSH), thiobarbituric acid-reactive substances (TBARS), and total sulfhydryls (total SH), as well as activities of glutathione peroxidase (GSH-P), GSSG reductase (GSSG-R), glucose-6-phosphate dehydrogenase (G-6-PDH), and glutathione S-transferase (GSH-S-T) were measured. In the dose-response experiment, few effects were apparent 1 wk after dosing. In the time-course experiment, significant changes were observed in the 7.8-mg/kg group at 2 wk or more posttreatment. Hepatic concentrations of GSH and TBARS were higher than in corresponding controls at wk 3 and 4; the activities of GSSG-R and GSH-S-T were higher than in controls at wk 2 and 4; and the activity of G-6-PDH was increased at wk 2 and 4. These data collectively indicate that altered glutathione metabolism and oxidative stress occurred and were indicative of both toxicity and induction of protective mechanisms in frogs exposed to PCB. A similar delay in response was reported in fish and may relate to lower metabolic rate and physiological reactions in ectothermic vertebrates

  15. Comparative microhabitat characteristics at oviposition sites of the California red-legged frog (Rana draytonii)

    Science.gov (United States)

    Alvarez, Jeff A.; Cook, David G.; Yee, Julie L.; van Hattem, Michael G.; Fong, Darren R.; Fisher, Robert N.

    2013-01-01

    We studied the microhabitat characteristics of 747 egg masses of the federally-threatened Rana draytonii (California red-legged frog) at eight sites in California. our study showed that a broad range of aquatic habitats are utilized by ovipositing R. draytonii, including sites with perennial and ephemeral water sources, natural and constructed wetlands, lentic and lotic hydrology, and sites surrounded by protected lands and nested within modified urban areas. We recorded 45 different egg mass attachment types, although the use of only a few types was common at each site. These attachment types ranged from branches and roots of riparian trees, emergent and submergent wetland vegetation, flooded upland grassland/ruderal vegetation, and debris. eggs were deposited in relatively shallow water (mean 39.7 cm) when compared to maximum site depths. We found that most frogs in artificial pond, natural creek, and artificial channel habitats deposited egg masses within one meter of the shore, while egg masses in a seasonal marsh averaged 27.3 m from the shore due to extensive emergent vegetation. Rana draytonii appeared to delay breeding in lotic habitats and in more inland sites compared to lentic habitats and coastal sites. eggs occurred as early as mid-december at a coastal artificial pond and as late as mid-April in an inland natural creek. We speculate that this delay in breeding may represent a method of avoiding high-flow events and/or freezing temperatures. Understanding the factors related to the reproductive needs of this species can contribute to creating, managing, or preserving appropriate habitat, and promoting species recovery.

  16. Cadmium-induced oxidative stress and apoptosis in the testes of frog Rana limnocharis

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Hangjun; Cai Chenchen; Shi Cailei; Cao Hui; Han Ziliu [Department of Environmental Sciences, Hangzhou Normal University, Xuelin Road 16, Xiasha Gaojiao Dongqu, Hangzhou, Zhejiang Province, 310036 (China); Jia Xiuying, E-mail: hznujiaxiuying@126.com [Department of Environmental Sciences, Hangzhou Normal University, Xuelin Road 16, Xiasha Gaojiao Dongqu, Hangzhou, Zhejiang Province, 310036 (China)

    2012-10-15

    Highlights: Black-Right-Pointing-Pointer Cd can cause vacuoles and deformity of the spermatogenic cells in the frog testes. Black-Right-Pointing-Pointer Cd can result in oxidative stress in the frog testes. Black-Right-Pointing-Pointer Cd can induce significantly increase of ROS contents triggered DNA damages in the frog testes. Black-Right-Pointing-Pointer Cd can cause apoptosis in the testes of male R. limnocharis. Black-Right-Pointing-Pointer Apoptosis by Cd in the frog testes is related to Caspase-3, Bax and Bcl-2 genes. - Abstract: This study explored the genetic damage induced by cadmium exposure in the testes of Rana limnocharis. Healthy adult frogs were exposed to 2.5, 5, 7.5, or 10 mg/L of cadmium solution for 14 days. The results showed that exposure to these concentrations increased the levels of reactive oxygen species and malondialdehyde content in the testes, clearly indicating a dose-effect relationship. Moreover, the same dosages of Cd{sup 2+} solution increased glutathione (reduced) content, with the values being significantly different from those observed in the control group (P < 0.01). The comet assay results demonstrated that the DNA damage rate, tail length, and tail moment of samples obtained from frogs exposed to 2.5-7.5 mg/L of cadmium solution significantly increased compared with those of samples obtained from the control group (P < 0.01). These findings suggest that cadmium can induce free radical generation, followed by lipid peroxidation and DNA damage. Ultrastructural observation revealed vacuoles in the spermatogenic cells, cell dispersion, incomplete cell structures, and deformed nucleoli. Moreover, cadmium exposure induced significant down-regulation of Bcl-2 expression and up-regulation of Bax and caspase-3 expressions. Taken together, these data indicate that cadmium can induce testicular cell apoptosis in R. limnocharis. Exploring the effects of cadmium on the mechanism of reproductive toxicity in amphibians will help provide a

  17. Short-term occupancy and abundance dynamics of the Oregon spotted frog (Rana pretiosa) across its core range

    Science.gov (United States)

    Adams, Michael J.; Pearl, Christopher A.; Mccreary, Brome; Galvan, Stephanie

    2014-01-01

    The Oregon spotted frog (Rana pretiosa) occupies only a fraction of its original range and is listed as Threatened under the Endangered Species Act. We surveyed 93 sites in a rotating frame design (2010–13) in the Klamath and Deschutes Basins, Oregon, which encompass most of the species’ core extant range. Oregon spotted frogs are declining in abundance and probability of site occupancy. We did not find an association between the probability that Oregon spotted frogs disappear from a site (local extinction) and any of the variables hypothesized to affect Oregon spotted frog occupancy. This 4-year study provides baseline data, but the 4-year period was too short to draw firm conclusions. Further study is essential to understand how habitat changes and management practices relate to the status and trends of this species.

  18. Seasonal Variation in the Hepatoproteome of the Dehydration- and Freeze-Tolerant Wood Frog, Rana sylvatica

    Directory of Open Access Journals (Sweden)

    Jon P. Costanzo

    2011-11-01

    Full Text Available Winter’s advent invokes physiological adjustments that permit temperate ectotherms to cope with stresses such as food shortage, water deprivation, hypoxia, and hypothermia. We used liquid chromatography (LC in combination with tandem mass spectrometry (MS/MS quantitative isobaric (iTRAQ™ peptide mapping to assess variation in the abundance of hepatic proteins in summer- and winter-acclimatized wood frogs (Rana sylvatica, a northerly-distributed species that tolerates extreme dehydration and tissue freezing during hibernation. Thirty-three unique proteins exhibited strong seasonal lability. Livers of winter frogs had relatively high levels of proteins involved in cytoprotection, including heat-shock proteins and an antioxidant, and a reduced abundance of proteins involved in cell proliferation, protein synthesis, and mitochondrial function. They also exhibited altered levels of certain metabolic enzymes that participate in the biochemical reorganization associated with aphagia and reliance on energy reserves, as well as the freezing mobilization and post-thaw recovery of glucose, an important cryoprotective solute in freezing adaptation.

  19. Prehibernation Energy Storage in Heilongjiang Brown Frogs (Rana amurensis) from Five Populations in North China

    Institute of Scientific and Technical Information of China (English)

    Wei CHEN; Tianpei GUAN; Lina REN; Dujuan HE; Ying WANG; Xin LU

    2015-01-01

    Energy storage is an important component in the life history of species that directly inlfuences survival and reproduction. The energetic demands of amphibian reproduction can differ between the sexes, with environmental conditions, reproductive pattern or process of the species, and depending upon the timing of breeding, and the reproductive season for a species. Surprisingly, comparative studies of pre-hibernation energy storage for anuran populations from different latitudes are relatively few in Asia, especially in China. Here we investigated the patterns of pre-hibernation energy storage of Heilongjiang brown frogsRana amurensis, based on ifve populations along a ifnely latitudinal gradient in north China (40.7–43.7°N). We found that pre-hibernation energy storage of the frogs did not show a clear latitudinal cline, but differed strongly between the sexes, with males depositing more energy reserves into the muscle and liver, whereas females accumulate more energy in the gonads. The sexual differences in energy storage may result from differential timing of energy allocation for reproduction.

  20. Highly complex mitochondrial DNA genealogy in an endemic Japanese subterranean breeding brown frog Rana tagoi (Amphibia, Anura, Ranidae).

    Science.gov (United States)

    Eto, Koshiro; Matsui, Masafumi; Sugahara, Takahiro; Tanaka-Ueno, Tomoko

    2012-10-01

    The endemic Japanese frog Rana tagoi is unique among Holarctic brown frogs in that it breeds in small subterranean streams. Using mitochondrial 16S ribosomal RNA and NADH dehydrogenase subunit 1 genes, we investigated genealogical relationships among geographic samples of this species together with its relative R. sakuraii, which is also a unique stream breeder. These two species together form a monophyletic group, within which both are reciprocally paraphyletic. Rana tagoi is divided into two major clades (Clade A and B) that are composed of 14 genetic groups. Rana sakuraii is included in Clade A and split into two genetic groups, one of which forms a clade (Subclade A-2) with sympatric R. tagoi. This species-level paraphyly appears to be caused by incomplete taxonomy, in addition to introgressive hybridization and/or incomplete lineage sorting. Rana tagoi strongly differs from other Japanese anurans in its geographic pattern of genetic differentiation, most probably in relation to its unique reproductive habits. Taxonomically, R. tagoi surely includes many cryptic species.

  1. Local adaptation with high gene flow: temperature parameters drive adaptation to altitude in the common frog (Rana temporaria)

    OpenAIRE

    2014-01-01

    Both environmental and genetic influences can result in phenotypic variation. Quantifying the relative contributions of local adaptation and phenotypic plasticity to phenotypes is key to understanding the effect of environmental variation on populations. Identifying the selective pressures that drive divergence is an important, but often lacking, next step. High gene flow between high- and low-altitude common frog (Rana temporaria) breeding sites has previously been demonstrated in Scotland. ...

  2. Experimental Repatriation of Mountain Yellow-legged Frogs (Rana muscosa) in the Sierra Nevada of California

    Science.gov (United States)

    Fellers, Gary M.; Bradford, David F.; Pratt, David; Wood, Leslie

    2008-01-01

    In the late 1970s, Rana muscosa (mountain yellow-legged frog) was common in the Tableland area of Sequoia National Park, California where it was possible to find hundreds of tadpoles and adults around many of the ponds and lakes. Surveys in 1993-1995 demonstrated that R. muscosa was absent from more than half of all suitable habitat within the park, including the Tableland area. At that same time, R. muscosa was still common at Sixty Lake Basin, Kings Canyon National Park, 30 km to the northeast. To evaluate the potential causes for the extirpation, we repatriated R. muscosa eggs, tadpoles, subadults, and adult frogs from Sixty Lake Basin to four sites in the Tableland area in 1994 and 1995. We subsequently surveyed each release site and the surrounding area 2 - 3 times per week in 1994-1995, and intermittently in 1996-1997, to monitor the survival of all life history stages, and to detect dispersal of adults and subadults. We also monitored predation, water quality, weather, and water temperature. Our techniques for capturing, holding, transporting, and releasing R. muscosa were refined during the study, and during 1995 resulted in high initial survival rates of all life history stages. Adult frogs were anaesthetized, weighed, measured, tagged, and held in plastic boxes with wet paper towels. Tadpoles were collected and held in fiberglass screen cages set in the water at the edge of a pond. This resulted in relatively natural conditions with less crowding and good water circulation. Frogs, tadpoles, and eggs were placed in Ziploc bags for transport to the Tableland by helicopter. Short-term survival of tadpoles, subadults, and adults was high at all four release sites, tadpoles reached metamorphosis, and adult frogs were still present. However, we detected no evidence of reproduction at three sites (e.g., no new eggs or small tadpoles) and nearly all life history stages disappeared within 12 months. At the fourth site, there was limited reproduction, but it was

  3. DDTs in rice frogs (Rana limnocharis) from an agricultural site, South China: tissue distribution, biomagnification, and potential toxic effects assessment.

    Science.gov (United States)

    Wu, Jiang-Ping; Zhang, Ying; Luo, Xiao-Jun; Chen, She-Jun; Mai, Bi-Xian

    2012-04-01

    Contamination with agricultural pesticides such as dichlorodiphenyltrichloroethane (DDT) and its metabolites, dichlorodiphenyldichloroethylene (DDE) and dichlorodiphenyldichloroethane (DDD), is among several proposed stressors contributing to the global declines in amphibian populations and species biodiversity. These chemicals were examined in insects and in the muscle, liver, and eggs of rice frogs (Rana limnocharis) from the paddy fields of an agricultural site in South China. The ΣDDT (sum of DDT, DDE, and DDD) concentrations ranged from 154 to 915, 195 to 1,400, and 165 to 1,930 ng/g lipid weight in the muscle, liver, and eggs, respectively. All the DDTs (DDT, DDE, and DDD) showed higher affinity for the liver relative to muscle tissue and can be maternally transferred to eggs in female frogs. The average biomagnification factors for DDTs ranged from 1.6 to 1.9 and 1.5 to 2.9 in female and male frogs, respectively, providing clear evidence of their biomagnification from insects to frogs. Compared with the reported DDT levels demonstrated to have toxic effects on frogs, DDTs in the present frogs are unlikely to constitute an immediate health risk. However, the adverse impacts of high DDT residues in eggs on the hatching success and their potential toxicity to the newly metamorphosed larval frogs should be assessed further.

  4. Oregon Spotted Frog (Rana pretiosa) movement and demography at Dilman Meadow: implications for future monitoring

    Science.gov (United States)

    Chelgren, Nathan D.; Pearl, Christopher A.; Bowerman, Jay; Adams, Michael J.

    2007-01-01

    Introduction The Oregon spotted frog (Rana pretiosa) is a highly aquatic frog that has been extirpated from a large portion of its historic range in the Pacific Northwest, and remaining populations are reduced and isolated (Hayes 1997, Pearl and Hayes 2005). Loss and alteration of marsh habitat, predation and competition from exotic fish and bullfrogs, and degraded water quality from agriculture and livestock grazing are implicated in their decline (Hayes 1997, Pearl and Hayes 2005). In 2001, an interagency team translocated a population of frogs from a site that was to be eliminated by the renovation of the dam impounding Wickiup Reservoir, to newly created ponds at Dilman Meadow (121i?? 39' 52" W, 43i?? 41' 58" N), 2.5 km from the original site in central Oregon, USA. We monitored Oregon spotted frog demography and movements at Dilman Meadow for > 4 yr to assess the efficacy of these mitigation efforts, determine metrics for long-term monitoring, and inform future management at the site. More broadly, many aspects of Oregon spotted frog life history are poorly known, so understanding demography and movement patterns is likely to be useful in its conservation. Although wildlife translocations have been attempted extensively as conservation means, few such projects have been sufficiently monitored for demographic rates to understand the causes for the translocation's success or failure (Dodd and Seigel 1991). Our objective here is to document demographic and movement patterns in the population of Oregon spotted frog at Dilman Meadow so that this information will be available to guide management decisions. To better evaluate amphibian population responses to management actions it is important to consider the contribution of each life history stage and both genders to the balance of reproduction and mortality. Population growth or contraction occurs as a complicated function of the probability of breeding, fecundity, and survival during multiple life history stages

  5. Evidence for a intimate relationship between mast cells and nerve fibers in the tongue of the frog, Rana esculenta

    Energy Technology Data Exchange (ETDEWEB)

    Chieffi Baccari, Gabriella; Minucci, Sergio [Naples, II Univ. (Italy). Dipt. di Fisiologia Umana e Funzioni Biologiche Integrate `Filippo Bottazzi`

    1997-12-31

    Morphological and ultrastructural association of mast cells and nerve fibers were studied in the tongue of the frog Rana esculenta. The number of mast cells in the tongue (253 {+-} 45 / mm{sup 2}) is far the highest of the frog tissue as far as people know. They are distributed throughout the connective tissue among the muscular fibers, near arterioles and venules but predominantly in close association and within the nerves. They are often embedded in the endoneurium within a nerve bundle near to myelinic or unmyelinic fibers and in membrane-to-membrane contact with axonlike processes. Just for the richness of mast cells, the tongue of the frog could represent an useful model to study the relationship between these cells and the peripheral nervous system.

  6. The precarious persistence of the endangered Sierra Madre yellow-legged frog Rana muscosa in southern California, USA

    Science.gov (United States)

    Backlin, Adam R.; Hitchcock, Cynthia J.; Gallegos, Elizabeth A.; Yee, Julie L.; Fisher, Robert N.

    2015-01-01

    We conducted surveys for the Endangered Sierra Madre yellow-legged frog Rana muscosa throughout southern California to evaluate the current distribution and status of the species. Surveys were conducted during 2000–2009 at 150 unique streams and lakes within the San Gabriel, San Bernardino, San Jacinto, and Palomar mountains of southern California. Only nine small, geographically isolated populations were detected across the four mountain ranges, and all tested positive for the amphibian chytrid fungus Batrachochytrium dendrobatidis. Our data show that when R. muscosa is known to be present it is easily detectable (89%) in a single visit during the frog's active season. We estimate that only 166 adult frogs remained in the wild in 2009. Our research indicates that R. muscosa populations in southern California are threatened by natural and stochastic events and may become extirpated in the near future unless there is some intervention to save them.

  7. Molecular cloning and characterization of oocyte-specific Pat1a in Rana rugosa frogs.

    Science.gov (United States)

    Nakamura, Yoriko; Iwasaki, Takehiro; Umei, Yosuke; Saotome, Kazuhiro; Nakajima, Yukiko; Kitahara, Shoichi; Uno, Yoshinobu; Matsuda, Yoichi; Oike, Akira; Kodama, Maho; Nakamura, Masahisa

    2015-10-01

    The Pat1 gene is expressed in the immature oocytes of Xenopus, and is reportedly involved in regulating the translation of maternal mRNAs required for oocyte-maturation. However, it is still unknown when Pat1a first appears in the differentiating ovary of amphibians. To address this issue, we isolated the full-length Pat1a cDNA from the frog Rana rugosa and examined its expression in the differentiating ovary of this frog. Among eight different tissues examined, the Pat1a mRNA was detectable in only the ovary. When frozen sections from the ovaries of tadpoles at various stages of development were immunostained for Vasa-a germ cell-specific protein-and Pat1a, Vasa-immunopositive signals were observed in all of the germ cells, whereas Pat1a signals were confined to the growing oocytes (50-200 μm in diameter), and absent from small germ cells (<50 μm in diameter). Forty days after testosterone injection into tadpoles to induce female-to-male sex-reversal, Pat1a-immunoreactive oocytes had disappeared completely from the sex-reversed gonad, but Vasa-positive small germ cells persisted. Thus, Pat1a would be a good marker for identifying the sexual status of the sex-reversing gonad in amphibians. In addition, fluorescence in situ hybridization analysis showed Pat1a to have an autosomal locus, suggesting that Pat1a transcription is probably regulated by a tissue-specific transcription factor in R. rugosa.

  8. Regulation of SMAD transcription factors during freezing in the freeze tolerant wood frog, Rana sylvatica.

    Science.gov (United States)

    Aguilar, Oscar A; Hadj-Moussa, Hanane; Storey, Kenneth B

    2016-11-01

    The wood frog, Rana sylvatica, survives sub-zero winter temperatures by undergoing full body freezing for weeks at a time, during which it displays no measurable brain activity, no breathing, and a flat-lined heart. Freezing is a hypometabolic state characterized by a global suppression of gene expression that is elicited in part by transcription factors that coordinate the activation of vital pro-survival pathways. Smad transcription factors respond to TGF-β signalling and are involved in numerous cellular functions from development to stress. Given the identity of genes they regulate, we hypothesized that they may be involved in coordinating gene expression during freezing. Protein expression of Smad1/2/3/4/5 in response to freezing was examined in 24h frozen and 8h thawed wood frog tissues using western immunoblotting, with the determination of subcellular localization in muscle and liver tissues. Transcript levels of smad2, smad4 and downstream genes (serpine1, myostatin, and tsc22d3) were measured by RT-PCR. Tissue-specific responses were observed during freezing where brain, heart, and liver had elevated levels of pSmad3, and skeletal muscle and kidneys had increased levels of pSmad1/5 and pSmad2 during freeze/thaw cycle, while protein and transcript levels remained constant. There were increases in nuclear levels of pSmad2 in muscle and pSmad3 in liver. Transcript levels of serpine1 were induced in heart, muscle, and liver, myostatin in muscle, and tsc22d3 in heart, and liver during freezing. These results suggest a novel freeze-responsive activation of Smad proteins that may play an important role in coordinating pro-survival gene networks necessary for freeze tolerance.

  9. Chilled frogs are hot: hibernation and reproduction of the Endangered mountain yellow-legged frog Rana muscosa

    Science.gov (United States)

    Santana, Frank E.; Swaisgood, Ronald R.; Lemm, Jeffrey M.; Fisher, Robert N.; Clark, Rulon W.

    2015-01-01

    In the face of the sixth great extinction crisis, it is imperative to establish effective breeding protocols for amphibian conservation breeding programs. Captive efforts should not proceed by trial and error, nor should they jump prematurely to assisted reproduction techniques, which can be invasive, difficult, costly, and, at times, counterproductive. Instead, conservation practitioners should first look to nature for guidance, and replicate key conditions found in nature in the captive environment, according to the ecological and behavioral requirements of the species. We tested the effect of a natural hibernation regime on reproductive behaviors and body condition in the Endangered mountain yellow-legged frog Rana muscosa. Hibernation had a clear positive effect on reproductive behavior, manifesting in vocal advertisement signaling, female receptivity, amplexus, and oviposition. These behaviors are critical components of courtship that lead to successful reproduction. Our main finding was that captive R. muscosa require a hibernation period for successful reproduction, as only hibernated females produced eggs and only hibernated males successfully fertilized eggs. Although hibernation also resulted in a reduced body condition, the reduction appeared to be minimal with no associated mortality. The importance of hibernation for reproduction is not surprising, since it is a major component of the conditions that R. muscosa experiences in the wild. Other amphibian conservation breeding programs can also benefit from a scientific approach that tests the effect of natural ecological conditions on reproduction. This will ensure that captive colonies maximize their role in providing genetic reservoirs for assurance and reintroduction efforts.

  10. Spatiotemporal Diversification of the True Frogs (Genus Rana): A Historical Framework for a Widely Studied Group of Model Organisms.

    Science.gov (United States)

    Yuan, Zhi-Yong; Zhou, Wei-Wei; Chen, Xin; Poyarkov, Nikolay A; Chen, Hong-Man; Jang-Liaw, Nian-Hong; Chou, Wen-Hao; Matzke, Nicholas J; Iizuka, Koji; Min, Mi-Sook; Kuzmin, Sergius L; Zhang, Ya-Ping; Cannatella, David C; Hillis, David M; Che, Jing

    2016-09-01

    True frogs of the genus Rana are widely used as model organisms in studies of development, genetics, physiology, ecology, behavior, and evolution. Comparative studies among the more than 100 species of Rana rely on an understanding of the evolutionary history and patterns of diversification of the group. We estimate a well-resolved, time-calibrated phylogeny from sequences of six nuclear and three mitochondrial loci sampled from most species of Rana, and use that phylogeny to clarify the group's diversification and global biogeography. Our analyses consistently support an "Out of Asia" pattern with two independent dispersals of Rana from East Asia to North America via Beringian land bridges. The more species-rich lineage of New World Rana appears to have experienced a rapid radiation following its colonization of the New World, especially with its expansion into montane and tropical areas of Mexico, Central America, and South America. In contrast, Old World Rana exhibit different trajectories of diversification; diversification in the Old World began very slowly and later underwent a distinct increase in speciation rate around 29-18 Ma. Net diversification is associated with environmental changes and especially intensive tectonic movements along the Asian margin from the Oligocene to early Miocene. Our phylogeny further suggests that previous classifications were misled by morphological homoplasy and plesiomorphic color patterns, as well as a reliance primarily on mitochondrial genes. We provide a phylogenetic taxonomy based on analyses of multiple nuclear and mitochondrial gene loci. [Amphibians; biogeography; diversification rate; Holarctic; transcontinental dispersal. © The Author(s) 2016. Published by Oxford University Press, on behalf of the Society of Systematic Biologists. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Multiple sublethal chemicals negatively affect tadpoles of the green frog, Rana clamitans

    Science.gov (United States)

    Boone, Michelle D.; Bridges, Christine M.; Fairchild, James F.; Little, Edward E.

    2005-01-01

    Many habitats may be exposed to multiple chemical contaminants, particularly in agricultural areas where fertilizer and pesticide use are common; however, the singular and interactive effects of contaminants are not well understood. The objective of our study was to examine how realistic, sublethal environmental levels of ammonium nitrate fertilizer (0, 10, 20 mg/L and ammonium chloride control) and the common insecticide carbaryl (0 or 2.5 mg/L) individually and interactively affect the development, size, and survival of green frog (Rana clamitans) tadpoles. We reared tadpoles for 95 d in outdoor 1,000-L polyethylene ponds. We found that the combination of carbaryl and nitrate had a negative effect on development and mass of tadpoles compared to the positive effect that either contaminant had alone. Presence of carbaryl was generally associated with short-term increases in algal resources, including ponds exposed to both carbaryl and nitrate. However, with exposure to nitrate and carbaryl, tadpole mass and development were not positively affected as with one chemical stressor alone. The combination of these sublethal contaminants may reduce the ability of amphibians to benefit from food-rich environments or have metabolic costs. Our study demonstrates the importance of considering multiple stressors when evaluating population-level responses.

  12. Cytonuclear discordance and historical demography of two brown frogs, Rana tagoi and R. sakuraii (Amphibia: Ranidae).

    Science.gov (United States)

    Eto, Koshiro; Matsui, Masafumi

    2014-10-01

    Prior studies of mitochondrial genomic variation reveal that the Japanese brown frog Rana tagoi comprises a complex of cryptic species lineages, and that R. sakuraii arose from within this complex. Neither species forms a monophyletic group on the mitochondrial haplotype tree, precluding a simple explanation for the evolutionary origins of R. sakuraii. We present a more complete sampling of mitochondrial haplotypic variation (from the ND1 and 16S genes) plus DNA sequence variation for five nuclear loci (from the genes encoding NCX1, NFIA, POMC, SLC8A3, and TYR) to resolve the evolutionary histories of these species. We test hypotheses of population assignment (STRUCTURE) and isolation-with-migration (IM) using the more slowly evolving nuclear markers. These demographic analyses of nuclear genetic variation confirm species-level distinctness and integrity of R. sakuraii despite its apparent polyphyly on the mitochondrial haplotype tree. Divergence-time estimates from both the mitochondrial haplotypes and nuclear genomic markers suggest that R. sakuraii originated approximately one million years ago, and that incomplete sorting of mitochondrial haplotype lineages best explains non-monophyly of R. sakuraii mitochondrial haplotypes. Cytonuclear discordance elsewhere in R. tagoi reveals a case of mitochondrial introgression between two species lineages on Honshu. The earliest phylogenetic divergence within this species group occurred approximately four million years ago, followed by cladogenetic events in the Pliocene and early Pleistocene yielding 10-13 extant species lineages, including R. sakuraii as one of the youngest.

  13. Neuronal nitric oxide synthase immunoreactivity in the respiratory tract of the frog, Rana temporaria.

    Science.gov (United States)

    Bodegas, M E; Villaro, A C; Montuenga, L M; Moncada, S; Riveros-Moreno, V; Sesma, P

    1995-10-01

    Physiological and histochemical studies have recently supported the notion that nitric oxide (NO) is the transduction signal responsible for the non-adrenergic, non-cholinergic relaxation of the vasculature as well as the airways of the mammalian lung. We report the presence of immunoreactivity to NO synthase (NOS) in nerve cell bodies and nerve fibres in the neural plexus of the buccal cavity and lungs of the frog, Rana temporaria, using the indirect immunocytochemical technique of avidin-biotin and the NADPH-diaphorase technique. The neural ganglia located next to the muscle layer and within the connective tissue of the buccal cavity were partially immunoreactive for NOS. In the lungs, NOS immunoreactivity occurred in nerve cell bodies, as well as in both myelinated and unmyelinated nerve fibres. Fine nerve fibres immunoreactive to NOS were observed within the muscle fibre bundles and next to the respiratory epithelium. Both the presence of NOS immunoreactivity and the positive histochemical reaction for NADPH-diaphorase in the neural plexus of amphibian respiratory tract suggests a broad evolutionary role for NO as a peripheral neurotransmitter.

  14. Metamorphic changes in the stomach of the frog Rana temporaria tadpoles.

    Science.gov (United States)

    Rovira, J; Villaro, A C; Bodegas, M E; Valverde, E; Sesma, P

    1995-02-01

    The histological transformation of amphibian stomach during metamorphosis was studied in the frog Rana temporaria. The earliest metamorphic changes occur shortly before regression of the cloacal piece of tail and appearance of forelegs. Autolysis of primary, larval epithelial cells and activity of phagocytes lead to regression of the apical mucosa, which is shed into the gastric lumen. Histogenesis takes place from the very beginning of metamorphosis in the basal region of the mucosa; undifferentiated, regenerative cells, arranged in small compact cords and surrounded by a thick basement membrane, give rise to secondary lining epithelium and glands. Lining epithelial cells differentiate into a typical mucosecretory epithelium. Oxyntic cells present in larval glands are substituted by both ion- and protein-secreting oxyntic-peptic cells. During metamorphosis, connective and muscular tissues markedly increase, a submucosa, not present in larval tadpoles, gradually develops. A muscularis mucosae is also formed and the muscular propria becomes thicker. At late metamorphosis, folded structures involving both mucosa and submucosa develop, increasing the luminal surface as in adults. Removal of the larval gastric mucosa and its replacement by a new, adult-type definitive one, together with development of peripheral connective and muscular tissues, account for metamorphosis of tadpole stomach.

  15. Mobile phone mast effects on common frog (Rana temporaria) tadpoles: the city turned into a laboratory.

    Science.gov (United States)

    Balmori, Alfonso

    2010-06-01

    An experiment has been made exposing eggs and tadpoles of the common frog (Rana temporaria) to electromagnetic radiation from several mobile (cell) phone antennae located at a distance of 140 meters. The experiment lasted two months, from the egg phase until an advanced phase of tadpole prior to metamorphosis. Measurements of electric field intensity (radiofrequencies and microwaves) in V/m obtained with three different devices were 1.8 to 3.5 V/m. In the exposed group (n = 70), low coordination of movements, an asynchronous growth, resulting in both big and small tadpoles, and a high mortality (90%) was observed. Regarding the control group (n = 70) under the same conditions but inside a Faraday cage, the coordination of movements was normal, the development was synchronous, and a mortality of 4.2% was obtained. These results indicate that radiation emitted by phone masts in a real situation may affect the development and may cause an increase in mortality of exposed tadpoles. This research may have huge implications for the natural world, which is now exposed to high microwave radiation levels from a multitude of phone masts.

  16. Environmental influence on testicular MAP kinase (ERK1) activity in the frog Rana esculenta.

    Science.gov (United States)

    Chieffi, Paolo; Minucci, Sergio

    2004-06-01

    Recent studies suggest a role for ERK1 in the regulation of spermatogonial proliferation. In this report the frog Rana esculenta, a seasonal breeder, was used as a model to study the possible effect on ERK1 of photoperiod and temperature. Adult male R. esculenta were subjected to several combinations of light and temperature at different times of the year to elucidate the regulation of ERK1 testicular activity in the spermatogonial proliferation by these environmental factors. Western blot analysis shows that under controlled experimental conditions an increase of temperature and photoperiod in November, characterized by a decrease in primary spermatogonial mitosis, induces ERK1 activity and spermatogonial proliferation, as confirmed using the proliferating cellular nuclear antigen (PCNA) as an early molecular marker. In contrast, a decrease in temperature and photoperiod in March, with an increase of primary spermatogonial mitosis, impairs ERK1 activity and spermatogonial proliferation. In conclusion, our data clearly show for the first time in a non-mammalian vertebrate that the temperature and the photoperiod exert a role in the spermatogonial proliferation via ERK1 activity.

  17. [Reinnervation of a mixed muscle in the frog Rana temporaria with a regenerating homogeneous nerve].

    Science.gov (United States)

    Radziukevich, T L

    1995-01-01

    Mixed muscle m. iliofibularis from the frog Rana temporaria, consisting of monosynaptically innervated phasic and polysynaptically innervated postural muscle fibers, was reinnervated by homogeneous tailor's nerve having no axons of tonic motor system in its composition. Within 2-7 months after nerves binding treatment phasic muscle fibers were easily identified by subneural apparatus structure revealed at coloration of synaptic acetylcholinesterase. Presynaptic part of neuromuscular apparatus of these fibers after the impregnation by protargol was presented by immature nervous terminals. The identification of tonic Muscular fibers was difficult especially at the late stages of reinnervation as subneural apparatus structure typical for tonic fibers was not revealed. Nonmyelinizated nerve fibers without features of terminal branch were observed in individual regions of nonidentified muscle fibers. The results obtained show that subneural apparatus of tonic muscle fibers depends to a great extent on the influence of inherent tonic motor system. Axons of phasic motor system even at distant reinnervation periods and in the absence of competitive influences of tonic motor system do not form typical "phasic" terminal picture of innervation under the contact with tonic muscle fibers.

  18. Demography and movement in a relocated population of Oregon Spotted Frogs (Rana pretiosa): Influence of season and gender

    Science.gov (United States)

    Chelgren, N.D.; Pearl, C.A.; Adams, M.J.; Bowerman, J.

    2008-01-01

    We used five years of recapture data and Bayesian estimation to assess seasonal survival, movement, and growth of Oregon Spotted Frogs (Rana pretiosa) relocated into created ponds at Dilman Meadow in Oregon, USA. We evaluate hypotheses specific to the relocation and elucidate aspects of R. pretiosa life history that are poorly known. The odds of survival of relocated individuals during the first year following relocation were 0.36 times the survival odds of relocated and non-relocated frogs after one year since the relocation. Survival rate was higher for large frogs. After accounting for frog size, we found little variation in survival between ponds at Dilman Meadow. Survival was lowest for males during the breeding/post-breeding redistribution period, suggesting a high cost of breeding for males. The highest survival rates occurred during winter for both genders, and one small spring was used heavily during winter but was used rarely during the rest of the year. Individual growth was higher in ponds that were not used for breeding, and increased with increasing pond age. Our study supports other evidence that R. pretiosa use different habitats seasonally and are specific in their overwintering habitat requirements. Because frogs were concentrated during winter, predator-free overwintering springs are likely to be of particular value for R. pretiosa populations. ?? 2008 by the American Society of Ichthyologists and Herpetologists.

  19. Odorous and Non-Fatal Skin Secretion of Adult Wrinkled Frog (Rana rugosa) Is Effective in Avoiding Predation by Snakes

    Science.gov (United States)

    Yoshimura, Yuri; Kasuya, Eiiti

    2013-01-01

    The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa) has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes’ responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping) behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes. PMID:24278410

  20. Odorous and non-fatal skin secretion of adult wrinkled frog (Rana rugosa is effective in avoiding predation by snakes.

    Directory of Open Access Journals (Sweden)

    Yuri Yoshimura

    Full Text Available The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes' responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes.

  1. Odorous and non-fatal skin secretion of adult wrinkled frog (Rana rugosa) is effective in avoiding predation by snakes.

    Science.gov (United States)

    Yoshimura, Yuri; Kasuya, Eiiti

    2013-01-01

    The roles played by nonfatal secretions of adult anurans in the avoidance of predation remain unknown. The adult Wrinkled frog (Rana rugosa) has warty skin with the odorous mucus secretion that is not fatal to the snake Elaphe quadrivirgata. We fed R. rugosa or Fejervarya limnocharis, which resembles R. rugosa in appearance and has mucus secretion, to snakes and compared the snakes' responses to the frogs. Compared to F. limnocharis, R. rugosa was less frequently bitten or swallowed by snakes. The snakes that bit R. rugosa spat out the frogs and showed mouth opening (gaping) behavior, while the snakes that bit F. limnocharis did not show gaping behavior. We also compared the responses of the snakes to R. rugosa and F. limnocharis secretions. We coated palatable R. japonica with secretions from R. rugosa or F. limnocharis. The frogs coated by R. rugosa secretion were less frequently bitten or swallowed than those coated by F. limnocharis secretion. We concluded that compared to different frog species of similar sizes, the adult R. rugosa was less frequently preyed upon by, and that its skin secretion was effective in avoiding predation by snakes.

  2. Ghrelin receptor in two species of anuran amphibian, bullfrog (Rana catesbeiana and Japanese tree frog (Hyla japonica

    Directory of Open Access Journals (Sweden)

    Hiroyuki eKaiya

    2011-09-01

    Full Text Available We identified cDNA encoding a functional growth hormone secretagogue-receptor 1a (GHS-R1a, ghrelin receptor in two species of anuran amphibian, bullfrog (Rana catesbeiana and Japanese tree frog (Hyla japonica. Deduced receptor protein for bullfrog and Japanese tree frog (tree frog was comprised of 374- and 371-amino acids, respectively. The two receptors showed 86% identity with each other, and phylogenetic analysis revealed that the two receptors belong to the same category with tetrapods. In functional analyses, ghrelin and GHS-R1a agonists increased intracellular Ca2+ concentration in HEK293 cell that transfected each receptor cDNA, but ligand selectivity of ghrelin with Ser3 and Thr3 was not observed between the two receptors. Bullfrog GHS-R1a mRNA was mainly expressed in the brain, stomach and testis. In the brain, the gene expression was detected in the diencephalon and mesencephalon, but not in the pituitary. Tree frog GHS-R1a mRNA was predominantly expressed in the gastrointestinal tract and ovary, but not detected in the pituitary. In bullfrog stomach, GHS-R1a mRNA expression increased at 10 days after fasting, but not in the brain. In tree frog, GHS-R1a mRNA expression increased in the brain, stomach and ventral skin by 10-days fasting, and in the stomach and ventral skin by a dehydration treatment. Intracerebroventricular injection of ghrelin in dehydrated tree frog did not affect water absorption from the ventral skin. These results suggest that ghrelin is involved in energy homeostasis and possibly in osmoregulation in frogs.

  3. Effects of six chemical deicers on larval wood frogs (Rana sylvatica).

    Science.gov (United States)

    Harless, Meagan L; Huckins, Casey J; Grant, Jacqualine B; Pypker, Thomas G

    2011-07-01

    Widespread and intensive application of road deicers, primarily road salt (NaCl), in North America threatens water quality and the health of freshwater ecosystems. Intensive use of NaCl can be harmful to sensitive members of freshwater ecosystems such as amphibians. Detection of negative effects of NaCl application has prompted the search for alternative chemical deicers with lower environmental impacts. We conducted a series of 96-h acute toxicity tests to determine the negative sensitivity of larval wood frogs (Rana [Lithobates] sylvatica) to six deicing chemicals: urea (CH(4) N(2) O), sodium chloride (NaCl), magnesium chloride (MgCl(2) ), potassium acetate (CH(3) COOK), calcium chloride (CaCl(2) ), and calcium magnesium acetate (C(8) H(12) CaMgO(8) ). Acetates are sometimes touted as environmentally friendly alternatives to NaCl but have not been examined in enough detail to warrant this designation. When exposed to a range of environmentally realistic concentrations of these chemicals, larvae were least sensitive (i.e., had the lowest mortality rate) to CH(4) N(2) O, NaCl, and MgCl(2) and most sensitive to acetates (C(8) H(12) CaMgO(8) , CH(3) COOK) and CaCl(2) . Our observed median lethal concentration estimates (LC50(96-h) ) for NaCl were over two times higher than values presented in previous studies, which suggests variability in tolerance among R. sylvatica populations. The deicers varied greatly in their toxicity, and further research is warranted to examine the differential effects of this suite of deicers on other species.

  4. Female choice for males with greater fertilization success in the Swedish Moor frog, Rana arvalis.

    Directory of Open Access Journals (Sweden)

    Craig D H Sherman

    Full Text Available BACKGROUND: Studies of mate choice in anuran amphibians have shown female preference for a wide range of male traits despite females gaining no direct resources from males (i.e. non-resource based mating system. Nevertheless, theoretical and empirical studies have shown that females may still gain indirect genetic benefits from choosing males of higher genetic quality and thereby increase their reproductive success. METHODOLOGY/PRINCIPAL FINDINGS: We investigated two components of sexual selection in the Moor frog (Rana arvalis, pre-copulatory female choice between two males of different size ('large' vs. 'small', and their fertilization success in sperm competition and in isolation. Females' showed no significant preference for male size (13 small and six large male preferences but associated preferentially with the male that subsequently was the most successful at fertilizing her eggs in isolation. Siring success of males in competitive fertilizations was unrelated to genetic similarity with the female and we detected no effect of sperm viability on fertilization success. There was, however, a strong positive association between a male's innate fertilization ability with a female and his siring success in sperm competition. We also detected a strong negative effect of a male's thumb length on his competitive siring success. CONCLUSIONS/SIGNIFICANCE: Our results show that females show no preference for male size but are still able to choose males which have greater fertilization success. Genetic similarity and differences in the proportion of viable sperm within a males ejaculate do not appear to affect siring success. These results could be explained through pre- and/or postcopulatory choice for genetic benefits and suggest that females are able to perceive the genetic quality of males, possibly basing their choice on multiple phenotypic male traits.

  5. Independent degeneration of W and Y sex chromosomes in frog Rana rugosa.

    Science.gov (United States)

    Miura, Ikuo; Ohtani, Hiromi; Ogata, Mitsuaki

    2012-01-01

    The frog Rana rugosa uniquely possesses two different sex-determining systems of XX/XY and ZZ/ZW, separately in the geographic populations. The sex chromosomes of both types share the same origin at chromosome 7, and the structural differences between X and Y or Z and W were evolved through two inversions. In order to ascertain the mechanisms of degeneration of W and Y chromosomes, we gynogenetically produced homozygous diploids WW and YY and examined their viability. Tadpoles from geographic group N (W(N)W(N)) containing three populations died of edema at an early developmental stage within 10 days after hatching, while tadpoles from the geographic group K (W(K)W(K)) that contained two populations died of underdeveloped growth at a much later stage, 40-50 days after fertilization. On the contrary, W(N)W(K) and W(K)W(N) hybrid embryos were viable, successfully passed the two lethal stages, and survived till the attainment of adulthood. The observed survival implies that the lethal genes of the W chromosomes are not shared by the two groups and thus demonstrates their independent degeneration histories between the local groups. In sharp contrast, a sex-linked gene of androgen receptor gene (AR) from the W chromosome was down-regulated in expression in both the groups, suggesting that inactivation of the W-AR allele preceded divergence of the two groups and appearance of the lethal genes. Besides, the YY embryos died of cardiac edema immediately after hatching. The symptom of lethality and the stage of developmental arrest differed from those for either of WW lethal embryos. We therefore conclude that the W and Y chromosomes involve no evolutionary common scenario for degeneration.

  6. Origin of centrifugal fibers to the labyrinth in the frog (Rana esculenta). A study with the fluorescent retrograde neuronal tracer 'Fast blue'.

    Science.gov (United States)

    Strutz, J; Spatz, W B; Schmidt, C L; Stürmer, C

    1981-06-29

    After injecting a solution of a fluorescent retrograde neuronal tracer (Fast blue, Diamidino compound 253/50) into the perilymphatic space of the frog labyrinth (Rana esculenta), labeled cells were found in the ventral and dorsal nuclei of the VIIIth nerve and in the nucleus reticularis medius. We consider these labeled cells to be the origin of the efferent innervation of the frog labyrinth. No evidence was found for the existence of a direct cerebello-labyrinthine connection.

  7. Clinical signs, pathology and dose-dependent survival of adult wood frogs, Rana sylvatica, inoculated orally with frog virus 3 Ranavirus sp., Iridoviridae.

    Science.gov (United States)

    Forzn, Mara J; Jones, Kathleen M; Vanderstichel, Raphal V; Wood, John; Kibenge, Frederick S B; Kuiken, Thijs; Wirth, Wytamma; Ariel, Ellen; Daoust, Pierre-Yves

    2015-05-01

    Amphibian populations suffer massive mortalities from infection with frog virus 3 FV3, genus Ranavirus, family Iridoviridae, a pathogen also involved in mortalities of fish and reptiles. Experimental oral infection with FV3 in captive-raised adult wood frogs, Rana sylvatica Lithobates sylvaticus, was performed as the first step in establishing a native North American animal model of ranaviral disease to study pathogenesis and host response. Oral dosing was successful LD50 was 10(2.93 2.423.44) p.f.u. for frogs averaging 35mm in length. Onset of clinical signs occurred 614days post-infection p.i. median 11 days p.i. and time to death was 1014 days p.i. median 12 days p.i.. Each tenfold increase in virus dose increased the odds of dying by 23-fold and accelerated onset of clinical signs and death by approximately 15. Ranavirus DNA was demonstrated in skin and liver of all frogs that died or were euthanized because of severe clinical signs. Shedding of virus occurred in faeces 710 days p.i. 34.5days before death and skin sheds 10 days p.i. 01.5days before death of some frogs dead from infection. Most common lesions were dermal erosion and haemorrhages haematopoietic necrosis in bone marrow, kidney, spleen and liver and necrosis in renal glomeruli, tongue, gastrointestinal tract and urinary bladder mucosa. Presence of ranavirus in lesions was confirmed by immunohistochemistry. Intracytoplasmic inclusion bodies probably viral were present in the bone marrow and the epithelia of the oral cavity, gastrointestinal tract, renal tubules and urinary bladder. Our work describes a ranaviruswood frog model and provides estimates that can be incorporated into ranavirus disease ecology models.

  8. Breeding ecology and oviposition site selection of black-spotted pond frogs (Rana nigromaculata) in Ningbo, China

    Institute of Scientific and Technical Information of China (English)

    Yanping WANG; Zhengjun WU; Ping LU; Fang ZHANG; Yiming LI

    2008-01-01

    The black-spotted pond frog (Rana nigromacu-lata) is one of the most widely distributed species in China. However, there have been only a few qualitative descrip-tions of their breeding ecology and oviposition site selec-tion. From 2004 to 2006, we investigated the breeding ecology and oviposition site selection of K nigromaculata in Ningbo, China, quantitatively. Analyses of breeding ecology show that: (1) mean frog density in the breeding season was 0.0903 ± 0.0029 individuals per meter (n = 11) (mean ± SE); (2) R. nigromaculata was a sexually dimorphic species, with females significantly larger than males in both body weight and snout-vent length; (3) the clutch size averaged 4643.04± 235.96 eggs (range 1546-7897, n = 50); and (4) the egg size ranged from 1.50 to 1.74 mm in diameter, with an average egg size of 1.6050 ± 0.0046 mm (n = 226). Oviposition sites differed significantly from random sites in percentages of water, bare ground and vegetation cover, water depth (cm), water temperature (°C) and water turbidity. Rana nigro-maculata preferred microhabitats with higher percentages of water and vegetation cover, while it avoided microha-bitats with deeper water. The results suggest that micro-habitats with higher percentages of water and vegetation cover, but not deeper water, should be priorities for pro-tection and conservation of the breeding habitats of R. nigromaculata.

  9. Endocrine-disrupting effects and reproductive toxicity of low dose MCLR on male frogs (Rana nigromaculata) in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Jia, Xiuying; Cai, Chenchen; Wang, Jia; Gao, Nana; Zhang, Hangjun, E-mail: zhanghangjun@gmail.com

    2014-10-15

    Highlights: • Low-dose MCLR (1 μg/L) elicits a potential ecological effect on amphibian populations. • MCLR can induce abnormal sperm morphologies and activities on male frogs. • MCLR can induce a decrease in serum testosterone and an increase in serum estradiol of male frogs. • MCLR can increase SF-1 protein levels and decrease P450 aromatase levels in the gonads of frogs. - Abstract: Toxic cyanobacterial blooms are potential global threats to aquatic ecosystems and human health. The World Health Organization has set a provisional guideline limit of 1 μg/L microcystin-LR (MCLR) in freshwater. However, MCLR concentrations in several water bodies have exceeded this level. Despite this recommended human safety standard, MCLR-induced endocrine-disrupting effects and reproductive toxicity on male frog (Rana nigromaculata) were demonstrated in this study. Results showed that sperm motility and sperm count were significantly and negatively correlated with exposure time and concentration. By contrast, abnormal sperm rate was positively correlated with both parameters. Ultrastructural observation results revealed abnormal sperm morphologies, vacuoles in spermatogenic cells, cell dispersion, incomplete cell structures, and deformed nucleoli. These results indicated that MCLR could induce toxic effects on the reproductive system of frogs, significantly decrease testosterone content, and rapidly increase estradiol content. Prolonged exposure and increased concentration enhanced the relative expression levels of P450 aromatase and steroidogenic factor 1; thus, endocrine function in frogs was disrupted. This study is the first to demonstrate in vivo MCLR toxicity in the reproductive system of male R. nigromaculata. This study provided a scientific basis of the global decline in amphibian populations.

  10. Interaction of an Introduced Predator with Future Effects of Climate Change in the Recruitment Dynamics of the Imperiled Sierra Nevada Yellow-legged Frog (Rana sierrae)

    Science.gov (United States)

    I Lacan; Kathleen R. Matthews; K.V. Feldman

    2008-01-01

    Between-year variation in snowpack (from 20 to 200% of average) and summer rainfall cause large fluctuations in volume of small lakes in the higher elevation (> 3000 m) Sierra Nevada, which are important habitat for the imperiled Sierra Nevada Yellow-legged Frog, Rana sierrae. Climate change (global warming) is predicted to increase these...

  11. Turning population trend monitoring into active conservation: Can we save the Cascades Frog (Rana cascadae) in the Lassen region of California?

    Science.gov (United States)

    Gary M. Fellers; Karen L. Pope; Jonathan E. Stead; Michelle S. Koo; Hartwell H. Welsh

    2007-01-01

    Monitoring the distribution, population size, and trends of declining species is necessary to evaluate their vulnerability to extinction. It is the responsibility of scientists to alert management professionals of the need for preemptive action if a species approaches imminent, regional extirpation. This is the case with Rana cascadae (Cascades Frog...

  12. Anti-apoptotic response during anoxia and recovery in a freeze-tolerant wood frog (Rana sylvatica

    Directory of Open Access Journals (Sweden)

    Victoria E.M. Gerber

    2016-03-01

    Full Text Available The common wood frog, Rana sylvatica, utilizes freeze tolerance as a means of winter survival. Concealed beneath a layer of leaf litter and blanketed by snow, these frogs withstand subzero temperatures by allowing approximately 65–70% of total body water to freeze. Freezing is generally considered to be an ischemic event in which the blood oxygen supply is impeded and may lead to low levels of ATP production and exposure to oxidative stress. Therefore, it is as important to selectively upregulate cytoprotective mechanisms such as the heat shock protein (HSP response and expression of antioxidants as it is to shut down majority of ATP consuming processes in the cell. The objective of this study was to investigate another probable cytoprotective mechanism, anti-apoptosis during oxygen deprivation and recovery in the anoxia tolerant wood frog. In particular, relative protein expression levels of two important apoptotic regulator proteins, Bax and p-p53 (S46, and five anti-apoptotic/pro-survival proteins, Bcl-2, p-Bcl-2 (S70, Bcl-xL, x-IAP, and c-IAP in response to normoxic, 24 Hr anoxic exposure, and 4 Hr recovery stages were assessed in the liver and skeletal muscle using western immunoblotting. The results suggest a tissue-specific regulation of the anti-apoptotic pathway in the wood frog, where both liver and skeletal muscle shows an overall decrease in apoptosis and an increase in cell survival. This type of cytoprotective mechanism could be aimed at preserving the existing cellular components during long-term anoxia and oxygen recovery phases in the wood frog.

  13. Small frogs get their worms first: the role of nonodonate arthropods in the recruitment of Haematoloechus coloradensis and Haematoloechus complexus in newly metamorphosed northern leopard frogs, Rana pipiens, and woodhouse's toads, Bufo woodhousii.

    Science.gov (United States)

    Bolek, Matthew G; Janovy, John

    2007-04-01

    Studies on the life cycles and epizootiology of North American frog lung flukes indicate that most species utilize odonates as second intermediate hosts; adult frogs become infected by ingesting odonate intermediate hosts. Newly metamorphosed frogs are rarely infected with these parasites, predominantly because they are gape-limited predators that cannot feed on large intermediate hosts such as dragonflies. We examined the role of the frog diet and potential intermediate hosts in the recruitment of the frog lung fluke, Haematoloechus coloradensis, to metamorphosed northern leopard frogs (Rana pipiens), Woodhouse's toads (Bufo woodhousii), and bullfrogs (Rana catesbeiana) from western Nebraska. Because of the uncertain validity of H. coloradensis as a distinct species from Haematoloechus complexus, morphological characters of both species were reevaluated and the life cycles of both species were completed in the laboratory. The morphological data on H. coloradensis and H. coimplexus indicate that they differ in their oral sucker to pharynx ratio, uterine loop distribution, and placement of vitelline follicles. However, in terms of their life cycles, both species are quite similar in their use of physid snails as first intermediate hosts, a wide range of nonodonate and odonate arthropods as second intermediate hosts, and leopard frogs and toads as definitive hosts. These results indicate that H. coloradensis and H. complexus are generalists at the second intermediate host level and might be able to infect newly metamorphosed leopard frogs and toads by using small nonodonate arthropods more commonly than other frog lung fluke species. Comparisons of population structure of adult flukes in newly metamorphosed leopard frogs indicate that the generalist nature of H. coloradensis metacercariae enables it to colonize young of the year leopard frogs more commonly than other Haematoloechus spp. that only use odonates as second intermediate hosts. In this respect, the

  14. A comparative study on the secretory activity of the subcommissural organ in the European green frogs: Rana esculenta, rana lessonae and Rana ridibunda

    NARCIS (Netherlands)

    Diederen, J.H.B.; Vullings, H.G.B.

    1980-01-01

    1. 1. The subcommissural organ (SCO), present in all vertebrates, is situated in the roof of the third brain ventricle, and secretes into this ventricle a glycoproteinaceous, fibre-like structure, the liquor fibe (LF). 2. 2. The three forms of European green frogs diner from each other in the three

  15. A comparative study on the secretory activity of the subcommissural organ in the European green frogs: Rana esculenta, rana lessonae and Rana ridibunda

    NARCIS (Netherlands)

    Diederen, J.H.B.; Vullings, H.G.B.

    1980-01-01

    1. 1. The subcommissural organ (SCO), present in all vertebrates, is situated in the roof of the third brain ventricle, and secretes into this ventricle a glycoproteinaceous, fibre-like structure, the liquor fibe (LF). 2. 2. The three forms of European green frogs diner from each other in the

  16. Endocrine-disrupting effects and reproductive toxicity of low dose MCLR on male frogs (Rana nigromaculata) in vivo.

    Science.gov (United States)

    Jia, Xiuying; Cai, Chenchen; Wang, Jia; Gao, Nana; Zhang, Hangjun

    2014-10-01

    Toxic cyanobacterial blooms are potential global threats to aquatic ecosystems and human health. The World Health Organization has set a provisional guideline limit of 1 μg/L microcystin-LR (MCLR) in freshwater. However, MCLR concentrations in several water bodies have exceeded this level. Despite this recommended human safety standard, MCLR-induced endocrine-disrupting effects and reproductive toxicity on male frog (Rana nigromaculata) were demonstrated in this study. Results showed that sperm motility and sperm count were significantly and negatively correlated with exposure time and concentration. By contrast, abnormal sperm rate was positively correlated with both parameters. Ultrastructural observation results revealed abnormal sperm morphologies, vacuoles in spermatogenic cells, cell dispersion, incomplete cell structures, and deformed nucleoli. These results indicated that MCLR could induce toxic effects on the reproductive system of frogs, significantly decrease testosterone content, and rapidly increase estradiol content. Prolonged exposure and increased concentration enhanced the relative expression levels of P450 aromatase and steroidogenic factor 1; thus, endocrine function in frogs was disrupted. This study is the first to demonstrate in vivo MCLR toxicity in the reproductive system of male R. nigromaculata. This study provided a scientific basis of the global decline in amphibian populations.

  17. Effect of exposure to continuous light and melatonin on ovarian follicular kinetics in the skipper frog, Rana cyanophlyctis.

    Science.gov (United States)

    Udaykumar, K; Joshi, B N

    1997-01-01

    Ovarian follicular kinetics and gravimetric changes in the ovary and oviducts were studied in the skipper frog, Rana cyanophlyctis, following exposure to continuous light and melatonin treatment during the breeding season. Daily late-afternoon injections of melatonin (15 micrograms subcutaneous) for 30 days decreased the gonadosomatic index (GSI), whereas continuously available melatonin from subcutaneous implants did not influence the GSI compared to those of controls. Exposure to continuous light for 30 days stimulated the GSI, and melatonin given as daily injections prevented the continuous-light induced increase in GSI. Oviductal weights decreased only in the melatonin-injected groups. Data on follicular kinetics revealed a decrease in first-growth-phase (FGP) oocytes and an increase in medium-sized second-growth-phase (MSGP) and large-sized second-growth-phase (LSGP) oocytes following continuous-light exposure. Melatonin administered to continuous-light-exposed frogs did not change the FGP oocyte number; however, it reduced both the MSGP and LSGP oocytes. Melatonin administration to frogs held in a light and dark cycle increased FGP oocytes and decreased MSGP and LSGP oocytes. Atretic follicles increased in all melatonin-treated groups. The results suggest that continuous light stimulates and melatonin inhibits reproductive function in this species.

  18. Toxic effects of 1-methyl-3-octylimidazolium bromide on the early embryonic development of the frog Rana nigromaculata.

    Science.gov (United States)

    Li, Xiao-Yu; Zhou, Jing; Yu, Miao; Wang, Jian-Ji; Pei, Yuan Chao

    2009-02-01

    Toxic effects of 1-methyl-3-octylimidazolium bromide ([C8mim]Br) on the early embryonic development of the frog Rana nigromaculata were evaluated. Frog embryos in different developmental stages (early cleavage, early gastrula, or neural plate) were exposed to 0, 45, 63, or 88.2 mg/L of the ionic liquid [C8mim]Br for 96 h. The 96-h median lethal concentration values at the early cleavage, early gastrula, and neural plate stages of development were 85.1, 43.4, and 42.4 mg/L, respectively. In embryos exposed to [C8mim]Br, the duration of embryo dechorionation was prolonged in the early cleavage and neural plate, but not the early gastrula, stages of development compared with control embryos. Embryos in the neural plate developmental stage were found to have the highest mortality rate following [C8mim]Br exposure. These results suggest that [C8mim]Br has toxic effects on the early embryonic development of the frog.

  19. Prevalence of the pathogenic chytrid fungus, Batrachochytrium dendrobatidis, in an endangered population of northern leopard frogs, Rana pipiens

    Directory of Open Access Journals (Sweden)

    Govindarajulu Purnima

    2010-03-01

    Full Text Available Abstract Background Emerging infectious diseases threaten naïve host populations with extinction. Chytridiomycosis, an emerging infectious disease of amphibians, is caused by the pathogenic fungus Batrachochytrium dendrobatidis (Bd and has been linked to global declines in amphibians. Results We monitored the prevalence of Bd for four years in the Northern leopard frog, Rana pipiens, which is critically imperiled in British Columbia (BC, Canada. The prevalence of Bd initially increased and then remained constant over the last three years of the study. Young of the year emerging from breeding ponds in summer were rarely infected with Bd. Some individuals cleared their Bd infections and the return rate between infected and uninfected individuals was not significantly different. Conclusions The BC population of R. pipiens appears to have evolved a level of resistance that allows it to co-exist with Bd. However, this small population of R. pipiens remains vulnerable to extinction.

  20. The quantitative genetic basis of adaptive divergence in the moor frog (Rana arvalis) and its implications for gene flow.

    Science.gov (United States)

    Hangartner, S; Laurila, A; Räsänen, K

    2012-08-01

    Knowledge on the relative contribution of direct genetic, maternal and environmental effects to adaptive divergence is important for understanding the drivers of biological diversification. The moor frog (Rana arvalis) shows adaptive divergence in embryonic and larval fitness traits along an acidification gradient in south-western Sweden. To understand the quantitative genetic basis of this divergence, we performed reciprocal crosses between three divergent population pairs and reared embryos and larvae at acid and neutral pH in the laboratory. Divergence in embryonic acid tolerance (survival) was mainly determined by maternal effects, whereas the relative contributions of maternal, additive and nonadditive genetic effects in larval life-history traits differed between traits, population pairs and rearing environments. These results emphasize the need to investigate the quantitative genetic basis of adaptive divergence in multiple populations and traits, as well as different environments. We discuss the implications of our findings for maintenance of local adaptation in the context of migrant and hybrid fitness.

  1. Ontogeny and distribution of cells in B lineage in the American leopard frog, Rana pipiens.

    Science.gov (United States)

    Zettergren, L D

    1982-01-01

    Two-color immunofluorescence techniques were used in order to trace the development and distribution of cells expressing immunoglobulin in Rana pipiens. Evidence is provided which suggests that (i) embryo-larval urogenital tissues are sites of generation of cells in B lineage, (ii) during ontogeny, there is a sequential expression of immunoglobulin isotypes on B cell surfaces, (iii) larvae are able to produce the full range of immunoglobulin clases found in adults, and (iv) at least two subpopulations of lymphocytes exist in Rana pipiens, sIg+ and sIg-; thymocytes and presumably peripheral T cells lack conventional surface immunoglobulin. Some ontogenetic and phylogenetic implications are discussed.

  2. Complete mitochondrial genome of a brown frog, Rana kunyuensis (Anura: Ranidae).

    Science.gov (United States)

    Li, Jiao; Yin, Wei; Xia, Rong; Lei, Guangchun; Fu, Cuizhang

    2016-01-01

    The first complete mitochondrial genome (mitogenome) of Rana sensu stricto (sensu Frost, 2013) was determined using Rana kunyuensis as a representative species. The mitogenome was 22,255 bp in length, including 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes and duplicated control regions. The mitogenome of R. kunyuensis showed novel gene order arrangement with a translocation of tRNA(Leu)((CUN)) and ND5 in comparison with published anuran mitogenomes to date. This mitogenome should contribute to understand the evolution of anuran mitochondrial gene order arrangements.

  3. [Analysis of helminthofauna of common spaedfoot Pelobates fuscus (Laurenti, 1768) and moor frog Rana arvalis Nilsson, 1842 (Amphibia: Anura) at their joint habitation].

    Science.gov (United States)

    Ruchin, A B; Chikhliaev, I V; Lukiianov, S V

    2009-01-01

    The helminths fauna of common spaedfoot Pelobates fuscus (Laurenti, 1768) and moor frog Rana arvalis Nilsson, 1842 has been studied at their joint habitation. The stuff was collected in 1998-2002, 2004-2006 years in several regions (republic Mordovia, Samara and Saratov areas). The processing of a stuff is conducted by a method of full helmintologic dissecting. The fauna of helminths considerably differs. For common spaedfoot only 13 species of helminths was detected which also parasitized moor frog (for moor frog 23 species) are detected. The index Jaccar demonstrated mean resemblance structure of helminths and varied from 0.25 till 0.69, and the index Morisite--from 44.58 of % till 74.51 of %. The communities of parasites of common spaedfoot was characterized by low values of an index of Shannon, but the high indexes of an index Simpson, whereas for moor frog tracked the return tendence.

  4. Subtle effects of environmental stress observed in the early life stages of the Common frog, Rana temporaria

    Science.gov (United States)

    Strong, Rebecca; Martin, Francis L.; Jones, Kevin C.; Shore, Richard F.; Halsall, Crispin J.

    2017-01-01

    Worldwide amphibian populations are declining due to habitat loss, disease and pollution. Vulnerability to environmental contaminants such as pesticides will be dependent on the species, the sensitivity of the ontogenic life stage and hence the timing of exposure and the exposure pathway. Herein we investigated the biochemical tissue ‘fingerprint’ in spawn and early-stage tadpoles of the Common frog, Rana temporaria, using attenuated total reflection-Fourier-transform infrared (ATR-FTIR) spectroscopy with the objective of observing differences in the biochemical constituents of the respective amphibian tissues due to varying water quality in urban and agricultural ponds. Our results demonstrate that levels of stress (marked by biochemical constituents such as glycogen that are involved in compensatory metabolic mechanisms) can be observed in tadpoles present in the pond most impacted by pollution (nutrients and pesticides), but large annual variability masked any inter-site differences in the frog spawn. ATR-FTIR spectroscopy is capable of detecting differences in tadpoles that are present in selected ponds with different levels of environmental perturbation and thus serves as a rapid and cost effective tool in assessing stress-related effects of pollution in a vulnerable class of organism. PMID:28317844

  5. Characterization of the Skin Microbiota in Italian Stream Frogs (Rana italica) Infected and Uninfected by a Cutaneous Parasitic Disease.

    Science.gov (United States)

    Federici, Ermanno; Rossi, Roberta; Fidati, Laura; Paracucchi, Romina; Scargetta, Silvia; Montalbani, Elena; Franzetti, Andrea; La Porta, Gianandrea; Fagotti, Anna; Simonceli, Francesca; Cenci, Giovanni; Di Rosa, Ines

    2015-01-01

    In human and wildlife populations, the natural microbiota plays an important role in health maintenance and the prevention of emerging infectious diseases. In amphibians, infectious diseases have been closely associated with population decline and extinction worldwide. Skin symbiont communities have been suggested as one of the factors driving the different susceptibilities of amphibians to diseases. The activity of the skin microbiota of amphibians against fungal pathogens, such as Batrachochytrium dendrobatidis, has been examined extensively, whereas its protective role towards the cutaneous infectious diseases caused by Amphibiocystidium parasites has not yet been elucidated in detail. In the present study, we investigated, for the first time, the cutaneous microbiota of the Italian stream frog (Rana italica) and characterized the microbial assemblages of frogs uninfected and infected by Amphibiocystidium using the Illumina next-generation sequencing of 16S rRNA gene fragments. A total of 629 different OTUs belonging to 16 different phyla were detected. Bacterial populations shared by all individuals represented only one fifth of all OTUs and were dominated by a small number of OTUs. Statistical analyses based on Bray-Curtis distances showed that uninfected and infected specimens had distinct cutaneous bacterial community structures. Phylotypes belonging to the genera Janthinobacterium, Pseudomonas, and Flavobacterium were more abundant, and sometimes almost exclusively present, in uninfected than in infected specimens. These bacterial populations, known to exhibit antifungal activity in amphibians, may also play a role in protection against cutaneous infectious diseases caused by Amphibiocystidium parasites.

  6. Disease associated with integumentary and cloacal parasites in tadpoles of northern red-legged frog Rana aurora aurora.

    Science.gov (United States)

    Nieto, Nathan C; Camann, Michael A; Foley, Janet E; Reiss, John O

    2007-10-31

    A total of 6830 northern red-legged frog Rana aurora aurora tadpoles were examined under a dissecting microscope for oral disc, integumentary, and cloacal abnormalities in 13 ponds in and near Redwood National Park in northern California. Of these, 163 tadpoles were collected for histopathological investigation, including 115 randomly collected individuals, 38 collected with oral disc abnormalities, and 10 collected due to severe morbidity of unknown etiology. The tadpoles were infected with 8 parasites, including Batrachochytrium dendrobatidis (the amphibian chytrid), trematodes, leeches, and protozoa. Chytridiomycosis was detected at an overall prevalence of 6.4%, but prevalence was higher in tadpoles with oral disc lesions than in those with normal oral discs (43.5% versus 6.1%). Interestingly, infection was associated with some environmental and co-infection risk factors. Individual tadpoles possessed 0 to 5 species of parasites in varying intensities. Apiosoma sp. was the most prevalent (66%) and widespread. Tadpoles infected with B. dendrobatidis had a lower diversity of oral parasites than those uninfected. During the field portion of the study, a large number (approximately 500) of moribund and dead tadpoles was seen occurring at multiple locations within and surrounding Redwood National Park. Ten animals were collected for histological examination and a diverse protozoal infection was discovered, including some known pathogens of fish. This study is the first reporting parasitism and disease in natural populations of northern red-legged frogs.

  7. The quality and fertility of sperm collected from European common frog (Rana temporaria) carcasses refrigerated for up to 7 days.

    Science.gov (United States)

    Shishova, Natalia V; Uteshev, Viktor K; Sirota, Nikolai P; Kuznetsova, Elena A; Kaurova, Svetlana A; Browne, Robert K; Gakhova, Edith N

    2013-01-01

    There is a catastrophic decrease in the biodiversity of amphibians coupled with the loss of genetic variation. The perpetuation of amphibian biodiversity demands a multifaceted approach, including the use of reproduction technologies (RTs), to enable efficient reproduction in captivity and to prevent the loss of genetic variation. Reproduction technologies for the storage of amphibian sperm for days to weeks, when refrigerated at 4°C, or for millennia when cryopreserved have recently undergone rapid development. Sperm from amphibians may be obtained through excision and maceration of testes; however, this is sometimes not possible with rare or endangered species. Alternate methods of obtaining sperm are through hormonal induction, or as spermatozoa from the carcasses of recently dead amphibians. The use of sperm from carcasses of recently dead amphibians is particularly valuable when sampled from genetically important founders in conservation breeding programs, or where catastrophic mortality is occurring in natural population. Sperm harvested over a period of 7 days from the testes of European common frog (Rana temporaria) carcasses stored in a refrigerator were assessed for percentage and progressive motility, cell membrane integrity, nuclear DNA fragmentation, and fertilizing ability. In addition, the survival of resulting embryos to hatch was recorded. Results indicated that some sperm of R. temporaria remain motile and fertile when harvested from frog carcasses refrigerated up to 7 days post-mortem, and resulting embryos can develop to hatch.

  8. Emerging Pathogen in Wild Amphibians and Frogs (Rana catesbeiana) Farmed for International Trade

    Science.gov (United States)

    Mazzoni, Rolando; Daszak, Peter; Apolo, Ada; Perdomo, Eugenio; Speranza, Gustavo

    2003-01-01

    Chytridiomycosis is an emerging disease responsible for global decline and extinction of amphibians. We report the causative agent, Batrachochytrium dendrobatidis, in North American bullfrogs (Rana catesbeiana) farmed for the international restaurant trade. Our findings suggest that international trade may play a key role in the global dissemination of this and other emerging infectious diseases in wildlife. PMID:12967500

  9. Leech presence on Iberian Brown Frog, Rana iberica, (Amphibia: Anura: Ranidae from north-western Spain

    Directory of Open Access Journals (Sweden)

    César Ayres

    2008-12-01

    Full Text Available The authors describe a case of parasitism on Rana iberica by two species of leeches, Batracobdella sp. and Hirudo medicinalis, in a mountainous area of north-western Spain. Conservation implications of high parasite load on small and isolated populations are discussed.

  10. Spatial Amphibian Impact Assessment – a management tool for assessment of road effects on regional populations of Moor frogs (Rana arvalis)

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt; Nachman, Gøsta Støger

    2013-01-01

    An expanding network of roads and railways fragments natural habitat affecting the amount and quality of habitat and reducing connectivity between habitat patches with severe consequences for biodiversity and population persistence. To ensure an ecologically sustainable transportation system it i...... demonstrate how SAIA can be used to assess which management measures would be best to mitigate the effect of landscape fragmentation caused by road constructions by means of a case study dedicated to the Moor frog (Rana arvalis)....

  11. Histopathological changes and erythrocytic nuclear abnormalities in Iberian green frogs (Rana perezi Seoane) from a uranium mine pond

    Energy Technology Data Exchange (ETDEWEB)

    Marques, S.M. [Departamento de Biologia/Centro de Estudos do Ambiente e do Mar (CESAM), Campus de Santiago, Universidade de Aveiro, 3810-193 Aveiro (Portugal)], E-mail: s.reis.marques@gmail.com; Antunes, S.C. [Departamento de Biologia/Centro de Estudos do Ambiente e do Mar (CESAM), Campus de Santiago, Universidade de Aveiro, 3810-193 Aveiro (Portugal); Pissarra, H. [Laboratorio de Anatomia Patologica, Centro de Investigacao Interdisciplinar em Sanidade Animal (CIISA), Faculdade de Medicina Veterinaria, U.T.L., Lisboa (Portugal); Pereira, M.L. [Departamento de Biologia/Centro de Investigacao em Materiais Ceramicos e Compositos (CICECO), Campus de Santiago, Universidade de Aveiro, 3810-193 Aveiro (Portugal); Goncalves, F.; Pereira, R. [Departamento de Biologia/Centro de Estudos do Ambiente e do Mar (CESAM), Campus de Santiago, Universidade de Aveiro, 3810-193 Aveiro (Portugal)

    2009-01-31

    In spite of their sensitivity to anthropogenic stressors, adults of Rana perezi Seoane were found inhabiting effluent ponds from a uranium mine. Due to the presence of such organisms in this environment, it becomes of paramount importance to assess the damages induced by local contamination on these aquatic vertebrates, in order to integrate this information on a site-specific risk assessment that is being carried out in the area. To attain this purpose an ethically and statistically acceptable number of green frogs were captured in the mine pond (M) and in a pristine river (VR), a few kilometres from the mine. Bioaccumulation of metals and histopathological alterations were evaluated in the liver, kidneys, spleen, lungs and testes of the animals. Simultaneously, blood samples were collected for the evaluation of genotoxic damage on erythrocytes. Animals captured in the M pond showed significantly increased levels of Be, Al, Mn, Fe and U in the liver, as well as Pb and U in the kidney. The liver was the main target organ for the bioaccumulation of Be, Al, Fe and U. However, renal histopathologies were more severe than those of liver. The main tissue alterations recorded in animals from the mine were: a slight increase in melanomacrophagic centers (MMC) in liver, lung and kidneys; dilatation of the renal tubules lumen associated with tubular necrosis. A significantly higher number of erythrocytic abnormalities (lobed, notched and kidney shaped nuclei and micronuclei) were recorded in frogs from M than in frogs from VR, along with a significantly lower frequency of immature erythrocytes. Both observations suggested that the removal of abnormal blood cells might be compromised.

  12. Recovery plan for the California Red-legged frog (Rana aurora draytonii)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objective of this plan is to reduce threats and improve the population status of the California red-legged frog sufficiently to warrant delisting. Actions...

  13. Alteration of the hypothalamic-pituitary-gonadal axis in estrogen- and androgen-treated adult male leopard frog, Rana pipiens

    Directory of Open Access Journals (Sweden)

    Jones Jeremy T

    2005-01-01

    Full Text Available Abstract Background Gonadal steroids, in particular 5 alpha-dihydrotestosterone (DHT and 17 beta-estradiol (E2, have been shown to feed back on the hypothalamic-pituitary-gonadal (HPG axis of the ranid frog. However, questions still remain on how DHT and E2 impact two of the less-studied components of the ranid HPG axis, the hypothalamus and the gonad, and if the feedback effects are consistently negative. Thus, the goal of the study was to examine the effects of DHT and E2 upon the HPG axis of the gonadally-intact, sexually mature male leopard frogs, Rana pipiens. Methods R. pipiens were implanted with silastic capsules containing either cholesterol (Ch, a control, DHT, or E2 for 10 or 30 days. At each time point, steroid-induced changes in hypothalamic GnRH and pituitary LH concentrations, circulating luteinizing hormone (LH, and testicular histology were examined. Results Frogs implanted with DHT or E2 for 10 days did not show significant alterations in the HPG axis. In contrast, frogs implanted with hormones for 30 days had significantly lower circulating LH (for both DHT and E2, decreased pituitary LH concentration (for E2 only, and disrupted spermatogenesis (for both DHT and E2. The disruption of spermatogenesis was qualitatively similar between DHT and E2, although the effects of E2 were consistently more potent. In both DHT and E2-treated animals, a marked loss of all pre-meiotic germ cells was observed, although the loss of secondary spermatogonia appeared to be the primary cause of disrupted spermatogenesis. Unexpectedly, the presence of post-meiotic germ cells was either unaffected or enhanced by DHT or E2 treatment. Conclusions Overall, these results showed that both DHT and E2 inhibited circulating LH and disrupted spermatogenesis progressively in a time-dependent manner, with the longer duration of treatment producing the more pronounced effects. Further, the feedback effects exerted by both steroid hormones upon the HPG axis were

  14. Rangewide phylogeography and landscape genetics of the Western U.S. endemic frog Rana boylii (Ranidae): Implications for the conservation of frogs and rivers

    Science.gov (United States)

    Lind, A.J.; Spinks, P.Q.; Fellers, G.M.; Shaffer, H.B.

    2011-01-01

    Genetic data are increasingly being used in conservation planning for declining species. We sampled both the ecological and distributional limits of the foothill yellow-legged frog, Rana boylii to characterize mitochondrial DNA (mtDNA) variation in this declining, riverine amphibian. We evaluated 1525 base pairs (bp) of cytochrome b and ND2 fragments for 77 individuals from 34 localities using phylogenetic and population genetic analyses. We constructed gene trees using maximum likelihood and Bayesian inference, and quantified genetic variance (using AMOVA and partial Mantel tests) within and among hydrologic regions and river basins. Several moderately supported, geographically-cohesive mtDNA clades were recovered for R. boylii. While genetic variation was low among populations in the largest, most inclusive clade, samples from localities at the edges of the geographic range demonstrated substantial genetic divergence from each other and from more central populations. Hydrologic regions and river basins, which represent likely dispersal corridors for R. boylii, accounted for significant levels of genetic variation. These results suggest that both rivers and larger hydrologic and geographic regions should be used in conservation planning for R. boylii. ?? 2010 US Government.

  15. Ameliorative effects of sodium chloride on acute copper toxicity among Cope's gray tree frog (Hyla chrysoscelis) and green frog (Rana clamitans) embryos.

    Science.gov (United States)

    Brown, Maria G; Dobbs, Emily K; Snodgrass, Joel W; Ownby, David R

    2012-04-01

    Urban stormwater runoff is composed of a mixture of components, including polycyclic aromatic hydrocarbons, metals, deicing agents, and many others. The fate of these chemicals is often in stormwater detention ponds that are used by amphibians for breeding. Among aquatic organisms, the toxic mechanism for many metals involves interference with active Na(+) and Cl(-) uptake. Addition of cations has been shown to reduce the toxicity of metals among some aquatic organisms through competitive inhibition, but no studies have investigated the interaction between NaCl and Cu among amphibian embryos and larvae. To determine the degree to which NaCl may ameliorate the toxicity of Cu to amphibian embryos and larvae, the authors exposed Hyla chrysoscelis (Cope's gray treefrogs) and Rana (Lithobates) clamitans (green frogs) to seven levels of Cu and NaCl in fully factorial experiments. When exposure was in artificial hard water, Cu was highly toxic to both species (96-h median lethal concentration [LC50] of 44.7 µg/L and 162.6 µg/L for H. chrysoscelis and R. clamitans, respectively). However, approximately 500 mg/L of NaCl eliminated Cu toxicity over the range of Cu concentrations used in the experiments (maximum 150 µg Cu/L for H. chrysoscelis and 325 µg Cu/L for R. clamitans). The current results suggest that NaCl is likely responsible for the toxic effects of NaCl and metal mixtures that might be typical of runoff from road surfaces in northern latitudes.

  16. The influence of water quality on the embryonic survivorship of the Oregon spotted frog (Rana pretiosa) in British Columbia, Canada.

    Science.gov (United States)

    McKibbin, René; Dushenko, William T; vanAggelen, Graham; Bishop, Christine A

    2008-05-20

    In Canada, the Oregon spotted frog (Rana pretiosa) is a critically endangered species with only three known populations and an estimated breeding population of less than 400 located in isolated sites in the extreme south-west corner of British Columbia. Floating Nitex cages were used to assess embryonic survivorship in two populations of Oregon spotted frogs from 2002-2005. One population, near Aldergrove, BC experienced declines in population size while the other population, at Maria Slough, increased during the period 1997-2001. During embryo development, we measured trace metals, nutrients and physical parameters in the water at each site. These were used to test the hypothesis that water quality parameters were correlated with embryonic survivorship. During the study period in the declining population at Aldergrove R. pretiosa bred at two distinct sub sites (A and B) located 500 m apart within the wetland. Mean embryonic survivorship varied from 9% to 36% at sub site A and from 78% to 88% at sub site B whereas in the population in Maria Slough, the mean embryonic survivorship varied from 77% to 84%. Sulphate was the only water chemistry variable that differed significantly between the two study sites and was the highest at Maria Slough. A weak significant positive correlation was found between chloride and embryonic survivorship and conductivity and embryonic survivorship. A multiple regression model found conductivity was the only significant variable. We concluded that natural water chemistry conditions of low chloride and consequently low conductivity may be contributing to low embryonic survivorship in the population of R. pretiosa at MD Aldergrove, BC.

  17. Status of the California Red-legged Frog (Rana draytonii) in the State of Baja California, México

    Science.gov (United States)

    Peralta-Garcia, Anny; Hellingsworth, Bradford D.; Richmond, Jonathan Q.; Valdez-Villavicencio, Jorge H.; Ruiz-Campos, Gorgonio; Fisher, Robert N.; Cruz-Hernandez, Pedro; Galina-Tessaro, Patricia

    2016-01-01

    The California Red-legged Frog (Rana draytonii) is a threatened species in the United States that has undergone population declines, especially in southern California. Due to the lack of information on the status of Mexican populations, we surveyed for the presence of R. draytonii in Baja California and assessed possible threats to population persistence. Our study area extended from the U.S.-Mexican border to the southern end of the distribution of the species in the Sierra San Pedro Mártir. We found R. draytonii at six of 15 historical sites, none at five proxy sites (i.e., alternative sites chosen because the historical record lacked precise locality data), and four at 24 additional sites. The 10 occupied sites are within three watersheds in the Sierra San Pedro Mártir (two sites at Arroyo San Rafael, two sites at Arroyo San Telmo, and six sites at Arroyo Santo Domingo). We did not detect R. draytonii at 60% of historical sites, including the highest elevation site at La Encantada and multiple low-elevation coastal drainages, suggesting the species has declined in Baja California. The threats we noted most frequently were presence of exotic aquatic animal species, water diversion, and cattle grazing. Management of remaining populations and local education is needed to prevent further declines.

  18. Conservation genetics of evolutionary lineages of the endangered mountain yellow-legged frog, Rana muscosa (Amphibia: Ranidae), in southern California

    Science.gov (United States)

    Schoville, Sean D.; Tustall, Tate S.; Vredenburg, Vance T.; Backlin, Adam R.; Gallegos, Elizabeth; Wood, Dustin A.; Fisher, Robert N.

    2011-01-01

    Severe population declines led to the listing of southern California Rana muscosa (Ranidae) as endangered in 2002. Nine small populations inhabit watersheds in three isolated mountain ranges, the San Gabriel, San Bernardino and San Jacinto. One population from the Dark Canyon tributary in the San Jacinto Mountains has been used to establish a captive breeding population at the San Diego Zoo Institute for Conservation Research. Because these populations may still be declining, it is critical to gather information on how genetic variation is structured in these populations and what historical inter-population connectivity existed between populations. Additionally, it is not clear whether these populations are rapidly losing genetic diversity due to population bottlenecks. Using mitochondrial and microsatellite data, we examine patterns of genetic variation in southern California and one of the last remaining populations of R. muscosa in the southern Sierra Nevada. We find low levels of genetic variation within each population and evidence of genetic bottlenecks. Additionally, substantial population structure is evident, suggesting a high degree of historical isolation within and between mountain ranges. Based on estimates from a multi-population isolation with migration analysis, these populations diversified during glacial episodes of the Pleistocene, with little gene flow during population divergence. Our data demonstrate that unique evolutionary lineages of R. muscosa occupy each mountain range in southern California and should be managed separately. The captive breeding program at Dark Canyon is promising, although mitigating the loss of neutral genetic diversity relative to the natural population might require additional breeding frogs.

  19. Evolutionary dynamics of a rapidly receding southern range boundary in the threatened California red-legged frog (Rana draytonii)

    Science.gov (United States)

    Richmond, Jonathan Q.; Barr, Kelly R.; Backlin, Adam R.; Vandergast, Amy G.; Fisher, Robert N.

    2013-01-01

    Populations forming the edge of a species range are often imperiled by isolation and low genetic diversity, with proximity to human population centers being a major determinant of edge stability in modern landscapes. Since the 1960s, the California red-legged frog (Rana draytonii) has undergone extensive declines in heavily urbanized southern California, where the range edge has rapidly contracted northward while shifting its cardinal orientation to an east-west trending axis. We studied the genetic structure and diversity of these frontline populations, tested for signatures of contemporary disturbance, specifically fire, and attempted to disentangle these signals from demographic events extending deeper into the past. Consistent with the genetic expectations of the ‘abundant-center’ model, we found that diversity, admixture, and opportunity for random mating increases in populations sampled successively further away from the range boundary. Demographic simulations indicate that bottlenecks in peripheral isolates are associated with processes extending tens to a few hundred generations in the past, despite the demographic collapse of some due to recent fire-flood events. While the effects of recent disturbance have left little genetic imprint on these populations, they likely contribute to an extinction debt that will lead to continued range contraction unless management intervenes to stall or reverse the process.

  20. Local adaptation with high gene flow: temperature parameters drive adaptation to altitude in the common frog (Rana temporaria).

    Science.gov (United States)

    Muir, A P; Biek, R; Thomas, R; Mable, B K

    2014-02-01

    Both environmental and genetic influences can result in phenotypic variation. Quantifying the relative contributions of local adaptation and phenotypic plasticity to phenotypes is key to understanding the effect of environmental variation on populations. Identifying the selective pressures that drive divergence is an important, but often lacking, next step. High gene flow between high- and low-altitude common frog (Rana temporaria) breeding sites has previously been demonstrated in Scotland. The aim of this study was to assess whether local adaptation occurs in the face of high gene flow and to identify potential environmental selection pressures that drive adaptation. Phenotypic variation in larval traits was quantified in R. temporaria from paired high- and low-altitude sites using three common temperature treatments. Local adaptation was assessed using Q(ST)-F(ST) analyses, and quantitative phenotypic divergence was related to environmental parameters using Mantel tests. Although evidence of local adaptation was found for all traits measured, only variation in larval period and growth rate was consistent with adaptation to altitude. Moreover, this was only evident in the three mountains with the highest high-altitude sites. This variation was correlated with mean summer and winter temperatures, suggesting that temperature parameters are potentially strong selective pressures maintaining local adaptation, despite high gene flow.

  1. Relationship between epithelial and connective tissues in the stomach of the frog Rana temporaria during metamorphosis: an ultrastructural study.

    Science.gov (United States)

    Villaro, A C; Rovira, J; Bodegas, M E; Burrell, M A; Sesma, P

    1998-08-01

    In the course of metamorphosis of the stomach of Rana temporaria tadpoles there is a marked increase in the amount of active mesenchymal fibroblasts and extracellular matrix underlying the regenerating gastric epithelium. At the onset of metamorphosis, a thick PAS-positive basement membrane is developed around the epithelial component of the mucosa, formed by the apical, degenerating larval epithelium and the basal, regenerative epithelial cords. Under the electron microscope, a folded basement membrane is usually revealed under the apical degenerating epithelium while a compact basement membrane (up to 1-2 microns thick), forming both patches and more extensive areas, is frequently seen around the regenerative glandular cords. Cytoplasmic processes, extending from both the epithelial and mesenchymal fibroblastic cells, cross the basement membrane and make physical contact between the two cellular types. At mid-metamorphosis areas of thick PAS-positive basement membrane are still observed around the differentiating glandular outlines, before disappearing completely at late metamorphosis. The probable involvement of intertissue interactions between epithelium and connective elements in the morphogenesis, proliferation and differentiation of secondary, definitive frog stomach is discussed. Early contacts between epithelium and phagocytes, probably related to the invasion of epithelium by the phagocytic cells, have also been observed.

  2. Predator mediated selection and the impact of developmental stage on viability in wood frog tadpoles (Rana sylvatica

    Directory of Open Access Journals (Sweden)

    Calsbeek Ryan

    2011-12-01

    Full Text Available Abstract Background Complex life histories require adaptation of a single organism for multiple ecological niches. Transitions between life stages, however, may expose individuals to an increased risk of mortality, as the process of metamorphosis typically includes developmental stages that function relatively poorly in both the pre- and post-metamorphic habitat. We studied predator-mediated selection on tadpoles of the wood frog, Rana sylvatica, to identify this hypothesized period of differential predation risk and estimate its ontogenetic onset. We reared tadpoles in replicated mesocosms in the presence of the larval odonate Anax junius, a known tadpole predator. Results The probability of tadpole survival increased with increasing age and size, but declined steeply at the point in development where hind limbs began to erupt from the body wall. Selection gradient analyses indicate that natural selection favored tadpoles with short, deep tail fins. Tadpoles resorb their tails as they progress toward metamorphosis, which may have led to the observed decrease in survivorship. Path models revealed that selection acted directly on tail morphology, rather than through its indirect influence on swimming performance. Conclusions This is consistent with the hypothesis that tail morphology influences predation rates by reducing the probability a predator strikes the head or body.

  3. Prolonged relaxation after stimulation of the clasping muscle of male frog, Rana japonica, during the breeding season.

    Science.gov (United States)

    Ishii, Yoshiki; Tsuchiya, Teizo

    2010-07-01

    We investigated the mechanical properties of the flexor carpi radialis muscle (FCR), a forelimb muscle used mainly for amplexus in the breeding season (February to March), of the male Japanese brown frog, Rana japonica. In the present experiment, the changes in force and stiffness of the FCR before, during, and after contraction were measured at 4 degrees C. The total time from the end of stimulation to the end of relaxation was about 30 min. The time course of this prolonged relaxation was fitted by two exponential decay processes. Stiffness decreased during prolonged relaxation, but stayed higher than force, when normalized to peak values. These mechanical properties of the FCR were different from those of the glutaeus magnus muscle (GM) in the hindlimb, used for jumping. When a quick release was applied to the FCR during relaxation, the force recovered gradually after a sudden decrease. The time course of this force recovery was fitted by a single exponential term, and the rate constant decreased as the prolonged relaxation proceeded. The possible involvement of active process(es) in the prolonged relaxation is discussed.

  4. Accumulation and pharmacokinetics of estrogenic chemicals in the pre- and post-hatch embryos of the frog Rana rugosa.

    Science.gov (United States)

    Takase, Minoru; Shinto, Hideaki; Takao, Yuji; Iguchi, Taisen

    2012-01-01

    Amphibian eggs spawned in water are exposed immediately to various chemicals present in their water. The present study aimed to investigate the accumulation and pharmacokinetics of 17α-ethynylestradiol (EE(2)), bisphenol A (BPA), and nonylphenol (NP), as well as 17β-estradiol (E(2)), in the pre-hatch and post-hatch embryos of the frog Rana rugosa. Fertilized eggs were exposed to chemicals at a final concentration of 500 nM in breeding water for two days, then the embryos with jelly coats were reared in fresh-breeding water without supplementation of the xenoestrogens for six more days. All exogenous chemicals were concentrated in the embryo body at two days after fertilization, whereas their concentrations in the jelly coat were the same as those in the breeding water. The bioconcentration factors for E(2), EE(2), BPA, and NP were 217.9, 170.2, 382.3, and 289.1, respectively, suggesting that the estrogenic chemicals were concentrated in the embryo body through the jelly coat.

  5. Alterations of biochemical parameters in malformed Indian rice frogs, Rana limnocharis from Southern Taiwan.

    Science.gov (United States)

    Chiu, Yuh-Wen; Wang, Shu-Yin; Wu, Jui-Pin; Huang, Da-Ji

    2011-11-01

    The purpose of this study is to investigate the factors that cause malformed frogs in upstream Kaoping river (KP site) and Tungkang river (T site) of Southern Taiwan. In this experiment, the activities of monooxygenase (MO), glutathione-S-transferase (GST), acetylcholinesterase (AchE) as well as the concentration of vitellogenin (Vg) in the liver were measured. Results show that activities of MO, GST and AchE, and Vg levels in normal frogs (male/female) were 0.09 +/- 0.02/0.09+/-0.01 deltaA min(-1) mg(-1) protein, 0.12 +/- 0.04/0.13 +/- 0.04 deltaA min(-1) mg(-1) protein, 6.13 +/- 2.69/6.01 +/- 2.09 U mg(-1) protein and 0.87 +/- 0.42/2.18 +/- 0.50 microg mg(-1) protein, respectively. Activities of MO, GST and AchE, and Vg levels in malformed frogs (male/female) were 0.15 +/- 0.04/0.21 +/- 0.07 deltaA min(-1) mg(-1) protein, 0.27 +/- 0.08/0.30 +/- 0.12 deltaA min(-1) mg(-1) protein, 4.59 +/- 2.71/5.19 +/- 3.74 U mg(-1) protein and 1.46 +/- 0.61/3.15 +/- 0.88 microg mg(-1) protein, respectively in KP site, and were 0.16 +/- 0.69/0.1 +/- 80.07 deltaA min(-1) mg(-1) protein, 0.21 +/- 0.07/0.24 +/- 0.08 deltaA min(-1) mg(-1) protein, 5.13 +/- 4.58/3.94 +/- 1.33 U mg(-1) protein and 2.23 +/- 1.47/4.11 +/- 1.63 microg mg(-1) protein, respectively in T site. These results indicate that male and female malformed frogs in both rivers upstream are found with higher activities. No significant difference in AchE activity was found between normal and malformed frogs in this investigation. It is therefore reasonable to speculate that the organic chemicals released from agricultural activities are presumable the main factors that lead to the malformation of frogs.

  6. Effects of oil sands waste water on the wood frog (rana sylvatica)

    Energy Technology Data Exchange (ETDEWEB)

    Hersikorn, B.; Smits, J.E. [Saskatchewan Univ., Regina, SK (Canada)

    2007-07-01

    The sustainability of various reclamation strategies can be determined by the growth and health of indigenous amphibians (Wood Frogs). This paper referred to the large quantities of tailings water that are generated by oil sand extraction activities. It presented the results of a study that was conducted in the spring and summer of 2006 and 2007 on reclaimed formation wetlands comprising tailings water. The objective was to understand the impact of these wetlands on native amphibians. Frogs were exposed to wetlands containing oil sands process affected water (OSPW) and reference water (no OSPW). Six experimental trenches were made at one site in the first year. Each trench had 3 enclosures with 50 tadpoles. In the second year, there were 13 sites, including 6 reference and 7 OSPW affected sites, which were classified as old (more than 8 yrs) or young (less than 7 yrs). Four enclosures, with 50 tadpoles each, were placed in each wetland. The study involved the evaluation of growth rate, survival, time to metamorphosis, thyroid hormone concentrations, liver EROD activity, and tissue retinol concentrations. In addition, stable isotopes were used to track carbon flow from primary production plants, through the food chain, to tadpoles and frogs which represent intermediate and higher trophic levels in reclaimed wetlands.

  7. Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata.

    Science.gov (United States)

    Ma, Yufang; Liu, Cunbao; Liu, Xiuhong; Wu, Jing; Yang, Hailong; Wang, Yipeng; Li, Jianxu; Yu, Haining; Lai, Ren

    2010-01-01

    Much attention has been paid on amphibian peptides for their wide-ranging pharmacological properties, clinical potential, and gene-encoded origin. More than 300 antimicrobial peptides (AMPs) from amphibians have been studied. Peptidomics and genomics analysis combined with functional test including microorganism killing, histamine-releasing, and mast cell degranulation was used to investigate antimicrobial peptide diversity. Thirty-four novel AMPs from skin secretions of Rana nigrovittata were identified in current work, and they belong to 9 families, including 6 novel families. Other three families are classified into rugosin, gaegurin, and temporin family of amphibian AMP, respectively. These AMPs share highly conserved preproregions including signal peptides and spacer acidic peptides, while greatly diversified on mature peptides structures. In this work, peptidomics combined with genomics analysis was confirmed to be an effective way to identify amphibian AMPs, especially novel families. Some AMPs reported here will provide leading molecules for designing novel antimicrobial agents.

  8. Effects of exposure to ultraviolet light on the development of Rana pipiens, the northern leopard frog

    Energy Technology Data Exchange (ETDEWEB)

    Williams, J.J.; Wofford, H.W. [Union Univ., Jackson, TN (United States)

    1996-10-01

    The increase in ultraviolet light intensity levels due to ozone depletion recently has been linked to the decline in amphibian population. In this experiment, eggs and larvae of Rana pipiens were subjected to differing amounts of ultraviolet radiation to determine the effects of ultraviolet light on the development of amphibian tadpoles. The total length, length of body without tail, and maximum width of each specimen was recorded for a month of the tadpoles` development, including several measurements after the ultraviolet exposures were concluded. It was found that ultraviolet exposure significantly reduced the size of the organisms in comparison with the control group in all three measured areas. Ultraviolet radiation altered the health and appearance of the exposed organisms and was lethal at large amounts. This experiment showed that ultraviolet radiation could cause many problems in developing amphibians. By slowing their development and physically weakening predation, thus contributing to a decline in overall population levels.

  9. Tricaine (MS-222) is a safe anesthetic compound compared to benzocaine and pentobarbital to induce anesthesia in leopard frogs (Rana pipiens).

    Science.gov (United States)

    Cakir, Yavuz; Strauch, Stephen M

    2005-01-01

    Tricaine (MS-222) is used commonly for sedation, immobilization, and anesthesia of poikilothermic animals. The anesthetic efficacy of different concentrations of MS-222 was compared to benzocaine and pentobarbital on the physiological changes, heart rate and ECG (electrocardiogram) parameters in the leopard frog, Rana pipiens. Loss of righting reflex (RR), loss of pain response (NR = nociceptor response) and recovery time were measured. Heart rate and ECG parameters were also tested before and during anesthesia. The time to loss of RR and NR decreased while recovery time markedly increased with the increasing concentration of MS-222. Benzocaine at 200 mg/l induced a rapid anesthesia, but all frogs needed resuscitation. Pentobarbital at 300 mg/l induced a slow anesthesia, however, all of the frogs also needed resuscitation. All anesthetics at the mentioned concentrations decreased heart rate significantly as well as altered the ECG parameters. All anesthetics prolonged the Q-T interval, and MS-222 at 800 mg/l and benzocaine at 200 mg/l were the most effective anesthetic concentrations in increasing the Q-T interval. Frogs anesthetized by benzocaine and pentobarbital and high concentrations of MS-222 required resuscitation due to hypoxia. Pentobarbital and benzocaine seem to be very effective compounds, but their safety margins are narrow because of ventilatory failure. Therefore, MS-222 at a concentration of 200 mg/l or less is highly recommended for leopard frogs because prolonged recovery, high mortality rate and significant ECG changes are observed with higher concentrations of MS-222.

  10. Comparison of diet, reproductive biology, and growth of the pig frog (Rana grylio) from harvested and protected areas of the Florida Everglades

    Science.gov (United States)

    Ugarte, C.A.; Rice, K.G.; Donnelly, M.A.

    2007-01-01

    Distinct differences in body size exist among three Rana grylio populations in areas of the Florida Everglades that differ in frog harvest pressure and hydroperiod. Frogs from two populations are harvested regularly throughout the year, while those in the third are protected from harvest. We compared seasonal and sex differences in diet, reproduction, and growth across these populations to examine life-history patterns. By volume, crayfish and anurans were the most abundant prey items for all adults across sites. Frogs from drier sites consumed more crayfish than frogs from the wettest site. Anurans were abundant in the diet during the wet season, while crayfish and fish were abundant during the dry season. More frogs with empty stomachs were captured during the wet season than the dry season. Feeding, growth, and fat deposition were greatest during the dry season across all sites. Although females were found in all reproductive stages throughout the year, the highest percentage of females had mature ova during the late dry season and spent ovaries during the early wet season. Individual patterns of growth were similar across all sites and matched historical growth data from the 1950s. Differences in body size among sites were most likely attributable to differential mortality (i.e., harvest pressure, predation) rather than to differences in food access or growth. ?? 2007 by the American Society of Ichthyologists and Herpetologists.

  11. Analysis of skin and secretions of Dybowski's frogs (Rana dybowskii) exposed to Staphylococcus aureus or Escherichia coli identifies immune response proteins.

    Science.gov (United States)

    Xiao, Xiang-Hong; Miao, Hui-Min; Xu, Yi-Gang; Zhang, Jing-Yu; Chai, Long-Hui; Xu, Jia-Jia

    2014-04-01

    The aim of the present study was to investigate responses in Dybowski's frogs (Rana dybowskii) exposed to bacteria, using proteomic and transcriptomic approaches. Staphylococcus aureus and Escherichia coli were used as representative Gram-positive and Gram-negative bacteria, respectively, in an infectious challenge model. Frog skin and skin secretions were collected and protein expression in infected frogs compared to control frogs by two-dimensional gel electrophoresis, silver staining, and image analysis. Proteins that demonstrated differential expression were analysed by mass spectrometry and identified by searching protein databases. More than 180 protein spots demonstrated differential expression in E. coli- or S. aureus-challenged groups and, of these, more than 55 spots were up- or down-regulated at least sixfold, post-infection. Proteins with a potential function in the immune response were identified, such as stathmin 1a, annexin A1, superoxide dismutase A, C-type lectin, lysozyme, antimicrobial peptides, cofilin-1-B, mannose receptor, histone H4, prohormone convertase 1, carbonyl reductase 1 and some components of the Toll-like receptor (TLR) signalling pathway. These molecules are potential candidates for further investigation of immune mechanisms in R. dybowskii; in particular, TLR-mediated responses, which might be activated in frogs exposed to pathogenic bacteria as part of innate immune defence, but which might also impact on adaptive immunity to infection.

  12. Spatio-temporal Dynamics of Pond Use and Recruitment in Florida Gopher Frogs (Rana Capito aesopus)

    Energy Technology Data Exchange (ETDEWEB)

    Greenberg, C.H.

    2000-05-16

    We examined spatio-temporal dynamics of the Florida Gopher frog breeding and juvenile recruitment. Ponds were situated in a hardwood or pine-savanna matrix of upland forest. Movement was monitored from 1994-1999. Adult pond use was low but relatively constant. Juvenile recruitment was higher in the upland savanna matrix. Body size was negatively correlated with the number of juveniles exiting the pond in only one year suggesting intraspecific competition is one of many factors. Most immigration occurred in May through August and was unrelated to rainfall.

  13. Foraging behaviour in tadpoles of the bronze frog Rana temporalis: Experimental evidence for the ideal free distribution

    Indian Academy of Sciences (India)

    Dheeraj K Veeranagoudar; Bhagyashri A Shanbhag; Srinivas K Saidapur

    2004-06-01

    The ability of bronze frog Rana temporalis tadpoles (pure or mixed parental lines) to assess the profitability of food habitats and distribute themselves accordingly was tested experimentally using a rectangular choice tank with a non-continuous input design. Food (boiled spinach) was placed at two opposite ends of the choice tank in a desired ratio (1 : 1, 1 : 2 or 1 : 4) to create habitat A and B. The tadpoles in Gosner stage 28–33, pre-starved for 24 h, were introduced in an open ended mesh cylinder placed in the center of the choice tank, held for 4 min (for acclimation) and then released to allow free movement and habitat selection. The number of tadpoles foraging at each habitat was recorded at 10, 15, 20, 25 and 30 min time intervals. The actual suitability, (the food available in a habitat after colonization of tadpoles) of each habitat was obtained from the equation = - () where is basic suitability (amount of food provided at each habitat before release of tadpoles), is the rate of depletion of food (lowering effect) with introduction of each tadpole, and is the density of tadpoles in habitat . The expected number of tadpoles at each habitat was derived from the actual suitability. With no food in the choice tank, movement of the tadpoles in the test arena was random indicating no bias towards any end of the choice tank or the procedure. In tests with a 1 : 1 food ratio, the observed ratio of tadpoles (11.71 : 12.28) was comparable with the expected 12 : 12 ratio. The observed number of tadpoles in the habitats with a 1 : 2 food ratio was 8.71 : 15.29 and 7.87 : 16.13 for pure and mixed parental lines respectively. In both cases, the observed ratios were close to the expected values (7 : 17). Likewise, in experiments with a 1 : 4 food ratio, the observed number of tadpoles in the two habitats (10.78 : 37.22) did not differ significantly from the expected ratio of 7 : 41. In all tests, the number of R. temporalis tadpoles matched ideally with

  14. Cryptic invasion of Northern Leopard Frogs (Rana pipiens) across phylogeographic boundaries and a dilemma for conservation of a declining amphibian

    Science.gov (United States)

    O'Donnell, Ryan P.; Drost, Charles A.; Mock, Karen E.

    2017-01-01

    Anthropogenic introduction of species is a major contributor to loss of biodiversity. Translocations within the range of a species are less frequently recognized, but have the potential for negative effects as well. Genetic mixing may lead to loss of local adaptations or further decline through outbreeding depression. These cryptic invasions may be quite difficult to recognize, but genetic tools can be used to recognize and monitor such intraspecific introductions. Conversely, translocations within species can be an important conservation tool to reduce inbreeding depression and replace lost genetic diversity. Thus, cryptic invasions can be either an aid or a hindrance to conservation efforts. We tested for the presence of non-native genotypes and assessed the extent and nature of introgression in populations of Northern Leopard Frog (Rana pipiens) in the southwestern US, where populations have declined to a few remnant populations. The most abundant and diverse complex of populations in the region contained a mitochondrial haplotype that was not native to the western US, probably resulting from the introduction of released pets, laboratory animals, or release during fish stocking. These non-native haplotypes were well integrated into a large complex of ponds and lakes, contributing to high genetic diversity in this area. Logistically, the geographic extent of non-native genetic influence within this population precludes eliminating or controlling the non-native component of this population. We recommend assessing the progress and fate of the introgression over time—along with population fitness parameters—to determine whether this introduction is beneficial or detrimental to population persistence. Meanwhile, translocations from nearby locations with similar environmental conditions have the best prospects for avoiding problems with outbreeding depression in other declining populations and will also most effectively preserve regional genetic diversity.

  15. A de novo Assembly of the Common Frog (Rana temporaria Transcriptome and Comparison of Transcription Following Exposure to Ranavirus and Batrachochytrium dendrobatidis.

    Directory of Open Access Journals (Sweden)

    Stephen J Price

    Full Text Available Amphibians are experiencing global declines and extinctions, with infectious diseases representing a major factor. In this study we examined the transcriptional response of metamorphic hosts (common frog, Rana temporaria to the two most important amphibian pathogens: Batrachochytrium dendrobatidis (Bd and Ranavirus. We found strong up-regulation of a gene involved in the adaptive immune response (AP4S1 at four days post-exposure to both pathogens. We detected a significant transcriptional response to Bd, covering the immune response (innate and adaptive immunity, complement activation, and general inflammatory responses, but relatively little transcriptional response to Ranavirus. This may reflect the higher mortality rates found in wild common frogs infected with Ranavirus as opposed to Bd. These data provide a valuable genomic resource for the amphibians, contribute insight into gene expression changes after pathogen exposure, and suggest potential candidate genes for future host-pathogen research.

  16. Induction of cytochrome P450-associated monooxygenases in northern leopard frogs, Rana pipiens, by 3,3',4,4',5-pentachlorobiphenyl

    Science.gov (United States)

    Huang, Y.-W.; Melancon, M.J.; Jung, R.E.; Karasov, W.H.

    1998-01-01

    Northern leopard frogs (Rana pipiens) were injected intraperitoneally either with a solution of polychlorinated biphenyl (PCB) 126 in corn oil at a concentration of 0.2, 0.7, 2.3 and 7.8 mg/kg body weight or with corn oil alone. Appropriate assay conditions with hepatic microsomes were determined for four cytochrome P450-associated monooxygenases: ethoxyresorufin-O-dealkylase (EROD), methoxy-ROD (MROD), benzyloxy-ROD (BROD) and pentoxy-ROD (PROD). One week after PCB administration, the specific activities of EROD, MROD, BROD and PROD were not elevated at doses ? 0.7 mg/kg (p > 0.05), but were significantly increased at doses ? 2.3 mg/kg compared to the control groups (p frogs.

  17. Within-population polymorphism of sex-determination systems in the common frog (Rana temporaria).

    Science.gov (United States)

    Rodrigues, N; Betto-Colliard, C; Jourdan-Pineau, H; Perrin, N

    2013-07-01

    In sharp contrast with birds and mammals, the sex chromosomes of ectothermic vertebrates are often undifferentiated, for reasons that remain debated. A linkage map was recently published for Rana temporaria (Linnaeus, 1758) from Fennoscandia (Eastern European lineage), with a proposed sex-determining role for linkage group 2 (LG2). We analysed linkage patterns in lowland and highland populations from Switzerland (Western European lineage), with special focus on LG2. Sibship analyses showed large differences from the Fennoscandian map in terms of recombination rates and loci order, pointing to large-scale inversions or translocations. All linkage groups displayed extreme heterochiasmy (total map length was 12.2 cM in males, versus 869.8 cM in females). Sex determination was polymorphic within populations: a majority of families (with equal sex ratios) showed a strong correlation between offspring phenotypic sex and LG2 paternal haplotypes, whereas other families (some of which with female-biased sex ratios) did not show any correlation. The factors determining sex in the latter could not be identified. This coexistence of several sex-determination systems should induce frequent recombination of X and Y haplotypes, even in the absence of male recombination. Accordingly, we found no sex differences in allelic frequencies on LG2 markers among wild-caught male and female adults, except in one high-altitude population, where nonrecombinant Y haplotypes suggest sex to be entirely determined by LG2. Multifactorial sex determination certainly contributes to the lack of sex-chromosome differentiation in amphibians. © 2013 The Authors. Journal of Evolutionary Biology © 2013 European Society For Evolutionary Biology.

  18. Supplementary studies of Pleurogenoides medians (Digenea: Lecithodendriidae infecting the Marsh frog Rana Ridibunda (Amphibia: Ranidae in Egypt

    Directory of Open Access Journals (Sweden)

    Rewaida Abdel-Gaber

    2017-06-01

    Full Text Available Pleurogenoides medians, a digenean lecithodendriid trematode, parasitize numerous aquatic vertebrate species including frogs, freshwater fish, urodeles and anurans. In the present study, a total of 190 out of 300 (63.33% marsh frogs Rana Ridibunda were found to be infected with this digenean parasite. The highest percentage of infection was recorded in winter reaching 93.33%, and the lowest value was recorded to be 6.66% during summer. Prevalence and intensity of infection were positively correlated with the host size. Host sex showed no effect in this respect. Morphological studies based on light and scanning electron microscopy revealed that the adult worms characterized by small body size measured 1.980–2.430 (2.205 ± 0.1 mm long and 0.870–1.20 (9.87 ± 0.01 mm wide with spines of similar size distributed all over the body surface; oral sucker is sub-terminal and measured 0.180–0.230 (0.203 ± 0.01 mm long and 0.120–0.180 (0.150 ± 0.01 mm wide; ventral sucker is smaller than the oral sucker, post-ovarian located at 1/3 level from the anterior end and measured 0.080–0.102 (0.090 ± 0.001 mm long and 0.100–0140 (0.120 ± 0.001 mm wide; two symmetrical testes were located near the cecal termination on both sides of the ventral sucker, measured 0.153–0.193 (0.176 ± 0.01 mm long and 0.160–0.192 (0.175 ± 0.01 mm wide; pre-acetabular ovary was present and measured 0.130–0.150 (0.140 ± 0.01 mm long and 0.100–0.130 (0.120 ± 0.01 mm wide; vitellaria are extra-caecal and extended from the level of the pharynx to a level slightly beyond the ovary. By comparing the recovered parasite with different species of the same genus from different hosts having different localities, it was found that the present species morphometrically more or less different from the comparable species and the only similar species was P. medians described previously from the common toad Bufo bufo by having all similar

  19. The luteotrophic effect of homoplastic pituitary pars distalis homogenate, PMSG, and HCG on the corpora lutea of the hypophysectomized frog, Rana cyanophlyctis (SCHN).

    Science.gov (United States)

    Pancharatna, M; Saidapur, S K

    1984-03-01

    The effect of homoplastic pituitary pars distalis homogenate (PDH), PMSG, and HCG on the postovulatory follicles/corpora lutea (CL) of the frog Rana cyanophlyctis was studied to elucidate the factors regulating the life span of the luteal cells. Ovulation and spawning was induced in hypophysectomized frogs using PDH. Starting from Day 1 of spawning 1/2 PDH, 50 IU PMSG, or 50 IU HCG was injected daily for 3 days. In the saline-injected control frogs, the granulosa lutein cells regressed markedly on Day 2 with a steady progressive increase in the pycnosis of their nuclei. The sudanophilic lipid droplets of the luteal cells were fine on Day 1 but became coarser and reduced in number on subsequent days. Histochemically, the luteal cell 3 beta-HSDH and G-6-PDH also decreased drastically by Day 2. In PDH-treated frogs the granulosa lutein cells were healthy on all 4 days of the experiment. The nuclear diameter of the luteal cells increased progressively due to PDH. The pycnosis of the luteal cells was limited to 7.6% on Day 4 due to PDH as opposed to 68% seen in the controls. Histochemically, 3 beta-HSDH and G-6-PDH activities remained much higher than in the controls with abundant sudanophilic lipids (both fine and coarse) in the luteal cells of PDH treated frogs even on Day 4. PMSG treatment also maintained the granulosa lutein cells beyond their normal life span but the luteotrophic effect was less than that of PDH. HCG was least effective. The present studies suggest that the structural integrity of CL in the frog can be extended beyond the normal life span by injecting PDH or PMSG.

  20. Effects of road de-icing salt (NaCl) on larval wood frogs (Rana sylvatica).

    Science.gov (United States)

    Sanzo, Domenico; Hecnar, Stephen J

    2006-03-01

    Vast networks of roads cover the earth and have numerous environmental effects including pollution. A major component of road runoff in northern countries is salt (mostly NaCl) used as a winter de-icing agent, but few studies of effects of road salts on aquatic organisms exist. Amphibians require aquatic habitats and chemical pollution is implicated as a major factor in global population declines. We exposed wood frog tadpoles to NaCl. Tests revealed 96-h LC50 values of 2,636 and 5,109 mg/l and tadpoles experienced reduced activity, weight, and displayed physical abnormalities. A 90 d chronic experiment revealed significantly lower survivorship, decreased time to metamorphosis, reduced weight and activity, and increased physical abnormalities with increasing salt concentration (0.00, 0.39, 77.50, 1,030.00 mg/l). Road salts had toxic effects on larvae at environmentally realistic concentrations with potentially far-ranging ecological impacts. More studies on the effects of road salts are warranted.

  1. Residues of polybrominated diphenyl ethers in frogs (Rana limnocharis) from a contaminated site, South China: tissue distribution, biomagnification, and maternal transfer.

    Science.gov (United States)

    Wu, Jiang-Ping; Luo, Xiao-Jun; Zhang, Ying; Chen, She-Jun; Mai, Bi-Xian; Guan, Yun-Tao; Yang, Zhong-Yi

    2009-07-15

    Environmental pollutants are suspected to be a cause of global declines in amphibian populations, but few data are available on the bioaccumulation of polybrominated diphenyl ethers (PBDEs) in amphibians. To examine the tissue distribution, biomagnification potential, and maternal transfer of PBDEs in frogs, eighteen PBDE congeners were measured in the muscle, liver, and egg tissues of rice frogs (Rana limnocharis) and insects collected from an electronic waste (e-waste) recycling site in South China. PBDE levels in the frogs ranged from 0.63 to 11.6, 4.57 to 56.2, and 10.7 to 125 ng/g wet wt in the muscles, livers, and eggs, respectively. The frogs exhibited a unique congener profile, compared to those in aquatic and terrestrial species, with BDEs 99, 153, 183, 209, and 47 as the dominant congeners, intermediating between aquatic and terrestrial species. Most of the PBDE congeners in general showed higher affinity to liver than to muscle tissue. Except for BDEs 28, 47, 66, 138, and 206, the average biomagnification factors (BMFs) for all PBDE congeners were greater than 1.0, providing clear evidence of their biomagnification from insects to frogs. A parabolic relationship between log BMFs and bromine atom numbers or log Kow of PBDEs was observed, with the maximum BMF values for PBDEs with 6 bromine atoms (or at a log K(ow) of approximately 8.0). Relatively higher levels of 3-MeO-BDE 47 were found in male frogs, suggesting that male frogs in the present study might have higher metabolic capacity for PBDEs compared to female frogs. The ratio of levels in egg/female liver, indicating mother-to-egg transfer capacity, increased with increasing bromine atom numbers up to 7 and then declined as the bromine atom numbers rose. This indicated that the physicochemical properties of the congeners (e.g., K(ow), molecular sizes, and structures), resulting in different affinities to transport proteins, might impact their maternal transfer in frogs.

  2. Amphibian population genetics in agricultural landscapes: does viniculture drive the population structuring of the European common frog (Rana temporaria?

    Directory of Open Access Journals (Sweden)

    Patrick P. Lenhardt

    2017-07-01

    Full Text Available Amphibian populations have been declining globally over the past decades. The intensification of agriculture, habitat loss, fragmentation of populations and toxic substances in the environment are considered as driving factors for this decline. Today, about 50% of the area of Germany is used for agriculture and is inhabited by a diverse variety of 20 amphibian species. Of these, 19 are exhibiting declining populations. Due to the protection status of native amphibian species, it is important to evaluate the effect of land use and associated stressors (such as road mortality and pesticide toxicity on the genetic population structure of amphibians in agricultural landscapes. We investigated the effects of viniculture on the genetic differentiation of European common frog (Rana temporaria populations in Southern Palatinate (Germany. We analyzed microsatellite data of ten loci from ten breeding pond populations located within viniculture landscape and in the adjacent forest block and compared these results with a previously developed landscape permeability model. We tested for significant correlation of genetic population differentiation and landscape elements, including land use as well as roads and their associated traffic intensity, to explain the genetic structure in the study area. Genetic differentiation among forest populations was significantly lower (median pairwise FST = 0.0041 at 5.39 km to 0.0159 at 9.40 km distance than between viniculture populations (median pairwise FST = 0.0215 at 2.34 km to 0.0987 at 2.39 km distance. Our analyses rejected isolation by distance based on roads and associated traffic intensity as the sole explanation of the genetic differentiation and suggest that the viniculture landscape has to be considered as a limiting barrier for R. temporaria migration, partially confirming the isolation of breeding ponds predicted by the landscape permeability model. Therefore, arable land may act as a sink habitat

  3. Correlation between chloride flux via the mitochondria-rich cells and transepithelial water movement in isolated frog skin (Rana esculenta)

    DEFF Research Database (Denmark)

    Nielsen, Robert

    1995-01-01

    Antidiuretic hormone; chloride transport; electroosmosis; Frog skin; Intercalated cells; Local osmosis; Mitochondria-rich cells.......Antidiuretic hormone; chloride transport; electroosmosis; Frog skin; Intercalated cells; Local osmosis; Mitochondria-rich cells....

  4. Effects of Evans Blue and amiloride on anti-diuretic hormone (ADH)-induced sodium transport across frog (Rana hexadactyla) skin.

    Science.gov (United States)

    Jared, Silviya Rajakumari; Rao, Jonakuty Prakasa

    2013-05-01

    The epithelial sodium channel (ENaC) has four subunits, namely α (alpha), β (beta), γ (gamma) and δ (delta). The functional ENaC is formed by the combination of either αβγ or δβγ subunits. The aim of the present study is to determine the combination of ENaC subunits predominant on the apical side of the frog skin, and the effect of ADH on sodium transport though these two ENaCs subunit combinations. The ventral abdominal skin of the frog, Rana hexadactyla was mounted in an Ussing-type chamber. The voltage-clamp method was performed to measure the ionic transport across the frog skin with normal Ringer solution (NR) on both sides. Evans blue (300 µM) and amiloride (100 µM) were added to the NR on the apical side and ADH (40 nM) was added on the serosal side. Statistical significance was analyzed by Student's paired t-test and repeated-measures ANOVA, P < 0.05 was considered significant. This study suggests that the ENaC of the frog skin consist of both αβγ and δβγ subunit combinations on the apical side. Though both types of subunit combination are present, the αβγ type was found to be more common than δβγ. ADH increases the sodium transport across the frog skin. The effect of ADH on sodium transport is achieved through the combination of δ-subunits, not through the combination of a-subunits in the skin of Pana hexadactyla.

  5. Don't get the blues: conspicuous nuptial colouration of male moor frogs (Rana arvalis) supports visual mate recognition during scramble competition in large breeding aggregations.

    Science.gov (United States)

    Sztatecsny, Marc; Preininger, Doris; Freudmann, Anita; Loretto, Matthias-Claudio; Maier, Franziska; Hödl, Walter

    2012-12-01

    Conspicuous male colouration is expected to have evolved primarily through selection by female choice. In what way conspicuous colours could be advantageous to males scrambling for mates remains largely unknown. The moor frog (Rana arvalis) belongs to the so-called explosive breeders in which spawning period is short; intrasexual competition is strong, and males actively search and scramble for females. During breeding, male body colouration changes from a dull brown (similar to females) to a conspicuous blue, and we wanted to test if male blueness influences mating success or facilitates male mate recognition. To do so, we first measured the colour of mated and non-mated males using a spectrophotometer. In an experiment, we then analysed interactions of actual male moor frogs in natural spawning aggregations with a brown (resembling a female or a non-breeding male) and a blue model frog. Mated and non-mated males did not differ in colouration, suggesting that female choice based on colour traits was unlikely. In our behavioural experiment, male moor frogs spent significantly more time in contact and in amplexus with the brown model than with the blue model. Our results suggest that the nuptial colouration in moor frogs can act as a new type of visual signal in anurans evolved to promote instantaneous mate recognition allowing males to quickly move between rivals while scrambling for females. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1007/s00265-012-1412-6) contains supplementary material, which is available to authorized users.

  6. Peripheral origins and functional characteristics of vibration-sensitive VIIIth nerve fibers in the frog Rana temporaria

    DEFF Research Database (Denmark)

    Jøgensen, Morten Buhl; Christensen-Dalsgaard, Jakob

    1991-01-01

    1) The peripheral origins of vibration-sensitive VIIIth nerve fibers in European grassfrogs (Rana temporaria) were investigated by recording from individual nerve branchlets within the inner ear. Furthermore, the fibers' responses to both pulsed and continuous, dorsoventral, sinusoidal vibrations...

  7. Bioavailability and tissue distribution of Dechloranes in wild frogs (Rana limnocharis) from an e-waste recycling area in Southeast China.

    Science.gov (United States)

    Li, Long; Wang, Wenyue; Lv, Quanxia; Ben, Yujie; Li, Xinghong

    2014-03-01

    Dechlorane Plus (DP), a flame retardant used as an alternative to decabromodiphenylether, has been frequently detected in organisms, indicating its bioaccumulation and biomagnification potential in aquatic and terrestrial species. However, little data is available on the bioaccumulation of DP in amphibians. Dechlorane Plus and its analogs (DPs) were detected in the liver, muscle and brain tissues of wild frogs (Rana limnocharis), which were collected from an e-waste recycling site, Southeast China. DP, Mirex, Dec 602 and a dechlorinated compound of DP (anti-Cl11-DP) varied in the range of 2.01-291, 0.650-179, 0.260-12.4, and not detected (nd)-8.67 ng/g lipid weight, respectively. No difference of tissue distribution was found for syn-DP, Mirex and Dec 602 between the liver and muscle tissue (liver/muscle concentration ratio close to 1, p > 0.05). However, higher retention was observed for anti-DP and anti-Cl11-DP in the frog muscle relative to the liver tissue (liver/muscle concentration ratio 1, p frog.

  8. How fast do amphibians disperse? Introductions, distribution and dispersal of the common frog Rana temporaria and the common toad Bufo bufo on a coastal island in Central Norway

    Directory of Open Access Journals (Sweden)

    Dag Dolmen

    2016-04-01

    Full Text Available The common frog (Rana temporaria and the common toad (Bufo bufo were introduced successfully to the coastal island of Frøya in Central Norway several times during 1960–2012. There is still a very high degree of conformity between sites where they were introduced and the present distribution of the two species. However, in western Frøya, a release of frogs about 1996 was followed by a quick expansion of their distribution area; in 2012 and 2013, breeding was registered close to 7 km westwards and eastwards, respectively, i.e. a population dispersal speed of approximately 0.4 km/yr. On eastern Frøya and some small islands in the archipelago, area expansions at another four frog localities have been prevented by ecological barriers like unfavourable limnetic or terrestrial habitats or salty water. Two local common toad populations on eastern Frøya do not show any expansion either. However, an apparently isolated record of the species on western Frøya in 2011 can possibly be explained by the expansion westwards of a population in northern central Frøya, where toads were introduced around 1995. This stretch is about 9.9 km, i.e. an average population dispersal speed of 0.6 km/yr.

  9. Diverse families of antimicrobial peptides isolated from skin secretions of three species of East Asian frogs, Babina daunchina, Babina adenopleura, and Rana omeimontis (Ranidae).

    Science.gov (United States)

    Hu, Yuhong; Xu, Shiqi; Hu, Yonghong; Guo, Chao; Meng, Hao; Li, Jing; Liu, Jingze; Wang, Hui

    2014-07-01

    Twenty-two novel cDNAs encoding 22 peptide precursors for 19 mature peptides including antimicrobial peptides (AMPs) were identified from East Asian frog species Babina daunchina, Babina adenopleura, and Rana omeimontis skin-derived cDNA libraries. Two atypical members of the brevinin-1 family AMPs, named brevinin-1AN1 (FLTGVLKLASKIPSVLCAVLKTC) and brevinin-1DN1(FLKGVINLASKIPSMLCAVLKTC), were purified from the skin secretions of B. adenopleura and B. daunchina, respectively. A member of the ranatuerin-2 family AMP named ranatuerin-2DN1 (GLFDSITQGLKDTAVKLLDKIKCKLSACPPA) was also purified from the skin secretion of B. daunchina. One AMP named japonicin-2OM1 (FIVPSIFLLKKAFCIALKKNC) was purified from the skin secretion of R. omeimontis. The antimicrobial tests showed that brevinin-1DN1, brevinin-1DN2, brevinin-1AN1, and japonicin-2OM1 possess higher antimicrobial activity against Gram-positive bacteria than Gram-negative bacteria.

  10. Spatial Amphibian Impact Assessment – a management tool for assessment of road effects on regional populations of Moor frogs (Rana arvalis)

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt; Nachman, Gøsta Støger

    2013-01-01

    An expanding network of roads and railways fragments natural habitat affecting the amount and quality of habitat and reducing connectivity between habitat patches with severe consequences for biodiversity and population persistence. To ensure an ecologically sustainable transportation system......), to be used as a standardized and quantitative tool for assessing the impact of roads on pond-breeding amphibians. The model considers a landscape mosaic of breeding habitat, summer habitat and uninhabitable land. As input, we use a GIS-map of the landscape with information on land cover as well as data...... demonstrate how SAIA can be used to assess which management measures would be best to mitigate the effect of landscape fragmentation caused by road constructions by means of a case study dedicated to the Moor frog (Rana arvalis)....

  11. Evidence for directional selection at a novel major histocompatibility class I marker in wild common frogs (Rana temporaria exposed to a viral pathogen (Ranavirus.

    Directory of Open Access Journals (Sweden)

    Amber G F Teacher

    Full Text Available Whilst the Major Histocompatibility Complex (MHC is well characterized in the anuran Xenopus, this region has not previously been studied in another popular model species, the common frog (Rana temporaria. Nor, to date, have there been any studies of MHC in wild amphibian host-pathogen systems. We characterise an MHC class I locus in the common frog, and present primers to amplify both the whole region, and specifically the antigen binding region. As no more than two expressed haplotypes were found in over 400 clones from 66 individuals, it is likely that there is a single class I locus in this species. This finding is consistent with the single class I locus in Xenopus, but contrasts with the multiple loci identified in axolotls, providing evidence that the diversification of MHC class I into multiple loci likely occurred after the Caudata/Anura divergence (approximately 350 million years ago but before the Ranidae/Pipidae divergence (approximately 230 mya. We use this locus to compare wild populations of common frogs that have been infected with a viral pathogen (Ranavirus with those that have no history of infection. We demonstrate that certain MHC supertypes are associated with infection status (even after accounting for shared ancestry, and that the diseased populations have more similar supertype frequencies (lower F(ST than the uninfected. These patterns were not seen in a suite of putatively neutral microsatellite loci. We interpret this pattern at the MHC locus to indicate that the disease has imposed selection for particular haplotypes, and hence that common frogs may be adapting to the presence of Ranavirus, which currently kills tens of thousands of amphibians in the UK each year.

  12. Enhancement of twitch force by stretch in a nerve-skeletal muscle preparation of the frog Rana porosa brevipoda and the effects of temperature on it.

    Science.gov (United States)

    Ishii, Yoshiki; Watari, Takashi; Tsuchiya, Teizo

    2004-12-01

    We investigated the mechanism of the enhancement of twitch force by stretch and the effects of temperature on it in nerve-skeletal muscle preparations of whole iliofibularis muscles isolated from the frog Rana brevipoda. When a preparation was stimulated indirectly and stretched, the twitch force after the stretch was enhanced remarkably in comparison to that observed before a stretch at low temperature. The enhanced force obtained by a stretch of 20% resting muscle length (l0) at low temperature was as high as the force obtained by direct stimulation. The phenomenon was not dependent on the velocity but on the amplitude of stretch. The enhanced force obeyed the length-force relationship when a stretch was long enough. The above results were observed when the frogs were kept at room temperature (20-22 degrees C). Measurements were also taken at low temperature (4 degrees C); when frogs were kept at low temperature for more than 2 months, twitch force obtained without stretch was considerably higher at l0. The amplitude of the action potential recorded extracellularly from the muscle surface increased remarkably after a stretch, but was same before and after a stretch when recorded from the nerve innervating muscle. The effects of temperature on twitch and tetanic force by direct or indirect stimulation without stretch were also studied as basic data of the stretch experiment. The results from this study suggest that stretch-induced force enhancement in a nerve-muscle preparation is caused by an increase in the transmission rate between nerve and muscle, and the amplitude of the enhanced force is determined by the length-force relationship of the muscle. The phenomenon is also strongly affected by the temperature at which the frogs are kept.

  13. Evidence for Directional Selection at a Novel Major Histocompatibility Class I Marker in Wild Common Frogs (Rana temporaria) Exposed to a Viral Pathogen (Ranavirus)

    Science.gov (United States)

    Teacher, Amber G. F.; Garner, Trenton W. J.; Nichols, Richard A.

    2009-01-01

    Whilst the Major Histocompatibility Complex (MHC) is well characterized in the anuran Xenopus, this region has not previously been studied in another popular model species, the common frog (Rana temporaria). Nor, to date, have there been any studies of MHC in wild amphibian host-pathogen systems. We characterise an MHC class I locus in the common frog, and present primers to amplify both the whole region, and specifically the antigen binding region. As no more than two expressed haplotypes were found in over 400 clones from 66 individuals, it is likely that there is a single class I locus in this species. This finding is consistent with the single class I locus in Xenopus, but contrasts with the multiple loci identified in axolotls, providing evidence that the diversification of MHC class I into multiple loci likely occurred after the Caudata/Anura divergence (approximately 350 million years ago) but before the Ranidae/Pipidae divergence (approximately 230 mya). We use this locus to compare wild populations of common frogs that have been infected with a viral pathogen (Ranavirus) with those that have no history of infection. We demonstrate that certain MHC supertypes are associated with infection status (even after accounting for shared ancestry), and that the diseased populations have more similar supertype frequencies (lower FST) than the uninfected. These patterns were not seen in a suite of putatively neutral microsatellite loci. We interpret this pattern at the MHC locus to indicate that the disease has imposed selection for particular haplotypes, and hence that common frogs may be adapting to the presence of Ranavirus, which currently kills tens of thousands of amphibians in the UK each year. PMID:19240796

  14. Colonization of frog Rana temporaria L. urinary bladder by Gram-negative bacteria leads to decreased effect of arginine-vasotocin on water reabsorption from the urinary bladder.

    Science.gov (United States)

    Fock, Ekaterina; Lavrova, Elena; Parnova, Rimma

    2013-11-01

    In frogs and toads the urinary bladder is very important for the maintenance of water balance due to its ability to store water which can be reabsorbed under the action of arginine-vasotocin (AVT). The usage of isolated bladders as a model for studying the osmotic water permeability (OWP) regulation has a disadvantage which relates to high variability of AVT effect among individuals, some showing insensitivity to the hormone. We hypothesized that the response of the bladder to AVT could depend on the colonization of the mucosal epithelium by Gram-negative bacteria. To test this, paired hemibladders of the frog Rana temporaria were used for measurement of OWP and for analysis of Gram-negative bacteria in the bladder tissue or isolated epithelial cells. Among the 206 frogs studied, 41% were infected by different Enterobacteriaceae, with prevalence of Hafnia alvei and Escherichia coli. In infected bladders the basal level of OWP was unchanged, whereas OWP stimulated by AVT was reduced (non-infected: 2.53 ± 0.13, n = 59, infected: 1.21 ± 0.17 µL min(-1)  cm(-2), n = 38, for the 15 min of AVT action, P < 0.001). In the sample, 100% of hemibladders that responded to AVT very weakly (OWP <0.5 µL min(-1)  cm(-2)) had a bacterial infection. Overnight treatment of hemibladders with mucosal lipopolysaccharide E. coli decreased OWP induced by AVT, forskolin, or IBMX lowering basal and stimulated level of cAMP. The data obtained indicate that the frog bladder epithelium could be colonized by Gram-negative bacteria, probably of cloacal origin, leading to reduction of sensitivity to AVT and to impairment of the urinary bladder to provide osmoregulation. © 2013 Wiley Periodicals, Inc.

  15. Influence of Ribeiroia ondatrae (Trematoda: Digenea) infection on limb development and survival of northern leopard frogs (Rana pipiens): effects of host stage and parasite-exposure level

    Science.gov (United States)

    Schotthoefer, Anna M.; Koehler, Anson V.; Meteyer, Carol U.; Cole, Rebecca A.

    2003-01-01

    Recent evidence suggests that infection by larvae of the trematode Ribeiroia ondatrae accounts for a significant proportion of limb malformations currently observed in amphibian populations of North America. However, the effects of R. ondatrae infection on northern leopard frogs (Rana pipiens), one of the species most frequently reported with malformations, have not been adequately explored. Moreover, the risk factors associated with R. ondatrae-induced malformations have not been clearly identified. We examined the effects of timing of infection on tadpole survival and limb development. Rana pipiens tadpoles were individually exposed to R. ondatrae cercariae at the pre-limb-bud (Gosner stages 24 and 25), limb-bud (Gosner stages 27 and 28), or paddle (Gosner stages 31–33) stages of development and monitored through metamorphosis. The effects of infection were stage-specific. Infections acquired at the pre-limb-bud stage resulted in a high mortality rate (47.5–97.5%), whereas tadpoles infected at the limb-bud stage displayed a high malformation rate (16% overall), and the magnitude of effects increased with the level of exposure to cercariae. In contrast, infections acquired at the paddle stage had no effect on limb development or tadpole survival, which suggests that the timing of R. ondatrae infection in relation to the stage structure of tadpole populations in the wild is an important determinant of the degree to which populations are affected by R. ondatrae.

  16. Immunocytochemical and ultrastructural characterization of endocrine cells in the larval stomach of the frog Rana temporaria tadpoles: a comparison with adult specimens.

    Science.gov (United States)

    Villaro, A C; Rovira, J; Bodegas, M E; Burrell, M A; García-Ros, D; Sesma, P

    2001-10-01

    According to immunostaining and ultrastructural patterns, Rana temporaria tadpole stomach displays a well-differentiated endocrine population comprising, at least, six cellular types: ECL, EC [serotonin], D [somatostatin] - all three of them abundant -, P [bombesin] - less numerous -, CCK-8 [cholecystokinin/gastrin] and A [glucagon/glicentin] - both very scarce. Larval endocrine cells are mainly located in the surface epithelium and show open or closed morphologies. Cellular diversity is similar in tadpoles and frogs, with the exception of immunoreactivity for gastrin-17, found in adults in numerous cells. Larval cells display mature ultrastructural traits, although with smaller secretory granules. The different distribution of endocrine cells, which in adults are preferentially located in the glands, probably refers to different functional requirements. However, the rich vascular plexus present in larval mucosa may be an efficient transport medium of surface hormones to-gastric targets. The enhancement in adults of endocrine population and correlative increase in hormonal secretion indicates a more active functional role, probably related to the shift from herbivorous to carnivorous habits. In summary, the tadpole gastric endocrine population, although not as numerous as that of adult frogs, displays histological traits that indicate a relevant (immunoreactive and ultrastructural properties, cellular diversity) and specific (surface location, relative abundance of open-type cells) role of local regulatory factors in amphibian larval gastric function.

  17. Sound and vibration sensitivity of VIIIth nerve fibers in the frogs Leptodactylus albilabris and Rana pipiens pipiens

    DEFF Research Database (Denmark)

    Christensen-Dalsgaard, J; Narins, P M

    1993-01-01

    1. Responses of 73 fibers to dorso-ventral vibration were recorded in the saccular and utricular branchlets of Rana pipiens pipiens using a ventral approach. The saccular branchlet contained nearly exclusively vibration-sensitive fibers (33 out of 36) with best frequencies (BFs) between 10 and 70...

  18. Complex patterns of geographic variation in heat tolerance and Hsp70 expression levels in the common frog Rana temporaria

    DEFF Research Database (Denmark)

    Sørensen, Jesper Givskov; Pekkonen, Minna; Lindgren, Beatrice

    2009-01-01

    1. We tested for geographical variation in heat tolerance and Hsp70 expression levels of Rana temporaria tadpoles along a 1500 km long latitudinal gradient in Sweden.   2. Temperature tolerance of the hatchling tadpoles did not differ among populations, but they tolerated stressful hot temperatures...

  19. Morphological and ultrastructural characteristics of Myxobolus ridibundae n. sp. (Myxosporea: Bivalvulida) infecting the testicular tissue of the marsh frog Rana ridibunda (Amphibia: Ranidae) in Egypt.

    Science.gov (United States)

    Abdel-Ghaffar, Fathy; Abdel-Gaber, Rewaida; Maher, Sherein; El Deeb, Nashwa; Kamel, Reem; Al Quraishy, Saleh; Mehlhorn, Heinz

    2017-01-01

    Myxozoans are one of the most economically important groups of protozoan parasites causing many serious diseases of their hosts. In the present study, a total of 60 live adult male specimens of the marsh frog Rana ridibunda have been randomly captured during the period of January-December 2015 in different areas at Kafr El-Sheikh Governorate, Egypt and were examined for infection by myxosporidian parasites. A total of 48 (80.0 %) out of 60 frog specimens were found to be infected with Myxobolus species. Parasitic infection was restricted to the testicular tissue of the examined frogs. Macroscopic cysts (plasmodia) which heavily infested different parts of the testes were recovered. Morphological and ultrastructural characteristics of these myxosporidian species were carried out using light and transmission electron microscopy. Plasmodia measured 0.16-0.53 (0.34 ± 0.01) mm in diameter. Mature spores appeared oval in frontal view, measuring 8.9-11.5 (9.6 ± 0.1) μm in length and 7.5-9.1 (8.4 ± 0.1) μm in width containing 5-6 turns of polar filaments. Morphometric characterization revealed that the very small size of the present Myxobolus species was the most distinctive feature that separates them from all previously described Myxobolus species. Ultrastructural analysis showed that the plasmodia are surrounded by a plasma membrane with numerous pinocytotic protrusions extending toward the host cell. The generative cells and the different developmental stages are arranged at the periphery of the plasmodia, while immature and mature spores are centrally located. Sporogenesis, capsulogenesis, valvogenesis, and spore maturation of the present parasite are also described. The present species is described as Myxobolus ridibundae and represents a new species.

  20. Spatial Amphibian Impact Assessment – a management tool for assessment of road effects on regional populations of Moor frogs (Rana arvalis

    Directory of Open Access Journals (Sweden)

    Maj-Britt Pontoppidan

    2013-11-01

    a case study dedicated to the Moor frog (Rana arvalis.

  1. A Brief Report on Biology of Johns' Frog (Rana johnsi Smith,1921) in China%Rana johnsi的生物学初探

    Institute of Scientific and Technical Information of China (English)

    李丕鹏; 陆宇燕

    2007-01-01

    从保护生物学角度对广西大瑶山Rana johnsi Smith,1921的栖息地和繁殖地生境、繁殖生物学及蝌蚪的特点等进行了初步探讨.该蛙在大瑶山主要分布在海拔800 m左右的一个狭窄区域,10月至次年1月下山繁殖,有效性比为5:1.蝌蚪唇齿式为Ⅰ∶5-5/1-1:Ⅳ和Ⅰ:4-4/1-1:Ⅳ,越冬后在5~6月完成变态.由于人为和自然因素的影响,该蛙种群受到严重威胁,应加强保护管理和宣传教育.

  2. Characterization of kappa 1 and kappa 2 opioid binding sites in frog (Rana esculenta) brain membrane preparation

    Energy Technology Data Exchange (ETDEWEB)

    Benyhe, S.; Varga, E.; Hepp, J.; Magyar, A.; Borsodi, A.; Wollemann, M.

    1990-09-01

    The distribution and properties of frog brain kappa-opioid receptor subtypes differ not only from those of the guinea pig brain, but also from that of the rat brain. In guinea pig cerebellum the kappa 1 is the dominant receptor subtype, frog brain contains mainly the kappa 2 subtype, and the distribution of the rat brain subtypes is intermediate between the two others. In competition experiments it has been established that ethylketocyclazocine and N-cyclopropylmethyl-norazidomorphine, which are nonselective kappa-ligands, have relatively high affinities to frog brain membranes. The kappa 2 ligands (Met5)enkephalin-Arg6-Phe7 and etorphine also show high affinities to the frog brain. Kappa 1 binding sites measured in the presence of 5 microM/D-Ala2-Leu5/enkephalin represent 25-30% of (3H)ethylketocyclazocine binding in frog brain membranes. The kappa 2 subtype in frog brain resembles more to the mu subtype than the delta subtype of opioid receptors, but it differs from the mu subtype in displaying low affinity toward beta-endorphin and /D-Ala2-(Me)Phe4-Gly5-ol/enkephalin (DAGO). From our data it is evident that the opioid receptor subtypes are already present in the amphibian brain but the differences among them are less pronounced than in mammalian brain.

  3. A study of degeneration, scar formation and regeneration after section of the optic nerve in the frog, Rana pipiens.

    OpenAIRE

    Scott, T. M.; Foote, J

    1981-01-01

    Degeneration, scar formation and regeneration have been studied after section of the optic nerve in the frog. In the normal optic nerve two types of macroglial cell were identified: astrocytes and oligodendroglia. Degeneration after injury proceeded rapidly in comparison with mammals but did not lead to the production of a dense scar. Before much scarring had developed, regenerating axons penetrated the lesioned area.

  4. Mass mortality associated with a frog virus 3-like Ranavirus infection in farmed tadpoles Rana catesbeiana from Brazil

    Science.gov (United States)

    Mazzoni, Rolando; de Mesquita, Albenones José; Fleury, Luiz Fernando F.; de Brito, Wilia Marta Elsner Diederichsen; Nunes, Iolanda A.; Robert, Jacques; Morales, Heidi; Coelho, Alexandre Siqueira Guedes; Barthasson, Denise Leão; Galli, Leonardo; Catroxo, Marcia H. B.

    2010-01-01

    Ranviruses (Iridoviridae) are increasingly associated with mortality events in amphibians, fish, and reptiles. They have been recently associated with mass mortality events in Brazilian farmed tadpoles of the American bullfrog Rana catesbeiana Shaw. 1802. The objectives of the present study were to further characterize the virus isolated from sick R. catesbeiana tadpoles and confirm the etiology in these outbreaks. Sick tadpoles were collected in 3 farms located in Goiás State, Brazil, from 2003 to 2005 and processed for virus isolation and characterization, microbiology, histopathology, and parasitology. The phylogenetic relationships of Rana catesbeiana ranavirus (RCV-BR) with other genus members was investigated by PCR with primers specific for the major capsid protein gene (MCP) and the RNA polymerase DNA-dependent gene (Pol II). Sequence analysis and multiple alignments for MCP products showed >99% amino acid identity with other ranaviruses, while Pol II products showed 100% identity. Further diagnostics of the pathology including histology and transmission electron microscopy confirmed the viral etiology of these mass deaths. As for as we know, this is the first report of a ranaviral infection affecting aquatic organisms in Brazil. Additionally, our results suggest that American bullfrogs may have served as a vector of transmission of this virus, which highlights the potential threat of amphibian translocation in the world distribution of pathogens. PMID:20066953

  5. An X-linked body color gene of the frog Rana rugosa and its application to the molecular analysis of gonadal sex differentiation.

    Science.gov (United States)

    Miura, I; Kitamoto, H; Koizumi, Y; Ogata, M; Sasaki, K

    2011-01-01

    We identified a sex-linked, recessive body color gene, presently designated w (whitish-yellow), in the frog Rana rugosa from the Iwakuni population in Western Japan. This is the first time a sex-linked body color gene was found in amphibians so far. In this population of R. rugosa, males are the heterogametic sex, but the sex chromosomes are still homomorphic. When heterozygous males (Ww), which were produced by crossing a whitish-yellow female (ww) found in the field and a wild-type male (WW) of the same population, were backcrossed to the homozygous whitish-yellow female (ww), the resultant male offspring were all wild-type, whereas the females were all whitish-yellow. This result definitely indicates that w is recessive and X-linked, and its wild-type allele W is located on the Y chromosome. Using this strain (X(w)X(w) female and X(w)Y(W) male), we found that expression of Dmrt1 and Rspo1, which are involved in testicular and ovarian differentiation in vertebrates, was higher in males and females, respectively, prior to the onset of the sexually dimorphic expression of Cyp17 and Cyp19, which are involved in biosynthesis of sex steroids and are critical markers of gonadal sex differentiation.

  6. Immunoreactivities of IL-1β and IL-1R in oviduct of Chinese brown frog (Rana dybowskii) during pre-hibernation and the breeding period.

    Science.gov (United States)

    Hu, Ruiqi; Liu, Yuning; Deng, Yu; Ma, Sihui; Sheng, Xia; Weng, Qiang; Xu, Meiyu

    2016-03-01

    The Chinese brown frog (Rana dybowskii) has one special physiological phenomenon, which is that its oviduct goes through expansion prior to hibernation instead of during the breeding period. In this study, we investigated the localization and expression level of interleukin-1 (IL-1β) and its functional membrane receptor type I (IL1R1) proteins in the oviduct of R. dybowskii during pre-hibernation and the breeding period. There were significant differences in both oviductal weight and pipe diameter, with values markedly higher in pre-hibernation than in the breeding period. Histologically, epithelium cells, glandular cells and tubule lumen were identified in the oviduct during pre-hibernation and the breeding period, while sizes of both cell types are larger in the pre-hibernation than those of the breeding period. IL-1β was immunolocalized in the cytoplasm of epithelial and glandular cells in both periods, whereas IL-1R1 was observed in the membrane of epithelial and glandular cells in the breeding period, whereas only in epithelial cells during pre-hibernation. Consistently, the protein levels of IL-1β and IL-1R1 were higher in pre-hibernation as compared to the breeding period. These results suggested that IL-1β may play an important autocrine or paracrine role in oviductal cell proliferation and differentiation of R. dybowskii.

  7. Osmolyte regulation by TonEBP/NFAT5 during anoxia-recovery and dehydration–rehydration stresses in the freeze-tolerant wood frog (Rana sylvatica)

    Science.gov (United States)

    Al-attar, Rasha; Zhang, Yichi

    2017-01-01

    Background The wood frog, Rana sylvatica, tolerates freezing as a means of winter survival. Freezing is considered to be an ischemic/anoxic event in which oxygen delivery is significantly impaired. In addition, cellular dehydration occurs during freezing because water is lost to extracellular compartments in order to promote freezing. In order to prevent severe cell shrinkage and cell death, it is important for the wood frog to have adaptive mechanisms for osmoregulation. One important mechanism of cellular osmoregulation occurs through the cellular uptake/production of organic osmolytes like sorbitol, betaine, and myo-inositol. Betaine and myo-inositol are transported by the proteins BGT-1 and SMIT, respectively. Sorbitol on the other hand, is synthesized inside the cell by the enzyme aldose reductase. These three proteins are regulated at the transcriptional level by the transcription factor, NFAT5/TonEBP. Therefore, the objective of this study was to elucidate the role of NFAT5/TonEBP in regulating BGT-1, SMIT, and aldose reductase, during dehydration and anoxia in the wood frog muscle, liver, and kidney tissues. Methods Wood frogs were subjected to 24 h anoxia-4 h recovery and 40% dehydration-full rehydration experiments. Protein levels of NFAT5, BGT-1, SMIT, and aldose reductase were studied using immunoblotting in muscle, liver, and kidney tissues. Results Immunoblotting results demonstrated downregulations in NFAT5 protein levels in both liver and kidney tissues during anoxia (decreases by 41% and 44% relative to control for liver and kidney, respectively). Aldose reductase protein levels also decreased in both muscle and kidney tissues during anoxia (by 37% and 30% for muscle and kidney, respectively). On the other hand, BGT-1 levels increased during anoxia in muscle (0.9-fold compared to control) and kidney (1.1-fold). Under 40% dehydration, NFAT5 levels decreased in liver by 53%. Aldose reductase levels also decreased by 42% in dehydrated muscle, and by

  8. Osmolyte regulation by TonEBP/NFAT5 during anoxia-recovery and dehydration–rehydration stresses in the freeze-tolerant wood frog (Rana sylvatica

    Directory of Open Access Journals (Sweden)

    Rasha Al-attar

    2017-01-01

    Full Text Available Background The wood frog, Rana sylvatica, tolerates freezing as a means of winter survival. Freezing is considered to be an ischemic/anoxic event in which oxygen delivery is significantly impaired. In addition, cellular dehydration occurs during freezing because water is lost to extracellular compartments in order to promote freezing. In order to prevent severe cell shrinkage and cell death, it is important for the wood frog to have adaptive mechanisms for osmoregulation. One important mechanism of cellular osmoregulation occurs through the cellular uptake/production of organic osmolytes like sorbitol, betaine, and myo-inositol. Betaine and myo-inositol are transported by the proteins BGT-1 and SMIT, respectively. Sorbitol on the other hand, is synthesized inside the cell by the enzyme aldose reductase. These three proteins are regulated at the transcriptional level by the transcription factor, NFAT5/TonEBP. Therefore, the objective of this study was to elucidate the role of NFAT5/TonEBP in regulating BGT-1, SMIT, and aldose reductase, during dehydration and anoxia in the wood frog muscle, liver, and kidney tissues. Methods Wood frogs were subjected to 24 h anoxia-4 h recovery and 40% dehydration-full rehydration experiments. Protein levels of NFAT5, BGT-1, SMIT, and aldose reductase were studied using immunoblotting in muscle, liver, and kidney tissues. Results Immunoblotting results demonstrated downregulations in NFAT5 protein levels in both liver and kidney tissues during anoxia (decreases by 41% and 44% relative to control for liver and kidney, respectively. Aldose reductase protein levels also decreased in both muscle and kidney tissues during anoxia (by 37% and 30% for muscle and kidney, respectively. On the other hand, BGT-1 levels increased during anoxia in muscle (0.9-fold compared to control and kidney (1.1-fold. Under 40% dehydration, NFAT5 levels decreased in liver by 53%. Aldose reductase levels also decreased by 42% in

  9. Connections of the torus semicircularis and oliva superior in the frog, Rana esculenta: a Phaseolus vulgaris leucoagglutinin labeling study.

    Science.gov (United States)

    Matesz, C; Kulik, A

    1996-01-01

    The afferent and efferent connections of the frog principal nucleus (TP) of torus semicircularis (TOS) and superior olive (SO) were examined by employing the anterograde and retrograde transport patterns of Phaseolus vulgaris leucoagglutinin (PHA-L). After injecting the tracer into these nuclei it was found that the TP projected to the ipsilateral posterior and central thalamic nuclei, all subdivisions of the bilateral TDS and the ipsilateral nucleus isthmi (NI). In the rhombencephalon the projection was restricted mainly to the contralateral SO and the cochlear nucleus (CN). Retrogradely labeled cells were found in most of the areas that contained anterogradely labeled terminals. The termination areas of the SO fibers were similar to the projections of fibers of TP origin in the diencephalic and in the mesencephalic auditory centers. A strong projection was followed into the contralateral SO; the CNs received fibers at both sides. Caudally to the SO the reticular formation, the spinal nucleus of the trigeminal nerve, the solitary nucleus and the dorsal column nuclei were supplied by the fibers of the SO origin. Retrogradely labeled cells were found in the TOS, tegmental nuclei, solitary nucleus, dorsal column nuclei and in the spinal nucleus of the trigeminal nerve. Our results indicate that the frog auditory pathway is more complex at the level of the secondary and tertiary fiber projections than has been previously recognized.

  10. Distribution of adrenomedullin and proadrenomedullin N-terminal 20 peptide immunoreactivity in the pituitary gland of the frog Rana perezi.

    Science.gov (United States)

    Collantes, M; Bodegas, M E; Sesma, M P; Villaro, A C

    2003-08-01

    Adrenomedullin (AM) and proadrenomedullin N-terminal 20 peptide (PAMP) are two multifunctional peptides processed from a common precursor which have been described in numerous mammalian organs, including the pituitary gland. Previous studies have found AM immunoreactivity in neurohypophysis nerve fibers of amphibian pituitary. In the present study, immunocytochemical and Western blot analysis in the pituitary gland of the amphibian Rana perezi demonstrated in the adenohypophysis both AM and PAMP. AM-like immunoreactivity was found in a moderate number of endocrine cells of the pars distalis. In the neurohypophysis, AM was observed not only in nerve fibers of pars nervosa and axonal projections innervating the pars intermedia, but also in the outer zone of the median eminence. PAMP staining was observed in numerous endocrine cells scattered all over the pars distalis and in some cells of the pars tuberalis, but not in the neurohypophysis. In order to compare the quantity of AM and PAMP immunoreactivity between pars distalis of female and male specimens, an image analysis study was done. Significant differences for AM immunoreactivity (p<0.001) between sexes was found, the males showing higher immunostained area percentage. Differences of PAMP immunoreactivity were not significant (p=0.599). Western blot analysis detected bands presumably corresponding to precursor and/or intermediate species in the propeptide processing.

  11. Population declines lead to replicate patterns of internal range structure at the tips of the distribution of the California red-legged frog (Rana draytonii)

    Science.gov (United States)

    Richmond, Jonathan Q.; Backlin, Adam R.; Tatarian, Patricia J.; Solvesky, Ben G.; Fisher, Robert N.

    2014-01-01

    Demographic declines and increased isolation of peripheral populations of the threatened California red-legged frog (Rana draytonii) have led to the formation of internal range boundaries at opposite ends of the species’ distribution. While the population genetics of the southern internal boundary has been studied in some detail, similar information is lacking for the northern part of the range. In this study, we used microsatellite and mtDNA data to examine the genetic structuring and diversity of some of the last remaining R. draytonii populations in the northern Sierra Nevada, which collectively form the northern external range boundary. We compared these data to coastal populations in the San Francisco Bay Area, where the species is notably more abundant and still exists throughout much of its historic range. We show that ‘external’ Sierra Nevada populations have lower genetic diversity and are more differentiated from one another than their ‘internal’ Bay Area counterparts. This same pattern was mirrored across the distribution in California, where Sierra Nevada and Bay Area populations had lower allelic variability compared to those previously studied in coastal southern California. This genetic signature of northward range expansion was mirrored in the phylogeography of mtDNA haplotypes; northern Sierra Nevada haplotypes showed greater similarity to haplotypes from the south Coast Ranges than to the more geographically proximate populations in the Bay Area. These data cast new light on the geographic origins of Sierra Nevada R. draytonii populations and highlight the importance of distinguishing the genetic effects of contemporary demographic declines from underlying signatures of historic range expansion when addressing the most immediate threats to population persistence. Because there is no evidence of contemporary gene flow between any of the Sierra Nevada R. draytonii populations, we suggest that management activities should focus on

  12. Genetic diversity, but not hatching success, is jointly affected by postglacial colonization and isolation in the threatened frog, Rana latastei.

    Science.gov (United States)

    Ficetola, Gentile Francesco; Garner, Trenton W J; De Bernardi, Fiorenza

    2007-05-01

    Both postglacial colonization and habitat fragmentation can reduce the genetic diversity of populations, which in turn can affect fitness. However, since these processes occur at different spatial and temporal scales, the consequences of either process may differ. To disentangle the relative role of isolation and postglacial colonization in determining genetic diversity and fitness, we studied microsatellite diversity of 295 individuals from 10 populations and measured the hatch rate of 218 clutches from eight populations of a threatened frog, R. latastei. The populations that were affected by fragmentation to a greater extent suffered higher embryo mortality and reduced hatch rate, while no effects of distance from glacial refugium on hatch rate were detected. Altogether, distance from glacial refugium and isolation explained > 90% of variation in genetic diversity. We found that the genetic diversity was lowest in populations both isolated and far from the glacial refugium, and that distance from refugium seems to have the primary role in determining genetic diversity. The relationship between genetic diversity and hatch rate was not significant. However, the proportion of genetic diversity lost through recent isolation had a significant, negative effect on fitness. It is possible that selection at least partially purged the negative effects of the ancestral loss of genetic diversity.

  13. Development of Hepatozoon caimani (Carini, 1909 Pessôa, De Biasi & De Souza, 1972 in the Caiman Caiman c. crocodilus, the frog Rana catesbeiana and the mosquito Culex fatigans

    Directory of Open Access Journals (Sweden)

    Ralph Lainson

    2003-01-01

    Full Text Available The sporogony of Hepatozoon caimani has been studied, by light microscopy, in the mosquito Culex fatigans fed on specimens of the caiman Caiman c. crocodilus showing gametocytes in their peripheral blood. Sporonts iniciate development in the space between the epithelium of the insect gut and the elastic membrane covering the haemocoele surface of the stomach. Sporulating oocysts are clustered on the gut, still invested by the gut surface membrane. Fully mature oocysts were first seen 21 days after the blood-meal. No sporogonic stages were found in some unidentified leeches fed on an infected caiman, up to 30 days following the blood-meal. When mosquitoes containing mature oocysts were fed to frogs (Leptodactylus fuscus and Rana catesbeiana, cysts containing cystozoites developed in the internal organs, principally the liver. Feeding these frogs to farm-bred caimans resulted in the appearance of gametocytes in their peripheral blood at some time between 59 and 79 days later, and the development of tissue cysts in the liver, spleen, lungs and kidneys. Transmission of the parasite was also obtained by feeding young caimans with infected mosquitoes and it is suggested that both methods occur in nature. The finding of similar cysts containing cystozoites in the semi-aquatic lizard Neusticurus bicarinatus, experimentally fed with infected C. fatigans, suggests that other secondary hosts may be involved.

  14. 沼泽绿牛蛙致病细菌的研究%Studies on the Fatal Bacteria in the Frog Rana grylio stejneger

    Institute of Scientific and Technical Information of China (English)

    汤显春; 薛翠峰; 高智慧

    2000-01-01

    从自然患病死亡的沼泽绿牛蛙(Rana grylio stejneger)体内分离到9株细菌,对其形态及生理生化特性进行了研究,该菌为嗜水气单胞菌嗜水变种(Aeremonas hydrophila subsp.hydrophila).

  15. The contribution of ventricular apicobasal and transmural repolarization patterns to the development of the T wave body surface potentials in frogs (Rana temporaria) and pike (Esox lucius).

    Science.gov (United States)

    Vaykshnorayte, Marina A; Azarov, Jan E; Tsvetkova, Alena S; Vityazev, Vladimir A; Ovechkin, Alexey O; Shmakov, Dmitry N

    2011-05-01

    The study aimed at the simultaneous determination of the transmural and apicobasal differences in the repolarization timing and the comparison of the contributions of these two repolarization gradients to the development of the body surface T wave potentials in animals with the single heart ventricle (fishes and amphibians). Unipolar potentials were measured on the body surface, epicardium and in the intramural (subepicardial, Epi; midmyocardial; and subendocardial, Endo) ventricular layers of 9 pike and 8 frogs. Activation times, repolarization times and activation-recovery intervals were determined. A transmural gradient in repolarization durations in frogs (Endo>Epi, Ppike that produces a repolarization sequence from Endo to Epi (Endopike and frogs.

  16. 实验温度对牛蛙神经冲动产生和传导的影响%Effects of Experimental Temperature on Nerve Impulse Generation and Conduction in Bull Frog (Rana catesbeiana )

    Institute of Scientific and Technical Information of China (English)

    罗来高; 许雪峰; 吴义莲; 殷培峰

    2012-01-01

    We recorded the action potential range and conductive velocity of the nerve trunk of bull frog (Rana catesbeiana) at seven (5, 15, 25, 30, 33, 35 and 39℃) temperatures, respectively. The results showed that testing temperature significantly affected the nerve impulse generation and conduction. The variations of the action potential range and conductive velocity with experimental temperature were asynchronous. The action potential range increased as temperature from 5 to 30℃ and decreased dramatically at higher temperatures. However, the nerve impulse conductive velocity was apparently faster at 25, 30 and 33℃ than that at lower than 25℃ or higher than 33℃.%测定了牛蛙(Rana catesbeiana)离体坐骨神经干在5、15、25、30、33、35、39℃七个温度条件下的动作电位波幅和传导速度.结果表明:温度显著影响牛蛙神经干的动作电位幅度和传导速度,牛蛙神经干动作电位幅度和传导速度不随温度的改变而呈同步的变化.在5 - 30℃温度范围内,牛蛙神经干的动作电位幅度随温度升高而增大,30℃后显著下降,39℃时最低;25、30、33℃动作电位的传导速度相对较快,温度低于25℃或高于33℃,牛蛙神经干的传导速度均呈显著的下降趋势.

  17. The effects of low temperature on nerve impulse generation and conduction of bull frog (Rana catesbeiana)%牛蛙神经冲动产生和传导的低温效应

    Institute of Scientific and Technical Information of China (English)

    吴义莲; 许雪峰; 罗来高; 殷培峰

    2012-01-01

    The action potential range and the conductive velocity of the nerve trunk of bull frog ( Rana catesbeiana) were measured at nine time (0, 24, 48, 96, 120, 144, 168, 192 and 216 h) under two (5℃ and 15℃ ) temperatures. Results showed that there was no significant difference of the action potential range at 0 and 24 h under the two temperatures. The conductive velocity at 0 h under the relative high temperature (15℃ ) was greater than that under the lower temperature (5℃) , however, there was no difference of the conductive velocity between two temperatures at 24 h. The action potential range and the conductive velocity of the nerve trunk could not be examined at 48 h under 15℃ , whereas, they could maintain at a relative high level for one week under 5℃.%在5℃和15℃温度条件下,用牛蛙(Rana catesbeiana)离体坐骨神经标本测定0、24、48、96、120、144、168、192、216 h 9个时段的动作电位波幅和传导速度.结果表明:两个温度下离体坐骨神经的动作电位幅度在0 h和24 h差异均不显著,0 h时相对高温(15℃)下动作电位传导速度大于相对低温(5℃),24 h时两个温度下动作电位的传导速度差异不显著,相对高温下48 h时坐骨神经的兴奋性为零.相对低温条件下,坐骨神经兴奋性能维持7 d时间.

  18. An immunocytochemical and ultrastructural study of the larval anterior intestine of the frog Rana temporaria, with especial reference to endocrine cells.

    Science.gov (United States)

    Bodegas, M E; Villaro, A C; Burrell, M A; Rovira, J; Valverde, E; Ortiz De Zárate, A; Sesma, P

    1997-10-01

    Endocrine cells of the larval intestine of Rana temporaria tadpoles have been identified by argyrophilic, immunocytochemical and electron-microscopical techniques. Scarce endocrine cells have been found in both the short non-absorptive zone immediately following the stomach, and in the rest of the anterior intestine. Endocrine cells are frequently seen to extend a cytoplasmic process towards the lumen. Immunoreactivity for serotonin, somatostatin, bombesin and cholecystokinin-8 has been detected. According to the ultrastructural traits of the endocrine granules, three larval intestinal endocrine populations have been differentiated.

  19. Morphological correlates of aquatic and terrestrial locomotion in a semi-aquatic frog, Rana esculenta : no evidence for a design conflict

    NARCIS (Netherlands)

    Nauwelaerts, Sandra; Ramsay, Jason; Aerts, Peter

    2007-01-01

    Semi-aquatic frogs are faced with an unusual locomotory challenge. They have to swim and jump using the same apparatus, i.e. the hind limbs. Optimization of two tasks that require mutually incompatible morphologies or physiologies cannot occur simultaneously. In such cases, natural selection will re

  20. Resurrecting an Extinct Species: Archival DNA, Taxonomy, and Conservation of the Vegas Valley Leopard Frog

    Science.gov (United States)

    Suggestions that the extinct Vegas Valley leopard frog (Rana fisheri = Lithobates fisheri) may have been synonymous with one of several declining species has complicated recovery planning for imperiled leopard frogs in southwestern North America. To address this concern, we recon...

  1. Immunofluorescence studies on gonadotropin releasing hormone (GRH) in the fore-brain and the neurohypophysis of the green frog, Rana esculenta L.

    Science.gov (United States)

    Goos, H J; Ligtenberg, P J; van Oordt, P G

    1976-05-13

    Using antibodies against mammalian LH-RH, the double antibody-immunofluorecence technique has been applied to serial cross sections of the brains of adult Rana esculenta. Immunoreactive material was found in perikarya of an unpaired nucleus in front of the preoptic recess. The axons of these perikarya also contain fluorescing material. They form a single bundle which passes under the preoptic recess, than splits into two tracts, one on either side of the optic chiasm. The two tracts reunite just before entering the median eminence. The axons end near the capillaries in the outer zone of the median eminence. The possibility of two separate centres for the stimulation of gonadotropic activity in the brains of anurans is discussed.

  2. Cryptic diversity in metropolis: confirmation of a new leopard frog species (Anura: Ranidae from New York City and surrounding Atlantic coast regions.

    Directory of Open Access Journals (Sweden)

    Jeremy A Feinberg

    Full Text Available We describe a new cryptic species of leopard frog from the New York City metropolitan area and surrounding coastal regions. This species is morphologically similar to two largely parapatric eastern congeners, Rana sphenocephala and R. pipiens. We primarily use bioacoustic and molecular data to characterize the new species, but also examine other lines of evidence. This discovery is unexpected in one of the largest and most densely populated urban parts of the world. It also demonstrates that new vertebrate species can still be found periodically even in well-studied locales rarely associated with undocumented biodiversity. The new species typically occurs in expansive open-canopied wetlands interspersed with upland patches, but centuries of loss and impact to these habitats give some cause for conservation concern. Other concerns include regional extirpations, fragmented extant populations, and a restricted overall geographic distribution. We assign a type locality within New York City and report a narrow and largely coastal lowland distribution from central Connecticut to northern New Jersey (based on genetic data and south to North Carolina (based on call data.

  3. Cryptic diversity in metropolis: confirmation of a new leopard frog species (Anura: Ranidae) from New York City and surrounding Atlantic coast regions.

    Science.gov (United States)

    Feinberg, Jeremy A; Newman, Catherine E; Watkins-Colwell, Gregory J; Schlesinger, Matthew D; Zarate, Brian; Curry, Brian R; Shaffer, H Bradley; Burger, Joanna

    2014-01-01

    We describe a new cryptic species of leopard frog from the New York City metropolitan area and surrounding coastal regions. This species is morphologically similar to two largely parapatric eastern congeners, Rana sphenocephala and R. pipiens. We primarily use bioacoustic and molecular data to characterize the new species, but also examine other lines of evidence. This discovery is unexpected in one of the largest and most densely populated urban parts of the world. It also demonstrates that new vertebrate species can still be found periodically even in well-studied locales rarely associated with undocumented biodiversity. The new species typically occurs in expansive open-canopied wetlands interspersed with upland patches, but centuries of loss and impact to these habitats give some cause for conservation concern. Other concerns include regional extirpations, fragmented extant populations, and a restricted overall geographic distribution. We assign a type locality within New York City and report a narrow and largely coastal lowland distribution from central Connecticut to northern New Jersey (based on genetic data) and south to North Carolina (based on call data).

  4. COMPARATIVE TOXICITY OF DIURON ON SURVIVAL AND GROWTH OF PACIFIC TREEFROG, BULLFROG, RED-LEGGED FROG, AND AFRICAN CLAWED FROG EMBRYOS AND TADPOLES

    Science.gov (United States)

    The effects of the herbicide diuron on survival and growth of Pacific treefrog (Pseudacris regilla),bullfrog(Rana catesbeiana), red-legged frog(Rana aurora),and African clawed frog(Xenopus laevis)embryos and tadpoles were determined in static-renewal tests. P.regilla and X.laevis...

  5. Density-dependent growth and metamorphosis in the larval bronze frog Rana temporalis is influenced by genetic relatedness of the cohort

    Indian Academy of Sciences (India)

    S Girish; S K Saidapur

    2003-06-01

    Effects of density and kinship on growth and metamorphosis in tadpoles of Rana temporalis were studied in a 2 × 4 factorial experiment. Fifteen egg masses were collected from streams in the Western Ghat region of south India. The tadpoles were raised as siblings or in groups of non-siblings at increasing density levels, viz. 15, 30, 60 and 120/5 l water. With an increase in density level from 15 to 120 tadpoles/5 l water, duration of the larval stage increased and fewer individuals metamorphosed irrespective of whether they belonged to sibling or non-sibling groups by day 100 when the experiments were terminated. The size of individuals at metamorphosis declined significantly with increase in the density of rearing. However, at higher densities (60 and 120 tadpoles/5 l water) sibling group tadpoles performed better compared to mixed groups and took significantly less time to metamorphose. Also, more individuals of sibling groups metamorphosed compared to non-sibling groups at a given density. Mixed rearing retarded growth rates, prolonged larval duration resulting in a wider spectrum of size classes, and lowered the number of individuals recruited to terrestrial life. The study shows that interference competition occurred more strongly in cohorts of mixed relatedness than in sibling groups.

  6. River islands, refugia and genetic structuring in the endemic brown frog Rana kukunoris (Anura, Ranidae) of the Qinghai-Tibetan Plateau.

    Science.gov (United States)

    Zhou, Weiwei; Yan, Fang; Fu, Jinzhong; Wu, Shifang; Murphy, Robert W; Che, Jing; Zhang, Yaping

    2013-01-01

    Frequently, Pleistocene climatic cycling has been found to be the diver of genetic structuring in populations, even in areas that did not have continental ice sheets, such as on the Qinghai-Tibetan Plateau (QTP). Typically, species distributed on the plateau have been hypothesized to re-treat to south-eastern refugia, especially during the Last Glacial Maximum (LGM). We evaluated sequence variation in the mitochondrial DNA gene Cytb and the nuclear DNA gene RAG-1 in Rana kukunoris, a species endemic to the QTP. Two major lineages, N and S, were identified, and lineage N was further subdivided into N1 and N2. The geographical distribution and genealogical divergences supported the hypothesis of multiple refugia. However, major lineages and sublineages diverged prior to the LGM. Demographical expansion was detected only in lineage S and sublineage N2. Sublineage N1 might have survived several glacial cycles in situ and did not expand after the LGM because of the absence of suitable habitat; it survived in river islands. Genetic analysis and environment modelling suggested that the north-eastern edge of QTP contained a major refugium for R. kukunoris. From here, lineage S dispersed southwards after the LGM. Two microrefugia in northern Qilian Mountains greatly contributed to current level of intraspecific genetic diversity. These results were found to have important implications for the habitat conservation in Northwest China.

  7. On the presence of Rana ridibunda ridibunda Pallas in the Netherlands

    NARCIS (Netherlands)

    Hoogmoed, M.S.

    1975-01-01

    Since long there has been a dispute whether in the Netherlands there occur one or two species of green frogs of the genus Rana. There has never been any doubt concerning the presence of Rana esculenta Linnaeus, a species widely distributed throughout the country (Van de Bund, 1964, 1968). The first

  8. [Cadmium distribution in tissues and Na,K-ATPase activity of the skin of the frog Rana temporaria in different routes of cadmium uptake by the body].

    Science.gov (United States)

    Vasil'eva, V F; Gusev, G P; Krestinskaia, T V; Burovina, I V; Ukhanov, K Iu

    1987-01-01

    Accumulation, distribution of Cd in tissues and its toxic effect depend of the mode of uptake of Cd by the organism. Subcutaneous injections of Cd (0.12-0.24 mg/100 g per day) for 10 days resulted in a significant accumulation of Cd in the liver and kidney. No death cases were observed. Addition of CdCl2 to the aquatic environment (more than 0.002%) caused acute toxic effect on frogs. Within 10 days, significant amounts of Cd were found in the skin, especially in its outside layers, small amounts were found in the kidney and liver. High external concentrations of CdCl2 (0.005%) inhibited the activity of Na,K-ATPase in the skin epithelium. It is suggested that adaptive detoxication of cadmium in the liver and kidney operating in mammals, is ineffective in amphibians provided cadmium uptake occurs via the skin.

  9. Toward understanding the genetic basis of adaptation to high-elevation life in poikilothermic species: A comparative transcriptomic analysis of two ranid frogs, Rana chensinensis and R. kukunoris

    Directory of Open Access Journals (Sweden)

    Yang Weizhao

    2012-11-01

    Full Text Available Abstract Background Understanding how organisms adapt to high-elevation environments at a genome scale provides novel insights into the process of adaptive evolution. Previous studies have mainly focused on endothermic organisms, while poikilothermic species may have evolved different mechanisms to cope with high-elevation environments. In this context, we sequenced transcriptomes of a pair of closely related anuran species, Rana chensinensis and R. kukunoris, which inhabit respective low- and high-elevation habitats. By comparing the two transcriptomes, we identified candidate genes that may be involved in high-elevation adaption in poikilothermic species. Results Over 66 million sequence reads from each transcriptome were generated. A total of 41,858 and 39,293 transcripts for each species were obtained by de novo assembly. By comparing the orthologous transcripts, we identified 125 protein-coding genes that have likely experienced strong positive selection (Ka/Ks>1. In addition, 335 genes that may bear a signature of positive selection (1≥Ka/Ks>0.5 were also recognized. By considering their functions, fourteen candidate genes were determined to be likely involved in high-elevation adaptation, including two CYP genes, USP-1, and several others. Conclusions We identified a set of candidate genes that may have promoted adaptation of R. kukunoris to its high-elevation environment. These include several genes that have previously been associated with oxygen binding, response to UV radiation, and repair of free radical injury. Detailed molecular, physiological, and phenotypic studies are required to better understand the roles of these genes in improving the performance of R. kukunoris in a high-elevation environment. We have evidence for both convergent and divergent evolution between endothermic and poikilothemic species, but additional research across a wide range of organisms will be necessary to comprehend the complexity of high

  10. California Red-Legged Frogs in coastal dune drainages (2015)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — California Red-legged Frogs (Rana draytonii) are typically regarded as inhabitants of permanent ponds, marshes, and slow-moving streams, but their ecology in other...

  11. New species of Haematoloechus (Digenea: Plagiorchidae in the lung of the foothill yellow-legged frog Rana boylii (Anura, from Humboldt County, California, USA Especie nueva de Haematoloechus (Digenea: Plagiorchidae del pulmón de la rana de patas amarillas Rana boylii (Anura, de Humboldt County, California, Estados Unidos de América

    Directory of Open Access Journals (Sweden)

    David Zamparo

    2011-06-01

    Full Text Available A new species of Haematoloechus is described from the lungs of Rana boylii from Humboldt County, California. The new species is similar to Haematoloechus buttensis, Haematoloechus kernensis, and Haematoloechus complexus in general course of the uterus and gonad shape. It is similar to H. buttensis by having a cirrus sac terminating midway between the posterior margin of the pharynx and the anterior margin of the ovary, and having a smaller oral/ventral sucker ratio; to H. complexus by having the genital pore ventral to the pharynx, and it is similar to H. kernensis by having a larger oral sucker to pharynx width ratio. The new species is unique by lacking an extra-cecal longitudinal uterine loop from the hind-body. Molecularly, the new species differs 1.04-1.15% in partial 28S sequence with respect to H. complexus, and a monophyletic grouping of these specimens in a phylogenetic analysis of all available sequence data consistent with the species-specific status proposed herein. Evidence is also presented to suggest that specimens identified as H. buttensis in Rana pretiosa from British Columbia, Canada represents a new, but still undescribed species. The importance of conducting biological inventories of helminths, along with continued monitoring of populations, and collections based taxonomy are related.Una especie nueva de Haematoloechus es descrita de los pulmones de Rana boylii de Humboldt County, California. La especie nueva guarda semejanza con Haematoloechus buttensis, Haematoloechus kernensis, y Haematoloechus complexus en la disposición general del útero y en la forma de las gónadas. Es similar a H. buttensis en que la bolsa del cirro finaliza entre el margen posterior de la faringe y el margen anterior del ovario, y en presentar una relación menor entre la ventosa oral y el acetábulo; a H. complexus por tener el poro genital ventral a la faringe, y a H. kernensis por tener una relación mayor del ancho de la ventosa oral contra la

  12. Landscape resistance to frog movements

    Science.gov (United States)

    Mazerolle, M.J.; Desrochers, A.

    2005-01-01

    An animal's capacity to recolonize a patch depends on at least two components: its ability to detect the patch and its ability to reach it. However, the disruption of such processes by anthropic disturbances could explain low animal abundance patterns observed by many investigators in certain landscapes. Through field experiments, we compared the orientation and homing success of northern green frogs (Rana clamitans melanota Rafinesque, 1820) and northern leopard frogs (Rana pipiens Schreber, 1782) translocated across disturbed or undisturbed surfaces. We also monitored the path selected by individuals when presented with a choice between a short distance over a disturbed surface and a longer, undisturbed route. Finally, we measured the water loss and behaviour of frogs on substrates resulting from anthropogenic disturbances and a control. When presented with a choice, 72% of the frogs avoided disturbed surfaces. Although able to orient towards the pond of capture when translocated on disturbed surfaces, frogs had a lower probability of homing successfully to the pond than when translocated at a similar distance on an undisturbed surface. Frogs lost the most water on substrates associated with disturbance and in the absence of cover. Our data illustrate that anthropically disturbed areas devoid of cover, such as mined peatlands and agricultural fields, disrupt the ability of frogs to reach habitat patches and are likely explanations to their reduced abundance patterns in such environments. ?? 2005 NRC Canada.

  13. 75 FR 8733 - Least Chub and Columbia Spotted Frog Candidate Conservation Agreement With Assurances; Receipt of...

    Science.gov (United States)

    2010-02-25

    ... Fish and Wildlife Service Least Chub and Columbia Spotted Frog Candidate Conservation Agreement With... (CCAA) for the least chub (Iotichthys phlegethontis) and Columbia spotted frog (Rana lutreiventris..., least chub and Columbia spotted frog inhabited a variety of aquatic habitat types throughout...

  14. Modeling potential river management conflicts between frogs and salmonids

    Science.gov (United States)

    Steven F. Railsback; Bret C. Harvey; Sarah J. Kupferberg; Margaret M. Lang; Scott McBain; Hart H. Welsh

    2016-01-01

    Management of regulated rivers for yellow-legged frogs (Rana boylii) and salmonids exemplifies potential conflicts among species adapted to different parts of the natural flow and temperature regimes. Yellow-legged frogs oviposit in rivers in spring and depend on declining flows and warming temperatures for egg and tadpole survival and growth,...

  15. Osteología, taxonomía y relaciones filogenéticas de las ranas del género Telmatobufo (Leptodactylidae Osteology, taxonomy and phylogenetic relationships of the frog genus Telmatobufo (Leptodactylidae

    Directory of Open Access Journals (Sweden)

    J. RAMÓN FORMAS

    2001-06-01

    Full Text Available Se hizo un análisis osteológico de las especies del género Telmatobufo (T. australis, T. bullocki, T. venustus, el que completa la definición genérica fundamentada exclusivamente en la osteología de T. bullocki y caracteres larvarios. Para cada especie se entrega nueva información distribucional, ecológica, reproductiva, morfométrica, cromosómica, alozímica y molecular. Se presenta una clave para identificar individuos adultos de las tres especies de Telmatobufo. Se publica por primera vez una lámina de Philippi perdida por casi un siglo, lo que permite aclarar de manera definitiva la identidad taxonómica de T. venustus. Con las distancias de Mahalanobis y las distancias genéticas de Rogers se determinan las similitudes morfológicas y genéticas entre las especies de Telmatobufo. Usando las secuencias para ARN 12S mitocondrial, frecuencias alélicas polarizadas de genes estructurales y caracteres morfológicos (osteológicos y morfológicos externos se propone una hipótesis de relaciones filogenéticas basada en los principios de máxima parsimonia y máxima probabilidad. Finalmente se entrega una proposición acerca de la especiación e historia evolutiva de este grupo de ranas endémicas de los bosques templados del centro-sur de ChileAn osteological analysis of the three species of the genus Telmatobufo (T. australis, T. bullocki, and T. venustus was done. That analysis completes the generic definition based mainly on the osteology of T. bullocki and on morphological larval characters. New information on morphometry, chromosomes, reproductive biology, ecology, geographical range, allozymes, and molecular data is provided for each species. A key for the taxonomic determination of adult specimens of Telmatobufo is also presented. An unedited original plate by R.A. Philippi, lost for almost a century, is published for the first time; this plate allowed the restatement of the taxonomical identity of T. venustus. Mahalanobis

  16. Distribución y abundancia de Craugastor vulcani: una especie de rana en riesgo de Los Tuxtlas, Veracruz, México Distribution and abundance of Craugastor vulcani: an endangered frog species from Los Tuxtlas, Veracruz, Mexico

    Directory of Open Access Journals (Sweden)

    Eduardo Pineda

    2010-04-01

    Full Text Available En México, más de la mitad de las especies de anfibios están amenazadas y de la mayoría no se genera información que permita conocer el estatus en el que se encuentran sus poblaciones. En este trabajo se evaluó la distribución y abundancia de Craugastor vulcani, una rana endémica de la sierra de Los Tuxtlas Veracruz que se encuentra en riesgo de extinción, en función de la transformación de la selva. Para este trabajo, se consultaron bases de datos de registros históricos y se muestrearon 12 sitios que representan ambientes comunes de la región. Se registró un total de 524 individuos, de los cuales el 77% se encontraron en fragmentos de selva, el 20% en remanentes riparios y sólo el 3% en potreros. La mayor abundancia (62% se registró durante la época seca del año. La distribución conocida de C. vulcani está sesgada hacia el norte de la sierra, existe poca información sobre su presencia en la porción sur. La permanencia de la especie en la zona parece depender de los pocos fragmentos de bosque existentes. El aumento en el número, área y conectividad de tales remanentes son algunas de las medidas necesarias para conservar ésta y otras especies amenazadas en la región.More than a half of all amphibian species occurring in Mexico are threatened, and for most of them there is no current information to assess the status of their populations. Craugastor vulcani is an endemic frog from the Los Tuxtlas mountains, Veracruz, and it is classified as an endangered species. We examine the distribution and abundance of C. vulcani as a function of rainforest transformation in Los Tuxtlas. We consulted historical records in databases and sampled 12 sites representing common habitats of the region. We recorded a total of 524 individuals of which 77% were found in rainforest fragments, 20% were collected in riparian remnants and just 3% in cattle pastures. Most individuals (62% were recorded during the dry season. The known distribution

  17. New Replacement Name for Rana paradoxa Mocquard, 1890 with Designations of Lectotypes for Rana paradoxa and Rana conspicil-lata Günther, 1872:Both Synonymized with Limnonectes kuhlii (Tschudi, 1838) (Dicroglossidae:Dicroglossinae)

    Institute of Scientific and Technical Information of China (English)

    Masafumi MATSUI; Alain DUBOIS; Annemarie OHLER

    2013-01-01

    Fanged frogs, now called Limnonectes kuhlii, from Borneo are remotely related to true Javanese L. kuhlii. For future taxonomy of Bornean fanged frogs, we ifx the nomenclatural status of two existing names, Rana conspicillata Günther, 1872 and Rana paradoxa Mocquard, 1890. Morphological comparison of the type-series revealed heterospeciifc relationships of the two species. For R. conspicillata, we designate BMNH 1947.2.29.20 as the lectotype, and for R. para-doxa, we also designate MNHN 1889.222 as the lectotype and propose a replacement name Limnonectes mocquardi, in order to stabilize their nomenclature.

  18. Report on Oregon Spotted Frog Egg Mass Surveys 2013-2015

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Oregon spotted frogs (Rana pretiosa) were once common across wetlands throughout western Washington and Oregon and were found in northern California and southern...

  19. Oregon Spotted Frog Monitoring in the Oregon Cascades 2012-2016

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains information from visual encounter surveys conducted between 2012 and 2016 by USGS as part of an ongoing Oregon spotted frog (Rana pretiosa)...

  20. Exploratory evaluation of nutrient enrichment and frog response at Conboy Lake National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — We sampled nutrient and water quality parameters and surveyed Oregon spotted frogs (Rana pretiosa) life stages (eggs, larvae and recently metamorphosed juveniles) to...

  1. Alimentación de las ranas pardas, Rana gr. temporaria, en el circo de Piedrafita, (Pirineos, España

    Directory of Open Access Journals (Sweden)

    Rodríguez Vieites, D.

    1997-12-01

    Full Text Available Feeding of high Pyrenean mountain brown frogs were studied in the pre-wintering period. The main prey is beetles (44'97o, two-winged flies (12'9% and bees, wasps, ants, etc (11'4%. For the whole of the frogs, the most frequent prey size is the small (smaller than 10 mm. Big frogs tend to consume bigger prey in not ,o. many quantity, while small frogs consume more quantity of preys but smaller in size. From prey way of life, frogs eat mainly terrestrial and aerial preys, although capture of aquatic prey was observed (11'5% and these preys were eaten inside the water.

    Se ha estudiado la dieta de las ranas pardas en alta montaña pirenaica durante el periodo pre-invernal. Las ranas consumen principalmente coleópteros (44'9%, dípteros (12'9% e himenópteros (11'4%. Para el conjunto de todas las ranas estudiadas, las presas más consumidas son las de pequeño tamaño (menores de 10 mm. Las ranas de mayor talla tienden a consumir presas más grandes y en poca cantidad, mientras que las ranas pequeñas consumen más presas aunque de pequeño tamaño. En cuanto a forma de vida las presas más consumidas son terrestres y aéreas, aunque también se ha comprobado la captura de presas acuáticas (11'5% que son consumidas por las ranas dentro del agua.

  2. 76 FR 45602 - Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow Creek Ranch, San Luis...

    Science.gov (United States)

    2011-07-29

    ... Fish and Wildlife Service Proposed Safe Harbor Agreement for California Red-Legged Frog, at Swallow... the Federally threatened California red-legged frog (Rana draytonii), under the Endangered Species Act... California red-legged frog on the property subject to the Agreement (Enrolled Property), which is owned...

  3. Mitotic activity in dorsal epidermis of Rana pipiens.

    Science.gov (United States)

    Garcia-Arce, H.; Mizell, S.

    1972-01-01

    Study of statistically significant rhythms of mitotic division in dorsal epidermis of frogs, Rana pipiens, exposed to a 12:12 light:dark environment for 14 days. The results include the findings that (1) male animals have a primary period of 22 hr in summer and 18 hr in winter, (2) female animals have an 18 hr period, and (3) parapinealectomy and blinding abolish the rhythm.

  4. discussion on validity of rana maoershanensis based on partial sequence of 16s rrna gene

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    rana maoershanensis found in mt.maoershan in guangxi,china was reported as a new species in 2007,but there was no molecular data for this frog.the partial sequences (543 bp) of 16s rrna gene from 12 specimens of 3 brown frog species (rana hanluica,r.maoershanensis and r.chensinensis) were analyzed with 17 specimens of 9 species from genbank.the nucleotide sequence divergence between r.maoershanensis and the other brown frog species were 4.5%-6.5%,with 22-30 nucleotide substitutions at this locus.the phylogenetic relationships based on mp,ml,and bayesian inference indicate that the brown frogs from southern china were diverged into three groups (clades a,b and c).r.maoershanensis was clustered together a well-supported subclade (b-l).it is suggested that r.maoershanensis is a valid species.

  5. New record of sheep frog (Hypopachus variolosus in the Tres Marías Islands archipelago, Nayarit, Mexico Nuevo registro de la rana ovejera (Hypopachus variolosus en el archipiélago de las islas Marías, Nayarit, México

    Directory of Open Access Journals (Sweden)

    J. Antonio de la Torre

    2010-08-01

    Full Text Available During a recent visit to María Madre Island, in the Tres Marías Island archipelago, 2 specimens of Hypopachus variolosus were found. This new record of the sheep frog from Tres Marías Island archipelago represents the first island record for this species. Due to the uncertainty about its conservation status in this locality, we consider necessary to improve the information about this species in the island.Durante una reciente vista a la isla María Madre del archipiélago de las islas Marías se encontraron 2 ejemplares de Hypopachus variolosus. Este nuevo registro de la rana ovejera en las islas Marías representa el primero de esta especie para una isla. Consideramos que es necesario obtener más información de esta especie en el archipiélago ya que su estado de conservación en esta localidad es incierto.

  6. Phylogeography of Declining Relict and Lowland Leopard Frogs in the Desert Southwest of North America

    Science.gov (United States)

    We investigated the phylogeography of the closely related relict leopard frog (Rana onca) and lowland leopard frog (R. yavapaiensis) – two declining anurans from the warm-desert regions of southwestern North America. We used sequence data from two mitochondrial DNA genes to asses...

  7. Propulsive force calculations in swimming frogs II. Application of a vortex ring model to DPIV data

    NARCIS (Netherlands)

    Stamhuis, EJ; Nauwelaerts, S

    2005-01-01

    Frogs propel themselves by kicking water backwards using a synchronised extension of their hind limbs and webbed feet. To understand this propulsion process, we quantified the water movements and displacements resulting from swimming in the green frog Rana esculenta, applying digital particle image

  8. Phylogeography of Declining Relict and Lowland Leopard Frogs in the Desert Southwest of North America

    Science.gov (United States)

    We investigated the phylogeography of the closely related relict leopard frog (Rana onca) and lowland leopard frog (R. yavapaiensis) – two declining anurans from the warm-desert regions of southwestern North America. We used sequence data from two mitochondrial DNA genes to asses...

  9. A stockpile of ova in the grass frog Rana temporaria is established once for the life span. Do ovaries in amphibians and in mammals follow the same evolutionary strategy?

    Science.gov (United States)

    Ogielska, Maria; Kotusz, Agnieszka; Augustyńska, Renata; Ihnatowicz, Jerzy; Paśko, Łukasz

    2013-04-01

    Most anuran amphibians produce high numbers of eggs during several consecutive breeding seasons. The question is still open whether oocytes are formed anew as a result of oogonial proliferation after each spawning or the definitive pool of oocytes is established during the juvenile period and is sufficient for the whole reproductive life span of a female. Our quantitative studies show that primary oogonia in adult female frogs can proliferate, but they fail to differentiate further and do not enter meiosis, and thereby there is no supplementation of new generations of oocytes after each spawning. Ovaries of one-year-old grass frogs contain (median) 53,447 diplotene oocytes, in two-years-old frogs this number decreased to 33,583 and eventually reached 25,679 in virgin mature females. More than 50% decrease in the total oocyte number was accompanied by massive degeneration (atresia) of oocytes. The final number of oocytes in a female forms a stock for 11-12 breeding seasons and exceeds the number of eggs produced during the potential reproductive life span of this species. The phylogenetic context of oocyte recruitment modes in the major clades of vertebrates is discussed in respect to their ability to replenish the stock (a renewable stock in ovaries named "open" vs. a non-renewable stock in ovaries named "closed"). Copyright © 2013 Wiley Periodicals, Inc.

  10. Maximizing Sampling Efficiency and Minimizing Uncertainty in Presence/Absence Classification of Rare Salamander Populations

    Science.gov (United States)

    2008-10-31

    of the Apalachicola River drainage. Although this proposed division in classification appears to be generally accepted by the herpetological community...breeding in small forest ponds. Herpetological Review 33(4):275-280. Carle, F. L. and M. R. Strub. 1978. A new method for estimating population size...gopher frogs (Rana capito) and southern leopard frogs (Rana sphenocephala). Journal of Herpetology 42: 97-103. Grevstad, F.S. 2005. Simulating

  11. Epidermal Laser Stimulation of Action Potentials in the Frog Sciatic Nerve

    Science.gov (United States)

    2008-10-01

    Laser Stimulation of Action Potentials in the Frog Sciatic Nerve Nichole M. Jindra Robert J. Thomas Human Effectiveness Directorate Directed...in the Frog Sciatic Nerve 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 62202F 6. AUTHOR(S) .Nichole M. Jindra, Robert J. Thomas, Douglas N...Alan Rice 14. ABSTRACT Measurements of laser stimulated action potentials in the sciatic nerve of leopard frogs (Rana pipiens) were made using

  12. Pesticides and Population Declines of California Alpine Frogs

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured ...

  13. Role of cutaneous surface fluid in frog osmoregulation

    DEFF Research Database (Denmark)

    Larsen, Erik Hviid; Ramløv, Hans

    2013-01-01

    The study investigated whether evaporative water loss (EWL) in frogs stems from water diffusing through the skin or fluid secreted by mucous glands. Osmolality of cutaneous surface fluid (CSF) of Rana esculenta (Pelophylax kl. esculentus) subjected to isoproterenol or 30 °C–34 °C was 191 ± 9...

  14. AIRBORNE PESTICIDES AND POPULATION DECLINES OF A CALIFORNIA ALPINE FROG

    Science.gov (United States)

    The mountain yellow-legged frog (Rana muscosa) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distribution and temporal variation of ...

  15. Pesticides and Population Declines of California Alpine Frogs

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured ...

  16. Sexual Dimorphism and Morphological Correlates of Mating Individuals in the Frog Rana dybowskii%东北林蛙的两性异形和抱对个体的形态相关性

    Institute of Scientific and Technical Information of China (English)

    刘鹏; 刘恒; 张德成; 赵文阁

    2013-01-01

    2012年4月,在吉林省长白山地区,对正在抱对的30对东北林蛙(Rana dybowskii)成体的体长、头长、头宽、前肢长和后肢长进行测量,使用统计学的方法分析抱对个体形态特征的两性异形及配偶间形态特征的相关性.结果表明,两性的所有局部形态特征均与其体长呈显著正相关,其中,前肢长和后肢长随体长的增长速率在两性间无显著差异,而头长和头宽随体长的增长速率存在显著差异.雌性成体显著大于雄性成体;特定体长下雄性的前肢显著大于雌性,其他局部特征没有显著的两性差异;雌性个体与抱对的雄性个体的后肢长呈显著正相关,其余形态特征两性间无相关性.因此,在东北林蛙的配偶选择中,雌性对雄性形态特征的选择与两性异形的形成无显著的相关性.%Thirty pairs of mating Rana dybowskii were collected from Changbaishan Mount of Jilin Province in April, 2012 to study sexual dimorphism and morphological correlates of mate choice. Measurements taken for each individual included snout-urostyle length (SUL), head length (HL), head width (HW) , fore-limb length (FLL) and hind-limb length (HLL). All morphological variables measured were positively correlated with SUL in both sexes. The rates at which FLL and HLL increased with SUL did not differ between the sexes, whereas the rates at which HL and HW increased with SUL differed between the sexes. The mean SUL was greater in females than in males, FLL was greater in males than in females after accounting for variation in SUL, and other morphological traits did not differ between the sexes. Our data also showed that there were no significant correlation in most examined morphological traits of paired female and male except HLL. Therefore, the formation of sexual dimorphism in R. dybowskii were not significantly correlates with morphological traits of mate choice.

  17. Acid exposure is an immune disruptor in adult Rana pipiens.

    Science.gov (United States)

    Vatnick, Itzick; Andrews, Jaime; Colombo, Matthew; Madhoun, Hareth; Rameswaran, Muthuramanan; Brodkin, Marc A

    2006-01-01

    Acidic environments are physiological stressors for amphibians. The objective of the present study was to document the effect of an acidic environment on innate immune system function under controlled experimental conditions in Rana pipiens. We developed an in vivo assay, by injecting a suspension of 1-microm fluorescent beads in fluid thioglycollate, to induce peritonitis. The number of peritoneal exudate leukocytes and their phagocytic activity did not increase with thioglycollate injection when frogs were exposed to pH 5.5 compared to when frogs were exposed to pH 7.0. An environment of pH 5.5 disrupted the inflammatory response of frogs compared to an environment of pH 7.0; at pH 5.5, more nonphagocytic leukocytes and fewer highly phagocytic leukocytes were found compared to those in frogs exposed to pH 7.0. Frogs stimulated by thioglycollate injection and exposed to pH 5.5 had a 50% increase in cells that did not exhibit phagocytosis and a 4- to 10-fold reduction in the number of highly phagocytic cells. This is evidence that acid exposure functions as an immune disruptor in adult R. pipiens under laboratory conditions.

  18. Body size affects the predatory interactions between introduced American Bullfrogs (Rana catesbeiana) and native anurans in China: An experimental study

    Science.gov (United States)

    Wang, Y.; Guo, Z.; Pearl, C.A.; Li, Y.

    2007-01-01

    Introduced American Bullfrogs (Rana catesbeiana) have established breeding populations in several provinces in China since their introduction in 1959. Although Bullfrogs are viewed as a potentially important predator of Chinese native anurans, their impacts in the field are difficult to quantify. We used two experiments to examine factors likely to mediate Bullfrog predation on native anurans. First, we examined effects of Bullfrog size and sex on daily consumption of a common Chinese native (Rana limnocharis). Second, we examined whether Bullfrogs consumed similar proportions of four Chinese natives: Black-Spotted Pond Frog (Rana nigromaculata), Green Pond Frog (Rana plancyi plancyi), Rice Frog (R. limnocharis), and Zhoushan Toad (Bufo bufo gargarizans). We found that larger Rana catesbeiana consumed more R. limnocharis per day than did smaller R. catesbeiana, and that daily consumption of R. limnocharis was positively related to R. catesbeiana body size. When provided with adults of four anurans that differed significantly in body size, R. catesbeiana consumed more individuals of the smallest species (R. limnocharis). However, when provided with similarly sized juveniles of the same four species, R. catesbeiana did not consume any species more than expected by chance. Our results suggest that body size plays an important role in the predatory interactions between R. catesbeiana and Chinese native anurans and that, other things being equal, smaller species and individuals are at greater risk of predation by R. catesbeiana. Copyright 2007 Society for the Study of Amphibians and Reptiles.

  19. Population size, survival, growth, and movements of Rana sierrae

    Science.gov (United States)

    Fellers, Gary M.; Kleeman, Patrick M.; Miller, David A. W.; Halstead, Brian J.; Link, William

    2013-01-01

    Based on 2431 captures of 757 individual frogs over a 9-yr period, we found that the population of R. sierrae in one meadow–stream complex in Yosemite National Park ranged from an estimated 45 to 115 adult frogs. Rana sierrae at our relatively low elevation site (2200 m) grew at a fast rate (K = 0.73–0.78), had high overwintering survival rates (44.6–95%), lived a long time (up to 16 yr), and tended to be fairly sedentary during the summer (100% minimum convex polygon annual home ranges of 139 m2) but had low year-to-year site fidelity. Even though the amphibian chytrid fungus (Batrachochytrium dendrobatidis, Bd) has been present in the population for at least 13 yr, there was no clear downward trend as might be expected from reports of R. sierrae population declines associated with Bd or from reports of widespread population decline of R. sierrae throughout its range.

  20. Nephrotoxic effects of lead nitrate in Rana ridibunda

    Energy Technology Data Exchange (ETDEWEB)

    Loumbourdis, N.S. [Department of Zoology, University of Thessaloniki, 54124, Thessaloniki (Greece)

    2003-09-01

    The impact of lead (Pb) on kidney histopathology of the frog Rana ridibunda was investigated. Female frogs were exposed for 4, 10 and 30 days to 14 ppm lead (as lead nitrate). All the lead concentrations and many histological changes were time dependent. Light microscopy of kidney revealed morphological changes mainly in the proximal convoluted tubule (PCT) cells. The most severe changes such as vacuolation, Perl's stained material, infiltration, brush border destruction and proximal tubule damage were detected in the animals exposed for 10 and 30 days. Karyomegaly was highest at 10-days exposure, probably as a result of intense stress caused by the lead. Some PCT in the 30-days-exposed animals were von Kossa's method positive, suggesting the presence of calcium. The possibility is discussed that some of these changes, such as karyomegaly and intranuclear inclusions, might be preneoplastic if lead was supplied at high concentrations and for long time. (orig.)

  1. Reproductive interference between Rana dalmatina and Rana temporaria affects reproductive success in natural populations.

    Science.gov (United States)

    Hettyey, Attila; Vági, Balázs; Kovács, Tibor; Ujszegi, János; Katona, Patrik; Szederkényi, Márk; Pearman, Peter B; Griggio, Matteo; Hoi, Herbert

    2014-10-01

    Experimental evidence suggests that reproductive interference between heterospecifics can seriously affect individual fitness; support from field studies for such an effect has, however, remained scarce. We studied reproductive interference in 25 natural breeding ponds in an area where two ranid frogs, Rana dalmatina and Rana temporaria, co-occur. The breeding seasons of the two species usually overlap and males of both species are often found in amplexus with heterospecific females, even though matings between heterospecifics produce no viable offspring. We estimated species abundance ratios based on the number of clutches laid and evaluated fertilization success. In ponds with low spatial complexity and a species abundance ratio biased towards R. temporaria, the average fertilization success of R. dalmatina eggs decreased, while this relationship was not detectable in spatially more complex ponds. Fertilization success of R. temporaria did not decrease with increasing relative numbers of heterospecifics. This asymmetry in fitness effects of reproductive interference may be attributed to R. temporaria males being more competitive in scramble competition for females than R. dalmatina males. Our study is among the first to demonstrate that in natural breeding populations of vertebrates interference among heterospecifics has the potential to substantially lower reproductive success at the population level, which may in turn affect population dynamics.

  2. Diseases of frogs and toads

    Science.gov (United States)

    Green, D.E.; Converse, K.A.; Majumdar, S.K.; Huffman, J.E.; Brenner, F.J.; Panah, A.I.

    2005-01-01

    (Rana pipiens). Other interesting diseases could have been presented, such as a wart-like virus infection of Japanese newts and a group of protistan parasites, referred to as Dermocystidium and Dermomycoides, in European frogs and toads. The reader is referred to Green (2001) for a review of these diseases. Amphibians have a rich diversity of helminthic parasites (Poynton and Whitaker, 2001). In general, most cestodes, trematodes and nematodes of amphibians are innocuous and not linked to specific clinical signs ('symptoms') or mortalities. An important major exception to this generalization is the trematode, Ribeiroia, which has been linked to numerous and bizarre malformations of frogs, toads and salamanders (Johnson et al., 1999, Johnson et al., 2001, Schotthoefer et al., 2003). Two genera of trematodal parasites are discussed in this chapter: Ribeiroia because they cause malformations and Clinostomum because they are large and produce visible lumps in the skin. For a review of amphibian helminths, the reader is referred to the text by Flynn (1973).

  3. Variación interpoblacional y ontogenética en la dieta de la rana llorona Physalaemus albonotatus (Anura: Leiuperidae Interpopulation and ontogenetic variation in the diet of the menwig frog Physalaemus albonotatus (Anura: Leiuperidae

    Directory of Open Access Journals (Sweden)

    Diego Alejandro Falico

    2012-12-01

    Full Text Available Se analizó y comparó el espectro trófico de 2 poblaciones de Physalaemus albonotatus que habitan en ecosistemas diferentes: a un terreno baldío urbano y b un área protegida del valle aluvial del río Paraná Medio. La dieta de Physalaemus albonotatus está compuesta fundamentalmente de hormigas, coleópteros, colémbolos e isópodos, pero con numerosas presas secundarias. Al comparar 3 grupos etarios de los individuos en cada población (adultos, subadultos y jóvenes se encontró una variación ontogenética relacionada con el volumen, cantidad y tipo de presa ingerida. Los anfibios adultos consumieron mayor cantidad de presas y más voluminosas, pero el nicho trófico de los jóvenes fue más amplio. Entre los adultos, la similitud de la dieta entre sexos fue muy elevada, aunque las hembras consumieron más hormigas que los machos. Si bien el solapamiento trófico entre las poblaciones fue elevado, la amplitud trófica resultó mayor en la población del humedal fluvial. Las diferencias en la alimentación encontradas entre las 2 poblaciones y lo registrado en otros trabajos realizados en diferentes ambientes reflejan la plasticidad trófica de este anuro, característica que le permite prosperar en hábitats diversos, incluso en los muy antropizados.We analyzed and compared the feeding of 2 populations of Physalaemus albonotatus inhabiting different ecosystems: a an urban vacant lot, and b a protected area of Middle Paraná River floodplain. The diet of Physalaemus albonotatus is mainly composed by ants, beetles, springtails and woodlouses, but also included several secondary preys. While comparing adults, subadults and juveniles diet on each population, we found an ontogenetic diet variation related to changes in prey type and volume as well as in number of prey items per gut. Bigger frogs consumed a greater amount of prey and more voluminous arthropods, while juveniles had a larger trophic niche breadth. Despite the great similarity in

  4. Biomimetic agent based modelling using male Frog calling behaviour as a case study

    DEFF Research Database (Denmark)

    Jørgensen, Søren V.; Demazeau, Yves; Christensen-Dalsgaard, Jakob

    2014-01-01

    by individuals to generate their observed population behaviour. A number of existing agent-modelling frameworks are considered, but none have the ability to handle large numbers of time-dependent event-generating agents; hence the construction of a new tool, RANA. The calling behaviour of the Puerto Rican Tree...... Frog, E. coqui, is implemented as a case study for the presentation and discussion of the tool, and results from this model are presented. RANA, in its present stage of development, is shown to be able to handle the problem of modelling calling frogs, and several fruitful extensions are proposed...

  5. Data regarding the trophic spectrum of a population of Rana esculenta Complex from Bacau County

    Directory of Open Access Journals (Sweden)

    Daniel GHIURCA

    2006-05-01

    Full Text Available We analyzed the trophic spectrum of one population of Rana esculenta complex collected, placed close to the lake accumulation Bacău II. The most abundant prey taxons in the food of edible frog are species from Coleoptera order, followed by Hymenoptera and Diptera among insects and Aranee among spiders. We identified a great number of gregarious small species (Formicidae showing an opportunistic predator behavior of this frogs, using the sit and wait foraging behavior. The terrestrial preys prevail in comparison with aquatic organisms.

  6. Ecological Benefit of Rice-Fish-Frog Stereoscopic Agriculture%稻-鱼-蛙立体农业生态效益的研究

    Institute of Scientific and Technical Information of China (English)

    李学军; 乔志刚; 聂国兴

    2001-01-01

    Through breeding grass carp juvenile and Rana grylio young inrice field,was done experiment about stereoscopic agriculture of rice-fish-frog.In the symbiotic ecosystem of rice-fish-frog,the relationship among all kinds of ecofactors is harmonious with reasonable substance cycle and energy flow.The resources in the system are fully utilized therefore the ecological benefit is very outstanding.

  7. Directionality of auditory nerve fiber responses to pure tone stimuli in the grassfrog, Rana temporaria. II. Spike timing

    DEFF Research Database (Denmark)

    Jørgensen, M B; Christensen-Dalsgaard, J

    1997-01-01

    We studied the directionality of spike timing in the responses of single auditory nerve fibers of the grass frog, Rana temporaria, to tone burst stimulation. Both the latency of the first spike after stimulus onset and the preferred firing phase during the stimulus were studied. In addition, the ...

  8. An Electromyographic Study of Jaw and Tongue Reflexes in Frogs

    OpenAIRE

    熊井, 敏文; 野村, 浩道

    1983-01-01

    Electromyographic activities of jaw and tongue muscles produced reflexly by mechanical and chemical stimulation of various loci of orofacial region were studied in the frog, Rana nigromaculata. Temporal muscle activity occurred when mechanical stimuli were applied to the palatal ridge, lower lip, root of tongue and pharynx. Electromyograms of the masseter muscle were similar to that of the temporal muscle, but the masseter muscle activity was occurred ipsilaterally and was not occurred by the...

  9. Dissecting the frog inner ear with Gaussian noise .2. Temperature dependence of inner ear function

    NARCIS (Netherlands)

    vanDijk, P; Wit, HP; Segenhout, JM

    1997-01-01

    The temperature dependence of the response of single primary auditory nerve fibers (n = 31) was investigated in the European edible frog, Rana esculenta (seven ears). Nerve fiber responses were analyzed with Wiener kernel analysis and polynomial correlation. The responses were described with a casca

  10. Breeding phenology in Rana temporaria. Local variation is due to pond temperature and population size.

    Science.gov (United States)

    Loman, Jon

    2016-09-01

    Frog breeding phenology in temperate zones is usually compared to progress of spring temperatures at a regional scale. However, local populations may differ substantially in phenology. To understand this, local climate and other aspects must be studied. In this study, breeding phenology of the common frog, Rana temporaria, in a set of ponds in southern Sweden is analyzed. There was within year a variation of up to 3 weeks in start of breeding among local populations. Water temperature was measured in the ponds, and breeding tended to be earlier in warmer ponds (surprise!). Breeding was also earlier in ponds with a large breeding congregation. Alternative reasons for these patterns are suggested and discussed. There was a large residual variation. The common frog has a wide range of acceptable wintering sites, and I hypothesize that the particular choice by a local population may explain part of this residual variation.

  11. Biomimetic agent based modelling using male Frog calling behaviour as a case study

    DEFF Research Database (Denmark)

    Jørgensen, Søren V.; Demazeau, Yves; Christensen-Dalsgaard, Jakob;

    2014-01-01

    A new agent-based modelling tool has been developed to allow the modelling of populations of individuals whose interactions are characterised by tightly timed dynamics. The tool was developed to model male frog calling dynamics, to facilitate research into what local rules may be employed...... Frog, E. coqui, is implemented as a case study for the presentation and discussion of the tool, and results from this model are presented. RANA, in its present stage of development, is shown to be able to handle the problem of modelling calling frogs, and several fruitful extensions are proposed...

  12. Dye-coupling among frog (Rana catesbeiana) taste disk cells.

    Science.gov (United States)

    Sata, O; Okada, Y; Miyamoto, T; Sato, T

    1992-09-01

    1. Dye-coupling among taste disk cells in the bullfrog fungiform papillae was examined histologically by injecting a fluorescent dye (Lucifer yellow) into the cell, and the effects of the dye-coupling on depolarizing responses induced by taste stimuli were studied electrophysiologically. 2. With dye injection into a taste cell, dye-coupling was found between taste cells (23%) or between taste cell and supporting cell (28%). With dye injection into a supporting cell, dye-coupling was found between supporting cells (34%) or between supporting cell and taste cell (27%). 3. Depolarizing responses recorded from either a taste cell or a supporting cell to stimulation with 0.5 M NaCl or 10 mM quinine-HCl were the same in amplitude whether the dye-coupling to another cell was present or not. On the other hand, depolarizing responses recorded from a taste cell for 0.5 mM acetic acid became significantly larger when dye-coupled to a supporting cell. 4. It is concluded that gustatory transduction for acid stimuli is influenced by supporting cells coupled to taste cells.

  13. Fantastic Frogs!

    Science.gov (United States)

    Scott, Kym

    2002-01-01

    Number rhymes can be used in many exciting and different ways to support the early learning goals for mathematics. The rhyme "five little speckled frogs" provides the theme for this display, which was set up in Lewisham's professional development center. It provides a range of ideas which would help develop young children's mathematical learning…

  14. Fantastic Frogs!

    Science.gov (United States)

    Scott, Kym

    2002-01-01

    Number rhymes can be used in many exciting and different ways to support the early learning goals for mathematics. The rhyme "five little speckled frogs" provides the theme for this display, which was set up in Lewisham's professional development center. It provides a range of ideas which would help develop young children's mathematical learning…

  15. A skeletochronological study of growth, longevity, and age at sexual maturity in a population of Rana latastei (Amphibia, Anura)

    Indian Academy of Sciences (India)

    Fabio M Guarino; Silvia Lunardi; Michela Carlomagno; Stefano Mazzotti

    2003-12-01

    Longevity and age at sexual maturity in an Italian population of Rana latastei were studied by skeletochronology performed on the phalanges. Frogs collected in 1998 and 1999 by drift fences and pitfall traps were marked by toe-clipping. After marking, individuals were released and the cut phalanges were processed for skeletochronological analysis. The maximum age so far recorded was 3 years in males and 4 years in females. The smallest male and female that were sexually mature on the basis of histological analysis of the gonads were 36 and 35 mm snout vent length (SVL), respectively. In both sexes, most individuals were estimated to breed shortly after emergence from their first overwintering. Among the European Brown Frogs, Rana latastei appears to be one of the shortest-lived and one of the first to reach sexual maturity.

  16. Hexadactyly case at a Rana kl. esculenta sample from the north-western part of Romania (Short Notes

    Directory of Open Access Journals (Sweden)

    Istvan SAS

    2006-05-01

    Full Text Available At 17 June 2006, in a habitat close to Gherta Mica locality (47°56'0'' N, 23°14'0'' E, Satu-Mare County, Romania we had found a sample of Rana kl. esculenta which presented hexadactyly at both of its posterior feet. The captured sample of edible frog had fully formed extra (sixth toes, with phalanges (bones. The hexadactyly was perfectly symmetrical at both of the posterior feet. At this individual we did not discovered any other malformations, the biometrical characters situating in the variations limits of the other green frogs from the studied habitat. A symmetric hexadacytly can be a result of atavism.

  17. Prevalence of Batrachochytrium dendrobatidis in three species of wild frogs on Prince Edward Island, Canada.

    Science.gov (United States)

    Forzán, M J; Vanderstichel, R; Hogan, N S; Teather, K; Wood, J

    2010-09-02

    Chytridiomycosis, caused by the fungus Batrachochytrium dendrobatidis (Bd), has resulted in the decline or extinction of approximately 200 frog species worldwide. It has been reported throughout much of North America, but its presence on Prince Edward Island (PEI), on the eastern coast of Canada, was unknown. To determine the presence and prevalence of Bd on PEI, skin swabs were collected from 115 frogs from 18 separate sites across the province during the summer of 2009. The swabs were tested through single round end-point PCR for the presence of Bd DNA. Thirty-one frogs were positive, including 25/93 (27%) green frogs Lithobates (Rana) clamitans, 5/20 (25%) northern leopard frogs L. (R.) pipiens, and 1/2 (50%) wood frogs L. sylvaticus (formerly R. sylvatica); 12 of the 18 (67%) sites had at least 1 positive frog. The overall prevalence of Bd infection was estimated at 26.9% (7.2-46.7%, 95% CI). Prevalence amongst green frogs and leopard frogs was similar, but green frogs had a stronger PCR signal when compared to leopard frogs, regardless of age (p frogs, juveniles were more frequently positive than adults (p = 0.001). Green frogs may be the most reliable species to sample when looking for Bd in eastern North America. The 1 wood frog positive for Bd was found dead from chytridiomycosis; none of the other frogs that were positive for Bd by PCR showed any obvious signs of illness. Further monitoring will be required to determine what effect Bd infection has on amphibian population health on PEI.

  18. Biosensor, ELISA, and frog embryo teratogenesis assay: Xenopus (FETAX) analysis of water associated with frog malformations in Minnesota

    Science.gov (United States)

    Garber, Eric A. E.; Erb, Judith L.; Downward, James G.; Priuska, Eric M.; Wittliff, James L.; Feng, Wenke; Magner, Joseph; Larsen, Gerald L.

    2001-03-01

    Between 1995 and 1997 over 62% of the counties in Minnesota reported the presence of malformed frogs. While most sites have recently shown a decline in malformed frog populations, one site in northeastern Minnesota with no prior history of containing malformed frogs was recently discovered to contain > 67% malformed Rana pipiens (northern leopard frogs). As part of an effort to study the presence of hormonally active agents in fresh water sources, water samples were collected from lakes in Minnesota containing malformed frogs and analyzed for the presence of hormonally active compounds using a novel evanescent field fluorometric biosensor and the frog embryo teratogenesis assay: Xenopus (FETAX) bioassay. The waveguide based biosensor developed by ThreeFold Sensors (TFS biosensor, Ann Arbor, MI) detects the presence of estrogenic compounds capable of interacting with free human ER-a and by inhibiting binding to an immobilized estrogen. The FETAX bioassay is a developmental assay, which measures teratogenicity, mortality, and inhibition of growth during the first 96 hours of organogenesis and thereby provides a universal screen for endocrine disruptors. TFS biosensor and FETAX screening of the water samples suggest a relationship between estrogenic activity, mineral supplementation, and the occurrence of malformed frogs.

  19. Prevalence of malformed frogs in Kaoping and Tungkang river basins of southern Taiwan.

    Science.gov (United States)

    Huang, Da-Ji; Chiu, Yuh-Wen; Chen, Chien-Min; Huang, Kai-Hsiang; Wang, Shu-Yin

    2010-05-01

    In this study we found many amphibians with bizarre appearances, known as malformations in Pingtung County southern Taiwan. For this investigation we collected frogs inhabiting the Kaoping and Tungkang river watersheds between February 2006 and June 2007. Among the total number of 10,909 normal frogs (i.e., anurans) collected during the investigation period, the Indian rice frogs (Rana limnocharis) account for the greatest number next is the Chinese bullfrog (Rana rugulosa). Of all the 244 captured malformed frogs, the Indian rice frog account for the greatest proportion. These malformed frogs have their main distribution in upstream areas of these two rivers. Our result indicates that the appearance rate of malformed frogs is 1.8% in the upstream reaches of the Kaoping River and 2.6%, and 0.8%, respectively in the upstream and midstream reaches of the Tungkang river. The most-commonly-found malformation is the lack of palms, followed by the lack of appendages, exostosis, and a malformed appendicular. It is, therefore, reasonable to speculate that the causes for the malformation may be related to the increased organic pollutants and agricultural chemicals used in the upstream reaches of these two rivers.

  20. LOS FANTASMAS EN RANAS DE ARISTÓFANES

    Directory of Open Access Journals (Sweden)

    Soraya Planchas Gallarte

    2015-05-01

    Full Text Available THE GHOSTS IN ARISTOPHANES’ FROGS. The aim of the following paper is to present and analyze the passages of the comedies of Aristophanes related to ghostly apparitions. By offering an overview of this issue, so recurrent among classical authors, we will be able to sketch, on the one hand, how the Athenian comic playwright configures this topic in one of his works. On the other, by contextualizing Aristophanes’ treatment of ghosts in his genre, we will have the opportunity of focusing on the similarities, and possible innovations introduced by the poet among ancient Greek authors. Keywords: Aristophanes, ghost, Frogs, apparition, comedy. // LOS FANTASMAS EN RANAS DE ARISTÓFANES. Resumen: La finalidad de nuestra investigación consiste principalmente en presentar y analizar aquellos pasajes de las comedias aristofánicas relacionados con el tópico de las apariciones fantasmales. Comenzaremos ofreciendo una visión general de este motivo, tan recurrente entre los autores clásicos, para, a continuación, detenernos exclusivamente en el tratamiento que hizo el comediógrafo ateniense. Creemos que una detenida observación de las similitudes e innovaciones de estas cuestiones nos llevará, en primer lugar, a delimitar una visión concreta del tópico dentro del género cómico y, en segundo lugar, a insertar una pieza clave en el puzle de la concepción de los fantasmas a lo largo de la literatura grecolatina. Palabras clave: Aristófanes, Ranas, fantasmas, apariciones, comedia.

  1. The Observation of Frog Species at State University of Malang as a Preliminary Effort on Frog Conservation

    Directory of Open Access Journals (Sweden)

    Dian Ratri Wulandari

    2013-04-01

    Full Text Available Frog is an amphibian which is widely spread around the world. Indonesia houses 450 species which represent 11% of frog species in the world. In Java Island alone, there live 42 species of frogs and toads. Frogs can be used as an environment indicator in that the presence of frog in a particular place indicates that the place stays natural and unpolluted. The 1st Campus of State University of Malang, which is located in the heart of Malang District, has been developing rapidly currently. Thus, it requires the construction of new various facilities to support its huge activities. Extensive construction can be destructive even damaging to the habitat of frog, which potentially threats the frog’s life, if it does not take the environmental impact into careful consideration. This study is aimed to identify the species of frog which survives at State University of Malang with, particularly the frog species found in 1995. Species identification was conducted by observing the morphological character. This study found that there were four species with three species remained survived in 1995; those were Duttaphrynus melanostictus, Polypedates leucomystax, and Kaloula baleta; and one new species called Rana chalconota. This study also revealed that there were four species which were extinct; those were Fejervarya cancrivora, Fejervarya limnocharis, Ingerophrynus biporcatus, and Occidoziga lima. This situation shows the decreasing amount of species from 7 to 4 within the last 17 years. This result indicates that there is a serious environmental degradation which causes the losing of frog habitats. Further research is needed to study the ecological condition changing in order to save the frog species.

  2. Fundamental Experiment to Determine Escape Countermeasures for Frogs Falling into Agricultural Canals

    Science.gov (United States)

    Watabe, Keiji; Mori, Atsushi; Koizumi, Noriyuki; Takemura, Takeshi

    Frogs often drown in agricultural canals with deep concrete walls, which are installed commonly in paddy fields after land improvement projects in Japan, because they cannot escape after falling into the canal. Therefore, countermeasures that enable frogs to escape from canals are required in some rural areas. An experimental canal with partially sloped walls was used as an escape countermeasure to investigate the preferable angle of slope for the walls, water depth and flow velocity that enables Tokyo Daruma Pond Frogs (Rana porosa porosa), which have no adhesive discs, to easily escape. Walls with slopes of 30-45 degrees allowed 50-60% of frogs to escape from the experimental canals, frogs especially easily climbed the 30 degree sloped walls. When the water depth was 5 cm or flow velocity was greater than 20 cm/s, approximately 80% of the frogs moved downstream and reached the sloped walls because the frogs' toes did not reach the bottom of the canal. However, if the depth was 2 cm and the flow velocity was 5 cm/s, only 4% of the frogs climbed the sloped walls because they could move freely. The frogs appeared to not be good at long-distance swimming and could not remain a long-time under running water. Therefore, walls sloped less than 30 degrees and control of both water depth and flow velocity appears important for enabling frogs to easily escape from canals.

  3. Airborne Pesticides as an Unlikely Cause for Population Declines of Alpine Frogs in the Sierra Nevada, California

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured...

  4. 76 FR 55413 - Proposed Safe Harbor Agreement for California Red-legged Frog, California Tiger Salamander, Smith...

    Science.gov (United States)

    2011-09-07

    ... Tiger Salamander, Smith's Blue Butterfly, and Yadon's Piperia at Palo Corona Regional Park, Monterey... federally threatened California red-legged frog (Rana draytonii) and California tiger salamander (Ambystoma..., California tiger salamander, Smith's blue butterfly, and Yadon's piperia on the property subject to...

  5. Spatial Patterns of Airborne Pesticides in the Alpine Habitat of a Declining California Amphibian, The Mountain Yellow-Legged Frog

    Science.gov (United States)

    The mountain yellow-legged frog complex (Rana muscosa complex) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distributions and conce...

  6. Airborne Pesticides as an Unlikely Cause for Population Declines of Alpine Frogs in the Sierra Nevada, California

    Science.gov (United States)

    Airborne pesticides from the Central Valley of California have been implicated as a cause for population declines of several amphibian species, with the strongest evidence for the mountain yellow-legged frog complex (Rana muscosa and R. sierrae) in the Sierra Nevada. We measured...

  7. Dissecting the frog inner ear with Gaussian noise .1. Application of high-order Wiener-kernel analysis

    NARCIS (Netherlands)

    vanDijk, P; Wit, HP; Segenhout, JM

    1997-01-01

    Wiener kernel analysis was used to characterize the auditory pathway from tympanic membrane to single primary auditory nerve fibers in the European edible frog, Rana esculenta. Nerve fiber signals were recorded in response to white Gaussian noise. By cross-correlating the noise stimulus and the nerv

  8. Spatial Patterns of Airborne Pesticides in the Alpine Habitat of a Declining Calfornia Amphibian, The Mountain Yellow-Legged Frog

    Science.gov (United States)

    The mountain yellow-legged frog complex (Rana muscosa complex) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distributions and conce...

  9. Distribution, structure and projections of the frog intracardiac neurons.

    Science.gov (United States)

    Batulevicius, Darius; Skripkiene, Gertruda; Batuleviciene, Vaida; Skripka, Valdas; Dabuzinskiene, Anita; Pauza, Dainius H

    2012-05-21

    Histochemistry for acetylcholinesterase was used to determine the distribution of intracardiac neurons in the frog Rana temporaria. Seventy-nine intracardiac neurons from 13 frogs were labelled iontophoretically by the intracellular markers Alexa Fluor 568 and Lucifer Yellow CH to determine their structure and projections. Total neuronal number per frog heart was (Mean ± SE) 1374 ± 56. Largest collections of neurons were found in the interatrial septum (46%), atrioventricular junction (25%) and venal sinus (12%). Among the intracellularly labelled neurons, we found the cells of unipolar (71%), multipolar (20%) and bipolar (9%) types. Multiple processes originated from the neuron soma, hillock and proximal axon. These processes projected onto adjacent neuron somata and cardiac muscle fibers within the interatrial septum. Average total length of the processes from proximal axon was 348 ± 50 μm. Average total length of processes from soma and hillock was less, 118 ± 27 μm and 109 ± 24 μm, respectively. The somata of 59% of neurons had bubble- or flake-shaped extensions. Most neurons from the major nerves in the interatrial septum sent their axons towards the ventricle. In contrast, most neurons from the ventral part of the interatrial septum sent their axons towards the atria. Our findings contradict to a view that the frog intracardiac ganglia contain only non-dendritic neurons of the unipolar type. We conclude that the frog intracardiac neurons are structurally complex and diverse. This diversity may account for the complicated integrative functions of the frog intrinsic cardiac ganglia.

  10. [Serotonin and neuropeptide FMRFamide in the nervous system of Opisthioglyphe ranae (Trematoda: Plagiorchiidae). an immunocytochemical study].

    Science.gov (United States)

    Terenina, N B; Kreshchenko, N D; Chilyuta, N V; Zaripova, F F

    2015-01-01

    The presence and localization of the serotoninergic and FMRFamidergic structures in the nervous system of the trematode Opisthioglyphe ranae, the marsh frog intestinal parasite, was studied using immunocytochemistry. The serotonin-immunoreactive nerve cells and fibers were revealed in the head ganglia, circular commissure, longitudinal nerve cords and their connective commissures, as well as around the oral and ventral suckers, oesophagus and genital pore. FMRF-specific immunoreactivity was observed in the head ganglia, longitudinal nerve cords and terminal parts of the reproductive system. The results obtained are discussed in light of the available data on the presence and functional significance of the above-mentioned neurotransmitters in trematodes.

  11. [Ploidy and genetic structure of hybrid populations of water frogs Pelophylax esculentus (L., 1758) complex (Amphibia, Ranidae) of Ukraine].

    Science.gov (United States)

    Mezhzherin, S V; Morozov-Leonov, S Iu; Rostovskaia, O V; Shabanov, D A; Sobolenko, L Iu

    2010-01-01

    The present study of green frog hybrid populations of Ukraine, including analysis of allozyme variability and planimetric analysis oferythrocytes size has confirmed that the unique region in this area is the Severski Donets basin The allopolyploid individuals there are met very frequently (5.7% of all investigated frogs). In other areas of Ukraine only two polyploid hybrids have been recorded. Beside that, one frog was defined as triploid Rana ridibundus. According to our investigations, all triploid hybrids from the Severski Donets basin are identified as P. esculentu (=lessonae)--2 ridibundus males.

  12. Oxidative phosphorylation efficiency, proton conductance and reactive oxygen species production of liver mitochondria correlates with body mass in frogs.

    Science.gov (United States)

    Roussel, Damien; Salin, Karine; Dumet, Adeline; Romestaing, Caroline; Rey, Benjamin; Voituron, Yann

    2015-10-01

    Body size is a central biological parameter affecting most biological processes (especially energetics) and the mitochondrion is a key organelle controlling metabolism and is also the cell's main source of chemical energy. However, the link between body size and mitochondrial function is still unclear, especially in ectotherms. In this study, we investigated several parameters of mitochondrial bioenergetics in the liver of three closely related species of frog (the common frog Rana temporaria, the marsh frog Pelophylax ridibundus and the bull frog Lithobates catesbeiana). These particular species were chosen because of their differences in adult body mass. We found that mitochondrial coupling efficiency was markedly increased with animal size, which led to a higher ATP production (+70%) in the larger frogs (L. catesbeiana) compared with the smaller frogs (R. temporaria). This was essentially driven by a strong negative dependence of mitochondrial proton conductance on body mass. Liver mitochondria from the larger frogs (L. catesbeiana) displayed 50% of the proton conductance of mitochondria from the smaller frogs (R. temporaria). Contrary to our prediction, the low mitochondrial proton conductance measured in L. catesbeiana was not associated with higher reactive oxygen species production. Instead, liver mitochondria from the larger individuals produced significantly lower levels of radical oxygen species than those from the smaller frogs. Collectively, the data show that key bioenergetics parameters of mitochondria (proton leak, ATP production efficiency and radical oxygen species production) are correlated with body mass in frogs. This research expands our understanding of the relationship between mitochondrial function and the evolution of allometric scaling in ectotherms.

  13. Itraconazole treatment reduces Batrachochytrium dendrobatidis prevalence and increases overwinter field survival in juvenile Cascades frogs.

    Science.gov (United States)

    Hardy, Bennett M; Pope, Karen L; Piovia-Scott, Jonah; Brown, Richard N; Foley, Janet E

    2015-01-15

    The global spread of the fungal pathogen Batrachochytrium dendrobatidis (Bd) has led to widespread extirpation of amphibian populations. During an intervention aimed at stabilizing at-risk populations, we treated wild-caught Cascades frogs Rana cascadae with the antifungal drug itraconazole. In fall 2012, we collected 60 recently metamorphosed R. cascadae from 1 of the 11 remnant populations in the Cascades Mountains (CA, USA). Of these, 30 randomly selected frogs were treated with itraconazole and the other 30 frogs served as experimental controls; all were released at the capture site. Bd prevalence was low at the time of treatment and did not differ between treated frogs and controls immediately following treatment. Following release, Bd prevalence gradually increased in controls but not in treated frogs, with noticeable (but still non-significant) differences 3 wk after treatment (27% [4/15] vs. 0% [0/13]) and strong differences 5 wk after treatment (67% [8/12] vs. 13% [1/8]). We did not detect any differences in Bd prevalence and load between experimental controls and untreated wild frogs during this time period. In spring 2013, we recaptured 7 treated frogs but none of the experimental control frogs, suggesting that over-winter survival was higher for treated frogs. The itraconazole treatment did appear to reduce growth rates: treated frogs weighed 22% less than control frogs 3 wk after treatment (0.7 vs. 0.9 g) and were 9% shorter than control frogs 5 wk after treatment (18.4 vs. 20.2 mm). However, for critically small populations, increased survival of the most at-risk life stage could prevent or delay extinction. Our results show that itraconazole treatment can be effective against Bd infection in wild amphibians, and therefore the beneficial effects on survivorship may outweigh the detrimental effects on growth.

  14. Efficacy of frog skin lipids in wound healing

    Directory of Open Access Journals (Sweden)

    Rajaram Rama

    2010-07-01

    Full Text Available Abstract Background Frog skin has been sequentially and scientifically evaluated by our group for its wound healing efficiency. Owing to the complex structure of skin, attempts were being made to analyse the role of individual constituents in different phases of healing. Our earlier papers have shown the significance of frog skin not only in wound healing but also enhancing the proliferating activity of the epidermal and dermal cells which are instrumental for normal healing process. We also have identified for the first time novel antimicrobial peptides from the skin of Rana tigerina and thereby reduce the complications involved in the sepsis. Purpose of the study and Results The current study envisages the role of frog skin lipids in the inflammatory phase of wound healing. The lipid moiety of the frog skin dominated by phospholipids exhibited a dose dependent acceleration of healing irrespective of the mode of application. The efficiency of the extract is attributed partially to the anti-inflammatory activity as observed by the histochemical and immunostimulatory together with plethysmographic studies. Conclusions Thus, frog skin for the first time has been demonstrated to possess lipid components with pharmaceutical and therapeutic potential. The identification and characterization of such natural healing molecules and evaluating their mechanism of action would therefore provide basis for understanding the cues of Nature and hence can be used for application in medicine.

  15. Drainage ditches facilitate frog movements in a hostile landscape

    Science.gov (United States)

    Mazerolle, M.J.

    2005-01-01

    Ditches are common in landscapes influenced by agricultural, forestry, and peat mining activities, and their value as corridors remains unassessed. Pond-breeding amphibians can encounter hostile environments when moving between breeding, summering, or hibernation sites, and are likely to benefit from the presence of ditches in the landscape. Within a system consisting of ditch networks in bogs mined for peat in eastern New Brunswick, Canada, I quantified the breeding, survival, and movements of green frogs (Rana clamitans melanota) in drainage ditches and also surveyed peat fields. Frogs rarely ventured on peat fields and most individuals frequented drainage ditches containing water, particularly in late summer. Though frogs did not breed in ditches, their survival rate in ditches was high (88%). Ditches did not hinder frog movements, as frogs moved independently of the current. Results indicate that drainage ditches containing water enable some movements between habitats isolated by peat mining, in contrast to peat surfaces, and suggest they function as amphibian movement corridors. Thus, such drainage ditches may mitigate the effects of peat extraction on amphibian populations. At the very least, these structures provide an alternative to hostile peat surfaces. This study highlights that small-scale corridors are potentially valuable in population dynamics. ?? Springer 2005.

  16. Effects of wetland vs. landscape variables on parasite communities of Rana pipiens: links to anthropogenic factors

    Science.gov (United States)

    Schotthoefer, Anna M.; Rohr, Jason R.; Cole, Rebecca A.; Koehler, Anson V.; Johnson, Catherine M.; Johnson, Lucinda B.; Beasley, Val R.

    2011-01-01

    The emergence of several diseases affecting amphibian populations worldwide has prompted investigations into determinants of the occurrence and abundance of parasites in frogs. To understand the spatial scales and identify specific environmental factors that determine risks of parasitism in frogs, helminth communities in metamorphic frogs of the northern leopard frog (Rana pipiens) were examined in relation to wetland and landscape factors at local (1 km) and regional (10 km) spatial extents in an agricultural region of Minnesota (USA) using regression analyses, ordination, and variance partitioning techniques. Greater amounts of forested and woody wetland habitats, shorter distances between woody wetlands, and smaller-sized open water patches in surrounding landscapes were the most consistently positive correlates with the abundances, richness, and diversity of helminths found in the frogs. Wetland and local landscape variables were suggested as most important for larval trematode abundances, whereas local and regional landscape variables appeared most important for adult helminths. As previously reported, the sum concentration of atrazine and its metabolite desethylatrazine, was the strongest predictor of larval trematode communities. In this report, we highlight the additional influences of landscape factors. In particular, our data suggest that anthropogenic activities that have resulted in the loss of the availability and connectivity of suitable habitats in the surrounding landscapes of wetlands are associated with declines in helminth richness and abundance, but that alteration of wetland water quality through eutrophication or pesticide contamination may facilitate the transmission of certain parasite taxa when they are present at wetlands. Although additional research is needed to quantify the negative effects of parasitism on frog populations, efforts to reduce inputs of agrochemicals into wetlands to limit larval trematode infections may be warranted

  17. Frog eat frog: exploring variables influencing anurophagy

    Directory of Open Access Journals (Sweden)

    G. John Measey

    2015-08-01

    Full Text Available Background. Frogs are generalist predators of a wide range of typically small prey items. But descriptions of dietary items regularly include other anurans, such that frogs are considered to be among the most important of anuran predators. However, the only existing hypothesis for the inclusion of anurans in the diet of post-metamorphic frogs postulates that it happens more often in bigger frogs. Moreover, this hypothesis has yet to be tested.Methods. We reviewed the literature on frog diet in order to test the size hypothesis and determine whether there are other putative explanations for anurans in the diet of post-metamorphic frogs. In addition to size, we recorded the habitat, the number of other sympatric anuran species, and whether or not the population was invasive. We controlled for taxonomic bias by including the superfamily in our analysis.Results. Around one fifth of the 355 records included anurans as dietary items of populations studied, suggesting that frogs eating anurans is not unusual. Our data showed a clear taxonomic bias with ranids and pipids having a higher proportion of anuran prey than other superfamilies. Accounting for this taxonomic bias, we found that size in addition to being invasive, local anuran diversity, and habitat produced a model that best fitted our data. Large invasive frogs that live in forests with high anuran diversity are most likely to have a higher proportion of anurans in their diet.Conclusions. We confirm the validity of the size hypothesis for anurophagy, but show that there are additional significant variables. The circumstances under which frogs eat frogs are likely to be complex, but our data may help to alert conservationists to the possible dangers of invading frogs entering areas with threatened anuran species.

  18. Plasma membrane electron transport in frog blood vessels

    Indian Academy of Sciences (India)

    Rashmi P Rao; K Nalini; J Prakasa Rao

    2009-12-01

    In an attempt to see if frog blood vessels possess a plasma membrane electron transport system, the postcaval vein and aorta isolated from Rana tigrina were tested for their ability to reduce ferricyanide, methylene blue, and 2,6-dichloroindophenol. While the dyes remained unchanged, ferricyanide was reduced to ferrocyanide. This reduction was resistant to inhibition by cyanide and azide. Heptane extraction or formalin fixation of the tissues markedly reduced the capability to reduce ferricyanide. Denuded aortas retained only 30% of the activity of intact tissue. Our results indicate that the amphibian postcaval vein and aorta exhibit plasma membrane electron transport

  19. A genetic component of resistance to fungal infection in frog embryos

    OpenAIRE

    Sagvik, Jörgen; Uller, Tobias; Olsson, Mats

    2008-01-01

    The embryo has traditionally been considered to completely rely upon parental strategies to prevent threats to survival posed by predators and pathogens, such as fungi. However, recent evidence suggests that embryos may have hitherto neglected abilities to counter pathogens. Using artificial fertilization, we show that among-family variation in the number of Saprolegnia-infected eggs and embryos in the moor frog, Rana arvalis, cannot be explained by maternal effects. However, analysed as a wi...

  20. TEMPORAL AND SPATIAL PATTERNS OF AIRBORNE PESTICIDES IN THE ALPINE ENVIRONMENT OF A DECLINING CALIFORNIA AMPHIBIAN, THE MOUNTAIN YELLOW-LEGGED FROG

    Science.gov (United States)

    The mountain yellow-legged frog (Rana muscosa) has disappeared from most of its historic localities in the Sierra Nevada of California, and airborne pesticides from the Central Valley have been implicated as a causal agent. To determine the distribution and temporal variation of...

  1. 东北林蛙满负荷放养技术%The Rana chensinensis full load cultivation techniques

    Institute of Scientific and Technical Information of China (English)

    宋玉波

    2015-01-01

    本文提出了东北林蛙养殖新模式———满负荷放养,并对该养殖模式的标准化蛙场基础设施建设、计划放养和科学管理等主要技术环节进行了详细介绍,可为林蛙养殖提供借鉴。%The full load cultivation which was the new cultivation mode of Rana chensinensis was raised in this paper.The standardized frog infrastructure construction, cultivation plan and scientific management of this cultivation mode were intro-duced.It provided reference to Rana chensinensis cultivation.

  2. Contractile reaction of isolated frog aorta after X-irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Michailov, M.C.; Prechter, I.; Greimel, H.; Welscher, U.E.

    1983-07-01

    The action of X-rays (50 kV, filtered by 0.3 mm Al) on helical strip of frog aorta (rana esculenta) has been investigated. The isolated preparations have a stable basal tone and are radio-sensitive to X-rays which induce reversible, dose-dependent, contractile responses. After repeated irradiational tachyphylaxis appears. The threshold doses are about 250 R at 3 to 6 kR/min, antiadrenergic (phentolamine, propranolol), anticholinergic (atropin), antihistaminic (Neo-Bridal) and serotoninergic (Deseril) drugs have no visible influence on the X-ray induced reaction, i.e. these action mechanisms of the irradiation-induced contraction do not seem probable. Theophylline and cAMP inhibit the X-ray contraction probably non-specifically. Indometacin also inhibits the X-ray contraction: this suggests participation of prostaglandin-mechanism on the contraction of frog aorta after irradiation.

  3. Prevalence of Spirometra mansoni in dogs, cats, and frogs and its medical relevance in Guangzhou, China.

    Science.gov (United States)

    Hong, Qing; Feng, Jieping; Liu, Haijuan; Li, Xiaomin; Gong, Lirong; Yang, Zhen; Yang, Weiming; Liang, Xiongfa; Zheng, Rujiang; Cui, Zhicai; Wang, Weiliang; Chen, Daixiong

    2016-12-01

    Sparganosis is an important parasitic disease in Guangzhou and is mainly acquired through the consumption of frog meat or contact with fresh frogs infected by larval stages (spargana) of the tapeworm species Spirometra mansoni. In this study, the prevalence of intestinal S. mansoni infections (with adult parasites) in dogs and cats and of extraintestinal S. mansoni infections (with spargana) in frogs was assessed. In addition, a questionnaire survey was carried out among residents in Guangzhou City in order to evaluate their awareness about the medical and epidemiological relevance of Spirometra and sparganosis. In total, the feces of 229 dogs and 116 cats were examined for eggs, and 1949 frogs were examined for spargana. Sixty-three dogs (27.5%) and 47 cats (40.5%) had eggs in their feces. Two hundred and sixteen out of 416 wild Rana tigrina rugulosa Wiegmann frogs examined were sparganum-positive, with an infection rate of 51.9%, while the infection rate in Rana limnocharis Boie was 35.1% (13/37). None of the tested farmed frogs (including R. tigrina rugulosa and Rana catesbeiana) was positive (0/1382). Analysis of the questionnaire revealed the following results: (1) about 41.0% of residents in Guangzhou had some knowledge of sparganosis or sparganum infection, and information in TV programs was the most important way that residents learned about sparganosis. (2) About 59.9% of the residents ate frog meat. Eating the meat, viscera, or blood of animals, e.g., frogs, snakes, pigs, chicken, mice, and birds, in an improper way might be the main means by which residents acquire the infection. (3) The risk of sparganum infection was higher in males than in females. A high sparganum infection rate was observed in the wild frogs sold in agricultural product markets in Guangzhou. The infection was also serious in cats and dogs in Guangdong Province. With lifestyles and eating habits resulting in sparganum infection, it is necessary to focus on market management and

  4. Chasing maximal performance: a cautionary tale from the celebrated jumping frogs of Calaveras County.

    Science.gov (United States)

    Astley, H C; Abbott, E M; Azizi, E; Marsh, R L; Roberts, T J

    2013-11-01

    Maximal performance is an essential metric for understanding many aspects of an organism's biology, but it can be difficult to determine because a measured maximum may reflect only a peak level of effort, not a physiological limit. We used a unique opportunity provided by a frog jumping contest to evaluate the validity of existing laboratory estimates of maximum jumping performance in bullfrogs (Rana catesbeiana). We recorded video of 3124 bullfrog jumps over the course of the 4-day contest at the Calaveras County Jumping Frog Jubilee, and determined jump distance from these images and a calibration of the jump arena. Frogs were divided into two groups: 'rental' frogs collected by fair organizers and jumped by the general public, and frogs collected and jumped by experienced, 'professional' teams. A total of 58% of recorded jumps surpassed the maximum jump distance in the literature (1.295 m), and the longest jump was 2.2 m. Compared with rental frogs, professionally jumped frogs jumped farther, and the distribution of jump distances for this group was skewed towards long jumps. Calculated muscular work, historical records and the skewed distribution of jump distances all suggest that the longest jumps represent the true performance limit for this species. Using resampling, we estimated the probability of observing a given jump distance for various sample sizes, showing that large sample sizes are required to detect rare maximal jumps. These results show the importance of sample size, animal motivation and physiological conditions for accurate maximal performance estimates.

  5. Nuevas localidades y descripción del hábitat de la rana Lithobates johni, especie endémica en peligro de extinción New records and description of the habitat for the endangered endemic frog Lithobates johni

    Directory of Open Access Journals (Sweden)

    José Ismael Campos-Rodríguez

    2012-06-01

    Full Text Available Se dan a conocer 2 localidades nuevas para Lithobates johni en el estado de Puebla, ubicadas dentro de la porción alta de la cuenca del río Tecolutla. Adicionalmente se describen las características de calidad del agua y microhábitat de las nuevas localidades de la especie.In this paper we provide 2 new records of the endemic frog Lithobates johni from the Mexican State of Puebla. These records are within the Upper Basin of Rio Tecolutla. Additionally, we describe the water quality and microhabitat of the new localities for this species.

  6. New record of sheep frog (Hypopachus variolosus) in the Tres Marías Islands archipelago, Nayarit, Mexico Nuevo registro de la rana ovejera (Hypopachus variolosus) en el archipiélago de las islas Marías, Nayarit, México

    OpenAIRE

    J. Antonio de la Torre; Leonardo J. López-Damián; Horacio V. Bárcenas; Edith Nájera-Solís; Rodrigo A Medellín

    2010-01-01

    During a recent visit to María Madre Island, in the Tres Marías Island archipelago, 2 specimens of Hypopachus variolosus were found. This new record of the sheep frog from Tres Marías Island archipelago represents the first island record for this species. Due to the uncertainty about its conservation status in this locality, we consider necessary to improve the information about this species in the island.Durante una reciente vista a la isla María Madre del archipiélago de las islas Marías se...

  7. Antimicrobial peptides from the skins of North American frogs.

    Science.gov (United States)

    Conlon, J Michael; Kolodziejek, Jolanta; Nowotny, Norbert

    2009-08-01

    North America is home to anuran species belonging to the families Bufonidae, Eleutherodactylidae, Hylidae, Leiopelmatidae, Ranidae, and Scaphiopodidae but antimicrobial peptides have been identified only in skin secretions and/or skin extracts of frogs belonging to the Leiopelmatidae ("tailed frogs") and Ranidae ("true frogs"). Eight structurally-related cationic alpha-helical peptides with broad-spectrum antibacterial activity, termed ascaphins, have been isolated from specimens of Ascaphus truei (Leiopelmatidae) occupying a coastal range. Characterization of orthologous antimicrobial peptides from Ascaphus specimens occupying an inland range supports the proposal that this population should be regarded as a separate species A. montanus. Ascaphin-8 shows potential for development into a therapeutically valuable anti-infective agent. Peptides belonging to the brevinin-1, esculentin-1, esculentin-2, palustrin-1, palustrin-2, ranacyclin, ranatuerin-1, ranatuerin-2, and temporin families have been isolated from North American ranids. It is proposed that "ranalexins" represent brevinin-1 peptides that have undergone a four amino acid residue internal deletion. Current taxonomic recommendations divide North American frogs from the family Ranidae into two genera: Lithobates and Rana. Cladistic analysis based upon the amino acid sequences of the brevinin-1 peptides provides strong support for this assignment.

  8. Which frog's legs do froggies eat? The use of DNA barcoding for identification of deep frozen frog legs (Dicroglossidae, Amphibia commercialized in France

    Directory of Open Access Journals (Sweden)

    Annemarie Ohler

    2017-02-01

    Full Text Available Several millions frogs captured in the wild in Indonesia are sold for food yearly in French supermarkets, as deep frozen frog legs. They are commercialized as Rana macrodon, but up to 15 look-alike species might also be concerned by this trade. From December 2012 to May 2013, we bought 209 specimens of deep frozen frog legs, and identified them through a barcoding approach based on the 16S gene. Our results show that 206 out of the 209 specimens belong to Fejervarya cancrivora, two to Limnonectes macrodon and one to F. moodiei. Thus only 0.96 % of the frogs were correctly identified. Unless misclassification was intentional, it seems that Indonesian frog leg exporters are not able to discriminate between the species. The quasi absence of L. macrodon in our samples might be an indication of its rarity, confirming that its natural populations are declining rapidly, in agreement with its “vulnerable” status according to the IUCN Red List. Our results show that the genetic and morphological diversity of the frogs in trade is much higher than the genetic and morphological diversity measured so far by scientific studies. These results underline the need for large scale studies to assess the status of wild populations.

  9. Localization and characterization of adrenergic receptors on frog skin melanophores.

    Science.gov (United States)

    Longshore, M A; Horowitz, J M

    1981-07-01

    The functional location of adrenergic binding sites was studied in frog skin melanophores by injecting norepinephrine (NE) outside and inside a melanophore. In 49 groups of cells (75% of the fields tested) iontophoretic injection of NE outside the cell caused melanosome aggregation in the target cell and/or in the field. In six cells in which a resting membrane potential was measured before and after intracellular injection (10-90 nA), NE elicited no change in melanosome configuration. Once the receptors were localized, the effect of temperature on these receptors was determined by measuring the reflectance of skins (an indication of melanosome aggregation or dispersion) in two populations of frogs treated with NE, Rana pipiens pipiens (with dominant alpha-receptors) and Rana berlandieri forreri (with dominant beta-receptors). NE (0.1 mM) caused melanosome aggregation in the former and dispersion in the latter tested at 12, 22, and 40 degrees C. The iontophoretic and reflectance results suggest that the binding site of the adrenergic receptor is located on the outer surface of the plasma membrane of melanophores and that alpha- and beta-receptors evoke aggregation and dispersion, respectively, within the temperature range of these experiments.

  10. Mercury pollution in Rana Chensinensis in Weisha River reach, in the upstream region of Songhua River

    Institute of Scientific and Technical Information of China (English)

    WANG Ning; ZHU Yanming; SHENG Lianxi; MENG Dan

    2005-01-01

    Twice a year continuous samples of Rana Chensinensis and sediments have been collected near gold mine in the upstream region of Songhua River from 2000 to 2002, for analyzing the total mercury (THg), methylmercury (MeHg) concentration and correlation in sediments, muscles, livers of the frog. The study indicates that THg and MeHg concentrations in polluted samples near the gold mine are higher than those in unpolluted ones. THg and MeHg concentrations are higher in autumn, in female, and in livers than those in spring, in male, in muscles respectively. The order of concentration degree in the frog organizations is as follows: liver>muscle>ovum>Fallopian tube. MeHg is the main form of mercury (Hg) existing in autumn, while inorganic Hg is in spring. There is no distinct difference of CMeHg/CTHg between male and female, livers and muscles. The correlation between MeHg concentrations in the river sediments and in the frog's livers and muscles are significant, which is related to disorderly discharge of Hg.

  11. Malnutrition in farm-cultured bullfrog (Rana catesbeiana fed on bovine milled lung in Argentina

    Directory of Open Access Journals (Sweden)

    J A Coppo, N B Mussart

    2005-11-01

    Full Text Available The true nutritional requirements of bullfrog (Rana catesbeiana, Anura: Ranidae are still controversial. In Argentine hatcheries, bullfrogs are fed on commercial balanced diets elaborated for fish; high price of balanced food decreases the relationship cost / benefit. This study had the objective to verify the nutritious effectiveness of bovine lung, by means of liveweight gains and metabolic and nutritional biochemical indicators controls. Eighty frogs were randomly divided into experimental (E and control (C groups of 40 animals each. Controls consumed a fish commercial balanced diet (23% protein in dry matter, DM, while those in group E were fed on bovine milled lung (16% protein, DM. Food was administered at a rate of 5% of liveweight/day (DM for both groups. The weighings and collection of samples were made on days 0 and 120. One frog of group C and 8 frogs of group E died during the study. Control animals did not register physical abnormalities. On the other hand, emaciation, adynamia, weakness, anorexy, and skin abnormal coloration were verified in some amphibians of group E. At the end of the study, liveweight and albumin, creatinine, urea, cholesterol, triglycerides, glucose, phosphorous and magnesium serum values, were significantly lower in group E than in group C (p < 0.05. This changes are attributed to metabolic imbalances related to malnutrition and reveal that bovine lung is not an appropriate food for captive bullfrog.

  12. Motor planning modulates sensory-motor control of collision avoidance behavior in the bullfrog, Rana catesbeiana

    Directory of Open Access Journals (Sweden)

    Hideki Nakagawa

    2012-08-01

    In this study, we examined the collision avoidance behavior of the frog, Rana catesbeiana to an approaching object in the upper visual field. The angular velocity of the frog's escape turn showed a significant positive correlation with the turn angle (r2 = 0.5741, P0.05. Thus, the frog was not able to control the velocity of the large escape turns accurately and did not complete the behavior within a constant time. In the latter case, there was a small but significant positive correlation between the threshold angular size and the angular velocity (r2 = 0.1459, P<0.05. This suggests that the threshold is controlled to compensate for the insufficient escape velocity achieved during large turn angles, and could explain a significant negative correlation between the turn angle and the threshold angular size (r2 = 0.1145, P<0.05. Thus, it is likely that the threshold angular size is also controlled by the turn angle and is modulated by motor planning.

  13. Yet More Frogs

    Science.gov (United States)

    Shutler, Paul M. E.

    2011-01-01

    Extending a recent paper by Derek Holton, we show how to represent the algorithm for the Frog Problem diagrammatically. This diagrammatic representation suggests a simpler proof of the symmetrical case (equal numbers of frogs of each colour) by allowing the even and odd cases to be treated together. It also provides a proof in the asymmetrical…

  14. Yet More Frogs

    Science.gov (United States)

    Shutler, Paul M. E.

    2011-01-01

    Extending a recent paper by Derek Holton, we show how to represent the algorithm for the Frog Problem diagrammatically. This diagrammatic representation suggests a simpler proof of the symmetrical case (equal numbers of frogs of each colour) by allowing the even and odd cases to be treated together. It also provides a proof in the asymmetrical…

  15. Enzymatic regulation of glycogenolysis in a subarctic population of the wood frog: implications for extreme freeze tolerance.

    Directory of Open Access Journals (Sweden)

    M Clara F do Amaral

    Full Text Available The wood frog, Rana sylvatica, from Interior Alaska survives freezing at -16°C, a temperature 10-13°C below that tolerated by its southern conspecifics. We investigated the hepatic freezing response in this northern phenotype to determine if its profound freeze tolerance is associated with an enhanced glucosic cryoprotectant system. Alaskan frogs had a larger liver glycogen reserve that was mobilized faster during early freezing as compared to conspecifics from a cool-temperate region (southern Ohio, USA. In Alaskan frogs the rapid glucose production in the first hours of freezing was associated with a 7-fold increase in glycogen phosphorylase activity above unfrozen frog levels, and the activity of this enzyme was higher than that of frozen Ohioan frogs. Freezing of Ohioan frogs induced a more modest (4-fold increase in glycogen phosphorylase activity above unfrozen frog values. Relative to the Ohioan frogs, Alaskan frogs maintained a higher total protein kinase A activity throughout an experimental freezing/thawing time course, and this may have potentiated glycogenolysis during early freezing. We found populational variation in the activity and protein level of protein kinase A which suggested that the Alaskan population had a more efficient form of this enzyme. Alaskan frogs modulated their glycogenolytic response by decreasing the activity of glycogen phosphorylase after cryoprotectant mobilization was well under way, thereby conserving their hepatic glycogen reserve. Ohioan frogs, however, sustained high glycogen phosphorylase activity until early thawing and consumed nearly all their liver glycogen. These unique hepatic responses of Alaskan R. sylvatica likely contribute to this phenotype's exceptional freeze tolerance, which is necessary for their survival in a subarctic climate.

  16. Enzymatic regulation of glycogenolysis in a subarctic population of the wood frog: implications for extreme freeze tolerance.

    Science.gov (United States)

    do Amaral, M Clara F; Lee, Richard E; Costanzo, Jon P

    2013-01-01

    The wood frog, Rana sylvatica, from Interior Alaska survives freezing at -16°C, a temperature 10-13°C below that tolerated by its southern conspecifics. We investigated the hepatic freezing response in this northern phenotype to determine if its profound freeze tolerance is associated with an enhanced glucosic cryoprotectant system. Alaskan frogs had a larger liver glycogen reserve that was mobilized faster during early freezing as compared to conspecifics from a cool-temperate region (southern Ohio, USA). In Alaskan frogs the rapid glucose production in the first hours of freezing was associated with a 7-fold increase in glycogen phosphorylase activity above unfrozen frog levels, and the activity of this enzyme was higher than that of frozen Ohioan frogs. Freezing of Ohioan frogs induced a more modest (4-fold) increase in glycogen phosphorylase activity above unfrozen frog values. Relative to the Ohioan frogs, Alaskan frogs maintained a higher total protein kinase A activity throughout an experimental freezing/thawing time course, and this may have potentiated glycogenolysis during early freezing. We found populational variation in the activity and protein level of protein kinase A which suggested that the Alaskan population had a more efficient form of this enzyme. Alaskan frogs modulated their glycogenolytic response by decreasing the activity of glycogen phosphorylase after cryoprotectant mobilization was well under way, thereby conserving their hepatic glycogen reserve. Ohioan frogs, however, sustained high glycogen phosphorylase activity until early thawing and consumed nearly all their liver glycogen. These unique hepatic responses of Alaskan R. sylvatica likely contribute to this phenotype's exceptional freeze tolerance, which is necessary for their survival in a subarctic climate.

  17. The New Technology of the Rana spinosa David Artificial Propagation and Cultivation%棘胸蛙人工繁育新技术

    Institute of Scientific and Technical Information of China (English)

    郑宝成

    2011-01-01

    在模拟棘胸蛙的野生态环境情况下,通过人工控制养殖池水的水温和酸碱度,根据棘胸蛙的生活特性,合理进行亲蛙选育、蝌蚪培育、幼蛙饲养和病害防治的技术改良,可以达到棘胸蛙年产卵次数达6~7次,年产卵量达1935粒,蛙卵孵化率达96.1%,蝌蚪变态率达96.5%,幼蛙成活率达96.8%的养殖效果。%We simulate the environment of the wild Rana Spinosa David,so that we can control temperature,basicity and acidity of the water.According to the living characteristic of Rana Spinosa David,we choose the parents of froggy,bring tadpole and little froggy up,make prevention of disease in improving technology rationally,the Rana Spinosa David can spawn 6~7 times with 1935 spawns every year,the frog incubation rate can reach as high as 96.1%,the tadpole metamorphosis rate 96.5%,the young frog survival rate 96.8%.

  18. Comparative toxicity of chlorpyrifos, diazinon, malathion and their oxon derivatives to larval Rana boylii

    Science.gov (United States)

    Sparling, D.W.; Fellers, G.

    2007-01-01

    Organophosphorus pesticides (OPs) are ubiquitous in the environment and are highly toxic to amphibians. They deactivate cholinesterase, resulting in neurological dysfunction. Most chemicals in this group require oxidative desulfuration to achieve their greatest cholinesterase-inhibiting potencies. Oxon derivatives are formed within liver cells but also by bacterial decay of parental pesticides. This study examines the toxicity of chlorpyrifos, malathion and diazinon and their oxons on the foothill yellow-legged frog (Rana boylii). R. boylii is exposed to agricultural pesticides in the California Central Valley. Median lethal concentrations of the parental forms during a 96 h exposure were 3.00 mg/L (24 h) for chlorpyrifos, 2.14 mg/L for malathion and 7.49 mg/L for diazinon. Corresponding oxons were 10 to 100 times more toxic than their parental forms. We conclude that environmental concentrations of these pesticides can be harmful to R. boylii populations. ?? 2006 Elsevier Ltd. All rights reserved.

  19. Sound and vibration sensitivity of VIIIth nerve fibers in the grassfrog, Rana temporaria

    DEFF Research Database (Denmark)

    Christensen-Dalsgaard, J; Jørgensen, M B

    1996-01-01

    , the animals were stimulated with dorso-ventral vibrations, and the sound-induced vertical vibrations in the setup could be canceled by emitting vibrations in antiphase from the vibration exciter. All low-frequency fibers responded to both sound and vibration with sound thresholds from 23 dB SPL and vibration......We have studied the sound and vibration sensitivity of 164 amphibian papilla fibers in the VIIIth nerve of the grassfrog, Rana temporaria. The VIIIth nerve was exposed using a dorsal approach. The frogs were placed in a natural sitting posture and stimulated by free-field sound. Furthermore...... thresholds from 0.02 cm/s2. The sound and vibration sensitivity was compared for each fiber using the offset between the rate-level curves for sound and vibration stimulation as a measure of relative vibration sensitivity. When measured in this way relative vibration sensitivity decreases with frequency from...

  20. Comparative toxicity of chlorpyrifos, diazinon, malathion and their oxon derivatives to larval Rana boylii.

    Science.gov (United States)

    Sparling, D W; Fellers, G

    2007-06-01

    Organophosphorus pesticides (OPs) are ubiquitous in the environment and are highly toxic to amphibians. They deactivate cholinesterase, resulting in neurological dysfunction. Most chemicals in this group require oxidative desulfuration to achieve their greatest cholinesterase-inhibiting potencies. Oxon derivatives are formed within liver cells but also by bacterial decay of parental pesticides. This study examines the toxicity of chlorpyrifos, malathion and diazinon and their oxons on the foothill yellow-legged frog (Rana boylii). R. boylii is exposed to agricultural pesticides in the California Central Valley. Median lethal concentrations of the parental forms during a 96 h exposure were 3.00 mg/L (24h) for chlorpyrifos, 2.14 mg/L for malathion and 7.49 mg/L for diazinon. Corresponding oxons were 10 to 100 times more toxic than their parental forms. We conclude that environmental concentrations of these pesticides can be harmful to R. boylii populations.

  1. Changes in activity of the organon vasculosum laminae terminalis in the annual cycle in Rana temporaria.

    Science.gov (United States)

    Krawczyk, S; Dziubek, K; Lach, H

    1978-01-01

    In 70 sexually mature male and femal Rana temporaria frogs captured in natural habitat, mean nuclear volumes for the cells of the pars ependymalis and pars parenchymalis of the organon vasculosum laminae terminalis (OVLT) were determined in seven characteristic stages in life. The mean nuclear volume for the cells of the pars ependymalis and pars parenchymalis of the OVLT showed distinct annual fluctuation. Maximum nuclear volume of the cells in both investigated parts of the OVLT were observed during the breeding period (Ist decade of April), and minimum volume of the nuclei of the pars ependymalis at the beginning of hibernation (IIIrd decade of October), and in the pars parenchymalis near the end of active life (Ist decade of September).

  2. Severe IgE-mediated anaphylaxis following consumption of fried frog legs: definition of alpha-parvalbumin as the allergen in cause.

    Science.gov (United States)

    Hilger, C; Grigioni, F; Thill, L; Mertens, L; Hentges, F

    2002-11-01

    IgE-mediated allergic reactions to bullfrog and edible frog have been reported. The implicated allergens have not been defined so far. The frog material and the patient's serum from a case of severe food-induced anaphylaxis were used to define the implicated allergen at the protein and DNA level. Immunoblotting techniques and N-terminal protein microsequencing were used to define the allergen recognized by the patient's serum. Back translation from the identified protein sequence was used to design degenerated primers to amplify the allergen's cDNA by polymerase chain reaction (PCR). We defined the nucleotide sequence of the allergen from the frog of Indonesian origin that was consumed by the patient, and the homologous cDNA from Rana esculenta. Protein microsequencing revealed that the implicated frog allergen belonged to the parvalbumin family. cDNAs coding for alpha- and beta-parvalbumin of R. esculenta and Rana species were cloned. Recombinant proteins were expressed in Escherichia coli. The patient's serum IgE antibodies recognized parvalbumin prepared from frog muscle and recombinant alpha-parvalbumin from R. species but not from R. esculenta. Recombinant beta-parvalbumin was not recognized by the IgE antibodies. This work defines at the protein and DNA levels alpha-parvalbumin as the allergen implicated in a case of IgE-mediated anaphylaxis to frog muscle. It also shows that a protein belonging to the parvalbumin family is implicated in type I allergies outside the fish species.

  3. D-Asp: a new player in reproductive endocrinology of the amphibian Rana esculenta.

    Science.gov (United States)

    Raucci, Franca; Di Fiore, Maria Maddalena

    2011-11-01

    We investigated the involvement of D-Aspartic acid (D-Asp) on ovarian and testicular morphology of the green frog, Rana esculenta, and its effect on the testosterone production. The study has been performed throughout the reproductive cycle. In both ovary and testis a substantial amount of D-Asp is endogenously present and its concentration varies as function of reproduction. In the frog, D-Asp content is differently correlated with gonadal and plasmatic levels of testosterone, depending on the sex. In fact, the amount of the D-Asp is inversely linked with that of the testosterone in the ovary, while this correlation directly matched in the testis. In vivo short-term experiments, consisting of a single intra-peritoneal injection of D-Asp (2.0 μmol/g body weight), demonstrated that the enantiomer is significantly accumulated by both the ovary and testis, reaching after 3 h the highest uptake and thereafter decreasing to baseline values within 24 h. Furthermore, D-Asp influences the synthesis and/or the release of testosterone, causing a decrease of its level in the female, and an increase in the male, respectively. In vivo long-term experiments, D-Asp, chronically administered to the frogs of both sexes, enhances the maturation of both gonads, determining in the oocytes an higher accumulation of carbohydrate yolk plates in the ooplasm, and stimulating the spermatogenesis in the testis. Taken altogether, our results show that D-Asp operates differently in female and male frog gonads, indicating that it has different targets in the reproductive machinery depending on the sex. Copyright © 2011 Elsevier B.V. All rights reserved.

  4. Pond and landscape determinants of Rana dalmatina population sizes in a Romanian rural landscape

    Science.gov (United States)

    Hartel, Tibor; Nemes, Szilárd; Cogălniceanu, Dan; Öllerer, Kinga; Moga, Cosmin Ioan; Lesbarrères, David; Demeter, László

    2009-01-01

    Amphibians are good indicators of human impact, declining steadily worldwide. We explored the relationships between the ponds and nearby landscape parameters and population size of the Agile Frog ( Rana dalmatina), estimated from the number of egg masses, in a cultural landscape within the central section of Târnava Mare Basin, Romania. Forty-three permanent ponds were surveyed in a 2600 km 2 area. The average number of egg masses per pond was 211.13 (SD = 426.41). The egg mass number was significantly and positively related to the emergent aquatic macrophyte cover (its effect peaks at around 50%) and the green connecting corridors between the ponds and forests, and negatively related to the extent of nearby urban areas. The proximity of the forest (positive effect) and the presence of high traffic roads (negative effect) were highly correlated with green corridors and further eliminated from the model due to multicollinearity. Both these variables had significant effects when incorporated in univariate models and multivariate models without green corridors. Since a large part of our study area was currently declared as Natura 2000 site, there is an increased need for management proposals and conservation applications for biodiversity, including amphibians. Rana dalmatina is an important species for monitoring because it is common in the studied area and is suited for short surveys.

  5. Effects of the herbicide imazapyr on juvenile Oregon spotted frogs.

    Science.gov (United States)

    Yahnke, Amy E; Grue, Christian E; Hayes, Marc P; Troiano, Alexandra T

    2013-01-01

    Conflict between native amphibians and aquatic weed management in the Pacific Northwest is rarely recognized because most native stillwater-breeding amphibian species move upland during summer, when herbicide application to control weeds in aquatic habitats typically occurs. However, aquatic weed management may pose a risk for aquatic species present in wetlands through the summer, such as the Oregon spotted frog (OSF, Rana pretiosa), a state endangered species in Washington. Acute toxicity of herbicides used to control aquatic weeds tends to be low, but the direct effects of herbicide tank mixes on OSFs have remained unexamined. We exposed juvenile OSFs to tank mixes of the herbicide imazapyr, a surfactant, and a marker dye in a 96-h static-renewal test. The tank mix was chosen because of its low toxicity to fish and its effectiveness in aquatic weed control. Concentrations were those associated with low-volume (3.5 L/ha) and high-volume (7.0 L/ha) applications of imazapyr and a clean-water control. Following exposure, frogs were reared for two months in clean water to identify potential latent effects on growth. Endpoints evaluated included feeding behavior, growth, and body and liver condition indices. We recorded no mortalities and found no significant differences for any end point between the herbicide-exposed and clean-water control frogs. The results suggest that imazapyr use in wetland restoration poses a low risk of direct toxic effects on juvenile OSFs. Copyright © 2012 SETAC.

  6. Effects of the herbicide imazapyr on juvenile Oregon spotted frogs

    Science.gov (United States)

    Yahnke, Amy E.; Grue, Christian E.; Hayes, Marc P.; Troiano, Alexandra T.

    2013-01-01

    Conflict between native amphibians and aquatic weed management in the Pacific Northwest is rarely recognized because most native stillwater-breeding amphibian species move upland during summer, when herbicide application to control weeds in aquatic habitats typically occurs. However, aquatic weed management may pose a risk for aquatic species present in wetlands through the summer, such as the Oregon spotted frog (OSF, Rana pretiosa), a state endangered species in Washington. Acute toxicity of herbicides used to control aquatic weeds tends to be low, but the direct effects of herbicide tank mixes on OSFs have remained unexamined. We exposed juvenile OSFs to tank mixes of the herbicide imazapyr, a surfactant, and a marker dye in a 96-h static-renewal test. The tank mix was chosen because of its low toxicity to fish and its effectiveness in aquatic weed control. Concentrations were those associated with low-volume (3.5 L/ha) and high-volume (7.0 L/ha) applications of imazapyr and a clean-water control. Following exposure, frogs were reared for two months in clean water to identify potential latent effects on growth. Endpoints evaluated included feeding behavior, growth, and body and liver condition indices. We recorded no mortalities and found no significant differences for any end point between the herbicide-exposed and clean-water control frogs. The results suggest that imazapyr use in wetland restoration poses a low risk of direct toxic effects on juvenile OSFs.

  7. Landscape associations of frog and toad species in Iowa and Wisconsin, U.S.A

    Science.gov (United States)

    Knutson, M.G.; Sauer, J.R.; Olsen, D.A.; Mossman, M.J.; Hemesath, L.M.; Lannoo, M.J.; Kaiser, Hinrich; Casper, Gary S.; Bernstein, Neil P.

    2000-01-01

    Landscape habitat associations of frogs and toads in Iowa and Wisconsin were tested to determine whether they support or refute previous general habitat classifications. We examined which Midwestern species shared similar habitats to see if these associations were consistent across large geographic areas (states). Rana sylvatica (wood frog), Hyla versicolor (eastern gray treefrog), Pseudacris crucifer (spring peeper), and Acris crepitans (cricket frog) were identified as forest species, P. triseriata (chorus frog), H. chrysoscelis (Cope's gray treefrog), R. pipiens (leopard frog), and Bufo americanus (American toad) as grassland species, and R. catesbeiana (bullfrog), R. clamitans (green frog), R. palustris (pickerel frog), and R. septentrionalis (mink frog) as lake or stream species. The best candidates to serve as bioindicators of habitat quality were the forest species R. sylvatica, H. versicolor, and P. crucifer, the grassland species R. pipiens and P. triseriata, and a cold water wetland species, R. palustris. Declines of P. crucifer, R. pipiens, and R. palustris populations in one or both states may reflect changes in habitat quality. Habitat and community associations of some species differed between states, indicating that these relationships may change across the range of a species. Acris crepitans may have shifted its habitat affinities from open habitats, recorded historically, to the more forested habitat associations we recorded. We suggest contaminants deserve more investigation regarding the abrupt and widespread declines of this species. Interspersion of different habitat types was positively associated with several species. A larger number of wetland patches may increase breeding opportunities and increase the probability of at least one site being suitable. We noted consistently negative associations between anuran species and urban development. Given the current trend of urban growth and increasing density of the human population, declines of

  8. Effects of prochloraz and ethinylestradiol on sexual development in Rana temporaria.

    Science.gov (United States)

    Brande-Lavridsen, Nanna; Christensen-Dalsgaard, Jakob; Korsgaard, Bodil

    2008-08-01

    A wide range of environmental xenobiotics that mimic hormones (endocrine-disrupting chemicals) may cause alterations in sexual development or reproductive function in aquatic organisms such as amphibians when exposed during early sensitive stages. We exposed tadpoles of the Common frog, Rana temporaria, from hatch to metamorphosis, to two different endocrine disruptors, the synthetic estrogen 17 alpha-ethinylestradiol and the fungicide prochloraz. The object of the study was to assess the effects of these two compounds on the sexual development of the tadpoles by investigating sex ratio, gonadal development, sex steroid concentrations and vitellogenin induction. Histology revealed that a large percentage of all groups were juvenile hermaphrodites at metamorphosis. Tadpoles exposed to 115 and 251 microg/L prochloraz showed a significant increased proportion of males. However, the testosterone concentrations were depressed in those groups. Ethinylestradiol in concentrations of 77 and 159 ng/L EE(2) increased whole-body calcium levels in a dose-dependent manner indicating induction of the egg yolk protein vitellogenin, verified also by gel electrophoresis. The study shows that ethinylestradiol may induce vitellogenesis and prochloraz may affect the sexual development in Common frogs.

  9. Effects of agricultural pesticides on the immune system of Xenopus laevis and Rana pipiens

    Energy Technology Data Exchange (ETDEWEB)

    Christin, M.S.; Menard, L.; Gendron, A.D.; Ruby, S.; Cyr, D.; Marcogliese, D.J.; Rollins-Smith, L.; Fournier, M

    2004-03-30

    Over the last 30 years, there have been mass declines in diverse geographic locations among amphibian populations. Multiple causes have been suggested to explain this decline. Among these, environmental pollution is gaining attention. Indeed, some chemicals of environmental concern are known to alter the immune system. Given that amphibians are frequently exposed to agricultural pesticides, it is possible that these pollutants alter their immune system and render them more susceptible to different pathogens. In this study, we exposed two frog species, Xenopus laevis and Rana pipiens, for a short period of time to a mixture of pesticides (atrazine, metribuzine, endosulfan, lindane, aldicarb and dieldrin) representative in terms of composition and concentrations to what it is found in the environment of the southwest region of the province of Quebec. The pesticides were known to be present in surface water of many tributaries of the St. Lawrence River (Quebec, Canada). Our results demonstrate that the mixture of pesticides could alter the cellularity and phagocytic activity of X. laevis and the lymphocyte proliferation of R. pipiens. Taken together, these results indicate that agricultural pesticides can alter some aspects of the immune response in frogs and could contribute to their global decline by rendering them more susceptible to certain infections.

  10. [Reabsorption of yellow fluorescent protein in the Rana temporaria kidney by receptor-mediated endocytosis].

    Science.gov (United States)

    Seliverstova, E V; Prutskova, N P

    2014-01-01

    The absorption of yellow fluorescent protein (YFP) and the expression of the endocytic receptors, megalin and cubilin, were investigated in the renal proximal tubules (PT) in frogs Rana temporaria after parenteral YFP injections. The methods of confocal microscopy and immunohistochemistry were used. The dynamics of YFP absorption was analyzed 2 h after injection. The logarithmic time dependence of the accumulation of YFP-containing endocytic vesicles in PT cells and the completion of absorption process 90-120 min after injection were shown. Unlike substantial megalin and cubilin expression 15-30 min after YFP introduction, immunolabeled endocytic receptors were not detected in PT cells after 2 h. The re-injection of YFP led to the appearance of apical endocytic vesicles containing megalin or cubilin colocalized with YFP. At the same time, the decrease of YFP uptake associated with reduction in the number of receptor-containing vesicles was demonstrated, suggesting a failure of megalin and cubilin expression. The decrease of absorption capacity of PT cells after YFP re-injection was similar to that found previously under conditions of the competitive absorption of green fluorescent protein (GFP) and YFP injected in different sequences. The data are the further demonstration of the proposed mechanism limiting the tubular protein absorption in the frog kidney and suggest the involvement of megalin and cubilin in uptake and vesicular transport of YFP.

  11. Legacy of road salt: Apparent positive larval effects counteracted by negative postmetamorphic effects in wood frogs.

    Science.gov (United States)

    Dananay, Kacey L; Krynak, Katherine L; Krynak, Timothy J; Benard, Michael F

    2015-10-01

    Road salt runoff has potentially large effects on wetland communities, but is typically investigated in short-term laboratory trials. The authors investigated effects of road salt contamination on wood frogs (Rana sylvatica) by combining a field survey with 2 separate experiments. The field survey tested whether wood frog larval traits were associated with road salt contamination in natural wetlands. As conductivity increased, wood frog larvae were less abundant, but those found were larger. In the first experiment of the present study, the authors raised larvae in outdoor artificial ponds under 4 salt concentrations and measured larval vital rates, algal biomass, and zooplankton abundance. Salt significantly increased larval growth, algal biomass, and decreased zooplankton abundance. In the second experiment, the authors raised larvae to metamorphosis in the presence and absence of salt contamination and followed resulting juvenile frogs in terrestrial pens at high and low densities. Exposure to road salt as larvae caused juvenile frogs to have greater mortality in low-density terrestrial environments, possibly because of altered energy allocation, changes in behavior, or reduced immune defenses. The present study suggests that low concentrations of road salt can have positive effects on larval growth yet negative effects on juvenile survival. These results emphasize the importance of testing for effects of contaminants acting through food webs and across multiple life stages as well as the potential for population-level consequences in natural environments.

  12. Consequences of intraspecific niche variation: phenotypic similarity increases competition among recently metamorphosed frogs.

    Science.gov (United States)

    Benard, Michael F; Middlemis Maher, Jessica

    2011-07-01

    Phenotype is often correlated with resource use, which suggests that as phenotypic variation in a population increases, intraspecific competition will decrease. However, few studies have experimentally tested the prediction that increased intraspecific phenotypic variation leads to reduced competitive effects (e.g., on growth rate, survival or reproductive rate). We investigated this prediction with two experiments on wood frogs (Rana sylvatica). In the first experiment, we found that a frog's size was positively correlated with the size of its preferred prey, indicating that the feeding niche of the frogs changed with size. In the second experiment, we used an experimental design in which we held the initial mass of "focal" frogs constant, but varied the initial mass of their competitors. We found a significant quadratic effect of the average mass of competitors: focal frog growth was lowest when raised with similar-sized competitors, and highest when raised with competitors that were larger or smaller. Our results demonstrate that growth rates increase (i.e., competitive intensity decreases) when individuals are less similar to other members of the population and exhibit less overlap in resource use. Thus, changes in the amount of phenotypic variation in a population may ultimately affect population-level processes, such as population growth rate and extinction risk.

  13. Skin microbiota differs drastically between co-occurring frogs and newts

    Science.gov (United States)

    Perl, R. G. Bina; Vences, Miguel

    2017-01-01

    Diverse microbial assemblages inhabit amphibian skin and are known to differ among species; however, few studies have analysed these differences in systems that minimize confounding factors, such as season, location or host ecology. We used high-throughput amplicon sequencing to compare cutaneous microbiotas among two ranid frogs (Rana dalmatina, R. temporaria) and four salamandrid newts (Ichthyosaura alpestris, Lissotriton helveticus, L. vulgaris, Triturus cristatus) breeding simultaneously in two ponds near Braunschweig, Germany. We found that bacterial communities differed strongly and consistently between these two distinct amphibian clades. While frogs and newts had similar cutaneous bacterial richness, their bacterial composition strongly differed. Average Jaccard distances between frogs and newts were over 0.5, while between species within these groups distances were only 0.387 and 0.407 for frogs and newts, respectively. At the operational taxonomic unit (OTU) level, 31 taxa exhibited significantly different relative abundances between frogs and newts. This finding suggests that chemical or physical characteristics of these amphibians' mucosal environments provide highly selective conditions for bacterial colonizers. Multi-omics analyses of hosts and their microbiota as well as directed efforts to understand chemical differences in the mucosal environments (e.g. pH), and the specificities of host-produced compounds against potential colonizers will help to better understand this intriguing pattern. PMID:28484639

  14. Spatial-ecological divergence of the common frog (Rana temporaria L. and the moor frog (Rana arvalis Nilss. within their geographic ranges

    Directory of Open Access Journals (Sweden)

    Kutenkov Anatoly

    2017-03-01

    It is only where there is the interpenetration of «core» landscapes of each species (large areas of the northern and western parts of the East European Plain, and a part of the West Siberian Plain contiguous to the Urals, one can observe the examples of real sympatry of R. arvalis and R. temporaria.

  15. A perchlorate sensitive iodide transporter in frogs.

    Science.gov (United States)

    Carr, Deborah L; Carr, James A; Willis, Ray E; Pressley, Thomas A

    2008-03-01

    Nucleotide sequence comparisons have identified a gene product in the genome database of African clawed frogs (Xenopus laevis) as a probable member of the solute carrier family of membrane transporters. To confirm its identity as a putative iodide transporter, we examined the function of this sequence after heterologous expression in mammalian cells. A green monkey kidney cell line transfected with the Xenopus nucleotide sequence had significantly greater (125)I uptake than sham-transfected control cells. The uptake in carrier-transfected cells was significantly inhibited in the presence of perchlorate, a competitive inhibitor of mammalian Na(+)/iodide symporter. Tissue distributions of the sequence were also consistent with a role in iodide uptake. The mRNA encoding the carrier was found to be expressed in the thyroid gland, stomach, and kidney of tadpoles from X. laevis, as well as the bullfrog Rana catesbeiana. The ovaries of adult X. laevis also were found to express the carrier. Phylogenetic analysis suggested that the putative X. laevis iodide transporter is orthologous to vertebrate Na(+)-dependent iodide symporters. We conclude that the amphibian sequence encodes a protein that is indeed a functional Na(+)/iodide symporter in X. laevis, as well as R. catesbeiana.

  16. Histological Study on Reproductive Organ of Rana Temporaria Chensinesis David

    Institute of Scientific and Technical Information of China (English)

    HUANG He; TIAN Yaguang; NING Fangyong; BAI Xiujuan; ZHANG Guixue

    2006-01-01

    The experiment was designed to study the histology of reproductive organ of Rana temporaria chensinesis David in reproductive season and dereproductive season, The results displayed that the sexual gland weight and oviduct weight of the Rana temporaria chensinesis David were significantly different between reproductive season and dereproductive season.

  17. Biomimetic agent based modelling using male Frog calling behaviour as a case study

    DEFF Research Database (Denmark)

    Jørgensen, Søren V.; Demazeau, Yves; Christensen-Dalsgaard, Jakob

    2014-01-01

    by individuals to generate their observed population behaviour. A number of existing agent-modelling frameworks are considered, but none have the ability to handle large numbers of time-dependent event-generating agents; hence the construction of a new tool, RANA. The calling behaviour of the Puerto Rican Tree......A new agent-based modelling tool has been developed to allow the modelling of populations of individuals whose interactions are characterised by tightly timed dynamics. The tool was developed to model male frog calling dynamics, to facilitate research into what local rules may be employed...

  18. Naloxone blocks the analgesic action of levorphanol but not of dextrorphan in the leopard frog.

    Science.gov (United States)

    Stevens, C W; Pezalla, P D

    1984-05-28

    Intraspinal injection of levorphanol (3 micrograms) at the lumbar area of the leopard frog, Rana pipiens, induced analgesia which was completely blocked by co-injection of naloxone (3 micrograms), whereas dextrorphan (3 micrograms) induced analgesia which was unaffected by naloxone. Subcutaneous levorphanol (20 or 80 mg/kg) induced a dose-dependent analgesia which was blocked by concurrent naloxone (2 mg/kg), while only the higher dose of dextrorphan (80 mg/kg) induced analgesia which was unaffected by concurrent naloxone at 8 or 80 mg/kg. These data are the first to indicate naloxone-insensitive, dextrorphan-induced analgesia.

  19. Cryoprotectants and extreme freeze tolerance in a subarctic population of the wood frog.

    Science.gov (United States)

    Costanzo, Jon P; Reynolds, Alice M; do Amaral, M Clara F; Rosendale, Andrew J; Lee, Richard E

    2015-01-01

    Wood frogs (Rana sylvatica) exhibit marked geographic variation in freeze tolerance, with subarctic populations tolerating experimental freezing to temperatures at least 10-13 degrees Celsius below the lethal limits for conspecifics from more temperate locales. We determined how seasonal responses enhance the cryoprotectant system in these northern frogs, and also investigated their physiological responses to somatic freezing at extreme temperatures. Alaskan frogs collected in late summer had plasma urea levels near 10 μmol ml-1, but this level rose during preparation for winter to 85.5 ± 2.9 μmol ml-1 (mean ± SEM) in frogs that remained fully hydrated, and to 186.9 ± 12.4 μmol ml-1 in frogs held under a restricted moisture regime. An osmolality gap indicated that the plasma of winter-conditioned frogs contained an as yet unidentified osmolyte(s) that contributed about 75 mOsmol kg-1 to total osmotic pressure. Experimental freezing to -8°C, either directly or following three cycles of freezing/thawing between -4 and 0°C, or -16°C increased the liver's synthesis of glucose and, to a lesser extent, urea. Concomitantly, organs shed up to one-half (skeletal muscle) or two-thirds (liver) of their water, with cryoprotectant in the remaining fluid reaching concentrations as high as 0.2 and 2.1 M, respectively. Freeze/thaw cycling, which was readily survived by winter-conditioned frogs, greatly increased hepatic glycogenolysis and delivery of glucose (but not urea) to skeletal muscle. We conclude that cryoprotectant accrual in anticipation of and in response to freezing have been greatly enhanced and contribute to extreme freeze tolerance in northern R. sylvatica.

  20. Cryoprotectants and extreme freeze tolerance in a subarctic population of the wood frog.

    Directory of Open Access Journals (Sweden)

    Jon P Costanzo

    Full Text Available Wood frogs (Rana sylvatica exhibit marked geographic variation in freeze tolerance, with subarctic populations tolerating experimental freezing to temperatures at least 10-13 degrees Celsius below the lethal limits for conspecifics from more temperate locales. We determined how seasonal responses enhance the cryoprotectant system in these northern frogs, and also investigated their physiological responses to somatic freezing at extreme temperatures. Alaskan frogs collected in late summer had plasma urea levels near 10 μmol ml-1, but this level rose during preparation for winter to 85.5 ± 2.9 μmol ml-1 (mean ± SEM in frogs that remained fully hydrated, and to 186.9 ± 12.4 μmol ml-1 in frogs held under a restricted moisture regime. An osmolality gap indicated that the plasma of winter-conditioned frogs contained an as yet unidentified osmolyte(s that contributed about 75 mOsmol kg-1 to total osmotic pressure. Experimental freezing to -8°C, either directly or following three cycles of freezing/thawing between -4 and 0°C, or -16°C increased the liver's synthesis of glucose and, to a lesser extent, urea. Concomitantly, organs shed up to one-half (skeletal muscle or two-thirds (liver of their water, with cryoprotectant in the remaining fluid reaching concentrations as high as 0.2 and 2.1 M, respectively. Freeze/thaw cycling, which was readily survived by winter-conditioned frogs, greatly increased hepatic glycogenolysis and delivery of glucose (but not urea to skeletal muscle. We conclude that cryoprotectant accrual in anticipation of and in response to freezing have been greatly enhanced and contribute to extreme freeze tolerance in northern R. sylvatica.

  1. DIET OF DIRECT-DEVELOPING FROGS (ANURA: CRAUGASTORIDAE: Pristimantis FROM THE ANDES OF WESTERN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Juan Carlos GARCIA-R

    2014-05-01

    Full Text Available We studied the diet of 15 montane frog species of the genus Pristimantis (Craugastoridae from the Andes of Western Colombia to determine the diet range, breadth of niche and overlap among species.  We identified 499 prey items from stomach and intestinal contents of 154 specimens. Prey items were included in 74 different categories. The most common 15 prey categories accounted for 65 % of all frogs’ diet. The invertebrate families Isotomidae, Chironomidae, Formicidae, and Tipulidae were the most abundant categories and accounted for 32 % of the frogs’ diet. Ten of the 15 frog species were found with at least one item of Araneae. Coleoptera and Tipulidae were found in nine frog species, and Acari and Carabidae in eight frog species. In general, beetles were found in gastrointestinal tracts of all species examined, except for P. quantus, but interpretation needs caution because only one individual of this species was caught. Pristimantis hectus showed a specialized diet, consuming mainly dipterans of the family Chironomidae, while the remaining species showed a generalist diet. Pristimantis palmeri showed niche overlap with P. erythropleura (Фjk = 0.69, P. myops (Фjk = 0.64, and P. orpacobates (Фjk = 0.64. Our results suggest that most of the frogs species studied are generalist, foraging opportunistically on dipterans, arachnids, collembolans, coleopterans, and hymenopterans. Here, we report the diet of montane Pristimantis species and discuss the results in comparison with data on related species in montane and lowland regionsDieta de ranas de desarrollo directo (Anura: Craugastoridae: Pristimantis de los Andes occidentales de ColombiaEstudiamos la dieta de 15 especies de ranas montanas del género Pristimantis (Craugastoridae en la Cordillera Occidental de Colombia para determinar su variación, amplitud y traslape de nicho. En los contenidos estomacales e intestinales de 154 especímenes se identificaron 499 presas que fueron

  2. Bioaccumulation of selenium by snakes and frogs in the San Joaquin Valley, California

    Science.gov (United States)

    Ohlendorf, H.M.; Hothem, R.L.; Aldrich, T.W.

    1988-01-01

    Livers of gopher snakes (Pituophis melanoleucus) from Kesterson Reservoir (Merced County, California) contained significantly higher mean selenium concentrations (11.1 .mu.g/g, dry weight) than those from two nearby reference sites (2.05 and 2.14 .mu.g/g). Livers of bullfrogs (Rana catesbeiana) collected from the San Luis Drain at Kersterson Reservoir also contained significantly higher mean selenium concentrations (45.0 .mu.g/g) than those from nearby reference sites (6.22 .mu.g/g). The high levels of selenium bioaccumulation in these snakes and frogs at Kersterson Reservoir reflected the elevated levels found in their food organisms. We did not examine that snakes or frogs from Kesterson for signs of ill health, but the concentrations we found were sufficiently high to warrant concern about potential adverse effects in these animals and their predators.

  3. A genetic component of resistance to fungal infection in frog embryos.

    Science.gov (United States)

    Sagvik, Jörgen; Uller, Tobias; Olsson, Mats

    2008-06-22

    The embryo has traditionally been considered to completely rely upon parental strategies to prevent threats to survival posed by predators and pathogens, such as fungi. However, recent evidence suggests that embryos may have hitherto neglected abilities to counter pathogens. Using artificial fertilization, we show that among-family variation in the number of Saprolegnia-infected eggs and embryos in the moor frog, Rana arvalis, cannot be explained by maternal effects. However, analysed as a within-females effect, sire identity had an effect on the degree of infection. Furthermore, relatively more eggs and embryos were infected when eggs were fertilized by sperm from the same, compared with a different, population. These effects were independent of variation in fertilization success. Thus, there is likely to be a significant genetic component in embryonic resistance to fungal infection in frog embryos. Early developmental stages may show more diverse defences against pathogens than has previously been acknowledged.

  4. Field exposure of frog embryos and tadpoles along a pollution gradient in the Fox River and Green Bay ecosystem in Wisconsin, Usa.

    Science.gov (United States)

    Karasov, William H; Jung, Robin E; Langenberg, Susan Vanden; Bergeson, Tara L E

    2005-04-01

    We raised embryos and tadpoles of green frogs (Rana clamitans melanota) and leopard frogs (R. pipiens) in situ along a contamination gradient in the Fox River/Green Bay ecosystem (WI, USA). Differences in exposure were reflected by significant positive regressions between concentrations in sediment and in frogs of polychlorinated biphenyl (PCB) congeners and some heavy metals (Cd, Cr, and Pb), which could have predictive value for estimating exposure of amphibians to contaminants in this ecosystem and, perhaps, in others. On average, non-ortho-substituted coplanar PCBs made up a very small percentage (average, 0.2%) of the PCB congeners in all samples analyzed, with larger fractions accounted for by mono- and di-ortho congeners (average, 19%) and routine congeners (average, 81%). Hatchability of frog embryo batches and anuran species richness at the sites were negatively correlated with level of contamination, but tadpole growth and survival were not. Sediment and tissue levels of PCBs and metals generally were correlated with each other, confounding the association of effects on frogs with any particular contaminant. It is also plausible that high levels of un-ionized ammonia (NH3) reduced hatching success of green frog, but not leopard frog, embryos in the field enclosures. Other environmental factors that were present but unmeasured in the field, such as ultraviolet-B radiation as well as water flow and level fluctuations, might have caused differences in hatching success at the field sites.

  5. Frogs In Danger

    Institute of Scientific and Technical Information of China (English)

    李笑; 岳巧玲

    2005-01-01

    If you go out to the field at ni ght inspring or summer,you can hear frogs croaking and singing joyfully here and there.It seems as if they were performing a fiel dsymphony (交响曲).How pleasant and sweet it sounds!It fills nature with music and vitality.

  6. It's a Frog's Life

    Science.gov (United States)

    Coffey, Audrey L.; Sterling, Donna R.

    2003-01-01

    When a preschool teacher unexpectedly found tadpoles in the school's outdoor baby pool, she recognized an unusual opportunity for her students to study pond life up close. By following the tadpoles' development, students learned about frogs, life cycles, habitats. (Contains 1 resource.)

  7. La introducción y el cultivo de la rana toro (Rana catesbeiana. ¿Un atentado a la biodiversidad de México?

    Directory of Open Access Journals (Sweden)

    Gustavo Casas Andreu

    2001-01-01

    Full Text Available Se analiza el efecto que la introducción y el cultivo de la rana toro (Rana catesbeiana ha tenido en el ecosistema y la biodiversidad en México. Se recomienda el cultivo de especies nativas para sustituir a la rana toro.

  8. Managing habitat to slow or reverse population declines of the Columbia spotted frog in the Northern Great Basin

    Science.gov (United States)

    Pilliod, David S.; Richard D. Scherer,

    2015-01-01

    Evaluating the effectiveness of habitat management actions is critical to adaptive management strategies for conservation of imperiled species. We quantified the response of a Great Basin population of the Columbia spotted frog (Rana luteiventris) to multiple habitat improvement actions aimed to reduce threats and reverse population declines. We used mark-recapture data for 1,394 adult frogs that had been marked by state, federal, and university biologists in 9 ponds representing a single population over a 16-year period from 1997 to 2012. With the use of demographic models, we assessed population-level effects of 1) a grazing exclosure constructed around 6 stock ponds that had been used to water livestock for decades before being fully fenced in 2003, and 2) the construction of 3 new stock ponds in 2003 to provide alternative water sources for livestock and, secondarily, to provide additional frog habitat. These management actions were implemented in response to a decline of more than 80% in population size from 1997 to 2002. We found evidence that excluding cattle from ponds and surrounding riparian habitats resulted in higher levels of frog production (more egg masses), higher adult frog recruitment and survival, and higher population growth rate. We also found that frogs colonized the newly constructed stock ponds within 3 years and frogs began breeding in 2 of them after 5 years. The positive effects of the cattle exclosure and additional production from the new ponds, although notable, did not result in full recovery of the population even 9 years later. This slow recovery may be partly explained by the effects of weather on recruitment rates, particularly the negative effects of harsher winters with late springs and higher fall temperatures. Although our findings point to potential successes of habitat management aimed at slowing or reversing rapidly declining frog populations, our study also suggests that recovering from severe population declines can take

  9. Bioaccumulation, maternal transfer and elimination of polybrominated diphenyl ethers in wild frogs.

    Science.gov (United States)

    Liu, Peng-Yan; Du, Guo-Dong; Zhao, Ya-Xian; Mu, Yun-Song; Zhang, Ai-Qian; Qin, Zhan-Fen; Zhang, Xiao-You; Yan, Shi-Shuai; Li, Yan; Wei, Rong-Guo; Qin, Xiao-Fei; Yang, Yong-Jian

    2011-08-01

    To investigate bioaccumulation, maternal transfer and elimination of polybrominated diphenyl ethers (PBDEs) in amphibians, we collected adult frogs (Rana limnocharis) from a rice field in an e-waste recycling site in China. We found that ∑PBDEs in the whole frogs and various tissues (brain, liver, testis and egg) ranged from 17.10 to 141.11 ng g(-1) wet weight. Various tissues exhibited a similar PBDE congener profile, which was characterized by intermediate brominated congeners (BDE-99 and BDE-153) as the largest contributors, with less lower brominated congeners (BDE-28 and BDE-47) and higher brominated congeners (BDE-209). The maternal transfer capacity of PBDEs declined with the increase in bromine numbers of PBDE congeners. We suggest that the bromine atom number (the molecular size, to some degree) might be a determining factor for the maternal transport of a PBDE congener rather than K(ow) (Octanol-Water partition coefficient), which expresses a compound's lipophilicity. ∑PBDEs concentrations in frogs decreased over time during a depuration period of 54 days when these wild frogs were brought to the lab from the e-waste recycling site. The half-life of ∑PBDEs was 35 days, with about 14 days for BDE-47, and 36 and 81 days for BDE-99 and BDE-153, respectively. The data shows that the elimination of PBDEs has no essential difference from aquatic and terrestrial species.

  10. Expression analysis and identification of antimicrobial peptide transcripts from six North American frog species

    Science.gov (United States)

    Robertson, Laura S.; Fellers, Gary M.; Marranca, Jamie Marie; Kleeman, Patrick M.

    2013-01-01

    Frogs secrete antimicrobial peptides onto their skin. We describe an assay to preserve and analyze antimicrobial peptide transcripts from field-collected skin secretions that will complement existing methods for peptide analysis. We collected skin secretions from 4 North American species in the field in California and 2 species in the laboratory. Most frogs appeared healthy after release; however, Rana boylii in the Sierra Nevada foothills, but not the Coast Range, showed signs of morbidity and 2 died after handling. The amount of total RNA extracted from skin secretions was higher in R. boylii and R. sierrae compared to R. draytonii, and much higher compared to Pseudacris regilla. Interspecies variation in amount of RNA extracted was not explained by size, but for P. regilla it depended upon collection site and date. RNA extracted from skin secretions from frogs handled with bare hands had poor quality compared to frogs handled with gloves or plastic bags. Thirty-four putative antimicrobial peptide precursor transcripts were identified. This study demonstrates that RNA extracted from skin secretions collected in the field is of high quality suitable for use in sequencing or quantitative PCR (qPCR). However, some species do not secrete profusely, resulting in very little extracted RNA. The ability to measure transcript abundance of antimicrobial peptides in field-collected skin secretions complements proteomic analyses and may provide insight into transcriptional mechanisms that could affect peptide abundance.

  11. Expression of steroidogenic factor-1 in frog embryo and developing gonad.

    Science.gov (United States)

    Kawano, K; Furusawa, S; Matsuda, H; Takase, M; Nakamura, M

    2001-07-01

    Steroidogenic factor-1 (SF-1), originally identified as an orphan nuclear receptor that regulates expression of genes encoding cytochrome P-450 steroid hydroxylases, is an essential transcriptional factor for adrenal and gonadal development in mammals. Since sex steroid hormones have been shown to play important roles in the sex determination of frogs, it is of interest to know how SF-1 gene expression is regulated during the sexual development of this organism. A previous study isolated the cDNA of the frog Rana rugosa SF-1 (rrSF-1) and found sexual differences in its gene expression in adult frogs; positive in testis and negative in ovary (Kawano et al., 1998). This study examined rrSF-1 gene expression in frog embryos and developing and mature gonads by immunohistochemical staining using anti-rrSF-1 protein antibody for protein localization and by in situ hybridization analysis for mRNA transcription. The results obtained in this study indicated that cells expressing SF-1 that originate in the mesoderm and endoderm probably migrate into the developing gonad via the dorsal mesentery, genital ridge, and mesorchium or mesovarium. Thus, SF-1 may play an important role in gonadal development in amphibians.

  12. Polypeptides from the Skin of Rana chensinensis Exert the Antioxidant and Antiapoptotic Activities on HaCaT Cells.

    Science.gov (United States)

    Zhang, Xin; Cheng, Yunyun; Yang, Yang; Liu, Songcai; Shi, Hui; Lu, Chao; Li, Siming; Nie, Linyan; Su, Dan; Deng, Xuming; Ding, Kexiang; Hao, Linlin

    2017-01-02

    Studies have shown that frog skin secretes many types of peptides that are good for human skin. In this study, acid and enzymatic extracts of Rana skin peptides (acid/enzymatic Rana skin peptides, ARPs/ERPs) were obtained. The chemical and physical properties of the ARPs and ERPs were identified through UV scanning, HGLC, FRIT, and MS. MTS and flow cytometry were used to test the proproliferative and antiapoptotic effects of the ARPs and ERPs on human immortalized keratinocytes (HaCaT cells). To elucidate the antiapoptotic mechanisms, the mRNA and protein levels of EGF (epidermal growth factor, which enhances stimulation of cellular proliferation in both cells and epithelial tissues) and caspase-3 were evaluated using quantitative RT-PCR. The results indicated that the ARPs and ERPs were extracted from the Rana skin with yields of 0.65% and 0.52%, respectively. Treatment with ARPs (1.6 g/L) and ERPs (0.8 g/L) showed a 1.66-fold (p < 0.001) and 2.1-fold (p < 0.001) enhancement in the proliferation rates of HaCaT cells. The rate of apoptosis decreased by 2.6 fold (p < 0.01) and 3.4 fold (p < 0.01) under the UVB stimulation, respectively, at the same time, the up-regulation of EGF and down-regulation of caspase-3 were found. These results suggested that we can dig into the potential value of ARPs/ERPs in a new field.

  13. Proposed method for evaluating the effects of PCBs in sediment on egg mass viability and reproductive success in frogs

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, C.S.; Henning, M.H.; Ebert, E.S. [McLaren/Hart-ChemRisk, Portland, ME (United States)

    1995-12-31

    A proposed study design for evaluating the effect of PCBs in the sediments of a large New England river on reproductive success in frogs is described. Depending on field conditions and species abundance, the study will use either bullfrogs, Rana catesbiana; spring peepers, Hyla pickeringii; or green frogs, Rana claymitans as the study model. A selected number of gravid females will be collected from both the target area and a reference area matched with respect to a number of key variables including, but not limited to, stream flow, temperature, pH, substrate type, depth, surrounding land use, and organic carbon content of sediments. The gravid frogs will be transferred to a laboratory, where the egg masses will be stripped following induced ovulation, and then fertilized using semen from males collected in the field. Egg masses will be maintained under static renewal conditions for a period up to and including 7 days post hatch, during which mortality and gross morphological appearance will be evaluated. In the event that statistically significant differences in these endpoints are noted, a dose response model will be developed to relate observed effects to previously determined PCB concentrations in egg masses and maternal tissues. The results of this study will be of significant utility in evaluating reproductive toxicity of PCBs in ecological risk assessment.

  14. Changes in growth rate and macroelement and trace element accumulation in Hydrocharis morsus-ranae L. during the growing season in relation to environmental contamination.

    Science.gov (United States)

    Polechońska, Ludmiła; Samecka-Cymerman, Aleksandra; Dambiec, Małgorzata

    2017-02-01

    The temporal variations in plant chemistry connected with its life cycle may affect the cycling of elements in an ecosystem as well as determine the usefulness of the species in phytoremediation and bioindication. In this context, there is a gap in knowledge on the role of floating plants for elements cycling in aquatic reservoirs. The aim of the study was to determine if there are variations in Hydrocharis morsus-ranae (European frog-bit) bioaccumulation capacity and the growth rate of its population during the growing season and to test the impact of environmental pollution on these features. The content of macroelements (Ca, K, Mg, N, Na, P, S) and trace metals (Cd, Co, Cu, Cr, Hg, Fe, Mn, Ni, Pb, Zn) was determined in H. morsus-ranae collected monthly from June to October from habitats differing in environmental contamination. The results showed that the highest content of most trace metals (Co, Cr, Cu, Hg, Mn, Ni, Zn) and some nutrients (N, P) in plants as well as the greatest bioaccumulation efficiency occurred simultaneously in the beginning of the growing season. In the following months, a dilution effect (manifested by a decrease in content) related to the rapid growth was observed. Co, Mn, and Ni content in plant tissues reflected the level of environmental contamination throughout the growing season which makes H. morsus-ranae a potential biomonitor of pollution for these metals. Considering the great bioaccumulation ability, high sensitivity to contamination, and low biomass of European frog-bit in polluted systems, further investigation is required to assess the real phytoremediation capability of the species.

  15. Dmrt1 polymorphism covaries with sex-determination patterns in Rana temporaria.

    Science.gov (United States)

    Ma, Wen-Juan; Rodrigues, Nicolas; Sermier, Roberto; Brelsford, Alan; Perrin, Nicolas

    2016-08-01

    Patterns of sex-chromosome differentiation and gonadal development have been shown to vary among populations of Rana temporaria along a latitudinal transect in Sweden. Frogs from the northern-boreal population of Ammarnäs displayed well-differentiated X and Y haplotypes, early gonadal differentiation, and a perfect match between phenotypic and genotypic sex. In contrast, no differentiated Y haplotypes could be detected in the southern population of Tvedöra, where juveniles furthermore showed delayed gonadal differentiation. Here, we show that Dmrt1, a gene that plays a key role in sex determination and sexual development across all metazoans, displays significant sex differentiation in Tvedöra, with a Y-specific haplotype distinct from Ammarnäs. The differential segment is not only much shorter in Tvedöra than in Ammarnäs, it is also less differentiated and associates with both delayed gonadal differentiation and imperfect match between phenotypic and genotypic sex. Whereas Tvedöra juveniles with a local Y haplotype tend to ultimately develop as males, those without it may nevertheless become functional XX males, but with strongly female-biased progeny. Our findings suggest that the variance in patterns of sex determination documented in common frogs might result from a genetic polymorphism within a small genomic region that contains Dmrt1. They also substantiate the view that recurrent convergences of sex determination toward a limited set of chromosome pairs may result from the co-option of small genomic regions that harbor key genes from the sex-determination pathway.

  16. Modelling the impact of roads on regional population of Moor frogs (Rana arvalis)

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt

    ecologically sustainable road planning conservation measures must be taken into consideration already in the earliest phases of road development. This requires adequate tools for assessment, prevention and mitigation of the impacts of infrastructure. For this reason the Danish Road Directorate decided...... to be constructed and analysed. The first scenario should be a map of the area as it is before the planned road construction (scenario 0). This analysis measures the ecological performance of the original landscape and is a reference against which other scenarios are to be compared. The second map (scenario 1......) should show the landscape as it is expected to be after the road constructions. In combination, the analyses of scenario 0 and scenario 1 make it possible to assess the effect of road construction on connectivity and population persistence. The analyses also constitute the basis for planning...

  17. Temporal variability of spawning site selection in the frog Rana dalmatina: consequences for habitat management

    Directory of Open Access Journals (Sweden)

    Ficetola, G. F.

    2006-12-01

    Full Text Available We evaluated whether R. dalmatina females laid their eggs randomly within a pond or preferred particular microhabitats. The same measures were performed in the same area in two consecutive years to determine whether the pattern remained constant over time. In 2003, we observed a significant selection for areas with more submerged deadwood and vegetation, presence of emergent ground and low water depth. However, these results were not confirmed in the subsequent year when none of the microhabitat features measured had a significant effect. Although microhabitat features can strongly influence tadpoles, the temporal variability of habitat at this spatial scale suggests that habitat management could be more effective if focused on a a wider spatial scale.

  18. Behavioural and physiological adaptations to low-temperature environments in the common frog, Rana temporaria

    OpenAIRE

    2014-01-01

    Background\\ud Extreme environments can impose strong ecological and evolutionary pressures at a local level. Ectotherms are particularly sensitive to low-temperature environments, which can result in a reduced activity period, slowed physiological processes and increased exposure to sub-zero temperatures. The aim of this study was to assess the behavioural and physiological responses that facilitate survival in low-temperature environments. In particular, we asked: 1) do high-altitude common ...

  19. Matrix permeability of agriculture landscapes: an analysis of movements of the common frog (Rana temporaria)

    NARCIS (Netherlands)

    Vos, C.C.; Goedhart, P.W.; Lammertsma, D.R.; Spitzen-van der Sluijs, A.M.

    2007-01-01

    The implications of habitat fragmentation go beyond changes in the size and composition of suitable habitat patches. In fragmented landscapes, "matrix permeability" influences the dispersal of organisms, thereby affecting the persistence of populations in such landscapes. We investigated the effect

  20. Identification of Elizabethkingia meningoseptica from American bullfrog (Rana catesbeiana farmed in Sabah, Malaysia using PCR method and future management of outbreak

    Directory of Open Access Journals (Sweden)

    Zainuri, N.

    2013-01-01

    Full Text Available Aims: High demand for frog meat in Malaysia especially the American bullfrog (Rana catesbeiana has promoted intensive farming of the animal. However, the farming of American bullfrog is restricted by the occurrence of diseases. This study reports the first isolation of Elizabethkingia meningoseptica from specimens of American bullfrog that suffer from cataract and ‘red-leg’ syndrome.Methodology and Result: The pathogen was isolated from eyes and internal organs (liver, kidney and spleen of thediseased bullfrog specimens. All the bacterial isolates were subjected to phenotypic characterization and antibiotic susceptibility assay, and further identified by using the 16S rDNA sequencing analysis. We designed two pair of specific PCR primers (22-25 mers which are complimentary to the β-lactamase gene in the reference strain ofE. meningoseptica ATCC49470. The result showed all the bacterial isolates shared similar phenotypic characters and antibiotic susceptibility. BLAST analysis of the 16S rDNA sequences indicated that the bacterial isolates had very high sequence homology (100% with E. meningospetica ATCC49470 and E. meningoseptica isolates from mosquito. The two PCR primers were very specific to E. meningoseptica isolates of this study. Conclusion, significance and impact of study: This is the first isolation and characterization of bacterial pathogen, E. meningoseptica in cultured American bullfrog (Rana catesbeina that suffered from eye cataract and ‘red-leg’syndrome in Sabah, Malaysia. It is suspected that one of the possible transmission routes of the bacterial pathogen could be via mosquito bites. The findings suggest that there is urgent requirement for standard guideline of good farming practice to be adopted in frog farms throughout the country. Such a guideline can help in minimizing economic losses, preventing transmission of the zoonotic bacterial pathogen to farm workers, and sustaining the industry in Malaysia andupgrading

  1. The first taxonomic revaluation of the Iranian water frogs of the genus Pelophylax (Anura: Ranidae) using sequences of the mitochondrial genome.

    Science.gov (United States)

    Pesarakloo, Alireza; Rastegar-Pouyani, Eskandar; Rastegar-Pouyani, Nasrollah; Kami, Hajigholi; Najibzadeh, Masoumeh; Khosravani, Azar; Oraie, Hamzeh

    2017-05-01

    The Eurasian water frog species and their geographic ranges have undergone considerable changes in the last four decades, but the Iranian populations have largely remained unknown. All the Iranian populations of water frogs, despite their vast distribution range have attributed to a single species: Rana ridibunda. In order to understand the phylogenetic relationships and taxonomic status of water frogs of Iran, we collected samples from many populations across the country and used the mitochondrial DNA sequence variation. A data set with a final sequence length of 616 nucleotides was generated for Cyt b from 70 individuals of Pelophylax in which there are 422 invariable sites, 174 variable sites of which 123 were parsimony informative. In total, 43 haplotypes were found (Hd: 0.9752). The result demonstrated that, two major clades with strong support can be identified within the Iranian water frogs. One of these clades that include north western and southwestern populations forms a monophyletic group along with P. bedriagae samples from Turkey. The second clade consists of water frog populations of north and northeastern parts of Iran which in turn is subdivided into two subclades. Inclusion of water frog samples from adjacent areas showed that the second clade of our study is, most likely, a distinct taxonomic entity at species rank with its two subclades indicating two diagnosable subspecies for the clade. In conclusion, we suggest that two distinct species, P. bedriagae and Pelophylax sp., with its two subspecies, should be identified as water frogs of Iran. In Addition, another traditionally reported water frog of Iran, P.ridibundus, most likely should be excluded from the Iranian water frog's checklist.

  2. Absence of invasive Chytrid fungus (Batrachochytrium dendrobatidis in native Fijian ground frog (Platymantis vitiana populations on Viwa-Tailevu, Fiji Islands

    Directory of Open Access Journals (Sweden)

    Edward Narayan

    2011-12-01

    Full Text Available We report on the first survey of chytridiomycosis (Batrachochytrium dendrobatidis- Bd in the endangered Fijian ground frog (Platymantis vitiana population on Viwa-Tailevu, Fiji Islands. This fungal pathogen has been implicated as the primary cause of amphibian declines worldwide. Few cases have been reported from tropical Asia however it was recently documented in 4 species of frogs in Indonesia. Two hundred individual frogs were swabbed from 5 different sites on Viwa Island. Swabs were tested to quantify the number of Bd zoospore equivalents using real-time Polymerase Chain Reaction (qPCR technique. We found zero (% prevalence of Bd in ground frogs. The lack of Bd may be due to 1 hot weather all year round inhibiting the spread of Bd, 2 Bd may be absent from Viwa Island due to a lack of amphibian introductions (not introduced or importation of exotic frogs such as Rana catesbeia-na, or Xenopus spp or pet trade spp or 3 the lack of introduction by human vectors due to the geographic isolation, and low visitation of non-local people into the island. While it is difficult to test these hypotheses, a precautionary approach would suggest an effective quarantine is required to protect Fiji’s endemic frogs from future disease outbreak. Conservation effort and research is needed at international level to assist the Fiji government in monitoring and protecting their unique endemic amphibians from outbreaks of B. dendrobatidis.

  3. Trichobothrial mediation of an aquatic escape response: Directional jumps by the fishing spider, Dolomedes triton, foil frog attacks

    Directory of Open Access Journals (Sweden)

    Robert B. Suter

    2003-07-01

    Full Text Available Fishing spiders (Pisauridae frequent the surfaces of ponds and streams and thereby expose themselves to predation by a variety of aquatic and semi-aquatic vertebrates. To assess the possibility that the impressive jumps of fishing spiders from the water surface function in evading attacks by frogs, attacks by bullfrogs (Rana catesbiana and green frogs (R. clamitans on Dolomedes triton were studied. Both the attack dynamics of the frogs and the evasive behaviors of the spiders were recorded at 250 frames per second. A freeze-dried bullfrog, propelled toward spiders with acceleration, posture, and position that approximated the natural attack posture and dynamics, was used to assess the spiders' behavior. Qualitatively, the spiders responded to these mock-attacks just as they had to attacks by live frogs: jumping (N=29 jumps, 56.9% of instances, rearing the legs nearest the attacking frog (N=15, 29.4%, or showing no visible response (N=7, 13.7%. Spiders that jumped always did so away (in the vertical plane from the attack (mean =137° vs. vertical at 90° or horizontally toward the frog at 0°. The involvement of the trichobothria (leg hairs sensitive to air movements, and the eyes as sensory mediators of the evasion response was assessed. Spiders with deactivated trichobothria were significantly impaired relative to intact and sham-deactivated spiders, and relative to spiders in total darkness. Thus, functional trichobothria, unlike the eyes, are both necessary and sufficient mediators of the evasion response. Measurements of air flow during frog attacks suggest that an exponential rise in flow velocity is the airborne signature of an attack.

  4. Pre-hibernation energy reserves in a temperate anuran, Rana chensinensis, along a relatively fine elevational gradient

    Science.gov (United States)

    Lu, X.; Li, B.; Li, Y.; Ma, X.; Fellers, G.M.

    2008-01-01

    Temperate anurans have energy substrates in the liver, fat bodies, carcass and gonads; these stores provide support for metabolism and egg production during hibernation, and for breeding activities in spring. This paper compares the energy budget shortly before hibernation among Rana chensinensis populations at elevations of 1400, 1700 and 2000 m along a river in northern China. The larger frogs, regardless of elevation, had relatively heavy storage organs and the masses of nearly all these organs were positively correlated with each other. After controlling for the effect of body size, we found no significant difference in energetic organ mass among different age classes for each of the three populations. There were sexual differences in energy strategy. Males in all populations accumulated greater reserves in liver, fat bodies and carcass than did females. In contrast, females put more energy into their ovaries and oviducts. Frogs from higher elevations tended to have heavier organs than those from lower elevations; however, the pattern did not vary systematically along fine environmental gradients. Mid-elevation R. chensinensis built up significantly more reserves than low-elevation individuals, but were similar to their highland conspecifics. Males from higher elevations tended to have heavier liver and fat bodies; females were similar in liver and ovary mass across all elevations, but formed heavier fat bodies, oviducts and somatic tissue at higher elevation sites.

  5. Non-specific immune response of bullfrog Rana catesbeiana to intraperitoneal injection of bacterium Aeromonas hydrophila

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Non-specific immune response of bullfrog Rana catesbeiana to pathogenic Aeromonas hydrophila was studied to 60 individuals in two groups. Each bullfrog in bacterium-injected group was injected intraperitoneally (i.p.) with 0.2 ml bacterial suspension at a density of 5.2 × 106 CFU/ml, while each one in control group injected i.p. with 0.2 ml sterile saline solution (0.85%, w/v). Three bullfrogs in both groups were sampled at 0, 1, 3, 7, 11, 15 and 20 days post-injection (dpi) for the evaluation of non-specific immune parameters. It was observed that intraperitoneal injection of A. hydrophila significantly increased the number of leucocytes and that of NBT-positive cells in peripheral blood. Significant increases in serum bactericidal activity and serum acid phosphatase activity were also observed in the bacterium-injected frogs when compared with those in the control group. However, a significant reduction was detected in vitro in phagocytosis activity of peripheral blood phagocytes. No significant difference in changes in the number of peripheral erythrocytes, serum superoxide dismutase (SOD) activity, and lysozyme activity was detected between the two groups. It is suggested that bullfrogs may produce a series of non-specific immune reactions in response to the A. hydrophila infection.

  6. Molecular cloning and expression patterns of the Vasa gene from Rana nigromaculata (Amphibia: Anura

    Directory of Open Access Journals (Sweden)

    Rui Jia

    2009-06-01

    Full Text Available The Vasa protein is a member of the DEAD (Asp-Glu-Alu-Asp box family of ATP-dependent RNA helicases. The Vasa gene is specifically expressed in germ-line cells of many metazoans and is known to play a critical role in gametogenesis and reproductive regulation. In this paper, we isolate the full length cDNA sequence of the Vasa gene from the frog Rana nigromaculata Hallowell, 1861. The open reading frame (ORF encoding 398 amino acid residues has nine conserved motifs. According to the similarities at the amino acid sequenceythe phylogenetic analysis of Vasa gene was consistent with the evolution relationships from chordates to mammals. Furthermore, the expression pattern analysis of RnVasa mRNA, using the technique of Reverse Transcriptase-Polymerase Chain Reaction (RT-PCR, showed a high level of transcripts in testis, ovary and kidney, whereas little to no signal was detected in other tissues, which suggests that it may play a role during gametogenesis.

  7. Non-specific immune response of bullfrog Rana catesbeiana to intraperitoneal injection of bacterium Aeromonas hydrophila

    Science.gov (United States)

    Zhang, Junjie; Zou, Wenzheng; Yan, Qingpi

    2008-08-01

    Non-specific immune response of bullfrog Rana catesbeiana to pathogenic Aeromonas hydrophila was studied to 60 individuals in two groups. Each bullfrog in bacterium-injected group was injected intraperitoneally (i.p.) with 0.2 ml bacterial suspension at a density of 5.2 × 106 CFU/ml, while each one in control group injected i.p. with 0.2 ml sterile saline solution (0.85%, w/v). Three bullfrogs in both groups were sampled at 0, 1, 3, 7, 11, 15 and 20 days post-injection (dpi) for the evaluation of non-specific immune parameters. It was observed that intraperitoneal injection of A. hydrophila significantly increased the number of leucocytes and that of NBT-positive cells in peripheral blood. Significant increases in serum bactericidal activity and serum acid phosphatase activity were also observed in the bacterium-injected frogs when compared with those in the control group. However, a significant reduction was detected in vitro in phagocytosis activity of peripheral blood phagocytes. No significant difference in changes in the number of peripheral erythrocytes, serum superoxide dismutase (SOD) activity, and lysozyme activity was detected between the two groups. It is suggested that bullfrogs may produce a series of non-specific immune reactions in response to the A. hydrophila infection.

  8. Comparative toxicity of chlorpyrifos, diazinon, malathion and their oxon derivatives to larval Rana boylii

    Energy Technology Data Exchange (ETDEWEB)

    Sparling, D.W. [Cooperative Wildlife Research Laboratory, Department of Zoology and Center for Ecology, Southern Illinois University, LS II, MS6504, Carbondale, IL 62901 (United States)]. E-mail: dsparl@siu.edu; Fellers, G. [Western Ecology Research Center, U.S. Geological Survey, Point Reyes National Seashore, Point Reyes, CA 94956 (United States)

    2007-06-15

    Organophosphorus pesticides (OPs) are ubiquitous in the environment and are highly toxic to amphibians. They deactivate cholinesterase, resulting in neurological dysfunction. Most chemicals in this group require oxidative desulfuration to achieve their greatest cholinesterase-inhibiting potencies. Oxon derivatives are formed within liver cells but also by bacterial decay of parental pesticides. This study examines the toxicity of chlorpyrifos, malathion and diazinon and their oxons on the foothill yellow-legged frog (Rana boylii). R. boylii is exposed to agricultural pesticides in the California Central Valley. Median lethal concentrations of the parental forms during a 96 h exposure were 3.00 mg/L (24 h) for chlorpyrifos, 2.14 mg/L for malathion and 7.49 mg/L for diazinon. Corresponding oxons were 10 to 100 times more toxic than their parental forms. We conclude that environmental concentrations of these pesticides can be harmful to R. boylii populations. - Laboratory tests on the toxicity of OP insecticides and their oxons suggest that they may be acutely lethal to amphibians at ecologically relevant concentrations.

  9. Lithobates sylvaticus (wood frog)

    Science.gov (United States)

    Fuller, Pam

    2016-01-01

    A single specimen found southwest of Hattiesburg in Timberton (31.270391oN, 89.327675oW; WGS 84). 23 July 2015. Gary, Kat, and Ron Lukens. Verifi ed by Kenneth Krysko, Florida Museum of Natural History (UF-Herpetology 176455). This species has never been recorded from the state of Mississippi before (Dodd 2013. Frogs of the United States and Canada – Volume 2. John Hopkins University Press, Baltimore, Maryland. 982 pp.). According to Dodd (2013), the closest population is located in east central Alabama, approximately 400 km to the northeast, as documented by Davis and Folkerts (1986. Brimleyana 12:29-50).

  10. Generation of transgenic frogs.

    Science.gov (United States)

    Loeber, Jana; Pan, Fong Cheng; Pieler, Tomas

    2009-01-01

    The possibility of generating transgenic animals is of obvious advantage for the analysis of gene function in development and disease. One of the established vertebrate model systems in developmental biology is the amphibian Xenopus laevis. Different techniques have been successfully applied to create Xenopus transgenics; in this chapter, the so-called meganuclease method is described. This technique is not only technically simple, but also comparably efficient and applicable to both Xenopus laevis and Xenopus tropicalis. The commercially available endonuclease I-SceI (meganuclease) mediates the integration of foreign DNA into the frog genome after coinjection into fertilized eggs. Tissue-specific gene expression, as well as germline transmission, has been observed.

  11. Persistence at distributional edges: Columbia spotted frog habitat in the arid Great Basin, USA

    Science.gov (United States)

    Arkle, Robert S.; Pilliod, David S.

    2015-01-01

    A common challenge in the conservation of broadly distributed, yet imperiled species is understanding which factors facilitate persistence at distributional edges, locations where populations are often vulnerable to extirpation due to changes in climate, land use, or distributions of other species. For Columbia spotted frogs (Rana luteiventris) in the Great Basin (USA), a genetically distinct population segment of conservation concern, we approached this problem by examining (1) landscape-scale habitat availability and distribution, (2) water body-scale habitat associations, and (3) resource management-identified threats to persistence. We found that areas with perennial aquatic habitat and suitable climate are extremely limited in the southern portion of the species’ range. Within these suitable areas, native and non-native predators (trout and American bullfrogs [Lithobates catesbeianus]) are widespread and may further limit habitat availability in upper- and lower-elevation areas, respectively. At the water body scale, spotted frog occupancy was associated with deeper sites containing abundant emergent vegetation and nontrout fish species. Streams with American beaver (Castor canadensis) frequently had these structural characteristics and were significantly more likely to be occupied than ponds, lakes, streams without beaver, or streams with inactive beaver ponds, highlighting the importance of active manipulation of stream environments by beaver. Native and non-native trout reduced the likelihood of spotted frog occupancy, especially where emergent vegetation cover was sparse. Intensive livestock grazing, low aquatic connectivity, and ephemeral hydroperiods were also negatively associated with spotted frog occupancy. We conclude that persistence of this species at the arid end of its range has been largely facilitated by habitat stability (i.e., permanent hydroperiod), connectivity, predator-free refugia, and a commensalistic interaction with an ecosystem

  12. Morphological changes in the skin of Rana pipiens in response to metabolic acidosis.

    Science.gov (United States)

    Page, R D; Frazier, L W

    1987-04-01

    The skin of Rana pipiens excretes H+ and this excretion is increased by metabolic acidosis. The mitochondria-rich (MR) cells of the skin have been found to mediate this H+ transport. The purpose of this study was to determine if there is a change in the MR cells of the skin during metabolic acidosis and if the isolated split epithelia of frog skin maintains its capacity to excrete H+. Metabolic acidosis was induced by injecting 120 mM NH4Cl (0.025 ml/g body wt) into the dorsal lymph sac three times a day for 2 days. The frogs were sacrificed and collagenase-split skins from the abdomen of normal and metabolic acidotic frogs were mounted between 2-ml chambers. H+ fluxes into both the mucosal and serosal media were measured and reported in units of (nmol) (cm2)-1 (min)-1. An increase in H+ flux was seen on both the mucosal and serosal sides of the acidotic split skins. The isolated epithelia were fixed, postosmicated, and dehydrated in the chamber. They were then embedded in Spurr's resin and 1-micron sections were cut and stained with Paragon multiple stain. Coded slides were used to count various cell types. Sections were randomly selected and approximately 40,000 cells were counted. Four basic cell types were noted and confirmed by TEM photomicrographs; basal (B) cells, granular (G) cells, keratinized cells, and MR cells. The ratio of G + B cells:MR cells in the normal skins was 1.0:0.021. The ratio in acidotic skins was 1.0:0.34. The average percentage of cell population of MR cells in the normal skins was 2.08 + 0.18 and in acidotic skins 3.20 + 0.36 (P less than 0.005). We conclude that the split skin maintains the capacity to acidify the mucosal fluid. Additionally, during metabolic acidosis there is an increased number of MR cells in the skin and this increase may be an adaptive mechanism of the skin to excrete excess H+ during acidosis.

  13. De novo Transcriptome Assemblies of Rana (Lithobates catesbeiana and Xenopus laevis Tadpole Livers for Comparative Genomics without Reference Genomes.

    Directory of Open Access Journals (Sweden)

    Inanc Birol

    Full Text Available In this work we studied the liver transcriptomes of two frog species, the American bullfrog (Rana (Lithobates catesbeiana and the African clawed frog (Xenopus laevis. We used high throughput RNA sequencing (RNA-seq data to assemble and annotate these transcriptomes, and compared how their baseline expression profiles change when tadpoles of the two species are exposed to thyroid hormone. We generated more than 1.5 billion RNA-seq reads in total for the two species under two conditions as treatment/control pairs. We de novo assembled these reads using Trans-ABySS to reconstruct reference transcriptomes, obtaining over 350,000 and 130,000 putative transcripts for R. catesbeiana and X. laevis, respectively. Using available genomics resources for X. laevis, we annotated over 97% of our X. laevis transcriptome contigs, demonstrating the utility and efficacy of our methodology. Leveraging this validated analysis pipeline, we also annotated the assembled R. catesbeiana transcriptome. We used the expression profiles of the annotated genes of the two species to examine the similarities and differences between the tadpole liver transcriptomes. We also compared the gene ontology terms of expressed genes to measure how the animals react to a challenge by thyroid hormone. Our study reports three main conclusions. First, de novo assembly of RNA-seq data is a powerful method for annotating and establishing transcriptomes of non-model organisms. Second, the liver transcriptomes of the two frog species, R. catesbeiana and X. laevis, show many common features, and the distribution of their gene ontology profiles are statistically indistinguishable. Third, although they broadly respond the same way to the presence of thyroid hormone in their environment, their receptor/signal transduction pathways display marked differences.

  14. Extra-intestinal localization of Goussia sp. (Apicomplexa) oocysts in Rana dalmatina (Anura: Ranidae), and the fate of infection after metamorphosis.

    Science.gov (United States)

    Jirků, M; Modrý, D

    2006-06-23

    Although coccidia of the genus Goussia are common parasites of fish, only 2 species have been described in amphibians: G. hyperolisi from common reed frogs Hyperolius viridiflavus from Kenya and G. neglecta from unspecified European water frogs of the genus Rana from Germany. The genus Goussia is characterized by an oocyst, with a fine oocyst wall, containing 4 dizoic sporocysts that are composed of 2 valves joined by a longitudinal suture and lacking a Stieda body (typical for the genus Eimeria). To date, infections in amphibians were generally considered to be specific to the intestine of aquatic larval stages (tadpoles) of anurans. Herein, we report on: (1) the presence of oocysts of Goussia sp. in an extra-intestinal location (liver) of tadpoles of the agile frog R. dalmatina and (2) the presence of oocysts in the liver of both juvenile and subadult R. dalmatina. These observations represent novel traits for Goussia infections in amphibians; they may explain the vertical transmission of Goussia in tadpoles.

  15. Agro-climatic Division of Rana chensinensis in Fushun

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Based on data collected by 3 basic weather stations in Fushun City and 47 automatic weather stations in the whole region,we selected indexes suitable for agro-climatic division of Rana chensinensis,and carried out a study on agro-climatic division of Rana chensinensis in this region.Annual active accumulated temperature ≥10 ℃ and precipitation during April and September are used as basic calculation factors,and we use climatic aridity to make climatic division of Rana chensinensis in Fushun City.According to relevant indexes,we divide Fushun City into 3 regions,namely most appropriate,appropriate and general regions.Finally,countermeasures and suggestions are put forward for providing reference for agricultural production.

  16. Multiple stressors in amphibian communities: Effects of chemical contamination, bullfrogs, and fish

    Science.gov (United States)

    Boone, M.D.; Semlitsch, R.D.; Little, E.E.; Doyle, M.C.

    2007-01-01

    A leading hypothesis of amphibian population declines is that combinations of multiple stressors contribute to declines. We examined the role that chemical contamination, competition, and predation play singly and in combination in aquatic amphibian communities. We exposed larvae of American toads (Bufo americanus), southern leopard frogs (Rana sphenocephala), and spotted salamanders (Ambystoma maculatum) to overwintered bullfrog tadpoles (R. catesbeiana), bluegill sunfish (Lepomis macrochirus), the insecticide carbaryl, and ammonium nitrate fertilizer in 1000-L mesocosms. Most significantly, our study demonstrated that the presence of multiple factors reduced survival of B. americanus and A. maculatum and lengthened larval periods of R. sphenocephala. The presence of bluegill had the largest impact on the community; it eliminated B. americanus and A. maculatum and reduced the abundance of R. sphenocephala. Chemical contaminants had the second strongest effect on the community with the insecticide, reducing A. maculatum abundance by 50% and increasing the mass of anurans (frogs and toads) at metamorphosis; the fertilizer positively influenced time and mass at metamorphosis for both anurans and A. maculatum. Presence of overwintered bullfrogs reduced mass and increased time to metamorphosis of anurans. While both bluegill and overwintered bullfrog tadpoles had negative effects on the amphibian community, they performed better in the presence of one another and in contaminated habitats. Our results indicate that predicting deleterious combinations from single-factor effects may not be straightforward. Our research supports the hypothesis that combinations of factors can negatively impact some amphibian species and could contribute to population declines. ?? 2007 by the Ecological Society of America.

  17. Survival costs associated with wood frog breeding migrations: effects of timber harvest and drought.

    Science.gov (United States)

    Rittenhouse, Tracy A G; Semlitsch, Raymond D; Thompson, Frank R

    2009-06-01

    Migration presents a trade-off for individuals between the potential fitness benefits of reaching high-quality habitat vs. the potential costs of migration. Within an information-theoretic framework, we examined the costs of migration for adult wood frogs (Rana sylvatica) in response to timber harvest and annual weather conditions using Cox proportional-hazard estimates of survival. In 2004 prior to timber harvest, survival did not differ between the inside (0.75, SE = 0.078) and outside (0.73, SE = 0.235) of the circular timber harvest arrays (each 164 m radius). Following timber harvest, survival inside arrays in both 2005 and 2006 (0.22, SE = 0.065; 0.42, SE = 0.139) was lower than survival outside of the arrays and prior to harvest. Sources of mortality included predation in all years and desiccation in the drought year of 2005. The most-supported models for explaining both predation and desiccation risks reflected behaviors as opposed to timber harvest or weather conditions. Both predation and desiccation risks increased when frogs made frequent movements or were located near breeding ponds. Optimal behaviors for reducing predation and desiccation risks were the same before and after timber harvest; however, the survival consequences for not adopting these behaviors were more severe following harvest. Our results provide empirical evidence for (1) the ecological pressures that influence migratory behavior and (2) differential survival in relation to migratory behavior which reveals why frogs move relatively long distances away from breeding sites.

  18. High dispersal in a frog species suggests that it is vulnerable to habitat fragmentation

    Science.gov (United States)

    Funk, W.C.; Greene, A.E.; Corn, P.S.; Allendorf, F.W.

    2005-01-01

    Global losses of amphibian populations are a major conservation concern and their causes have generated substantial debate. Habitat fragmentation is considered one important cause of amphibian decline. However, if fragmentation is to be invoked as a mechanism of amphibian decline, it must first be established that dispersal is prevalent among contiguous amphibian populations using formal movement estimators. In contrast, if dispersal is naturally low in amphibians, fragmentation can be disregarded as a cause of amphibian declines and conservation efforts can be focused elsewhere. We examined dispersal rates in Columbia spotted frogs (Rana luteiventris) using capture–recapture analysis of over 10 000 frogs in combination with genetic analysis of microsatellite loci in replicate basins. We found that frogs had exceptionally high juvenile dispersal rates (up to 62% annually) over long distances (>5 km), large elevation gains (>750 m) and steep inclines (36° incline over 2 km) that were corroborated by genetic data showing high gene flow. These findings show that dispersal is an important life-history feature of some amphibians and suggest that habitat fragmentation is a serious threat to amphibian persistence.

  19. Dual effect of GABA on descending monosynaptic excitatory postsynaptic potential in frog lumbar motoneurons.

    Science.gov (United States)

    Ovsepian, S V; Vesselkin, N P

    2004-01-01

    Monosynaptic excitatory postsynaptic potentials (EPSPs) evoked by stimulating ipsilateral ventrolateral column (VLC) in the thoracic section were recorded in lumbar motoneurons within the isolated spinal cord of the frog Rana ridibunda. Bath application of the selective GABAB receptor agonist (-)-baclofen (0.05 mM) caused a reduction in the peak amplitude of VLC EPSP. Baclofen did not cause any consistent change in the membrane potential or in the EPSP waveform within frog motoneurones. The selective GABA(B) receptor antagonist saclofen (0.1 mM) completely blocked the effect of (-)-baclofen on VLC EPSP. A decrease in VLC EPSP peak amplitude was also observed during GABA (0.5 mM) application. Unlike (-)-baclofen, inhibition of VLC EPSP induced by GABA was accompanied by a shortening of the EPSP time course and a reduction in membrane input resistance within lumbar motoneurons. The decrease in VLC EPSP peak amplitude induced by (-)-baclofen and GABA was accompanied by an increase in the paired-pulse facilitation. These data provide evidence for a dual pre- and postsynaptic GABAergic inhibition of the VLC monosynaptic EPSP in lumbar motoneurons within the frog spinal cord.

  20. To Be or Not to Be...a Frog: The Frog Prince and Shifting Paradigms.

    Science.gov (United States)

    Crane, Lisa Marie

    1997-01-01

    Discusses three modern variations of the classic "Frog Prince" folk tale: "Pondlarker" (Fred Gwynne); "The Frog Prince Continued" (Jon Scieszka); and "The Prince of the Pond" (Donna Jo Napoli). Notes that these variants create a world in which frogs can have values, wisdom, and emotion, and in which frogs can influence the ways of humanity. (RS)

  1. A Comparison of V-Frog[C] to Physical Frog Dissection

    Science.gov (United States)

    Lalley, James P.; Piotrowski, Phillip S.; Battaglia, Barbara; Brophy, Keith; Chugh, Kevin

    2010-01-01

    The purpose of the present study was to examine and compare the effectiveness of virtual frog dissection using V-Frog[C] and physical frog dissection on learning, retention, and affect. Subjects were secondary students enrolled in year-long life science classes in a suburban high school (N=102). Virtual dissections were done with V-Frog[C], a…

  2. Cinco ranas y un sátiro

    OpenAIRE

    2010-01-01

    1 dibujo sobre papel; 145 x 114. Tinta. Papel. - Esbozo de conco ranas y un sátiro. - En el reverso de un sobre enviado a Miguel de Unamuno desde Bermeo (Vizcaya) el 1 de septiembre de 1899. - Buena conservación.

  3. A serine proteinase inhibitor from frog eggs with bacteriostatic activity.

    Science.gov (United States)

    Han, Yaoping; Yu, Haining; Yang, Xinbo; Rees, Huw H; Liu, Jingze; Lai, Ren

    2008-01-01

    By Sephadex G-50 gel filtration, Resource Q anionic exchange and C4 reversed phase liquid high performance liquid chromatography, a proteinase inhibitor protein (Ranaserpin) was identified and purified from the eggs of the odour frog, Rana grahami. The protein displayed a single band adjacent to the molecular weight marker of 14.4 kDa analyzed by SDS-PAGE. The inhibitor protein homogeneity and its molecular weight were confirmed again by MALDI-TOF mass spectrometry analysis. The MALDI-TOF mass spectrum analysis gave this inhibitor protein an m/z of 14422.26 that was matched well with the result from SDS-PAGE. This protein is a serine proteinase inhibitor targeting multiple proteinases including trypsin, elastase, and subtilisin. Ranaserpin inhibited the proteolytic activities of trypsin, elastase, and subtilisin. It has an inhibitory constant (K(i)) of 6.2 x 10(-8) M, 2.7 x 10(-7) M and 2.2 x 10(-8) M for trypsin, elastase, and subtilisin, respectively. This serine proteinase inhibitor exhibited bacteriostatic effect on Gram-positive bacteria Bacillus subtilis (ATCC 6633). It was suggested that ranaserpin might act as a defensive role in resistance to invasion of pests or pathogens. This is the first report of serine proteinase inhibitor and its direct defensive role from amphibian eggs.

  4. Regeneration of frog twitch and slow muscle fibers after mincing.

    Science.gov (United States)

    Schmidt, H; Emser, W

    1985-10-01

    Iliofibularis muscles of Rana temporaria were minced and allowed to regenerate in the iliofibularis or the sartorius bed of the same frog. Regenerated muscles were examined for the presence of slow muscle fibers using electrophysiologic, histochemical, and contractile parameters. Muscle regeneration from sartorius mince was also studied. Regeneration was more successful from iliofibularis than from sartorius mince, and the iliofibularis bed was more favorable for regeneration than the sartorius bed for both types of muscle. Twitch fibers regenerated within a few months, but slow fibers could not be identified earlier than 14 months after muscle destruction. Slow muscle fibers regenerated only from iliofibularis mince, both orthotopically and heterotopically. All regenerates capable of maintaining a K-contracture contained histochemically identified slow fibers; the membrane properties of electrophysiologically identified slow fibers were normal. It is concluded that slow muscle fibers regenerate only from the remnants of a muscle that contains slow fibers. The results are discussed with respect to the role of innervating nerve fibers.

  5. Possible Role of Fish and Frogs as Paratenic Hosts of Dracunculus medinensis, Chad

    Science.gov (United States)

    Yabsley, Michael J.; Zirimwabagabo, Hubert; Bishop, Henry; Cleveland, Christopher A.; Maerz, John C.; Bringolf, Robert; Ruiz-Tiben, Ernesto

    2016-01-01

    Copepods infected with Dracunculus medinensis larvae collected from infected dogs in Chad were fed to 2 species of fish and tadpoles. Although they readily ingested copepods, neither species of fish, Nile tilapia (Oreochromis niloticus) nor fathead minnow (Pimephalis promelas), were found to harbor Dracunculus larvae when examined 2–3 weeks later. Tadpoles ingested copepods much more slowly; however, upon examination at the same time interval, tadpoles of green frogs (Lithobates [Rana] clamitans) were found to harbor small numbers of Dracunculus larvae. Two ferrets (Mustela putorius furo) were fed fish or tadpoles that had been exposed to infected copepods. Only the ferret fed tadpoles harbored developing Dracunculus larvae at necropsy 70–80 days postexposure. These observations confirm that D. medinensis, like other species in the genus Dracunculus, can readily survive and remain infective in potential paratenic hosts, especially tadpoles. PMID:27434418

  6. Irradiation damage to frog inner ear during synchrotron radiation tomographic investigation

    Energy Technology Data Exchange (ETDEWEB)

    Boistel, Renaud [Equipe Communications Acoustiques, NAMC, CNRS UMR 8620, F-91405 Orsay (France); CNRS UMR 7179 ' Mecanismes adaptatifs: des organismes aux communautes' , Departement ' Ecologie et Gestion de la Biodiversite' , Museum National d' Histoire Naturelle, 57 rue Cuvier, case postale 55, 75231 Paris Cedex 5 (France); Univ Paris Sud, F-91405 Orsay (France); European Synchrotron Radiation Facility, B.P. 220, F-38043 Grenoble (France)], E-mail: boistel@mnhn.fr; Pollet, Nicolas [Univ Paris Sud, F-91405 Orsay (France); CNRS UMR 8080, F-91405 Orsay (France); Epigenomics Project, Genopole, Univ Evry Val d' Essonne, 91034 Evry Cedex (France); Tinevez, Jean-Yves [Laboratoire Physico-Chimie Curie, CNRS UMR 168, Institut Curie Recherche, 26, Rue d' Ulm, 75248 Paris Cedex 05 (France); Cloetens, Peter [European Synchrotron Radiation Facility, B.P. 220, F-38043 Grenoble (France); Schlenker, Michel [Institut Neel, CNRS, and Grenoble Institute of Technology, B.P. 166, F-38042 Grenoble (France)

    2009-03-15

    Unexpectedly severe radiation damage, showing up through deformation of the saccule, was encountered during a synchrotron radiation high-resolution (700 nm pixel size) tomographic observation of an inner ear, fixed in a formaldehyde solution, of the frog Rana esculenta. The visible displacement of the edge of the otoconia-filled part of the saccule amounted to about 100 {mu}m after an irradiation with 20.5 keV X-ray photons corresponding to a dose of 1.5 kGy for the protein matrix. The close-knit coexistence of organic and mineral components in the biological tissue may be linked to the dramatic increase of radiation dosage sensitivity.

  7. Interference of a short-chain phospholipid with ion transport pathways in frog skin

    DEFF Research Database (Denmark)

    Unmack, M A; Frederiksen, O; Willumsen, N J

    1997-01-01

    The effects of mucosal application of the short-chain phospholipid didecanoyl-L-alpha-phosphatidylcholine (DDPC; with two saturated 10-carbon acyl chains) on active Na+ transport and transepithelial conductance (G) in the frog skin (Rana temporaria) were investigated. Active Na+ transport...... was measured as the amiloride-sensitive short-circuit current (ISC) and G was determined from transepithelial voltage-clamp pulses under short-circuit conditions. DDPC dose-dependently inhibited ISC with an ID50 of about 0.05% (w/v) and a maximal effect ( approximately 55%) at >/= 1% DDPC. G increased...... in G by DDPC, these results suggest that the DDPC-induced increase in G represents an increase in the paracellular shunt conductance. The effects of mucosal DDPC were almost fully reversible within 8 h. The results indicate that DDPC inhibits amiloride-sensitive Na+ channels in the apical membrane...

  8. The Sodium and Potassium Exchange between Intact Frogs and Their Environment

    Science.gov (United States)

    STEINBACH, H. BURR

    1966-01-01

    Intact living frogs (Rana pipiens) were partially immersed in dilute salt solution labeled with K42 or Na24 or, alternatively, injected with Ringer’s fluid containing the appropriate isotope and then partially immersed in unlabeled dilute salt. Before isotopic equilibrium, the animals were sacrificed and specific activities of K42 and Na24 were determined for medium, skin, plasma, and other tissues. With Na24, entering from the medium or escaping to the medium, specific activities of the skin approach that of the plasma. For K42, entering from the medium, the specific activity exceeds that of the plasma. The results are interpreted as indicating that the exchange rate for Na is greater plasma to skin than medium to skin, with the reverse situation for K. Values are given for average Na, K, and Cl contents of the various organ systems. PMID:5924103

  9. Carryover aquatic effects on survival of metamorphic frogs during pond emigration

    Science.gov (United States)

    Chelgren, N.D.; Rosenberg, D.K.; Heppell, S.S.; Gitelman, A.I.

    2006-01-01

    In organisms with complex life cycles, physiological stressors during early life stages may have fitness-level impacts that are delayed into later stages or habitats. We tested the hypothesis that body size and date of metamorphosis, which are highly responsive to aquatic stressors, influence post-metamorphic survival and movement patterns in the terrestrial phase of an ephemeral pond-breeding frog by examining these traits in two populations of northern red-legged frogs (Rana aurora aurora). To increase variation of body size at metamorphosis, we manipulated food availability for 314 of 1045 uniquely marked tadpoles and estimated the probability that frogs survived and emigrated using concentric rings of drift fencing surrounding ponds and Bayesian capture-recapture modeling. The odds of surviving and emigrating from the ponds to the innermost drift fences, ???12 m, increased by factors of 2.20 (95% credibility intervals 1.39-4.23) and 2.54 (0.94-4.91) with each millimeter increase in snout-vent length and decreased by factors of 0.91 (0.85-0.96) and 0.89 (0.80-1.00) with each day's delay in metamorphosis for the two ponds. The odds of surviving and moving to the next ring of fencing, 12 m to ???40 m from the ponds, increased by a factor of 1.20 (0.45-4.06) with each millimeter increase in size. Our results demonstrated that body size and timing of metamorphosis relate strongly to the performance of newly metamorphosed frogs during their initial transition into terrestrial habitat. Carryover effects of aquatic stressors that reduce size and delay metamorphosis may have population-level impacts that are not expressed until terrestrial stages. Since changes in both aquatic and terrestrial systems are implicated in many amphibian declines, quantifying both immediate and delayed effects of stressors on demographic rates is critical to sound management. ?? 2006 by the Ecological Society of America.

  10. 49 CFR 213.137 - Frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frogs. 213.137 Section 213.137 Transportation... TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.137 Frogs. (a) The flangeway depth measured from a plane across the wheel-bearing area of a frog on Class 1 track shall not be less than 13/8 inches, or...

  11. [Morphological and physiological characterization of fiber types in the iliofibular muscle of Rana esculenta].

    Science.gov (United States)

    Dauber, W

    1977-01-01

    In both longitudinal and cross sections of the M. iliofibularis of Rana esculenta three types of muscle fibres are identified by means of light and electron microscopy. These fibretypes called A-, B- and C-fibres are according to the fibres of m. rectus abdominis of the frog. They can be compared with the fibres of the m. rectus abdominis of rat and mouse. But there is another distribution of the fibretypes A, B and C in the m. iliofibularis and in the m. rectus abdominis. The m. iliofibularis is divided into two parts called "Tonusbündel" and "nichttonischer Teil" by means of their reaction to acetylcholine. The surface of the "Tonusbündel" consists of A-, B- and C-fibres while its inside is onlyformed by A- and B-fibres. They continue the "Tonusbündel" in the "nichttonischer Teil". This part chiefly consists of A-fibres. In cross sections their myofibrils are larger in their extent than the A-fibres known before. Therefore the A-fibretype has to be distinguished into two A-fibres: A1 and A2. The new one is called A2-fibre. A1-fibre is described in the "Tonusbündel" and in further investigations. The difference between the two fibres can be understood as a greater manifestation of power of the A1-fibre. The surface of the "nichttonischer Teil" of the m. iliofibularis consists of A2-fibres which easily could be found opposite the "Tonusbündel". At this point in contrary to the "Tonusbündel" could be found a defined morphological substrate for physiological investigations. The different reactions of "Tonusbündel" and "nichttonischer Teil" to acetylcholine could only be explained by the sum of reactions of all fibretypes in each bundle in correspondence with the reaction of the fibres in the neighbour bundle. But their different behaviour by summer- and winterfrogs is unknown. Therefore it is to discuss whether it is allowed to refer generally the results to "muscle" or "musclefibre" got from frogs living in cooled rooms. It is known in literature that not all

  12. Impacts of weathered tire debris on the development of Rana sylvatica larvae

    Science.gov (United States)

    Camponelli, K.M.; Casey, R.E.; Snodgrass, J.W.; Lev, S.M.; Landa, E.R.

    2009-01-01

    Highway runoff has the potential to negatively impact receiving systems including stormwater retention ponds where highway particulate matter can accumulate following runoff events. Tire wear particles, which contain about 1% Zn by mass, make up approximately one-third of the vehicle derived particulates in highway runoff and therefore may serve as a stressor to organisms utilizing retention ponds as habitat. In this study, we focused on the potential contribution of tire debris to Zn accumulation by Rana sylvatica larvae and possible lethal or sublethal impacts resulting from exposure to weathered tire debris during development. Eggs and larvae were exposed to aged sediments (containing either ZnCl2 or tire particulate matter, both providing nominal concentrations of 1000 mg Zn kg-1) through metamorphosis. Water column Zn was elevated in both the ZnCl2 and tire treatments relative to the control treatment, indicating that aging allowed Zn leaching from tire debris to occur. Tissue Zn was also elevated for the ZnCl2 and tire treatments indicating that Zn in the treatments was available for uptake by the amphibians. Exposure to both ZnCl2 and tire treatments increased the time for larvae to complete metamorphosis in comparison with controls. We also observed that the longer the organisms took to complete metamorphosis, the smaller their mass at metamorphosis. Our results indicate that Zn leached from aged tire debris is bioavailable to developing R. sylvatica larvae and that exposure to tire debris amended sediments can result in measurable physiological outcomes to wood frogs that may influence population dynamics. ?? 2008 Elsevier Ltd.

  13. Conservation in the Teaching Laboratory--Substitution of Xenopus for Rana.

    Science.gov (United States)

    Bernhart, David M; And Others

    1991-01-01

    Reports on experimental comparisons between the leopard frog, currently captured for laboratory use, and the African clawed frog, raised specifically for research. Except for the increased longevity of isolated nerve axons in the clawed frog, no other significant differences were established. Recommends laboratory use of clawed frogs as…

  14. Behavioural consistency and life history of Rana dalmatina tadpoles

    OpenAIRE

    Urszán, Tamás Janós; Török, János; Hettyey, Attila; Garamszegi, László Z; Herczeg, Gábor

    2015-01-01

    The focus of evolutionary behavioural ecologists has recently turned towards understanding the causes and consequences of behavioural consistency, manifesting either as animal personality (consistency in a single behaviour) or behavioural syndrome (consistency across more behaviours). Behavioural type (mean individual behaviour) has been linked to life-history strategies, leading to the emergence of the integrated pace-of-life syndrome (POLS) theory. Using Rana dalmatina tadpoles as models, w...

  15. Spirometra mansoni sparganum infection in frogs from Qingyuan city markets%清远市市售蛙类曼氏裂头蚴感染情况调查

    Institute of Scientific and Technical Information of China (English)

    林燕锋; 杨普贤; 徐国洪; 陈文青

    2014-01-01

    目的 了解清远市市售蛙类曼氏裂头蚴的感染状况.方法 从市场购买人工养殖的虎纹蛙和野生泽蛙,逐只解剖查找曼氏裂头蚴.结果 检查100只人工饲养的虎纹蛙,均为阴性;检查107只野生泽蛙,曼氏裂头蚴感染率为41.12%(44/107),平均感染度为6.55条/只;不同大小泽蛙曼氏裂头蚴感染率差异有统计学意义(x2=7.40,P<0.01);曼氏裂头蚴可在蛙体内任何部位的肌肉寄生,其中以大腿部肌肉寄生最为常见,占62.85%(181/288).结论 清远市市售人工养殖的虎纹蛙未发现曼氏裂头蚴,野生蛙类体内曼氏裂头蚴感染率较高,野生蛙类为重点防范对象,开展健康教育,预防曼氏裂头蚴病的工作十分必要.%Objective To investigate the infection condition Spirometra marsoni Sparganum in frogs from Qingyuan city markets.Methods Rana tigrina and wild Rana limnocharis were bought from markets in Qingyuan city,and were dissected for finding Sparganum mansoni.Results 100 Rana tigrina were dissected; the infection rate was zero.107 wild R.limnocharis were dissected,with an infection rate of 41.12% (44/107),and with an average infection of 6.55 Sparganum per frog.There were significant differences on the infection rates of Sparganum in different sizes of R.imnocharis (x2=7.40,P<O.01);Sparganum mansoni can lodge in any muscle of frogs,and the thigh muscle was the most common parasitic location,accounted for 62.85% (181/288).Conclusion There was no Sparganum mansoni in Rana tigrina from Qingyuan city markets.The infection rate of sparganum of Spirometra mansoni in wild frogs was high,so the wild frogs were the main precautionary subjects.It is necessary to carry out health education for preventing sparganosis mansoni.

  16. Mechanics of the frog ear

    NARCIS (Netherlands)

    Van Dijk, Pim; Mason, Matthew J.; Schoffelen, Richard L. M.; Narins, Peter M.; Meenderink, Sebastiaan W. F.

    2011-01-01

    The frog inner ear contains three regions that are sensitive to airborne sound and which are functionally distinct. (1) The responses of nerve fibres innervating the low-frequency, rostral part of the amphibian papilla (AP) are complex. Electrical tuning of hair cells presumably contributes to the f

  17. Guinea Worm in a Frog

    Centers for Disease Control (CDC) Podcasts

    2017-03-09

    Dr. Mark Eberhard, a retired parasitologist and CDC guest researcher, discusses Guinea worm infection in a wild-caught frog.  Created: 3/9/2017 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 3/9/2017.

  18. FROG - Fingerprinting Genomic Variation Ontology.

    Directory of Open Access Journals (Sweden)

    E Abinaya

    Full Text Available Genetic variations play a crucial role in differential phenotypic outcomes. Given the complexity in establishing this correlation and the enormous data available today, it is imperative to design machine-readable, efficient methods to store, label, search and analyze this data. A semantic approach, FROG: "FingeRprinting Ontology of Genomic variations" is implemented to label variation data, based on its location, function and interactions. FROG has six levels to describe the variation annotation, namely, chromosome, DNA, RNA, protein, variations and interactions. Each level is a conceptual aggregation of logically connected attributes each of which comprises of various properties for the variant. For example, in chromosome level, one of the attributes is location of variation and which has two properties, allosomes or autosomes. Another attribute is variation kind which has four properties, namely, indel, deletion, insertion, substitution. Likewise, there are 48 attributes and 278 properties to capture the variation annotation across six levels. Each property is then assigned a bit score which in turn leads to generation of a binary fingerprint based on the combination of these properties (mostly taken from existing variation ontologies. FROG is a novel and unique method designed for the purpose of labeling the entire variation data generated till date for efficient storage, search and analysis. A web-based platform is designed as a test case for users to navigate sample datasets and generate fingerprints. The platform is available at http://ab-openlab.csir.res.in/frog.

  19. Salmonella Infection and Water Frogs

    Centers for Disease Control (CDC) Podcasts

    2010-01-12

    This podcast, featuring lead investigator Shauna Mettee, discusses the first known outbreak of Salmonella in people due to contact with water frogs.  Created: 1/12/2010 by National Center for Zoonotic, Vector-Borne, and Enteric Diseases (NCZVED).   Date Released: 1/12/2010.

  20. Post-evaluation of the neurophaties treatment post-trauma with therapeutic laser. Model in sciatic nerve of frog

    Science.gov (United States)

    Escobar, Antonio S.; Ocampo, Arcelia F. M.; Hernández, María G. H.; Jasso, José L. C.; Lira, Maricela O. F.; Flores, Mariana A.; Balderrama, Vicente L.

    2010-05-01

    The purpose of this study was to evaluate the compound nerve action potential amplitude and latency measured to determine the degree of myelination and the number of fibers stimulated in a model of stimulated frog sciatic nerve laser at 810 nm as perioperative treatment after injury. It used 30 bullfrogs (Rana catesbeiana) to obtain 60 sciatic nerves forming four groups, groups 1 and 2 worked with nerves in vitro, were dissected in humid chambers for placing isolated organ, was recorded on compound nerve action potential, the second group laser was applied at 24, 48, 72, 96 and 120 hours and at the same time were placed in 10% formalin. Groups 3 and 4 are worked in vivo localizing the nerve and causing damage through compression, occurred over the compound nerve action potential to assess the degree of myelination and the number of fibers stimulated, the group 4 was applied to 810 nm laser (500 Hz, 10 J, 200 mW) after injury, after 48 hours, three frogs were sacrificed by introducing the nerves in 10% formalin. The latency recorded by stimulating the sciatic nerve of frog to 0.5 mA and 100 ms in groups 1 and 2 show significant differences (p000), as to the extent, if any statistically significant difference. (p<0.001 and p<0.000). The laser produces a favorable response in the treatment of paresthesia (post-traumatic neuropathy).

  1. Toxic effects of octylphenol on the expression of genes in liver identified by suppression subtractive hybridization of Rana chensinensis.

    Science.gov (United States)

    Li, Xin-Yi; Xiao, Ning; Zhang, Yu-Hui

    2014-01-01

    Octylphenol (OP) is the degradative product of alkylphenol ethoxylates that are widely used to produce rubber, pesticides, and paints. It is chemically stable substance and demonstrates estrogenic effects, toxicity and carcinogenic effects in the environment. The toxin accumulates rapidly in the liver where it exerts most of its damage, but the molecular mechanisms behind its toxicity remain unclear. Due to limited information concerning the effect of OP on liver, this study investigates how OP causes hepatotoxicity in liver. Here, suppression subtractive hybridization was used to identify the alterations in gene transcription of the frog (Rana chensinensis) after exposure to OP. After hybridization and cloning, the subtractive cDNA libraries were obtained. At random, 207 positive clones were selected and sequenced from the subtractive libraries, which gave a total of 75 gene fragment sequences. The screening identified numerous genes involved in apoptosis, signal transduction, cytoskeletal remodeling, innate immunity, material and energy metabolism, translation and transcription which were extensively discussed. Two sequenced genes were analyzed further using real time quantitative PCR. The two genes from the library were found to be transcriptionally up-regulated. These results confirmed the successful construction of the subtractive cDNA library that was enriched for the genes that were differentially transcribed in the amphibian liver challenged with OP, and for the first time present the basic data on toxicity effect of OP on liver.

  2. Care and Feeding of Frogs

    Science.gov (United States)

    Pan, Margaret; Chiang, Eugene

    2012-01-01

    "Propellers" are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno et al.) the longitude residuals of the best-observed propeller, "Blériot," appear consistent with a sinusoid of period ~4 years. Pan & Chiang proposed that propeller moonlets librate in "frog resonances" with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t delay, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t delay exceeds the frog libration period P lib, and if damping from Lindblad torques balances driving from co-orbital torques. If t delay Lt P lib, then the libration amplitude damps to zero. In the case of Blériot, the frog resonance model can reproduce the observed libration period P lib ~= 4 yr. However, our simple feedback prescription suggests that Blériot's t delay ~ 0.01P lib, which is inconsistent with the observed libration amplitude of 260 km. We urge more accurate treatments of feedback to test the assumptions of our toy models.

  3. CARE AND FEEDING OF FROGS

    Energy Technology Data Exchange (ETDEWEB)

    Pan, Margaret; Chiang, Eugene, E-mail: mpan@astro.berkeley.edu [Department of Astronomy, University of California, Berkeley, CA 94720 (United States)

    2012-01-15

    'Propellers' are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno et al.); the longitude residuals of the best-observed propeller, 'Bleriot', appear consistent with a sinusoid of period {approx}4 years. Pan and Chiang proposed that propeller moonlets librate in 'frog resonances' with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t{sub delay}, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t{sub delay} exceeds the frog libration period P{sub lib}, and if damping from Lindblad torques balances driving from co-orbital torques. If t{sub delay} << Pl{sub ib}, then the libration amplitude damps to zero. In the case of Bleriot, the frog resonance model can reproduce the observed libration period P{sub lib} {approx_equal} 4 yr. However, our simple feedback prescription suggests that Bleriot's t{sub delay} {approx} 0.01P{sub lib}, which is inconsistent with the observed libration amplitude of 260 km. We urge more accurate treatments of feedback to test the assumptions of our toy models.

  4. Inherent rhythmcity and interstitial cells of Cajal in a frog vein

    Indian Academy of Sciences (India)

    Dipanwita Ghose; Lingu Jose; S Manjunatha; Muddanna S Rao; J Prakasa Rao

    2008-12-01

    Interstitial cells of Cajal are responsible for rhythmic contractions of the musculature of the gastrointestinal tract and blood vessels. The existence of these cells and spontaneous rhythmicity were noticed in amphibian vein and the findings are reported in this paper. The postcaval vein was identified in the frog, Rana tigrina and was perfused with amphibian Ringer solution after isolation. Contractile activity was recorded through a tension transducer connected to a polygraph. The isolated postcaval vein showed spontaneous rhythmic activity. Addition of cold Ringer solution decreased, while warm Ringer increased, the rate of contraction. Adrenaline caused inhibition of rhythmic activity at a dosage that increased the rate of isolated sinus venosus. Sections of the postcaval vein, when stained supravitally with methylene blue, showed the presence of interstitial cells of Cajal. Photic stimulation of the vein in the presence of methylene blue led to a significant decrease in the rate of spontaneous beating of the vein. These findings indicate that the postcaval vein of frog is capable of inherent rhythmcity, which is dependent on the interstitial cells of Cajal but is independent of the sinus venosus.

  5. Antimicrobial peptides from the skin secretions of the South-East Asian frog Hylarana erythraea (Ranidae).

    Science.gov (United States)

    Al-Ghaferi, Nadia; Kolodziejek, Jolanta; Nowotny, Norbert; Coquet, Laurent; Jouenne, Thierry; Leprince, Jérôme; Vaudry, Hubert; King, Jay D; Conlon, J Michael

    2010-04-01

    Peptidomic analysis of norepinephrine-stimulated skin secretions of the South-East Asian frog Hylarana erythraea (formerly Rana erythraea partim) has led to the identification of multiple peptides with antimicrobial activity. Structural characterization of the peptides demonstrated that they belong to the brevinin-1 (3), brevinin-2 (2), esculentin-2 (4), and temporin (1) families. The values in parentheses indicate the number of paralogs. In addition, a peptide (GVIKSVLKGVAKTVALG ML.NH(2)) was isolated that shows some structural similarity to the brevinin-2-related peptides (B2RP) previously isolated from North American frogs of the genus Lithobates. A synthetic replicate of the species B2RP showed broad-spectrum growth inhibitory activity against reference strains of Escherichia coli (MIC=12.5 microM), Staphylococcus aureus (MIC=12.5 microM) and Candida albicans (MIC=50 microM) and was active against multidrug-resistant clinical isolates of Acetinobacter baumannii (MIC in the range 6-12.5 microM). The hemolytic activity of the peptide was relatively low (LC(50)=280 microM). Phylogenetic analysis based upon the amino acid sequences of 47 brevinin-2 peptides from 17 Asian species belonging to the family Ranidae provides support for the placement of H. erythraea in the genus Hylarana.

  6. From frog integument to human skin: dermatological perspectives from frog skin biology

    NARCIS (Netherlands)

    Haslam, I.S.; Roubos, E.; Mangoni, M.L.; Yoshizato, K.; Vaudry, H.; Kloepper, J.E.; Pattwell, D.M.; Maderson, P.F.A.; Paus, R.

    2014-01-01

    For over a century, frogs have been studied across various scientific fields, including physiology, embryology, neuroscience, (neuro)endocrinology, ecology, genetics, behavioural science, evolution, drug development, and conservation biology. In some cases, frog skin has proven very successful as a

  7. From frog integument to human skin: dermatological perspectives from frog skin biology

    NARCIS (Netherlands)

    Haslam, I.S.; Roubos, E.; Mangoni, M.L.; Yoshizato, K.; Vaudry, H.; Kloepper, J.E.; Pattwell, D.M.; Maderson, P.F.A.; Paus, R.

    2014-01-01

    For over a century, frogs have been studied across various scientific fields, including physiology, embryology, neuroscience, (neuro)endocrinology, ecology, genetics, behavioural science, evolution, drug development, and conservation biology. In some cases, frog skin has proven very successful as a

  8. Effect of static magnetic fields on the metamorphosis of frogs; Kaeru no hentai katei ni oyobosu jiba no eikyo ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    Hiwaki, O. [Hiroshima City University, Hiroshima (Japan)

    1996-01-20

    The effect of static magnetic fields on the metamorphosis of frogs was investigated to examine the effect of static magnetic fields on the internal secretion system and nerve system in a living body. In this experiment, the growth and metamorphosis of a Rana Japonica`s larva are inhibited inside the vessel in which a magnet whose upper surface is the N pole was put at the bottom. However, no remarkable change was recognized when a magnet whose upper surface is the S pole was put at the bottom. For a bullfrog, the same result as described above was obtained. The experiment result shows that the vertical upward fields inhibit the growth and metamorphosis of a frog`s larva, but the vertical downward fields do not remarkably act on them. As a result of this experiment, the growth and metamorphosis of a frog are considered to act on the internal secretion system of a tadpole in static magnetic fields when the control by thyroxin is considered. Since the existence of action varies depending on the polarity of vertical magnetic fields, the magnet in a living body is judged to be associated with the internal secretion system of a tadpole. 17 refs., 8 figs.

  9. Primary structures of skin antimicrobial peptides indicate a close, but not conspecific, phylogenetic relationship between the leopard frogs Lithobates onca and Lithobates yavapaiensis (Ranidae).

    Science.gov (United States)

    Conlon, J Michael; Coquet, Laurent; Leprince, Jérôme; Jouenne, Thierry; Vaudry, Hubert; King, Jay D

    2010-04-01

    The phylogenetic relationship between the relict leopard frog Lithobates (Rana) onca (Cope, 1875) and the lowland leopard frog Lithobates (Rana) yavapaiensis (Platz and Frost, 1984) is unclear. Chromatographic analysis of norepinephrine-stimulated skin secretions from L. onca led to the identification of six peptides with antimicrobial activity. Determination of their primary structures indicated that four of the peptides were identical to brevinin-1Ya, brevinin-1Yb, brevinin-1Yc and ranatuerin-2Ya previously isolated from skin secretions of L. yavapaiensis. However, a peptide belonging to the temporin family (temporin-ONa: FLPTFGKILSGLF.NH(2)) and an atypical member of the ranatuerin-2 family containing a C-terminal cyclic heptapeptide domain (ranatuerin-2ONa: GLMDTVKNAAKNLAGQMLDKLKCKITGSC) were isolated from the L. onca secretions but were not present in the L. yavapaiensis secretions. Ranatuerin-2ONa inhibited the growth of Escherichia coli (MIC=50muM) and Candida albicans (MIC=100muM ) and showed hemolytic activity (LC(50)=90muM) but was inactive against Staphylococcus aureus. The data indicate a close phylogenetic relationship between L. onca and L. yavapaiensis but suggest that they are not conspecific species.

  10. A Depolarizing Electrogenic Pump in Frog Muscle

    Science.gov (United States)

    1975-08-01

    mw copy AFRRI SR75-20 AUGUST 1975 AFRRI SCIENTIFIC REPORT O ■ to A DEPOLARIZING ELECTROGENIC PUMP IN FROG MUSCLE D. Geduldig D. R...Academy of Sciences - National Research Council. AFRRI SR75-20 August 1975 A DEPOLARIZING ELECTROGENIC PUMP IN FROG MUSCLE D. GEDULDIG* D. R...INTRODUCTION When Na-enriched frog muscles are bathed in Na- and K-free saline, the small amount of potassium which could accumulate outside of the membrane

  11. HARDENING FROG POINTS BY EXPLOSIVE ENERGY,

    Science.gov (United States)

    Experiments were made to determine the most efficient method of strain hardening railroad frog points in order to increase their fatigue resistance...Mechanical strain hardening with rolls 40 mm in diameter under a load of 8 tons produced in standard frogs cast from G13L high-manganese steel (AISI...Hadfield steel) a work-hardened surface layer 3-5 mm thick with a hardness of 340 HB. In other experiments, the frogs were hardened by exploding a

  12. Los cromosomas meióticos de la rana arborícola Smilisca baudinii (Anura: Hylidae

    Directory of Open Access Journals (Sweden)

    Javier Hernández-Guzmán

    2011-03-01

    Full Text Available La rana arborícola mexicana Smilisca baudinii, es una especie de rana común en Centroamérica. Sin embargo, la biología y genética de la especie, es pobremente conocida a pesar de su importancia para mantener en equilibrio ecológico las selvas tropicales. Con el propósito de contribuir con el conocimiento biológico de esta especie, establecimos el cariotipo típico en meiosis en especímenes recolectados en Tabasco, México, mediante procedimientos citogenéticos estándares. El estudio, se fundamentó en el análisis de 131 dispersiones cromosómicas en estadio meiótico de dos adultos de la especie (una hembra y un macho. El análisis de las metafases, permitió establecer el número modal haploide de 1n=12 cromosomas bivalentes. La fórmula cromosómica del cariotipo haploide, se integró por 12 cromosomas birrámeos caracterizado por 12 pares de cromosomas bivalentes metacéntricos-submetacéntricos (msm. Los conteos en meiosis, hacen suponer como número diploide de cromosomas a un complemento integrado por 2n=24 cromosomas birrámeos. No fue posible observar presencia de cromosomas sexuales, entre las dispersiones meióticas del espécimen hembra y macho. Los resultados sugieren que la estructura cromosómica de S. baudinii, es compartida ampliamente entre las especies de la familia Hylidae y los cromosomas "B" son estructuras importantes en la diversificación de las especies.Meiotic chromosomes of the tree frog Smilisca baudinii (Anura: Hylidae. The Mexican tree frog Smilisca baudinii, is a very common frog in Central America. In spite their importance to keep the ecological equilibrium of the rainforest, its biology and genetics are poorly known. In order to contribute with its biological knowledge, we described the typical meiotic karyotype based in standard cytogenetic protocols to specimens collected in Tabasco, Mexico. The study was centered in the analysis of 131 chromosome spreads at meiotic stage from two adults of the

  13. A simplified molecular method for distinguishing among species and ploidy levels in European water frogs (Pelophylax).

    Science.gov (United States)

    Hauswaldt, J Susanne; Höer, Manuela; Ogielska, Maria; Christiansen, Ditte G; Dziewulska-Szwajkowska, Daria; Czernicka, Elżbieta; Vences, Miguel

    2012-09-01

    Western Palearctic water frogs in the genus Pelophylax are a set of morphologically similar anuran species that form hybridogenetic complexes. Fully reliable identification of species and especially of hybrid ploidy depends on karyological and molecular methods. In central Europe, native water frog populations consist of the Pelophylax esculentus complex, that is, P. lessonae (LL), P. ridibundus (RR) and the hybrid form P. esculentus that can have different karyotypes (RL, LLR and RRL). We developed existing molecular methods further and propose a simple PCR method based on size-differences in the length of the serum albumin intron-1 and the RanaCR1, a non-LTR retrotransposon of the chicken repeat (CR) family. This PCR yields taxon-specific banding patterns that can easily be screened by standard agarose gel electrophoresis and correctly identify species in all of the 160 samples that had been identified to karyotype with other methods. To distinguish ploidy levels in LR, LLR and RRL specimens, we used the ratio of the peak heights of the larger (ridibundus specific) to the smaller (lessonae specific) bands of fluorescently labelled PCR products resolved on a capillary DNA sequencer and obtained a correct assignment of the karyotype in 93% of cases. Our new method will cut down time and expenses drastically for a reliable identification of water frogs of the P. esculentus complex and potentially for identification of other hybridogenetic complexes and/or taxa, and it even serves as a good indicator of the ploidy status of hybrid individuals.

  14. In vivo muscle force and muscle power during near-maximal frog jumps.

    Science.gov (United States)

    Moo, Eng Kuan; Peterson, Daniel R; Leonard, Timothy R; Kaya, Motoshi; Herzog, Walter

    2017-01-01

    Frogs' outstanding jumping ability has been associated with a high power output from the leg extensor muscles. Two main theories have emerged to explain the high power output of the frog leg extensor muscles, either (i) the contractile conditions of all leg extensor muscles are optimized in terms of muscle length and speed of shortening, or (ii) maximal power is achieved through a dynamic catch mechanism that uncouples fibre shortening from the corresponding muscle-tendon unit shortening. As in vivo instantaneous power generation in frog hind limb muscles during jumping has never been measured directly, it is hard to distinguish between the two theories. In this study, we determined the instantaneous variable power output of the plantaris longus (PL) of Lithobates pipiens (also known as Rana pipiens), by directly measuring the in vivo force, length change, and speed of muscle and fibre shortening in near maximal jumps. Fifteen near maximal jumps (> 50cm in horizontal distance) were analyzed. High instantaneous peak power in PL (536 ± 47 W/kg) was achieved by optimizing the contractile conditions in terms of the force-length but not the force-velocity relationship, and by a dynamic catch mechanism that decouples fascicle shortening from muscle-tendon unit shortening. We also found that the extra-muscular free tendon likely amplifies the peak power output of the PL by modulating fascicle shortening length and shortening velocity for optimum power output, but not by releasing stored energy through recoiling as the tendon only started recoiling after peak PL power had been achieved.

  15. The pathogen Batrachochytrium dendrobatidis disturbs the frog skin microbiome during a natural epidemic and experimental infection.

    Science.gov (United States)

    Jani, Andrea J; Briggs, Cheryl J

    2014-11-25

    Symbiotic microbial communities may interact with infectious pathogens sharing a common host. The microbiome may limit pathogen infection or, conversely, an invading pathogen can disturb the microbiome. Documentation of such relationships during naturally occurring disease outbreaks is rare, and identifying causal links from field observations is difficult. This study documented the effects of an amphibian skin pathogen of global conservation concern [the chytrid fungus Batrachochytrium dendrobatidis (Bd)] on the skin-associated bacterial microbiome of the endangered frog, Rana sierrae, using a combination of population surveys and laboratory experiments. We examined covariation of pathogen infection and bacterial microbiome composition in wild frogs, demonstrating a strong and consistent correlation between Bd infection load and bacterial community composition in multiple R. sierrae populations. Despite the correlation between Bd infection load and bacterial community composition, we observed 100% mortality of postmetamorphic frogs during a Bd epizootic, suggesting that the relationship between Bd and bacterial communities was not linked to variation in resistance to mortal disease and that Bd infection altered bacterial communities. In a controlled experiment, Bd infection significantly altered the R. sierrae microbiome, demonstrating a causal relationship. The response of microbial communities to Bd infection was remarkably consistent: Several bacterial taxa showed the same response to Bd infection across multiple field populations and the laboratory experiment, indicating a somewhat predictable interaction between Bd and the microbiome. The laboratory experiment demonstrates that Bd infection causes changes to amphibian skin bacterial communities, whereas the laboratory and field results together strongly support Bd disturbance as a driver of bacterial community change during natural disease dynamics.

  16. Hypothalamus-pituitary axis: an obligatory target for endocannabinoids to inhibit steroidogenesis in frog testis.

    Science.gov (United States)

    Chianese, Rosanna; Ciaramella, Vincenza; Fasano, Silvia; Pierantoni, Riccardo; Meccariello, Rosaria

    2014-09-01

    Endocannabinoids - primarily anandamide (AEA) and 2-arachidonoylglycerol (2-AG) - are lipophilic molecules that bind to cannabinoid receptors (CB1 and CB2). They affect neuroendocrine activity inhibiting gonadotropin releasing hormone (GnRH) secretion and testosterone production in rodents, through a molecular mechanism supposed to be hypothalamus dependent. In order to investigate such a role, we choose the seasonal breeder, the anuran amphibian Rana esculenta, an experimental model in which components of the endocannabinoid system have been characterized. In February, at the onset of a new spermatogenetic wave, we carried out in vitro incubations of frog testis with AEA, at 10(-9)M dose. Such a treatment had no effect on the expression of cytochrome P450 17alpha hydroxylase/17,20 lyase (cyp17) nor 3-β-hydroxysteroid dehydrogenase/Δ-5-4 isomerase (3β-HSD), key enzymes of steroidogenesis. To understand whether or not the functionality of the hypothalamus-pituitary axis could be essential to support the role of endocannabinoids in steroidogenesis, frogs were injected with AEA, at 10(-8)M dose. Differently from in vitro experiment, the in vivo administration of AEA reduced the expression of cyp17 and 3β-HSD. Whereas the effect on 3β-HSD was counteracted by SR141716A (Rimonabant) - a selective antagonist of CB1, thus indicating a CB1 dependent modulation - the effect on cyp17 was not, suggesting a possible involvement of receptors other than CB1, probably the type-1 vanilloid receptor (TRPV1), since AEA works as an endocannabinoid and an endovanilloid as well. In conclusion our results indicate that endocannabinoids, via CB1, inhibit the expression of 3β-HSD in frog testis travelling along the hypothalamus-pituitary axis.

  17. Care and feeding of frogs

    CERN Document Server

    Pan, Margaret; 10.1088/0004-6256/143/1/9

    2012-01-01

    "Propellers" are features in Saturn's A ring associated with moonlets that open partial gaps. They exhibit non-Keplerian motion (Tiscareno 2010); the longitude residuals of the best-observed propeller, "Bl\\'eriot," appear consistent with a sinusoid of period ~4 years. Pan and Chiang (2010) proposed that propeller moonlets librate in "frog resonances" with co-orbiting ring material. By analogy with the restricted three-body problem, they treated the co-orbital material as stationary in the rotating frame and neglected non-co-orbital material. Here we use simple numerical experiments to extend the frog model, including feedback due to the gap's motion, and drag associated with the Lindblad disk torques that cause Type I migration. Because the moonlet creates the gap, we expect the gap centroid to track the moonlet, but only after a time delay t_diff, the time for a ring particle to travel from conjunction with the moonlet to the end of the gap. We find that frog librations can persist only if t_diff exceeds the...

  18. Light-dependent magnetic compass in Iberian green frog tadpoles

    Science.gov (United States)

    Diego-Rasilla, Francisco Javier; Luengo, Rosa Milagros; Phillips, John B.

    2010-12-01

    Here, we provide evidence for a wavelength-dependent effect of light on magnetic compass orientation in Pelophylax perezi (order Anura), similar to that observed in Rana catesbeiana (order Anura) and Notophthalmus viridescens (order Urodela), and confirm for the first time in an anuran amphibian that a 90° shift in the direction of magnetic compass orientation under long-wavelength light (≥500 nm) is due to a direct effect of light on the underlying magnetoreception mechanism. Although magnetic compass orientation in other animals (e.g., birds and some insects) has been shown to be influenced by the wavelength and/or intensity of light, these two amphibian orders are the only taxa for which there is direct evidence that the magnetic compass is light-dependent. The remarkable similarities in the light-dependent magnetic compasses of anurans and urodeles, which have evolved as separate clades for at least 250 million years, suggest that the light-dependent magnetoreception mechanism is likely to have evolved in the common ancestor of the Lissamphibia (Early Permian, ~294 million years) and, possibly, much earlier. Also, we discuss a number of similarities between the functional properties of the light-dependent magnetic compass in amphibians and blue light-dependent responses to magnetic stimuli in Drosophila melanogaster, which suggest that the wavelength-dependent 90° shift in amphibians may be due to light activation of different redox forms of a cryptochrome photopigment. Finally, we relate these findings to earlier studies showing that the pineal organ of newts is the site of the light-dependent magnetic compass and recent neurophysiological evidence showing magnetic field sensitivity in the frog frontal organ (an outgrowth of the pineal).

  19. S1 satellite DNA repetitive units display identical structure and overall variability in all Anatolian brown frog taxa.

    Science.gov (United States)

    Picariello, Orfeo; Feliciello, Isidoro; Chinali, Gianni

    2016-02-01

    S1 satellite DNA from Palearctic brown frogs has a species-specific structure in all European species. We characterized S1 satellite DNA from the Anatolian brown frogs Rana macrocnemis, R. camerani, and R. holtzi in order to define their taxonomic rank and the structure of this satellite in this frog lineage. Southern blots of genomic DNA digested with KpnI, EcoRV, NdeI, NheI, or StuI produced the same pattern of satellite DNA bands. Moreover, quantitative dot blots showed that this satellite DNA accounts for 0.1 % of the genome in all taxa. Analysis of the overall genomic variability of the S1a repeat sequence in specimens from various populations demonstrated that this repetitive unit also has the same size (476 bp), the same most common sequence (MCS) and the same overall variability in all three taxa, and also in R. macrocnemis tavasensis. The S1a repetitive unit presents three deletions of 9, 8 and 1 bp compared to the 494-bp S1a repeat from European frogs. The S1a MCS has three variable positions (sequence WWTK in positions 183-186), due to the presence of two repeat subpopulations with motifs AATG and WWTT in all taxa. Unlike previously analyzed mitochondrial and nuclear sequences that show considerable variations among these taxa, no difference could be detected in the structure and variability of the S1 satellite repetitive units. This suggests that these taxa should belong to a single species. Our results indicate that this satellite DNA variety probably formed when the Anatolian lineage radiated from common ancestor about 4 mya, and since then has maintained its structure in all four taxa examined.

  20. FROG INTESTINAL PERFUSION TO EVALUATE DRUG PERMEABILITY: APPLICATION TO P-gp AND CYP3A4 SUBSTRATES

    Directory of Open Access Journals (Sweden)

    Neelima eYerasi

    2015-07-01

    Full Text Available AbstractTo evaluate the reliability of using in situ frog intestinal perfusion technique for permeability assessment of carrier transported drugs which are also substrates for CYP enzymes. Single Pass Intestinal Perfusion (SPIP studies were performed in frogs of the species Rana tigrina using established method for rats with some modifications after inducing anesthesia. Effective permeability coefficient (Peff of losartan and midazolam was calculated in the presence and absence of inhibitors using the parallel-tube model. Peff of losartan when perfused alone was found to be 0.427 ± 0.27×10-4cm/s and when it was co-perfused with inhibitors, significant change in Peff was observed. Peff of midazolam when perfused alone was found to be 2.03 ± 0.07 × 10-4cm/s and when it was co-perfused with inhibitors, no significant change in Peff was observed. Comparison of Peff calculated in frog with that of other available models and also humans suggested that the Peff values are comparable and reflected well with human intestinal permeability. It is possible to determine the Peff value for compounds which are dual substrates of P-gp and CYP3A4 using in situ frog intestinal perfusion technique. The calculated Peff values correlated well with reported Peff values of probe drugs. comparison of the Peff value of losartan obtained with that of reported human’s Peff and Caco 2 cell data, and comparison of the Peff value of midazolam with that of reported rat’s Peff, we could conclude that SPIP from model can be reliably used in preclinical studies for permeability estimation. This model may represent a valuable alternative to the low speed and high cost of conventional animal models (typically rodents for the assessment of intestinal permeability.

  1. Selection, trans-species polymorphism, and locus identification of major histocompatibility complex class IIβ alleles of New World ranid frogs

    Science.gov (United States)

    Kiemnec-Tyburczy, Karen M.; Richmond, Jonathan Q.; Savage, Anna E.; Zamudio, Kelly R.

    2010-01-01

    Genes encoded by the major histocompatibility complex (MHC) play key roles in the vertebrate immune system. However, our understanding of the evolutionary processes and underlying genetic mechanisms shaping these genes is limited in many taxa, including amphibians, a group currently impacted by emerging infectious diseases. To further elucidate the evolution of the MHC in frogs (anurans) and develop tools for population genetics, we surveyed allelic diversity of the MHC class II ??1 domain in both genomic and complementary DNA of seven New World species in the genus Rana (Lithobates). To assign locus affiliation to our alleles, we used a "gene walking" technique to obtain intron 2 sequences that flanked MHC class II?? exon 2. Two distinct intron sequences were recovered, suggesting the presence of at least two class II?? loci in Rana. We designed a primer pair that successfully amplified an orthologous locus from all seven Rana species. In total, we recovered 13 alleles and documented trans-species polymorphism for four of the alleles. We also found quantitative evidence of selection acting on amino acid residues that are putatively involved in peptide binding and structural stability of the ??1 domain of anurans. Our results indicated that primer mismatch can result in polymerase chain reaction (PCR) bias, which influences the number of alleles that are recovered. Using a single locus may minimize PCR bias caused by primer mismatch, and the gene walking technique was an effective approach for generating single-copy orthologous markers necessary for future studies of MHC allelic variation in natural amphibian populations. ?? 2010 Springer-Verlag.

  2. Incongruence in the pattern and timing of intra-specific diversification in bronze frogs and bullfrogs (Ranidae).

    Science.gov (United States)

    Austin, James D; Zamudio, Kelly R

    2008-09-01

    We compare patterns of lineage divergence in mitochondrial DNA (mtDNA) sequences of two protein-encoding mitochondrial genes (cyt b and ND2) in two ecologically similar, co-distributed, and closely related ranid frogs (Rana clamitans and Rana catesbeiana), that are geographically widespread, and frequently syntopic. We identified three lineages in R. clamitans, separated by 0.5% to 2.1% net corrected sequence divergence, comparable to two R. catesbeiana lineages separated by 0.6%. The geographic pattern of lineage distribution differed notably between the two species. In R. clamitans, we found a Coastal Plain-Appalachian (CPA) lineage restricted to south and east of the Appalachian Mountains and a widespread lineage that encompassing nearly all the sampled range. A third distinct and divergent lineage was detected in one location in the southwest portion of the range (Louisiana). This pattern contrasts with the east-west pattern in R. catesbeiana, and reflects possible differences in refugial dynamics and patterns of range expansion. Although both species have undergone range expansion and population growth, coalescent reconstruction of N(e) reflects larger lineages but more recent divergence in R. clamitans relative to R. catesbeiana, reflecting significant differences in population history or divergent patterns of molecular evolution at mtDNA.

  3. The Ups and Downs of Frogs.

    Science.gov (United States)

    Greene, Janice Schnake; Tamme, Tina

    2001-01-01

    Presents a science activity in which students simulate increases and decreases in frog populations to get a better understanding of different environmental issues affecting animal populations. Includes simulations for both natural frog populations as well as populations affected by human activities. (YDS)

  4. Semi-automated identification of leopard frogs

    Science.gov (United States)

    Petrovska-Delacrétaz, Dijana; Edwards, Aaron; Chiasson, John; Chollet, Gérard; Pilliod, David S.

    2014-01-01

    Principal component analysis is used to implement a semi-automatic recognition system to identify recaptured northern leopard frogs (Lithobates pipiens). Results of both open set and closed set experiments are given. The presented algorithm is shown to provide accurate identification of 209 individual leopard frogs from a total set of 1386 images.

  5. The Ups and Downs of Frogs.

    Science.gov (United States)

    Greene, Janice Schnake; Tamme, Tina

    2001-01-01

    Presents a science activity in which students simulate increases and decreases in frog populations to get a better understanding of different environmental issues affecting animal populations. Includes simulations for both natural frog populations as well as populations affected by human activities. (YDS)

  6. A comparative analysis of frog early development.

    Science.gov (United States)

    del Pino, Eugenia M; Venegas-Ferrín, Michael; Romero-Carvajal, Andrés; Montenegro-Larrea, Paola; Sáenz-Ponce, Natalia; Moya, Iván M; Alarcón, Ingrid; Sudou, Norihiro; Yamamoto, Shinji; Taira, Masanori

    2007-07-17

    The current understanding of Xenopus laevis development provides a comparative background for the analysis of frog developmental modes. Our analysis of development in various frogs reveals that the mode of gastrulation is associated with developmental rate and is unrelated to egg size. In the gastrula of the rapidly developing embryos of the foam-nesting frogs Engystomops coloradorum and Engystomops randi, archenteron and notochord elongation overlapped with involution at the blastopore lip, as in X. laevis embryos. In embryos of dendrobatid frogs and in the frog without tadpoles Eleutherodactylus coqui, which develop somewhat more slowly than X. laevis, involution and archenteron elongation concomitantly occurred during gastrulation; whereas elongation of the notochord and, therefore, dorsal convergence and extension, occurred in the postgastrula. In contrast, in the slow developing embryos of the marsupial frog Gastrotheca riobambae, only involution occurred during gastrulation. The processes of archenteron and notochord elongation and convergence and extension were postgastrulation events. We produced an Ab against the homeodomain protein Lim1 from X. laevis as a tool for the comparative analysis of development. By the expression of Lim1, we were able to identify the dorsal side of the G. riobambae early gastrula, which otherwise was difficult to detect. Moreover, the Lim1 expression in the dorsal lip of the blastopore and notochord differed among the studied frogs, indicating variation in the timing of developmental events. The variation encountered gives evidence of the modular character of frog gastrulation.

  7. Efectivos poblacionales de la Rana ágil (Rana dalmatina y uso del hábitat reproductor en Navarra

    Directory of Open Access Journals (Sweden)

    GOSA, Alberto

    2002-01-01

    Full Text Available La población navarra de Rana dalmatina se encuentra fragmentada en 4 núcleos incomunicados, con baja disponibilidad de humedales para la reproducción (entre 2 y 15 por área. La población de hembras adultas fluctúa anualmente entre 1000 y 1500 individuos, sin considerar de la La Barranca, todavía no investigada. La conservación de la especie depende de la gestión de las zonas húmedas.

  8. 77 FR 53221 - Santa Clara Valley Habitat Conservation Plan/Natural Community Conservation Plan, Environmental...

    Science.gov (United States)

    2012-08-31

    ...) (Ambystoma californiense), threatened California red-legged frog (Rana draytonii), endangered least Bell's... the foothill yellow-legged frog (Rana boylii), western pond turtle (Clemmys marmorata),...

  9. Sound and vibration sensitivity of VIIIth nerve fibers in the grassfrog, Rana temporaria.

    Science.gov (United States)

    Christensen-Dalsgaard, J; Jørgensen, M B

    1996-10-01

    We have studied the sound and vibration sensitivity of 164 amphibian papilla fibers in the VIIIth nerve of the grassfrog, Rana temporaria. The VIIIth nerve was exposed using a dorsal approach. The frogs were placed in a natural sitting posture and stimulated by free-field sound. Furthermore, the animals were stimulated with dorso-ventral vibrations, and the sound-induced vertical vibrations in the setup could be canceled by emitting vibrations in antiphase from the vibration exciter. All low-frequency fibers responded to both sound and vibration with sound thresholds from 23 dB SPL and vibration thresholds from 0.02 cm/s2. The sound and vibration sensitivity was compared for each fiber using the offset between the rate-level curves for sound and vibration stimulation as a measure of relative vibration sensitivity. When measured in this way relative vibration sensitivity decreases with frequency from 42 dB at 100 Hz to 25 dB at 400 Hz. Since sound thresholds decrease from 72 dB SPL at 100 Hz to 50 dB SPL at 400 Hz the decrease in relative vibration sensitivity reflects an increase in sound sensitivity with frequency, probably due to enhanced tympanic sensitivity at higher frequencies. In contrast, absolute vibration sensitivity is constant in most of the frequency range studied. Only small effects result from the cancellation of sound-induced vibrations. The reason for this probably is that the maximal induced vibrations in the present setup are 6-10 dB below the fibers' vibration threshold at the threshold for sound. However, these results are only valid for the present physical configuration of the setup and the high vibration-sensitivities of the fibers warrant caution whenever the auditory fibers are stimulated with free-field sound. Thus, the experiments suggest that the low-frequency sound sensitivity is not caused by sound-induced vertical vibrations. Instead, the low-frequency sound sensitivity is either tympanic or mediated through bone conduction or sound

  10. Evaluation of the effects of titanium dioxide nanoparticles on cultured Rana catesbeiana tailfin tissue

    Directory of Open Access Journals (Sweden)

    S. Austin eHammond

    2013-11-01

    Full Text Available Nanoparticles (NPs, materials that have one dimension less than 100 nm, are used in manufacturing, health and food products, and consumer products including cosmetics, clothing and household appliances. Their utility to industry is derived from their high surface-area-to-volume ratios and physico-chemical properties distinct from their bulk counterparts, but the near-certainty that NPs will be released into the environment raises the possibility that they could present health risks to humans and wildlife. The thyroid hormones (THs, thyroxine and 3,3’,5-triiodothyronine (T3, are involved in development and metabolism in vertebrates including humans and frogs. Many of the processes of anuran metamorphosis are analogous to human post-embryonic development and disruption of TH action can have drastic effects. These shared features make the metamorphosis of anurans an excellent model for screening for endocrine disrupting chemicals (EDCs. We used the cultured tailfin (C-fin assay to examine the exposure effects of 0.1-10 nM (~8-800 ng/L of three types of ~20 nm TiO2 NPs (P25, M212, M262 and micron-sized TiO2 (μTiO2 ±10 nM T3. The actual Ti levels were 40.9 – 64.7% of the nominal value. Real-time quantitative polymerase chain reaction (QPCR was used to measure the relative amounts of mRNA transcripts encoding TH-responsive thyroid hormone receptors (thra and thrb and Rana larval keratin type I (rlk1, as well as the cellular stress-responsive heat shock protein 30 kDa (hsp30, superoxide dismutase (sod, and catalase (cat. The levels of the TH-responsive transcripts were largely unaffected by any form of TiO2. Some significant effects on stress-related transcripts were observed upon exposure to micron-sized TiO2, P25 and M212 while no effect was observed with M262 exposure. Therefore the risk of adversely affecting amphibian tissue by disrupting TH-signalling or inducing cellular stress is low for these compounds relative to other previously

  11. Toxicity of the conventional energetics TNT and RDX relative to new insensitive munitions constituents DNAN and NTO in Rana pipiens tadpoles.

    Science.gov (United States)

    Stanley, Jacob K; Lotufo, Guilherme R; Biedenbach, James M; Chappell, Pornsawan; Gust, Kurt A

    2015-04-01

    An initiative within the US military is targeting the replacement of traditional munitions constituents with insensitive munitions to reduce risk of accidental detonation. The purpose of the present study was to comparatively assess toxicity of the traditional munitions constituents 2,4,6-trinitrotoluene (TNT) and 1,3,5-trinitroperhydro-1,3,5-triazine (RDX) with the new insensitive munitions constituents 2,4-dinitroanisole (DNAN) and 3-nitro-1,2,4-triazol-5-one (NTO). The following exposure durations were performed with Rana pipiens (leopard frog) tadpoles: TNT and DNAN, 96 h and 28 d; RDX, 10 d and 28 d; NTO, 28 d. The 96-h 50% lethal concentration (LC50) values and 95% confidence intervals for TNT and DNAN were 4.4 mg/L (4.2 mg/L, 4. 7 mg/L) and 24.3 mg/L (21.3 mg/L, 27.6 mg/L), respectively. No significant impacts on survival were observed in the 10-d exposure to RDX up to 25.3 mg/L. Effects on tadpole swimming distance were observed with a lowest-observed-effect concentration (LOEC) of 5.9 mg/L RDX. In the 28-d exposures, the LOECs for survival for TNT, DNAN, and NTO were 0.003 mg/L, 2.4 mg/L, and 5.0 mg/L, respectively. No significant mortality was observed in the RDX chronic 28-d exposure up to the highest treatment level tested of 28.0 mg/L. Neither tadpole developmental stage nor growth was significantly affected in any of the 28-d exposures. Rana pipiens were very sensitive to chronic TNT exposure, with an LOEC 3 orders of magnitude lower than those for insensitive munitions constituents DNAN and NTO.

  12. Population density of tropical forest frogs: relation to retreat sites.

    Science.gov (United States)

    Stewart, M M; Pough, F H

    1983-08-05

    The forest frog Eleutherodactylus coqui defends specific sites for retreats and nests in the Luquillo Forest, Puerto Rico. The hypothesis that shortages of nest and retreat sites limit population size was tested by placing 100 bamboo frog houses in plots measuring 100 square meters in areas of high frog density. These new sites were readily adopted by adult frogs. After one year, experimental plots had significantly more nests and frogs of all sizes than did control plots.

  13. Infestation of Wild-caught American Bullfrogs (Rana catesbeiana) by Multiple Species of Metazoan Parasites

    National Research Council Canada - National Science Library

    Lemke, Laura B; Dronen, Norman; Fox, James G; Nambiar, Prashant R

    2008-01-01

    The American bullfrog (Rana catesbeiana) is an aquatic, carnivorous member of the family Ranidae that is used extensively in physiology education programs and in various physiology, toxicology, sensorineural, and genetics research...

  14. PARTIAL LIFE-CYCLE TOXICITY AND BIOCONCENTRATION MODELLING OF PERFLUOROOCTANE SULFONATE (PFOS) IN THE NORTHERN LEOPARD FROG (RANA PIPIENS)

    Science.gov (United States)

    A number of recent monitoring studies have demonstrated elevated concentrations of perfluorooctane sulfonate (PFOS) in humans and wildlife throughout the world. Although no longer manufactured in the U.S., the global distribution and relative persistence of PFOS indicates a need ...

  15. Effect of cadmium on the spermatogenesis of Rana hexadactyla Lesson.

    Science.gov (United States)

    Kasinathan, S; Veeraraghavan, K; Ramakrishnan, S

    1987-01-01

    A single subcutaneous injection of 0.5 mg cadmium chloride in Amphibian Ringer solution caused a significant decrease in secondary spermatogonial and primary spermatocytic stages in the semineferous tubules of frogs in 7 days. B3 cells of adenohypophysis and the activities of delta 5-3 beta-hydroxy steroid dehydrogenase and 17 beta-dehydrogenase in the Leydig cells were significantly increased in the same period. There were no significant changes in 3 days.

  16. Population status and population genetics of northern leopard frogs in Arizona

    Science.gov (United States)

    Theimer, Tad C.; Drost, Charles A.; O'Donnell, Ryan P.; Mock, Karen E.

    2011-01-01

    Increasing isolation of populations by habitat fragmentation threatens the persistence of many species, both from stochastic loss of small isolated populations, and from inbreeding effects in populations that have become genetically isolated. In the southwestern United States, amphibian habitat is naturally patchy in occurrence because of the prevailing aridity of the region. Streams, rivers, and other wetlands are important both as habitat and as corridors that connect populations. However, populations of some species have become more fragmented and isolated by habitat degradation and loss. Northern leopard frogs (Rana pipiens) have experienced serious declines in the Southwest. We conducted an extensive survey across the known range of northern leopard frogs in Arizona to determine the current distribution and abundance of the species. From a range that once spanned much of the northern and central part of the State, northern leopard frogs have been reduced to three or four widely separated populations, near Lyman Lake in east-central Arizona, in the Stoneman Lake area south of Flagstaff, along Truxton Wash near Peach Springs, and a population of uncertain extent on Navajo Nation lands. The Lyman Lake and Truxton Wash populations are small and extremely isolated. The Stoneman Lake population, however, is an extensive metapopulation spread across several stream drainages, including numerous ponds, wetlands, and artificial tanks. This is the only population in Arizona that is increasing in extent and numbers, but there is concern about the apparent introduction of nonnative genetic stock from eastern North America into this area. We analyzed genetic diversity within and genetic divergence among populations of northern leopard frogs, across both extant and recently extirpated populations in Arizona. We also analyzed mitochondrial DNA to place these populations into a larger phylogenetic framework and to determine whether any populations contained genetic material

  17. Lbx1 expression and frog limb development.

    Science.gov (United States)

    Sabo, Michelle C; Nath, Kimberly; Elinson, Richard P

    2009-12-01

    In order to identify prospective limb muscle cells in a frog, we cloned Lbx1 from the direct developing frog Eleutherodactylus coqui. Like in embryos of the frog Xenopus laevis but unlike in other vertebrates, EcLbx1 is expressed in all trunk somites. Like in embryos of chick, mouse, and zebrafish, cells expressing EcLbx1 are then found in limb buds, consistent with migration of those cells from somites. EcLbx1 is also expressed in the dorsal spinal cord as in other vertebrates.

  18. Levels of sparganum infections and phylogenetic analysis of the tapeworm Spirometra erinaceieuropaei sparganum in wild frogs from Henan Province in central China.

    Science.gov (United States)

    Wei, T; Zhang, X; Cui, J; Liu, L N; Jiang, P; Wang, Z Q

    2015-07-01

    Sparganosis is a serious food-borne parasitic zoonosis caused by infection with Spirometra spargana. The prevalence of sparganum infection in wild frogs (Rana nigromaculata, R. limmochari, R. temporaria and Bufo gargarizans) was investigated in Henan Province of central China during 2008-2012. Of 3482 caught wild frogs, 565 (16.23%) were found to be infected with plerocercoids (spargana) of the genus Spirometra. Spargana were found in 14.85% (320/2155) of R. nigromaculata, 20.82% (233/1119) of R. limmochari and 10.91% (12/110) of R. temporaria frogs. However, no sparganum was found in B. gargarizans. To investigate the phylogenetic position of collected spargana, three mitochondrial DNA (mtDNA) regions, namely cytochrome c oxidase subunits 1 and 3 (cox1 and cox3), and NADH dehydrogenase subunit 4 (nad4), were amplified, sequenced and analysed. Sequences of cox1, cox3 and pnad4 were 417, 390 and 578 bp in length, respectively. The base composition of cox1, cox3 and pnad4 were generally AT rich with a mean of 63.5%, 68.3% and 67% AT, respectively. Phylogenetic analysis showed that all the sparganum isolates in Henan Province represented Spirometra erinaceieuropaei and were a well-supported clade. These findings demonstrated clearly the usefulness of the three mtDNA sequences for molecular identification and population genetics studies of S. erinaceieuropaei spargana of human and animal health significance.

  19. Inventory of the pool frog, newt and gulyxne in Forsmark 2012; Inventering av goelgroda, stoerre vattensalamander och gulyxne i Forsmark 2012

    Energy Technology Data Exchange (ETDEWEB)

    Collinder, Per [Ekologigruppen AB, Stockholm (Sweden)

    2013-01-15

    On assignment from the Swedish Nuclear Fuel and Waste Management Co (SKB), Ekologigruppen AB carried out inventories of species populations during the summer of 2012. Species included in the study are described in three separate chapters of this report. The three species were pool frog Rana lessonae, great crested newt Triturus cristatus, and fen orchid Liparis loeselii. SKB will follow up the development of the local populations. Inventory of pool frogs are already a follow-up on a study carried out in 2011. Concern for these species is due to their protection within the EU system of species and habitat protection. Construction of the planned depository for used nuclear fuel will involve redirection of groundwater, which could potentially drain these wetlands. The three species pool frog, great crested newt and fen orchid are inventoried by well-documented procedures, which will allow repletion of the study at the same locals and according to the same methods during consequent years. The inventories are not complete in the sense that they would give number of individuals in a local population. Rather, the result should be regarded as an index for comparison and monitoring.

  20. Effect of mono-ortho and di-ortho substituted polychlorinated biphenyl (PCB) congeners on leopard frog survival and sexual development.

    Science.gov (United States)

    Jofré, Mariana Beatriz; Karasov, William H

    2008-02-01

    We tested the effect of mono-ortho and di-ortho PCB congeners on northern leopard frog (Rana pipiens) hatching success, survival and sexual development. Embryos and tadpoles were exposed to two levels (0.5 and 50 microg/l) of two PCBs. PCBs 101 and 70 were selected because they were present in amphibians collected in the Fox River-Green Bay ecosystem and they have the theoretical structural requirements to be able to bind to the estrogen receptor and mediate estrogenic responses. The exposure of leopard frog embryos and tadpoles to PCB 70 and 101 did not significantly affect hatchability, survival, deformities or growth. There were significant departures from the expected 50:50 sex ratio in tadpoles/froglets exposed to PCB 101 and PCB 70. In all the cases of significant departure, the bias was towards higher number of females. Decrease in the proportion of male gonads and increase in the proportion of intersex gonads were observed with increasing PCB tissue concentrations. The effects of PCB congeners on sexual differentiation occur at concentrations higher than observed in frogs in the Fox River/Green Bay ecosystem.

  1. Turning population trend monitoring into active conservation: Can we save the cascades frog (Rang cascadae) in the Lassen Region of California?

    Science.gov (United States)

    Fellers, G.M.; Pope, K.L.; Stead, J.E.; Koo, M.S.; Welsh, W.H.

    2008-01-01

    Monitoring the distribution, population size, and trends of declining species is necessary to evaluate their vulnerability to extinction. It is the responsibility of scientists to alert management professionals of the need for preemptive action if a species approaches imminent, regional extirpation. This is the case with Rana cascadae (Cascades Frog) populations near Lassen Peak From 1993 to 2007, we conducted 1,873 amphibian surveys at 856 sites within Lassen Volcanic National Park and Lassen National Forest, California, USA. These surveys encompassed all R. cascadae habitats: ponds, lakes, meadows, and streams on those lands. We found frogs at only six sites during 14 years of surveys, and obtained one report of a single frog at one additional locality. These sites represented 12 years. Causes for the decline remain unclear, but introduced trout, disease, and pesticides are likely factors. We recommend that (1) additional protection for R. cascadae within 50 km of Lassen Peak; (2) investigation of the genetics of R. cascadae in California; (3) research into the role of possible causative factors in these declines; and (4) implementation of a feasibility study to captive breed and reintroduce R. cascadae in the Lassen area. Copyright ?? 2008. Gary Fellers. All rights reserved.

  2. Features of the karyotypes of Pelophylax ridibundus Pallas, 1771 and Rana macrocnemis Boulenger, 1885 (Amphibia: Ranidae from Armenia

    Directory of Open Access Journals (Sweden)

    A Martirosyan

    2009-08-01

    Full Text Available Сhromosomal complements of Pelophylax ridibundus Pallas, 1771 from 9 localities (Northern, Central and South Armenia and Rana macrocnemis Boulenger, 1885 from one locality (North-West Armenia have been analyzed. The chromosome sets of P. ridibundus collected from 8 localities showed 2n=26, (10m+12sm+4st; NF=52. A secondary constriction has been observed in all studied individuals on the 10-th chromosome pair showing NOR-positive reaction. C-positive heterochromatin blocks have been observed on long arms of the 2-nd and 10-th pairs of chromosomes (7 localities. In addition, C-heterochromatin blocks have been found on interstitial regions of short arms of the 12-th pairs, as well as in telomeric regions of long arms of the 9-th pairs and on short arms of the 5-th pair in the frogs from 2 localities. The karyotype of P. ridibundus from populations near Ejmiatsin differs from other populations (2n=26, 12m+10sm+4st. Diploid number of chromosomes of R. macrocnemis was also 26 (8m+12sm+6st, NF=52. Blocks of C-positive heterochromatin have been revealed in telomeric parts of the 1-st, 2-nd (p, 3-rd (q, 4-th (q, 6-th, 9-th (p, 10-th (p,q and 13-th (q pairs, as well as in interstitial regions of the 1-st and 2-nd pairs of chromosomes.  Intrapopulation and interpopulation geographic variations of karyotypes and C-heterochromatin banding patterns of P. ridibundus have been revealed. Karyotypically, morphotypes “macrocnemis” and “camerani” are closely related.

  3. Stomach contents from invasive American bullfrogs Rana catesbeiana (= Lithobates catesbeianus on southern Vancouver Island, British Columbia, Canada

    Directory of Open Access Journals (Sweden)

    Kevin Jancowski

    2013-03-01

    Full Text Available Invasive alien American bullfrog populations are commonly identified as a pernicious influence on the survival of native species due to their adaptability, proliferation and consequent ecological impacts through competition and predation. However, it has been difficult to determine conclusively their destructive influence due to the fragmentary and geographically dispersed nature of the historical database. An expanding meta-population of invasive American bullfrogs, Rana catesbeiana (= Lithobates catesbeianus, became established on southern Vancouver Island, British Columbia, Canada in the mid- to late 1980s. An on-going bullfrog control program begun in 2006 offered a unique opportunity to examine the stomach contents removed from 5,075 adult and juvenile bullfrogs collected from 60 sites throughout the active season (April to October. Of 15 classes of organisms identified in the diet, insects were numerically dominant, particularly social wasps and odonates (damselflies and dragonflies. Seasonality and site-specific habitat characteristics influenced prey occurrence and abundance. Native vertebrates in the diet included fish, frogs, salamanders, snakes, lizards, turtles, birds, and mammals, including some of conservation concern. Certain predators of bullfrog tadpoles and juveniles are commonly preyed upon by adult bullfrogs, thereby suppressing their effectiveness as biological checks to bullfrog population growth. Prey species with anti-predator defences, such as wasps and sticklebacks, were sometimes eaten in abundance. Many prey species have some type of anti-predator defence, such as wasp stingers or stickleback spines, but there was no indication of conditioned avoidance to any of these. Results from this study reinforce the conclusion that, as an invasive alien, the American bullfrog is an opportunistic and seemingly unspecialized predator that has a uniquely large and complex ecological footprint both above and below the water surface.

  4. Mechanistic basis of adaptive maternal effects: egg jelly water balance mediates embryonic adaptation to acidity in Rana arvalis.

    Science.gov (United States)

    Shu, Longfei; Suter, Marc J-F; Laurila, Anssi; Räsänen, Katja

    2015-11-01

    Environmental stress, such as acidification, can challenge persistence of natural populations and act as a powerful evolutionary force at ecological time scales. The ecological and evolutionary responses of natural populations to environmental stress at early life-stages are often mediated via maternal effects. During early life-stages, maternal effects commonly arise from egg coats (the extracellular structures surrounding the embryo), but the role of egg coats has rarely been studied in the context of adaptation to environmental stress. Previous studies on the moor frog Rana arvalis found that the egg coat mediated adaptive divergence along an acidification gradient in embryonic acid stress tolerance. However, the exact mechanisms underlying these adaptive maternal effects remain unknown. Here, we investigated the role of water balance and charge state (zeta potential) of egg jelly coats in embryonic adaptation to acid stress in three populations of R. arvalis. We found that acidic pH causes severe water loss in the egg jelly coat, but that jelly coats from an acid-adapted population retained more water than jelly coats from populations not adapted to acidity. Moreover, embryonic acid tolerance (survival at pH 4.0) correlated with both water loss and charge state of the jelly, indicating that negatively charged glycans influence jelly water balance and contribute to embryonic adaptation to acidity. These results indicate that egg coats can harbor extensive intra-specific variation, probably facilitated in part via strong selection on water balance and glycosylation status of egg jelly coats. These findings shed light on the molecular mechanisms of environmental stress tolerance and adaptive maternal effects.

  5. Extraction and antioxidant activity of polysaccharides from Rana chensinensis skin.

    Science.gov (United States)

    Wang, Zhanyong; Zhao, Yuanyuan; Su, Tingting

    2015-01-22

    The extraction process of polysaccharides from Rana chensinensis skin was optimized by using a Box-Behnken design. The optimum extraction conditions were as follows: extraction time, 4.96h; extraction temperature, 100°C; ratio of water to raw material, 60; and extraction frequency, 1. Under these conditions, the experimental polysaccharide yield was 2.03±0.14%, which agreed with the predicted yield. The purified polysaccharide RCSP II was successfully obtained by diethylaminoethanol-Sepharose and Sepharose CL-6B column chromatography. In vitro experiments showed that RCSP II exhibited a strong scavenging activity against superoxide anion and 1,1-diphenyl-2-picrylhydrazyl radicals but a weak scavenging activity against hydroxyl radicals. RCSP II also showed a strong reducing capacity. Thus, this polysaccharide can be used as a natural antioxidant in functional foods or medicines.

  6. Widespread bacterial infection affecting Rana temporaria tadpoles in mountain areas

    Directory of Open Access Journals (Sweden)

    Rocco Tiberti

    2011-06-01

    Full Text Available Periodic mass die-offs of Rana temporaria tadpole populations have occurred in the ponds of prealpine mountain areas of Brescia (northern Italy since the early 2000s. The author reports some observational data and analytical results from three sites: tadpoles from mortality events had erythema, especially on the legs, suggestive of septicemia. Bacterial culture of these tadpoles revealed Aeromonas hydrophila and Aeromonas sobria, two organisms often associated with Red leg disease. Egg mass counts from 29 pastureland ponds did not revealed breeding activity declines over five years in the Monte Guglielmo area. Aeromonas hydrophila and Aeromonas sobria usually behave as opportunistic bacteria that can become pathogenic after suppression of the immune system by endogenous or exogenous stressors. Thus, a plurality of environmental factors may contribute to mortality events; some of them are discussed, including loss of high altitude breeding ponds resulting in overcrowding and poor water quality in remaining ponds and the presence of other pathogens.

  7. Transcriptome resources for the frogs Lithobates clamitans and Pseudacris regilla, emphasizing antimicrobial peptides and conserved loci for phylogenetics

    Science.gov (United States)

    Robertson, Laura S.; Cornman, Robert S.

    2014-01-01

    We developed genetic resources for two North American frogs, Lithobates clamitans and Pseudacris regilla, widespread native amphibians that are potential indicator species of environmental health. For both species, mRNA from multiple tissues was sequenced using 454 technology. De novo assemblies with Mira3 resulted in 50 238 contigs (N50 = 687 bp) and 48 213 contigs (N50 = 686 bp) for L. clamitans and P. regilla, respectively, after clustering with CD-Hit-EST and purging contigs below 200 bp. We performed BLASTX similarity searches against the Xenopus tropicalis proteome and, for predicted ORFs, HMMER similarity searches against the Pfam-A database. Because there is broad interest in amphibian immune factors, we manually annotated putative antimicrobial peptides. To identify conserved regions suitable for amplicon resequencing across a broad taxonomic range, we performed an additional assembly of public short-read transcriptome data derived from two species of the genus Rana and identified reciprocal best TBLASTX matches among all assemblies. Although P. regilla, a hylid frog, is substantially more diverged from the ranid species, we identified 56 genes that were sufficiently conserved to allow nondegenerate primer design with Primer3. In addition to providing a foundation for comparative genomics and quantitative gene expression analysis, our results enable quick development of nuclear sequence-based markers for phylogenetics or population genetics.

  8. Meeting the "Standards" with Vanishing Frogs.

    Science.gov (United States)

    Davidson, Cindy B.; Matthews, Catherine E.; Patrick, Patricia

    2001-01-01

    Explains methods for introducing high school students to the issue of the declining amphibian population. Plays the game Frogs' Futures following a seminar as an instructional strategy. Describes the game, procedures, and rules. (YDS)

  9. Region 6 Northern Leopard Frog Information

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document contains a collection of completed questionnaires and related additional data regarding the status review of the northern leopard frog. On July 1,...

  10. Meeting the "Standards" with Vanishing Frogs.

    Science.gov (United States)

    Davidson, Cindy B.; Matthews, Catherine E.; Patrick, Patricia

    2001-01-01

    Explains methods for introducing high school students to the issue of the declining amphibian population. Plays the game Frogs' Futures following a seminar as an instructional strategy. Describes the game, procedures, and rules. (YDS)

  11. Malformed frog survey Dahomey NWR - 2001

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Report contains field data sheets assoicated with malformed frog survey on Dahomey NWR in 2001. Work was done in support of regional sampling on refuges for...

  12. Frog Call Survey Summary 2002-2006

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Since 2002, Patuxent Research Refuge has conducted frog surveys on South Tract, Central Tract, and North Tract locations. These surveys are conducted by Patuxent...

  13. Internal fertilization in an oviparous frog.

    Science.gov (United States)

    Townsend, D S; Stewart, M M; Pough, F H; Brussard, P F

    1981-04-24

    Eleutherodactylus coqui, an oviparous frog, undergoes internal fertilization. If this mode of fertilization occurs in other species of anurans, interpretations of anuran reproductive strategies based on the assumption of external fertilization must be reviewed.

  14. A Study on the Chromosomes in Bullfrog Rana catesbeiana%牛蛙(Rana catesbeiana)染色体研究

    Institute of Scientific and Technical Information of China (English)

    朱传炳; 王瑛

    2006-01-01

    对牛蛙(Rana catesbeiana,Shaw)的染色体组型进行了研究.观察骨髓的C-中期细胞,结果证明牛蛙的体细胞染色体数目2n=26,其中有5对大型染色体和8对小型染色体,可以分成A、B、C 3个组,雌性和雄性个体间没有发现异型性染色体.上述结果与前人的研究结果基本一致.但是作者发现牛蛙骨髓细胞的第7、8、10、12号染色体上均有次缢痕.牛蛙的核型为2n=26=22m+4sm.

  15. Incidence of climate on common frog breeding: Long-term and short-term changes

    Science.gov (United States)

    Neveu, André

    2009-09-01

    In Brittany (northwest France), the climate is showing a trend toward warming. This change is increasingly suspected to have a role in driving amphibian decline, but it is very difficult to determine at what level the climate affects the future of species. Recently, some studies have detected some direct effects on breeding phenology and indirect effects on energy allocation. The present study explores some of these effects on the common frog ( Rana temporaria) from 1984 to 2007. The results show two trends: a long-term change in breeding activities and a short-term influence due to the 2003 climatic anomaly. For the period of study, the start of egg-laying shows a precocity that was correlated with thermal conditions during the preceding 40 days as well as milder springs during the previous year. This degree of precocity is currently the highest found in Europe (+26.6 days). As a result of the 2003 heat wave, the clutch mean fecundity in 2004 was smaller than for other years, the fecundity rates were reduced and abortions were numerous (unlike other years). Moreover, young females were the smallest observed in recent years and some females seemed to exhibit a trade-off between fecundity and growth. Before or after egg-laying, female body condition and mean weight of mature ovules were both lower. The year 2005 appears as a transition period before the recovery in 2006-2007. The results show that climate warming endangers the vital rates of the common frog, while the 2003 climatic events seem more detrimental than the long-term warming trend.

  16. Detritus Quality and Locality Determines Survival and Mass, but Not Export, of Wood Frogs at Metamorphosis.

    Science.gov (United States)

    Milanovich, Joseph R; Barrett, Kyle; Crawford, John A

    2016-01-01

    Single-site experiments have demonstrated detritus quality in wetlands can have strongly negative, neutral, and even positive influences on wildlife. However, an examination of the influence of detritus quality across several regions is lacking and can provide information on whether impacts from variation in detritus quality are consistent across species with wide ranges. To address this gap in regional studies we examined effects of emergent and allochthonous detritus of different nutrient qualities on amphibians and assessed a mechanism that may contribute to potential impacts. We used aquatic mesocosms to raise wood frogs (Rana sylvatica) from two regions of the United States with whole plants from purple loosestrife (Lythrum salicaria), leaf litter from native hardwood trees, and a mixture of both. We examined several metrics of amphibian fitness and life history, including survival, number of days to metamorphosis, and size at metamorphosis. Further, we quantified whether the effects of detritus type could translate to variation in anuran biomass or standing stock of nitrogen or phosphorus export. Our results show detritus with high nutrient quality (purple loosestrife) negatively influenced survival of wood frogs, but increased size of metamorphic individuals in two different regions of the United States. Despite the decrease in survival, the increase in size of post-metamorphic anurans raised with high quality detritus resulted in anuran biomass and standing stock of N and P export being similar across treatments at both locations. These results further demonstrate the role of plant quality in shaping wetland ecosystem dynamics, and represent the first demonstration that effects are consistent within species across ecoregional boundaries.

  17. In vivo muscle force and muscle power during near-maximal frog jumps

    Science.gov (United States)

    Leonard, Timothy R.; Kaya, Motoshi; Herzog, Walter

    2017-01-01

    Frogs’ outstanding jumping ability has been associated with a high power output from the leg extensor muscles. Two main theories have emerged to explain the high power output of the frog leg extensor muscles, either (i) the contractile conditions of all leg extensor muscles are optimized in terms of muscle length and speed of shortening, or (ii) maximal power is achieved through a dynamic catch mechanism that uncouples fibre shortening from the corresponding muscle-tendon unit shortening. As in vivo instantaneous power generation in frog hind limb muscles during jumping has never been measured directly, it is hard to distinguish between the two theories. In this study, we determined the instantaneous variable power output of the plantaris longus (PL) of Lithobates pipiens (also known as Rana pipiens), by directly measuring the in vivo force, length change, and speed of muscle and fibre shortening in near maximal jumps. Fifteen near maximal jumps (> 50cm in horizontal distance) were analyzed. High instantaneous peak power in PL (536 ± 47 W/kg) was achieved by optimizing the contractile conditions in terms of the force-length but not the force-velocity relationship, and by a dynamic catch mechanism that decouples fascicle shortening from muscle-tendon unit shortening. We also found that the extra-muscular free tendon likely amplifies the peak power output of the PL by modulating fascicle shortening length and shortening velocity for optimum power output, but not by releasing stored energy through recoiling as the tendon only started recoiling after peak PL power had been achieved. PMID:28282405

  18. Development of the pseudothumb in frogs

    Science.gov (United States)

    Tokita, Masayoshi; Iwai, Noriko

    2010-01-01

    Frogs have highly conserved hand and foot morphology, possessing four fingers and five toes. As an exception, two Japanese ranid frog species, the Otton frog Babina subaspera and the dagger frog Babina holsti, possess a unique thumb-like structure (the pseudothumb) in the forelimb, giving an appearance of a total of five fingers on the hand. To obtain insights into the developmental mechanisms that generate this novel character, we investigated the hand morphogenesis of the Otton frog. The unique morphological pattern of the pseudothumb was already established in juveniles. Surprisingly, the bud-like structure, which is similar to the area of inductive activity (e.g. feather buds in birds and the carapacial ridge in turtles), was detected over the site where the future prepollex develops in larvae. By contrast, this bud-like structure was not found in larvae of other ranid species. We discuss possible scenarios that would favour the evolution of this very unusual trait in frogs. PMID:20147308

  19. From Virtual Frog to Frog Island: Design Studies in a Development Project.

    Science.gov (United States)

    Dev, Parvati; Walker, Decker F.

    1999-01-01

    Explores the efforts of a curriculum development team who set out to create a virtual frog for use in biology education, but instead, after several design studies, developed a virtual world called Frog Island. Argues for incorporating educational design studies into other educational development projects. (CMK)

  20. Relação de variáveis ambientais em baias cobertas com polietileno e desempenho da rã-touro (Rana catesbeiana Relationship between environmental variables in sheds covered with a polyethylene structure and the performance of bullfrogs (Rana catesbeiana

    Directory of Open Access Journals (Sweden)

    Sônia M. Teodoro

    2005-04-01

    Full Text Available Este trabalho visou a relacionar variáveis ambientais em instalação para criação de rãs, com cobertura de polietileno e baias construídas usando material alternativo, com o desempenho de rãs-touro (Rana catesbeiana. No interior das baias, foram medidas as temperaturas do piso, do ar ambiente (bulbo seco, de bulbo úmido, globo negro e da água do reservatório. Foram utilizados 60 animais por baia e três baias por galpão. As variáveis de desempenho estudadas foram peso vivo, ganho de peso e conversão alimentar. Nas condições experimentais, quando a temperatura do ar atingiu valores abaixo de 10 ºC ou superiores a 40 ºC, houve diminuição no consumo de ração pelos animais. Concluiu-se que o estresse predominante, neste tipo de estrutura, para as condições climáticas do período experimental, foi devido, principalmente, às baixas temperaturas. Concluiu-se, ainda, que o uso do Índice de Temperatura e Umidade (THI, na estimativa de variáveis de desempenho, melhorou a precisão da estimativa em relação ao uso exclusivo da temperatura do ar, embora valores desse índice, considerados estressantes para animais superiores, não o tenham sido para as rãs.The objective of this project was to find correlations between environmental variables of an installation used for raising frogs and the performance of the Bullfrog (Rana catesbeiana. Each installation included a shed built with alternative materials covered by a polyethylene structure. Floor, air (dry bulb, wet bulb, black globe and swimming water temperatures were measured inside the sheds. Sixty bullfrogs were raised in each shed with three sheds in each structure. The performance variables studied, included live weight, weight gain and food conversion. A decrease in food consumption was observed each time air temperatures fell below 10 ºC or went above 40 ºC. It was concluded that the main stress factor in this kind of structure and these climatic conditions during the

  1. Bioaccumulation kinetics of the conventional energetics TNT and RDX relative to insensitive munitions constituents DNAN and NTO in Rana pipiens tadpoles.

    Science.gov (United States)

    Lotufo, Guilherme R; Biedenbach, James M; Sims, Jerre G; Chappell, Pornsawan; Stanley, Jacob K; Gust, Kurt A

    2015-04-01

    The manufacturing of explosives and their loading, assembling, and packing into munitions for use in testing on training sites or battlefields has resulted in contamination of terrestrial and aquatic sites that may pose risk to populations of sensitive species. The bioaccumulative potential of the conventional explosives 2,4,6-trinitrotoluene (TNT) and hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX) and of the insensitive munitions (i.e., less shock sensitive) compound 2,4-dinitroanisole (DNAN) were assessed using the Northern leopard frog, Rana pipiens. Trinitrotoluene entering the organism was readily biotransformed to aminodinitrotoluenes, whereas no transformation products were measured for RDX or DNAN. Uptake clearance rates were relatively slow and similar among compounds (1.32-2.19 L kg(-1) h(-1) ). Upon transfer to uncontaminated water, elimination rate was very fast, resulting in the prediction of fast time to approach steady state (5 h or less) and short elimination half-lives (1.2 h or less). A preliminary bioconcentration factor of 0.25 L kg(-1) was determined for the insensitive munitions compound 3-nitro-1,2,4-trizole-5-one (NTO) indicating negligible bioaccumulative potential. Because of the rapid elimination rate for explosives, tadpoles inhabiting contaminated areas are expected to experience harmful effects only if under constant exposure conditions given that body burdens can rapidly depurate preventing tissue concentrations from persisting at levels that may cause detrimental biological effects.

  2. Breeding site heterogeneity reduces variability in frog recruitment and population dynamics

    Science.gov (United States)

    McCaffery, Rebecca M.; Eby, Lisa A.; Maxell, Bryce A.; Corn, Paul Stephen

    2013-01-01

    Environmental stochasticity can have profound effects on the dynamics and viability of wild populations, and habitat heterogeneity provides one mechanism by which populations may be buffered against the negative effects of environmental fluctuations. Heterogeneity in breeding pond hydroperiod across the landscape may allow amphibian populations to persist despite variable interannual precipitation. We examined recruitment dynamics over 10 yr in a high-elevation Columbia spotted frog (Rana luteiventris) population that breeds in ponds with a variety of hydroperiods. We combined these data with matrix population models to quantify the consequences of heterogeneity in pond hydroperiod on net recruitment (i.e. number of metamorphs produced) and population growth rates. We compared our heterogeneous system to hypothetical homogeneous environments with only ephemeral ponds, only semi-permanent ponds, and only permanent ponds. We also examined the effects of breeding pond habitat loss on population growth rates. Most eggs were laid in permanent ponds each year, but survival to metamorphosis was highest in the semi-permanent ponds. Recruitment success varied by both year and pond type. Net recruitment and stochastic population growth rate were highest under a scenario with homogeneous semi-permanent ponds, but variability in recruitment was lowest in the scenario with the observed heterogeneity in hydroperiods. Loss of pond habitat decreased population growth rate, with greater decreases associated with loss of permanent and semi-permanent habitat. The presence of a diversity of pond hydroperiods on the landscape will influence population dynamics, including reducing variability in recruitment in an uncertain climatic future.

  3. Effect of acclimation temperature and pH on contraction of frog sartorius muscle.

    Science.gov (United States)

    Renaud, J M; Stevens, E D

    1981-05-01

    The effect of acclimation temperature and pH on the isometric twitch and tetanus of sartorius muscle from frog, Rana pipiens, was studied at different experimental temperatures. Seven variables were measured, namely: tension, latent period, time to maximum tension, half-relaxation time, mean rate, maximum rate, and maximum acceleration of tension development. The effect of experimental temperature was similar to that reported in the literature. The effects of acclimation temperature were small and were not compensatory. Different pH's were obtained by varying CO2 in the gas phase, while the HCO3- concentration was kept constant. The main effects of a decrease in pH on the isometric twitch and tetanus were a reduction in tension and rate of tension development and an increase in latent period. A decrease in pH had no effect on the time to maximum tension or the half-relaxation time. Analysis of variance showed that the test temperature had the greatest effect of all three treatments on each variable, the effects of test and acclimation temperature were dependent on neither the test nor the acclimation temperatures. The in vivo relationships between these three treatments are discussed.

  4. Mechanisms for the effects of acetylcholine on sodium transport in frog skin.

    Science.gov (United States)

    Cuthbert, A W; Wilson, S A

    1981-03-15

    In frog skin (Rana temporaria) acetylcholine applied to the serosal surface produces either a sustained inhibiton or sustained stimulation of short-circuit current (SCC). The former effect is accompanied by a reduction and the latter by an increase in total tissue conductance. Both effects of acetylcholine can be accounted for, within experimental error, by changes in net sodium flux across the tissue. By use of selective agonists and antagonists it is concluded that acetylcholine interacts with muscarinic receptors in the serosal membrane. The effects of cholinoceptor agents are also seen with isolated epithelium. The stimulatory effect of acetylcholine is potentiated by theophylline and blocked by inhibitors of prostaglandin synthetase and by mepacrine. It is suggested that acetylcholine stimulates transport by liberating prostaglandins which may then activate adenylcyclase. The inhibitory effect of acetylcholine is correlated with a reduction in cyclic AMP content of the epithelium. Calcium appears to be an important determinant of the type of response seen eith acetylcholine, but the mechanism is not known.

  5. Requirement of potassium for the action of anti-diuretic hormone (ADH) on frog skin.

    Science.gov (United States)

    Jared, Silviya Rajakumari; Rao, Jonakuty Prakasa

    2011-12-01

    The aim of the present study is to study whether the presence of K(+) in bathing media is required for the action of ADH to the ionic transport across the skin in the frog species Rana hexadactyla. lonic transport was measured as transepithelial potential difference (TEPD) and short circuit current (SCC) by using an indigenously developed computer based voltage-clamp technique. Addition of ADH (40 nM) on the serosal side significantly increased the TEPD and SCC with Normal Ringer (NR) on both sides. ADH had no effect subsequent to amiloride (100 µM) pre-treatment, which confirmed the ADH-induced Na(+) transport. Chloride also has a significant role in the development of TEPD. To determine the role of K(+), Potassium-free Ringer (KFR) was placed on both sides; addition of ADH had no effect consequently. Further experiments were carried out to find out which side of K(+) was required for the action of ADH. There was a lack of ADH effect with apical NR and serosal KFR, demonstrating that serosal K(+) is essential to activate Na(+), K(+)- ATPase. Similarly, the ADH effect was lacking with apical KFR and serosal NR that was the novel finding of this study. Due to the concentration gradient, the K(+) was secreted from serosal side to apical side through barium (1 mM) blockable K(+) channel. This study provides evidence that serosal as well as apical K(+) are necessary for the action of ADH.

  6. Phenotypically plastic responses of green frog embryos to conflicting predation risk.

    Science.gov (United States)

    Ireland, D H; Wirsing, A J; Murray, D L

    2007-05-01

    Predators have been shown to alter the timing of switch points between life history stages, but few studies have addressed switch point plasticity in prey exposed simultaneously to conflicting predation pressure. We tested hatching responses of green frog (Rana clamitans) embryos subject to perceived predation risk from chemical cues released by two stage-specific predators, predicting that these predators would elicit: (1) directional hatching responses when presented independently, and (2) intermediate phenotypic responses when presented simultaneously. R. clamitans embryos in outdoor exclosures were exposed to cues from an egg predator (freshwater leeches; Nephelopsis obscura), a larval predator (dragonfly nymphs, Aeschna canadensis), and both predators in a 2 x 2 factorial experiment, and changes in hatchling size, hatchling developmental stage, and hatching time were compared to those for control embryos. Leeches alone induced embryos to hatch at a smaller size and an earlier developmental stage than controls, while dragonfly nymphs elicited a delay in egg hatching time that was associated with larger size and later developmental stage at hatching. Embryos failed to respond to simultaneous exposure to both predators, implying that responses to each occurred concurrently and were therefore dampened. Our results indicate that prey under threat from conflicting predators may manifest intermediate defensive phenotypes. Such intermediate responses may result in elevated rates of prey mortality with possible consequences at the population level.

  7. Ontogeny and localization of gamma-crystallins in Rana temporaria, Ambystoma mexicanum and Pleurodeles waltlii normal lens development

    NARCIS (Netherlands)

    Brahma, S.K.; McDevitt, David S.

    1974-01-01

    Rana pipiens lens γ-crystallin antibodies were used in the indirect immunofluorescence staining method to investigate the role of γ-crystallins in the normal lens development of the amphibians Rana temporaria, Ambystoma mexicanum and Pleurodeles waltlii Michah. In each case, the fluorescence was fir

  8. Ontogeny and localization of gamma-crystallins in Rana temporaria, Ambystoma mexicanum and Pleurodeles waltlii normal lens development

    NARCIS (Netherlands)

    Brahma, S.K.; McDevitt, David S.

    1974-01-01

    Rana pipiens lens γ-crystallin antibodies were used in the indirect immunofluorescence staining method to investigate the role of γ-crystallins in the normal lens development of the amphibians Rana temporaria, Ambystoma mexicanum and Pleurodeles waltlii Michah. In each case, the fluorescence was

  9. Effects of flow regimes altered by dams on survival, population declines, and range-wide losses of California river-breeding frogs.

    Science.gov (United States)

    Kupferberg, Sarah J; Palen, Wendy J; Lind, Amy J; Bobzien, Steve; Catenazzi, Alessandro; Drennan, Joe; Power, Mary E

    2012-06-01

    Widespread alteration of natural hydrologic patterns by large dams combined with peak demands for power and water delivery during summer months have resulted in frequent aseasonal flow pulses in rivers of western North America. Native species in these ecosystems have evolved with predictable annual flood-drought cycles; thus, their likelihood of persistence may decrease in response to disruption of the seasonal synchrony between stable low-flow conditions and reproduction. We evaluated whether altered flow regimes affected 2 native frogs in California and Oregon (U.S.A.) at 4 spatial and temporal extents. We examined changes in species distribution over approximately 50 years, current population density in 11 regulated and 16 unregulated rivers, temporal trends in abundance among populations occupying rivers with different hydrologic histories, and within-year patterns of survival relative to seasonal hydrology. The foothill yellow-legged frog (Rana boylii), which breeds only in flowing water, is more likely to be absent downstream of large dams than in free-flowing rivers, and breeding populations are on average 5 times smaller in regulated rivers than in unregulated rivers. Time series data (range = 8 - 19 years) from 5 populations of yellow-legged frogs and 2 populations of California red-legged frogs (R. draytonii) across a gradient of natural to highly artificial timing and magnitude of flooding indicate that variability of flows in spring and summer is strongly correlated with high mortality of early life stages and subsequent decreases in densities of adult females. Flow management that better mimics natural flow timing is likely to promote persistence of these species and others with similar phenology.

  10. Endocrine control of active sodium transport across frog skin; Le controle endocrinien du transport actif de sodium a travers la peau de grenouille

    Energy Technology Data Exchange (ETDEWEB)

    Maetz, J. [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    I. Action of the neurohypophyseal peptides on sodium transport. 1) On Rana Esculenta, oxytocin alone is active on the sodium transport (not vaso pressin). 2) The post hypophysis of R.e. contains an hormonal factor even more specific on Na transport (12 times more active than oxytocin). 3) This new factor must be closely related to oxytocin. II. Action of the adrenal corticoids. 1) The skin of frogs adapted to a salt-rich external medium, shows a considerable diminution in sodium uptake. 2) This decreased sodium uptake is brought back to normal by the injections of aldosterone. 3) This suggests that salt loading of amphibians (as well as mammals) inhibits the mineralocorticoid activity of the adrenals. (author) [French] I. Action des peptides neurohypophysaires chez Rana esculenta. 1) Le transport actif de Na est sensible a l'action de l'ocytocine mais non a l'hormone antidiuretique. 2) La posthypophyse de ces grenouilles contient un facteur plus specifique encore, puisque 12 fois plus actif que l'ocytocine. 3) Ce facteur est cependant tres voisin de l'ocytocine au point de vue chimique. lI. Action des corticoides surrenaliens chez Rana Esculenta. 1) L'adaptation des grenouilles a un milieu riche en sel a pour effet une diminution considerable du transport actif de sodium, visible in vivo et in vitro. 2) L'injection d'aldosterone a des grenouilles adaptees dans ces conditions restaure le transport actif a un niveau comparable a celui que l'on observe chez les animaux conserves dans de l'eau courante. 3) Ces faits suggerent que la surcharge en NaCI produirait chez les amphibiens, comme chez les mammiferes, une mise au repos de la fonction mineralotrope de la surrenale. (auteur)

  11. 49 CFR 213.139 - Spring rail frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Spring rail frogs. 213.139 Section 213.139..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.139 Spring rail frogs. (a) The... wing rail shall be solidly tamped and fully and tightly bolted. (c) Each frog with a bolt hole defect...

  12. 49 CFR 213.141 - Self-guarded frogs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Self-guarded frogs. 213.141 Section 213.141..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.141 Self-guarded frogs. (a) The raised guard on a self-guarded frog shall not be worn more than three-eighths of an inch. (b) If repairs...

  13. Pain perception and anaesthesia in research frogs.

    Science.gov (United States)

    Guénette, Sarah Annie; Giroux, Marie-Chantal; Vachon, Pascal

    2013-01-01

    Frogs possess pain receptors and pathways that support processing and perception of noxious stimuli however the level of organization is less well structured compared to mammals. It was long believed that the experience of pain was limited to 'higher' phylums of the animal kingdom. However, it is now commonly accepted that amphibians possess neuro-anatomical pathways conductive of a complete nociceptive experience. Xenopus laevis frogs have been one of the most popular aquatic research models for developmental studies and genetic research. These frogs have been extensively use in research for their eggs, that can be collected following hormonal stimulation either naturally or by surgical intervention. Many anaesthetics have been used in amphibians such as bath solutions of MS-222, benzocaine and eugenol as well as systemic injections of ketamine or tiletamine, barbiturates, propofol and gas administrations of methoxyflurane, halothane and isoflurane. Most of these anaesthetic drugs produce variability in depth and duration of anaesthesia. MS-222 appears to be one of the most reliable anaesthetics. This review will focus on the evidence of pain perception in frogs and will compare the effectiveness and limitations of different anaesthetics used in Xenopus leavis frogs.

  14. Age and body size of Rana amurensis from northeastern China

    Institute of Scientific and Technical Information of China (English)

    Wei CHEN; Xin LU

    2011-01-01

    Age and body size are two important demographic traits that determine the life history strategies of populations and species.We measured these two parameters of Rana amurensis,at a 900 m and a 500 m altitude site in northeastern China.At the two sites,age at first reproduction was 2 years for males and 3 years for females.The maximum age of males and females at the high-altitude site was 6 and 7 years,and 5 and 7 years at the low-altitude population,respectively.Females were significantly larger than males in both populations,due to greater age in both the high- and low-altitude sites.Body size of either males or females did not differ significantly between populations; only males showed increased body size at the high-altitude site when age effect was statistically controlled for.The increased cline of male body size may be attributable to delayed maturation of the sex due to a shorter growing season at high altitudes [Current Zoology 57 (6):781-784,2011].

  15. The propeller and the frog

    CERN Document Server

    Pan, Margaret

    2010-01-01

    "Propellers" in planetary rings are disturbances in ring material excited by moonlets that open only partial gaps. We describe a new type of co-orbital resonance that can explain the observed non-Keplerian motions of propellers. The resonance is between the moonlet underlying the propeller, and co-orbiting ring particles downstream of the moonlet where the gap closes. The moonlet librates within the gap about an equilibrium point established by co-orbiting material and stabilized by the Coriolis force. In the limit of small libration amplitude, the libration period scales linearly with the gap azimuthal width and inversely as the square root of the co-orbital mass. The new resonance recalls but is distinct from conventional horseshoe and tadpole orbits; we call it the "frog" resonance, after the relevant term in equine hoof anatomy. For a ring surface density and gap geometry appropriate for the propeller Bl\\'eriot in Saturn's A ring, our theory predicts a libration period of ~4 years, similar to the ~3.7 yea...

  16. FROG The Fast and Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light ($<3\\textrm{MB}$) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  17. FROG The Fast and Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light ($<3\\textrm{MB}$) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  18. FROG: The Fast & Realistic OPENGL Displayer

    CERN Document Server

    Quertenmont, Loic

    2009-01-01

    FROG is a generic framework dedicated to visualisation of events in high energy experiment. It is suitable to any particular physics experiment or detector design. The code is light (<3 MB) and fast (browsing time ~20 events per second for a large High Energy Physics experiment) and can run on various operating systems, as its object-oriented structure (C++) relies on the cross-platform OPENGL and GLUT libraries. Moreover, FROG does not require installation of third party libraries for the visualisation. This document describes the features and principles of FROG version 1.106, its working scheme and numerous functionalities such as: 3D and 2D visualisations, graphical user interface, mouse interface, configuration files, production of pictures of various format, integration of personal objects, etc. Finally, several examples of its current applications are presented for illustration.

  19. The Frog Inner Ear: Picture Perfect?

    OpenAIRE

    Mason, Matthew James; Segenhout, Johannes M.; Cobo-Cuan, Ariadna; Quiñones, Patricia M.; van Dijk, Pim

    2015-01-01

    This is the accepted manuscript of a paper published in the Journal of the Association for Research in Otolaryngology (2015) DOI: 10.1007/s10162-015-0506-z Many recent accounts of the frog peripheral auditory system have reproduced Wever’s (1973) schematic cross-section of the ear of a leopard frog. We sought to investigate to what extent this diagram is an accurate and representative depiction of the anuran inner ear, using three-dimensional reconstructions made from serial sections of Ra...

  20. Birds and frogs in mathematics and physics

    Energy Technology Data Exchange (ETDEWEB)

    Dyson, Freeman J [Institute for Advanced Study, Princeton, NJ (United States)

    2010-11-15

    Some scientists are birds, others are frogs. Birds fly high in the air and survey broad vistas of mathematics out to the far horizon. They delight in concepts that unify our thinking and bring together diverse problems from different parts of the landscape. Frogs live in the mud below and see only the flowers that grow nearby. They delight in the details of particular objects, and they solve problems one at a time. A brief history of mathematics and its applications in physics is presented in this article. (from the history of physics)

  1. Behavioural consistency and life history of Rana dalmatina tadpoles.

    Science.gov (United States)

    Urszán, Tamás János; Török, János; Hettyey, Attila; Garamszegi, László Zsolt; Herczeg, Gábor

    2015-05-01

    The focus of evolutionary behavioural ecologists has recently turned towards understanding the causes and consequences of behavioural consistency, manifesting either as animal personality (consistency in a single behaviour) or behavioural syndrome (consistency across more behaviours). Behavioural type (mean individual behaviour) has been linked to life-history strategies, leading to the emergence of the integrated pace-of-life syndrome (POLS) theory. Using Rana dalmatina tadpoles as models, we tested if behavioural consistency and POLS could be detected during the early ontogenesis of this amphibian. We targeted two ontogenetic stages and measured activity, exploration and risk-taking in a common garden experiment, assessing both individual behavioural type and intra-individual behavioural variation. We observed that activity was consistent in all tadpoles, exploration only became consistent with advancing age and risk-taking only became consistent in tadpoles that had been tested, and thus disturbed, earlier. Only previously tested tadpoles showed trends indicative of behavioural syndromes. We found an activity-age at metamorphosis POLS in the previously untested tadpoles irrespective of age. Relative growth rate correlated positively with the intra-individual variation of activity of the previously untested older tadpoles. In previously tested older tadpoles, intra-individual variation of exploration correlated negatively and intra-individual variation of risk-taking correlated positively with relative growth rate. We provide evidence for behavioural consistency and POLS in predator- and conspecific-naive tadpoles. Intra-individual behavioural variation was also correlated to life history, suggesting its relevance for the POLS theory. The strong effect of moderate disturbance related to standard behavioural testing on later behaviour draws attention to the pitfalls embedded in repeated testing.

  2. Do all frogs swim alike? The effect of ecological specialization on swimming kinematics in frogs.

    Science.gov (United States)

    Robovska-Havelkova, Pavla; Aerts, Peter; Rocek, Zbynek; Prikryl, Tomas; Fabre, Anne-Claire; Herrel, Anthony

    2014-10-15

    Frog locomotion has attracted wide scientific interest because of the unusual and derived morphology of the frog pelvic girdle and hind limb. Previous authors have suggested that the design of the frog locomotor system evolved towards a specialized jumping morphology early in the radiation of the group. However, data on locomotion in frogs are biased towards a few groups and most of the ecological and functional diversity remains unexplored. Here, we examine the kinematics of swimming in eight species of frog with different ecologies. We use cineradiography to quantify movements of skeletal elements from the entire appendicular skeleton. Our results show that species with different ecologies do differ in the kinematics of swimming, with the speed of limb extension and especially the kinematics of the midfoot being different. Our results moreover suggest that this is not a phylogenetic effect because species from different clades with similar ecologies converge on the same swimming kinematics. We conclude that it is important to analyze frog locomotion in a broader ecological and evolutionary context if one is to understand the evolutionary origins of this behavior.

  3. Valores fisiológicos en sangre y orina de rana toro en cautiverio, rana catesbeiana (Anura: ranidae)

    OpenAIRE

    Coppo, J. A.; N.B. Mussart; Fioranelli, S. A.; Zeinsteger, Pedro Adolfo

    2005-01-01

    Con el propósito de obtener valores sanguíneos y urinarios de referencia, 302 muestras de ejemplares sanos de Rana catesbeiana del nordeste argentino (9-21 meses de edad, 50% de cada sexo), fueron analizadas por espectrofotometría, electroforesis, densitometría, refractometría y microscopía. Fueron obtenidos intervalos de confianza (p

  4. Valores fisiológicos en sangre y orina de rana toro en cautiverio, rana catesbeiana (Anura: ranidae)

    OpenAIRE

    Coppo, J. A.; Mussart, N. B.; Fioranelli, S. A.; Zeinsteger, Pedro Adolfo

    2005-01-01

    Con el propósito de obtener valores sanguíneos y urinarios de referencia, 302 muestras de ejemplares sanos de Rana catesbeiana del nordeste argentino (9-21 meses de edad, 50% de cada sexo), fueron analizadas por espectrofotometría, electroforesis, densitometría, refractometría y microscopía. Fueron obtenidos intervalos de confianza (p

  5. Water Frogs, Aquariums, and Salmonella -- Oh My!

    Centers for Disease Control (CDC) Podcasts

    2009-12-09

    This CDC Kidtastics podcast discusses how people can get Salmonella from water frogs and aquariums.  Created: 12/9/2009 by National Center for Zoonotic, Vector-Borne, and Enteric Diseases (NCZVED).   Date Released: 12/9/2009.

  6. Frog egg growth, experiment S003

    Science.gov (United States)

    Young, R. S.; Tremor, J. W.

    1971-01-01

    The objective of experiment was to determine the effect of weightlessness on the ability of a fertilized frog egg to divide normally and to differentiate and form a normal embryo. This experiment was first attempted on the Gemini 8 mission and was completed only partially because of the early termination of that mission.

  7. Female frogs send ultrasonic signals for courtship

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ During their studies of Odorrana tormota,a frog species with recessed tympanic membranes,CAS researchers have found that females go ultrasonic during courtship,revealing an amazingly system for communication.The work was reported online on 8 May by Nature.

  8. Tracking Frogs that sing ultrasonic duet

    Institute of Scientific and Technical Information of China (English)

    XIN Ling

    2009-01-01

    @@ In central China, unique frogs talk by emitting ultrasonic calls, male to show their virility and female for courtship, which are received by tunable ears with amazing accuracy. Prof. SHEN Junxian from the CAS Institute of Biophysics and his collaborators are working diligently to explore the mysteries of unique sound communication in animal kingdom.

  9. The response characteristics of vibration-sensitive saccular fibers in the grassfrog, Rana temporaria

    DEFF Research Database (Denmark)

    Christensen-Dalsgaard, J; Jørgensen, M B

    1988-01-01

    The response characteristics of saccular nerve fibers in European grassfrogs (Rana temporaria) subjected to dorso-ventral, 10-200 Hz sinusoidal vibrations were studied. Only 4 fibers out of a total of 129 did not respond to the vibrations. 70 fibers had an irregular spontaneous activity of 2...

  10. Acid-base regulation in tadpoles of Rana catesbeiana exposed to environmental hypercapnia

    DEFF Research Database (Denmark)

    Busk, Morten; Larsen, Erik Hviid; Jensen, Frank B.

    1997-01-01

    Tadpoles of Rana catesbeiana were exposed to different levels of environmental hypercapnia. The acid-base regulatory response differed from that in adult amphibians in showing a high degree of pH compensation in the extracellular fluid (65-85%) and complete compensation in the intracellular fluid...

  11. Blood and urine physiological values in farm-cultured Rana catesbeiana (Anura: Ranidae) in Argentina

    OpenAIRE

    2014-01-01

    A total of 302 samples of healthy farm-cultured Rana catesbeiana specimens (9-21 months-old, 50- 350 g liveweight, 50% each sex) from the north-east of Argentina, were analyzed through spectrophotometry, electrophoresis, densitometry, refractometry and microscopy in order to obtain blood and urine normal values. Confidence intervals (p

  12. Pattern formation in artificially activated ectoderm (Rana pipiens and Ambystoma punctatum)

    NARCIS (Netherlands)

    Nieuwkoop, P.D.

    1963-01-01

    Presumptive ectoneuroderm of late blastulae or early gastrulae of Rana pipiens was partially activated by short-lasting disaggregation in Ca-free Holtfreter or Niu-Twitty solutions and subsequent reaggregation in normal solutions. The explants usually became dumbbell shaped and consisted respectivel

  13. The collapse of Rana Plaza and the limits, options and challenges of transnational labour regulation

    NARCIS (Netherlands)

    ter Haar, B.

    2013-01-01

    The collapse of the Rana Plaza in Bangladesh on 24 April 2013 resulted in the death of over 1,100 workers and many more injured workers. Consequently, it has again raised the debate about the social responsibility of multinational companies (MNCs) for their full production chain. European and

  14. Capsaicin in adult frogs: effects on nociceptive responses to cutaneous stimuli and on nervous tissue concentrations of immunoreactive substance P, somatostatin and cholecystokinin.

    Science.gov (United States)

    Chéry-Croze, S; Godinot, F; Jourdan, G; Bernard, C; Chayvialle, J A

    1985-11-01

    Adult frogs (Rana esculenta) were given subcutaneous injections of 10, 20, 30, 50 and 100 mg/kg capsaicin in sequential order over 5 days, or the vehicle only. The nociceptive thresholds to electrical, thermal and chemical stimuli were measured before, and 1, 5 and 24 h after each injection. Capsaicin was followed by a dose-related reduction of nociceptive responses to all stimuli, but these effects lasted for only 1-5 h after the given injection. Water/acetic extracts of undivided brains and spinal cords were prepared at the corresponding time periods for the radioimmunoassay of peptides. Spinal cord concentrations of immunoreactive substance P were essentially unaffected by capsaicin, while those of immunoreactive somatostatin were significantly increased after the second for fourth injections (20, 30 and 50 mg/kg) of capsaicin. Brain extracts showed an increase of somatostatin and substance P concentrations after the dose of 50 mg/kg. In an additional experiment, immunoreactive substance P, somatostatin and cholecystokinin were measured in tissue samples taken at 2 and 10 min, and 1, 5 and 24 h after a single dose of either 50 mg/kg capsaicin or the vehicle. The only significant effect of capsaicin was an increase of immunoreactive somatostatin concentration in brain homogenates at 5 h, while the vehicle in itself elicited major variations of all three peptides in spinal cord and/or brain. These results indicate that capsaicin reduces the nociceptive responses to cutaneous stimuli in adult frogs.(ABSTRACT TRUNCATED AT 250 WORDS)

  15. The role of thyroid hormone in the regulation of hepatic carbamyl phosphate synthetase activity in Rana catesbeiana.

    Science.gov (United States)

    Galton, V A; Morganelli, C M; Schneider, M J; Yee, K

    1991-11-01

    Both spontaneous and thyroid hormone (TH)-induced metamorphosis of Rana catesbeiana are accompanied by a marked increase in the activity of the urea cycle enzyme carbamyl phosphate synthetase (CPS). The increase induced by exogenous TH is de novo synthesis of enzyme and appears to be secondary to an increase in the CPS mRNA level resulting from the elevated plasma TH. Since endogenous TH levels rise sharply during spontaneous metamorphosis, a similar sequence of events would be anticipated. However, after midclimax, CPS activity continues to increase, while plasma TH levels steadily decline, suggesting that other factors are involved. To obtain insight into this problem, the changes in CPS mRNA level during spontaneous development were determined using a mammalian CPS cDNA probe and correlated with changes in CPS activity and plasma T3 concentration. CPS mRNA level and CPS activity were barely detectable until midprometamorphosis, but both increased rapidly during the latter half of this phase. CPS activity continued to rise, reaching a maximum in the adult frog. The CPS mRNA level, however, was highest during the first half of climax, but declined after midclimax and was relatively low in the adult frog. Studies were also performed in which the rise and fall in the plasma T3 concentration typical of metamorphic climax were induced by exposure of premetamorphic tadpoles to T3, followed by its withdrawal. Both CPS activity and CPS mRNA level were induced by T3, but when plasma T3 levels fell after removal of the exogenous T3, CPS mRNA level, but not CPS activity, also decreased. Additional studies indicated that the TH-induced increase in CPS mRNA was evident within 24 h, could be prevented by simultaneous injection of actinomycin-D, and could not be induced in tadpoles undergoing climax; in this phase the T3 receptors are fully occupied with endogenous TH. When premetamorphic tadpoles were immersed in T3-containing water (0-500 nM) for 6 days, CPS mRNA, CPS

  16. 14C-丁草胺、14C-毒死蜱和14C-DDT在日本林蛙中的生物学行为%BEHAVIORS OF 14C-BUTACHLOR,14C-CHLORPYRIFOS AND 14C-DDT IN Rana japonica japonica Guenther

    Institute of Scientific and Technical Information of China (English)

    张奕强; 张海清; 钟创光; 赵小奎; 陈舜华

    2002-01-01

    用同位素示踪技术研究了14C-丁草胺、14C-毒死蜱和14C-DDT在日本林蛙(Rana japonica japonica Guenther)中的生物学行为.结果发现,14C-丁草胺、14C-毒死蜱和14C-DDT在24h后分布到青蛙的各个器官组织,并分别以胆囊、小肠、小肠为它们的特异性浓集器官.与胆囊或小肠的14C放射性活度比较,其它器官组织中的要小得多.14C-DDT在日本林蛙中较难降解,24h后DDT母体在肝和脂肪组织中占DDT代谢物的54.6%和88.4%.青蛙中的14C-丁草胺、14C-毒死蜱和14C-DDT可被丙酮提取,但三者之间以及在青蛙的器官之间有差异.%The research on the behaviors of 14C-butachlor, 14C-chlorpyrifos and 14C-DDT in the frog Rana japonica japonica Guenther was carried out. After administrated per os to the frogs in doses of 380,347,363 Bq/g, 14C-butachlor, 14C-chlorpyrifos and 14C-DDT, were distributed respectively to various organs within 24 h with specific accumulating organs as gallbladder, intestine and intestine, relevantly to the pesticides described. Compared to that in gallbladder and intestine, the radioactivity of many organs was extremely low, and this might due to the characters of the pesticides. Analysis of the metabolites of 14C-DDT in frog at 24th hr demonstrated that DDT was difficult to be degraded. Most 14C-butachlor, 14C-chlorpyrifos 14C-DDT in liver and fat or ovary of frog was extractable with acetone. However, there were some differences between the pesticides, and the organs as well. And 14C-butachlor, 14C-chlorpyrifos or 14C-DDT were better bound in liver than in fat.

  17. 直链烷基苯磺酸钠对中国林蛙抗菌肽基因表达的影响%The Effects of Linear Alkylbenzene Sulfonate on Antimicrobial Peptide Genes Expression in Rana chensinensis

    Institute of Scientific and Technical Information of China (English)

    谢晖; 孙燕; 李治; 宋婧

    2011-01-01

    近年来由于生境丧失及环境污染等原因,中国林蛙野生种群急剧减少.为深入研究水体中普遍存在的阴离子表面活性剂直链烷基苯磺酸钠(linear alkylbenzene sulfonate,LAS)对中国林蛙生存的影响,通过急毒实验确定LAS对分别处于发育阶段26、32、42、46期的中国林蛙的半致死浓度.同时利用1、4、8 mg/L LAS处理不同发育阶段中国林蛙,研究LAS对中国林蛙存活率、发育状态的影响,并利用real-time PCR技术检测中国林蛙抗菌肽基因表达水平变化.结果表明,当处理时间为96 h,LAS浓度达到12.33 mg/L以上时会对不同发育阶段中国林蛙产生较为严重的致死效应.1~8 mg/L浓度范围的LAS虽然对中国林蛙存活和发育没有明显影响,但是改变了其抗菌肽基因表达模式.特别是中国林蛙胚后发育后期(32期)和变态期(42期),4~8 mg/L LAS会在不同程度上抑制prepropalustrin-2CE3 、preprobrevinin-2CE1和preprotemporin-1 CEd1抗菌肽基因表达.总体而言,高浓度LAS对中国林蛙免疫系统造成一定影响,可能使该物种更易受到致病菌的侵袭.研究结果为化学污染物对中国林蛙免疫系统影响积累了实验数据,同时为研究中国林蛙抗菌肽基因表达的调控通路提供一定的理论依据.%Rana chensinensis has been suffered from a dramatic reduction in recent years due to the losing of habitat, environmental pollution and so on. To understand the influence of linear alkylbenzene sulfonate (LAS), which is one of the most important pollutants in water environment, on the survival of Rana chensinensis, the median lethal concentration of LAS had been calculated by explosion of the frogs at stage 26, 32, 42, 46 in different concentrations of LAS. The effects of 1, 4, 8 mg/L LAS on the survival and development of Rana chensinensis at different stages were also investigated. Also, the expressions of antimicrobial peptide genes were detected by real-time PCR. The

  18. Embryo Development of Tree Frog Polypedates leucomystax at Campus of State University of Malang

    OpenAIRE

    Pearlindah; Emy Kusumawati; Dian Ratri Wulandari; Dwi Listyorini

    2012-01-01

    Tree frogs live in natural places which are unpolluted. Regarding their role as an ecological indicator, the decrease of frogs population in a particular habitat indicates the danger of environment quality decrease. Moreover, this condition can harm the frogs themselves. All kinds of frogs breed in aqueous environment such as ponds, marshes, and farming fields. One of the tree frogs, Polypedates leucomystax, which belongs to Familia Rachophoridae, is widely spread in Indonesia. This frog has ...

  19. Vasculature of the parotoid glands of four species of toads (bufonidae: bufo).

    Science.gov (United States)

    Hutchinson, Deborah A; Savitzky, Alan H

    2004-05-01

    The parotoid glands of toads (Bufonidae) consist of large aggregations of granular glands located between the otic region of the skull and the scapular region. To determine the circulatory pattern of these glands, we perfused the vascular systems of Bufo alvarius, B. marinus, B. terrestris, and B. valliceps with either India ink or Microfil, a fine latex. The perfused glands were studied by gross dissection, microscopic examination, and histology. The vascular patterns of the parotoid glands were compared to the arrangement of vessels in the dorsal skin of Rana sphenocephala (Ranidae), a frog that lacks parotoid glands. The parotoid glands of the four species of toads are supplied with blood by the lateral and dorsal cutaneous arteries and are drained by one or more branches of the internal jugular vein. The dorsal cutaneous artery supplies most of the blood to the parotoid glands in B. terrestris and B. valliceps. In B. alvarius and B. marinus, both the lateral and dorsal cutaneous arteries serve major roles in the blood supply of the glands. These patterns of blood flow have not been described previously for parotoid glands and conflict with earlier accounts for B. alvarius and B. marinus. The arteries and veins associated with the parotoid glands of toads are present in R. sphenocephala, but are arranged differently. In R. sphenocephala, the lateral cutaneous artery supplies the dorsal and lateral skin posterior to the shoulder region, whereas the dorsal cutaneous artery supplies the skin of the shoulder region. In toads, both the lateral and dorsal cutaneous arteries supply the skin of the shoulder region and ramify into subcutaneous capillaries that surround the secretory units of the parotoid glands. Extensive vasculature presumably is important for delivering cholesterol and other precursor molecules to the parotoid glands, where those compounds are converted into toxins.

  20. Frog tongue acts as muscle-powered adhesive tape

    OpenAIRE

    Kleinteich, Thomas; Gorb, Stanislav N

    2015-01-01

    Frogs are well known to capture fast-moving prey by flicking their sticky tongues out of the mouth. This tongue projection behaviour happens extremely fast which makes frog tongues a biological high-speed adhesive system. The processes at the interface between tongue and prey, and thus the mechanism of adhesion, however, are completely unknown. Here, we captured the contact mechanics of frog tongues by filming tongue adhesion at 2000 frames per second through an illuminated glass. We found th...

  1. The Bear,The Rabbit And The Golden Frog

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Mr. Bear and Mr. Rabbit didn’t like each other very much. One day, while walking through the woods, they came across a golden frog. They were amazed when the frog talked to them. The golden frog admitted that he didn’t often meet anyone, but, when he did, he always gave them six wishes. He told them that they could have 3 wishes each.

  2. From frog integument to human skin: dermatological perspectives from frog skin biology.

    Science.gov (United States)

    Haslam, Iain S; Roubos, Eric W; Mangoni, Maria Luisa; Yoshizato, Katsutoshi; Vaudry, Hubert; Kloepper, Jennifer E; Pattwell, David M; Maderson, Paul F A; Paus, Ralf

    2014-08-01

    For over a century, frogs have been studied across various scientific fields, including physiology, embryology, neuroscience, (neuro)endocrinology, ecology, genetics, behavioural science, evolution, drug development, and conservation biology. In some cases, frog skin has proven very successful as a research model, for example aiding in the study of ion transport through tight epithelia, where it has served as a model for the vertebrate distal renal tubule and mammalian epithelia. However, it has rarely been considered in comparative studies involving human skin. Yet, despite certain notable adaptations that have enabled frogs to survive in both aquatic and terrestrial environments, frog skin has many features in common with human skin. Here we present a comprehensive overview of frog (and toad) skin ontogeny, anatomy, cytology, neuroendocrinology and immunology, with special attention to its unique adaptations as well as to its similarities with the mammalian integument, including human skin. We hope to provide a valuable reference point and a source of inspiration for both amphibian investigators and mammalian researchers studying the structural and functional properties of the largest organ of the vertebrate body.

  3. Effects of changing climate on aquatic habitat and connectivity for remnant populations of a wide-ranging frog species in an arid landscape

    Science.gov (United States)

    Pilliod, David S.; Arkle, Robert S.; Robertson, Jeanne M; Murphy, Melanie; Funk, W. Chris

    2015-01-01

    Amphibian species persisting in isolated streams and wetlands in desert environments can be susceptible to low connectivity, genetic isolation, and climate changes. We evaluated the past (1900–1930), recent (1981–2010), and future (2071–2100) climate suitability of the arid Great Basin (USA) for the Columbia spotted frog (Rana luteiventris) and assessed whether changes in surface water may affect connectivity for remaining populations. We developed a predictive model of current climate suitability and used it to predict the historic and future distribution of suitable climates. We then modeled changes in surface water availability at each time period. Finally, we quantified connectivity among existing populations on the basis of hydrology and correlated it with interpopulation genetic distance. We found that the area of the Great Basin with suitable climate conditions has declined by approximately 49% over the last century and will likely continue to decline under future climate scenarios. Climate conditions at currently occupied locations have been relatively stable over the last century, which may explain persistence at these sites. However, future climates at these currently occupied locations are predicted to become warmer throughout the year and drier during the frog's activity period (May – September). Fall and winter precipitation may increase, but as rain instead of snow. Earlier runoff and lower summer base flows may reduce connectivity between neighboring populations, which is already limited. Many of these changes could have negative effects on remaining populations over the next 50–80 years, but milder winters, longer growing seasons, and wetter falls might positively affect survival and dispersal. Collectively, however, seasonal shifts in temperature, precipitation, and stream flow patterns could reduce habitat suitability and connectivity for frogs and possibly other aquatic species inhabiting streams in this arid region.

  4. The role of extensional viscosity in frog tongue projection

    Science.gov (United States)

    Noel, Alexis; Wagner, Caroline; McKinley, Gareth; Mendelson, Joe; Hu, David

    2014-11-01

    Frogs and other amphibians capture insects through high-speed tongue projection, some achieving tongue accelerations of over fifty times gravity. In this experimental study, we investigate how a frog's sticky saliva enables high-speed prey capture. At the Atlanta zoo, we used high-speed video to film the trajectory of frog tongues during prey capture. We have also designed and built a portable extensional rheometer; by following the capillary-driven thinning in the diameter of a thread of saliva we characterize the relaxation time and extensional viscosity and so infer the adhesive force between the frog tongue and prey.

  5. Faint Infrared-Excess Field Galaxies FROGs

    CERN Document Server

    Moustakas, L A; Zepf, S E; Bunker, A J

    1997-01-01

    Deep near-infrared and optical imaging surveys in the field reveal a curious population of galaxies that are infrared-bright (I-K>4), yet with relatively blue optical colors (V-I20, is high enough that if placed at z>1 as our models suggest, their space densities are about one-tenth of phi-*. The colors of these ``faint red outlier galaxies'' (fROGs) may derive from exceedingly old underlying stellar populations, a dust-embedded starburst or AGN, or a combination thereof. Determining the nature of these fROGs, and their relation with the I-K>6 ``extremely red objects,'' has implications for our understanding of the processes that give rise to infrared-excess galaxies in general. We report on an ongoing study of several targets with HST & Keck imaging and Keck/LRIS multislit spectroscopy.

  6. Low levels of the herbicide atrazine alter sex ratios and reduce metamorphic success in Rana pipiens tadpoles raised in outdoor mesocosms.

    Science.gov (United States)

    Langlois, Valérie S; Carew, Amanda C; Pauli, Bruce D; Wade, Michael G; Cooke, Gerard M; Trudeau, Vance L

    2010-04-01

    There are conflicting reports regarding the effects of atrazine (ATZ) on amphibian development. Therefore, further studies are needed to examine the potential mechanisms of action of ATZ in amphibians. Our aim in this study was to determine whether low concentrations of ATZ affect gonadal development and metamorphosis in the Northern leopard frog, Rana pipiens. Tadpoles were exposed in outdoor mesocosms to nominal concentrations of 0.1 and 1.8 microg/L of formulated ATZ from Gosner stage 27 (G27) to metamorphic climax (G42). Exposure to 17alpha-ethinylestradiol (EE2; 1.5 microg/L) provided a positive control for induction of testicular oocytes in males. Endocrine-related gene expression and gonadal histopathology were examined at G42 and in a subset of premetamorphic G34 tadpoles that failed to metamorphose. Gonadal gross morphology revealed that the 1.8-microg/L ATZ treatment produced 20% more females compared with the control. Histologic analysis revealed that 22% of EE2-treated males had testicular oocytes, whereas none were observed in any animals from the control or either ATZ groups. ATZ increased brain estrogen receptor alpha mRNA to 2.5 times that of the control at premetamorphosis and altered liver levels of 5beta-reductase activity at metamorphosis. In contrast, brain aromatase mRNA level and activity did not change. ATZ treatments significantly reduced metamorphic success (number of animals reaching metamorphosis) without affecting body weight, snout-vent length, or age at metamorphosis. Gene expression analysis indicated that ATZ decreased the expression of deiodinase type 3 in the tail at premetamorphosis. Our study indicates that exposure to low concentrations of ATZ in experimental mesocosms alters gonadal differentiation and metamorphosis in developing R. pipiens.

  7. Sialyl-glycoconjugates in cholesterol-rich microdomains of P388 cells are the triggers for apoptosis induced by Rana catesbeiana oocyte ribonuclease.

    Science.gov (United States)

    Ogawa, Y; Sugawara, S; Tatsuta, T; Hosono, M; Nitta, K; Fujii, Y; Kobayashi, H; Fujimura, T; Taka, H; Koide, Y; Hasan, I; Matsumoto, R; Yasumitsu, H; Kanaly, R A; Kawsar, S M A; Ozeki, Y

    2014-02-01

    SBL/RC-RNase was originally isolated from frog (Rana catesbeiana) oocytes and purified as a novel sialic acid-binding lectin (SBL) that displayed strong anti-cancer activity. SBL was later shown to be identical to a ribonuclease (RC-RNase) from oocytes of the same species. The administration of SBL/RC-RNase induced apoptosis (with nuclear condensation and DNA fragmentation) in mouse leukemia P388 cells but did not kill umbilical vein endothelial or fibroblast cells derived from normal tissues. The cytotoxic activity of SBL/RC-RNase was inhibited by desialylation of P388 cells and/or the co-presence of free bovine submaxillary mucin. FACS analysis showed that SBL/RC-RNase was incorporated into cells after attachment to cholesterol-rich microdomains. Addition of the cholesterol remover methyl-β-cyclodextrin reduced SBL/RC-RNase-induced apoptosis. Apoptosis occurred through the caspase-3 pathway following activation of caspase-8 by SBL/RC-RNase. A heat shock cognate protein (Hsc70) and a heat shock protein (Hsp70) (each 70 kDa) on the cell membrane were shown to bind to SBL/RC-RNase by mass spectrometric and flow cytometric analyses. Quercetin, an inhibitor of Hsc70 and Hsp70, significantly reduced SBL/RC-RNase-induced apoptosis. Taken together, our findings suggest that sialyl-glycoconjugates present in cholesterol-rich microdomains form complexes with Hsc70 or Hsp70 that act as triggers for SBL/RC-RNase to induce apoptosis through a pathway involving the activation of caspase-3 and caspase-8.

  8. A perchlorate sensitive iodide transporter in frogs

    OpenAIRE

    Carr, Deborah L.; James A. Carr; Ray E. Willis; Pressley, Thomas A.

    2008-01-01

    Nucleotide sequence comparisons have identified a gene product in the genome database of African clawed frogs (Xenopus laevis) as a probable member of the solute carrier family of membrane transporters. To confirm its identity as a putative iodide transporter, we examined the function of this sequence after heterologous expression in mammalian cells. A green monkey kidney cell line transfected with the Xenopus nucleotide sequence had significantly greater 125I uptake than sham-transfected con...

  9. Variation and Sexual Dimorphism of Body Size in the Plateau Brown Frog along an Altitudinal Gradient

    Institute of Scientific and Technical Information of China (English)

    Xueyun FENG; Wei CHEN; Junhua HU; Jianping JIANG

    2015-01-01

    Variation in body size and sexual size dimorphism (SSD) can have important consequences for animal ecology, behavior, population dynamics and the evolution of life-history traits. Organisms are expected to be larger in colder climate (i.e., Bergmann’s rule) and SSD varies with body size (i.e., Rensch’s rule). However, the underlying mechanisms are still elusive. The plateau brown frog (Rana kukunoris), a medium-sized anuran species with female-biased SSD, is endemic to the Qinghai-Tibetan Plateau (QTP). From 1797 m (Maoxiang’ping) to 3453 m (Heihe’qiao) in the eastern margin of the QTP, we surveyed 10 populations of R. kukunoris and collected phalanges and snout vent length (SVL) data for 258 adult individuals (199 males versus 59 females). Based on these data, we explored how body size and SSD varying along the altitudinal gradient and examined the corresponding effects of temperature. We found body size to be larger at higher altitude for males but not for females, with likely effects from the temperature on the variation in male body size. Sex differences in growth rates may be the main cause of the variation in SSD. Our results suggested that only males follow the Bergmann’s rule and variation in SSD of R. kukunoris do not support the Rensch’s rule and its inverse. Therefore, the variations of body size can be different between sexes and the applicability of both Bergmann’s rule and Rensch’s rule should depend on species and environment where they live.

  10. Giants, dwarfs and the environment - metamorphic trait plasticity in the common frog.

    Directory of Open Access Journals (Sweden)

    Franziska Grözinger

    Full Text Available In order to understand adaptation processes and population dynamics, it is central to know how environmental parameters influence performance of organisms within populations, including their phenotypes. The impact of single or few particular parameters in concert was often assessed in laboratory and mesocosm experiments. However, under natural conditions, with many biotic and abiotic factors potentially interacting, outcomes on phenotypic changes may be different. To study the potential environmental impact on realized phenotypic plasticity within a natural population, we assessed metamorphic traits (developmental time, size and body mass in an amphibian species, the European common frog Rana temporaria, since a larval amphibians are known to exhibit high levels of phenotypic plasticity of these traits in response to habitat parameters and, b the traits' features may strongly influence individuals' future performance and fitness. In 2007 we studied these metamorphic traits in 18 ponds spread over an area of 28 km2. A subset of six ponds was reinvestigated in 2009 and 2010. This study revealed locally high variances in metamorphic traits in this presumed generalist species. We detected profound differences between metamorphing froglets (up to factor ten; both between and within ponds, on a very small geographic scale. Parameters such as predation and competition as well as many other pond characteristics, generally expected to have high impact on development, could not be related to the trait differences. We observed high divergence of patterns of mass at metamorphosis between ponds, but no detectable pattern when metamorphic traits were compared between ponds and years. Our results indicate that environment alone, i.e. as experienced by tadpoles sharing the same breeding pond, can only partly explain the variability of metamorphic traits observed. This emphasizes the importance to assess variability of reaction norms on the individual level to

  11. Evidence of fast serotonin transmission in frog slowly adapting type 1 responses.

    Science.gov (United States)

    Press, Daniel; Mutlu, Sevinç; Güçlü, Burak

    2010-01-01

    The Merkel cell-neurite (MCN) complex generates slowly adapting type 1 (SA1) response when mechanically stimulated. Both serotonin (5-HT) and glutamate have been implicated in the generation of normal SA1 responses, but previous studies have been inconclusive as to what their roles are or how synaptic transmission occurs. In this study, excised dorsal skin patches from common water frogs (Rana ridibunda) were stimulated by von Frey hairs during perfusion in a tissue bath, and single-unit spike activity was recorded from SA1 fibres. Serotonin had no significant effect on the SA1 response at low (10 µM) concentration, significantly increased activity in a force-independent manner at 100 µM, but decreased activity with reduced responsiveness to force at 1 mM. Glutamate showed no effect on the responsiveness to force at 100 µM. MDL 72222 (100 µM), an ionotropic 5-HT3 receptor antagonist, completely abolished the responsiveness to force, suggesting that serotonin is released from Merkel cells as a result of mechanical stimulation, and activated 5-HT3 receptors on the neurite. The metabotropic 5-HT2 receptor antagonist, ketanserin, greatly reduced the SA1 fibre's responsiveness to force, as did the non-specific glutamate receptor antagonist, kynurenic acid. This supports a role for serotonin and glutamate as neuromodulators in the MCN complex, possibly by activation and/or inhibition of signalling cascades in the Merkel cell associated with vesicle release. Additionally, it was observed that SA1 responses contained a force-independent component, similar to a dynamic response observed during mechanical vibrations.

  12. Efficient induction of spawning of Northern leopard frogs (Lithobates pipiens) during and outside the natural breeding season

    Science.gov (United States)

    2013-01-01

    Background Amphibian declines are now recognized globally. It is also well known that many anurans do not reproduce easily in captivity, especially when held over long periods, or if they require hibernation before breeding. A simple method to induce spawning and subsequent development of large numbers of healthy tadpoles is therefore required to meet research and conservation goals. Methods The method is based on simultaneous injection of both female and male leopard frogs, Lithobates pipiens (formerly called Rana pipiens) with a cocktail of a gonadotropin-releasing hormone agonist (GnRH-A) and a dopamine antagonist. We call this the AMPHIPLEX method, which is derived from the combination of the words amphibian and amplexus. Following injection, the animals are thereby induced, and perform amplexus and natural fertilization under captive conditions. Results We tested combinations of a GnRH agonist with 2 different dopamine antagonists in L. pipiens in the breeding season. The combination of des-Gly10, D-Ala6, Pro-NHEt9-GnRH (0.4 micrograms/g body weight; GnRH-A) with metoclopramide hydrochloride (10 micrograms/g body weight; MET) or domperidone (DOM) were equally effective, producing 89% and 88% successful spawning, respectively. This yielded more than 44,000 eggs for the 16/18 females that ovulated in the GnRH-A+MET group, and more than 39,000 eggs for the 15/17 females that ovulated in the GnRH-A+DOM group. We further tested the GnRH-A+MET in frogs collected in the wild in late autumn and hibernated for a short period under laboratory conditions, and report a low spawning success (43%). However, GnRH-A priming 24 hours prior to injections of the GnRH-A+MET cocktail in animals hibernated for 5–6 weeks produced out-of-season spawning (89%) and fertilization (85%) comparable to those we observed for in-season spawning. Assessment of age and weight at metamorphosis indicated that L. pipiens tadpoles resulting from out-of-season spawning grew normally and

  13. Frogs and snakes from the island of Morotai (Moluccas)

    NARCIS (Netherlands)

    Brongersma, L.D.

    1948-01-01

    Van Kampen (1924, p. 284) mentions only two species of frogs from Morotai Island; the identification of one of these was considered to be doubtful. Of snakes De Jong (1928, p. 149) records five species from this island. The study of a small collection of frogs and snakes from Morotai, presented to t

  14. Coleman Revisited: School Segregation, Peers, and Frog Ponds

    Science.gov (United States)

    Goldsmith, Pat Rubio

    2011-01-01

    Students from minority segregated schools tend to achieve and attain less than similar students from White segregated schools. This study examines whether peer effects can explain this relationship using normative models and frog-pond models. Normative models (where peers become alike) suggest that minority schoolmates are a liability. Frog-pond…

  15. Using a Phototransduction System to Monitor the Isolated Frog Heart

    Science.gov (United States)

    Stephens, Philip J.

    2015-01-01

    A simple and inexpensive method of monitoring the movement of an isolated frog heart provides comparable results to those obtained with a force transducer. A commercially available photoresistor is integrated into a Wheatstone bridge circuit, and the output signal is interfaced directly with a recording device. An excised, beating frog heart is…

  16. Using a Phototransduction System to Monitor the Isolated Frog Heart

    Science.gov (United States)

    Stephens, Philip J.

    2015-01-01

    A simple and inexpensive method of monitoring the movement of an isolated frog heart provides comparable results to those obtained with a force transducer. A commercially available photoresistor is integrated into a Wheatstone bridge circuit, and the output signal is interfaced directly with a recording device. An excised, beating frog heart is…

  17. N.C. Rana: The Life of a `Comet' in the Astrophysical World

    CERN Document Server

    Mukhopadhyay, Utpal

    2014-01-01

    Narayan Chandra Rana, a person with extraordinary potential from a remote village of Bengal, India, came into the limelight of the international scientific world through his exceptional talent, zeal and courage. In his very short life-span, he excelled not only into various branches of astrophysics, but also took a leading role in science popularization, text book writing etc. In this paper, life and works of that budding scientist of India have been discussed from multifarious viewpoints.

  18. O sufixo -rana no português falado pelo caboclo amazonense

    Directory of Open Access Journals (Sweden)

    Orlando Azevedo

    2012-12-01

    Full Text Available O artigo aborda a formação de palavras com o sufixo -rana no português falado em seis localidades situadas na região do Médio Solimões no Estado do Amazonas. O corpus para a análise foi retirado das respostas dos informantes ao questionário semântico-lexical da tese de Azevedo¹, que está em andamento e que trata da variação dialetal na região do Baixo Amazonas e do Médio Solimões. Para os propósitos da pesquisa, nossa fundamentação foi baseada no modelo da morfologia gerativa a fim de que fosse possível a construção de uma regra aplicável às bases que esse sufixo seleciona. Os resultados mostraram a existência de formações neológicas, uma vez que não foram encontradas em obras lexicográficas. Além disso, o sufixo -rana ao selecionar bases substantivas não muda a classe gramatical da palavra primitiva ao formar novos substantivos. Devido à regularidade, foi possível estabelecermos uma regra de formação de palavras para o sufixo -rana no português falado nessa região da Amazônia brasileira.

  19. 49 CFR 213.355 - Frog guard rails and guard faces; gage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Frog guard rails and guard faces; gage. 213.355... Higher § 213.355 Frog guard rails and guard faces; gage. The guard check and guard face gages in frogs... distance between the gage line of a frog to the guard line 1 of its guard rail or guarding face,...

  20. 黑斑蛙、虎纹蛙和牛蛙皮肤的比较组织学%Comparative Histology of the Skin of Rana Nigromaculata,Rana Rugulosa and Rana Catesbeiana

    Institute of Scientific and Technical Information of China (English)

    李洋; 金磊; 李昌春; 唐宝将; 张盛周

    2009-01-01

    应用H.E和V.G胶原染色法对黑斑蛙(Rana nigromaculata)、虎纹蛙(Rana rugulosa)和牛蛙(Rana catesbeiana)皮肤进行了组织学观察和参数测量与比较.结果表明:三种蛙皮肤组织结构相似,但皮肤厚度、各组织层相对厚度及腺体密度存在较明显的种间差异和部位差异.虎纹蛙的皮肤最厚(0.44-0.68mm),牛蛙其次(0.28-0.60mm),黑斑蛙最薄(0.19-0.38mm);在三种蛙中,黑斑蛙躯体多数部位表皮相对厚度为15.1%-22.6%,较虎纹蛙(10.9%-17.7%)和牛蛙(9.9%-21.8%)厚.虎纹蛙和牛蛙皮肤胶原纤维层相对厚度分别为59.9%-68.7%和51.6%-75.3%,较黑斑蛙(44.4%-69.0%)厚;黑斑蛙和虎纹蛙躯体多数部位的颗粒腺密度(4.5-23.1个/mm2;8.9-25.3个/mm2)和粘液腺(54.1-152.2个/mm2;68.6-127.5个/mm2)较牛蛙(1.4-10.8个/mm2;16.8-39.3个/mm2)高.研究结果可供蛙类皮肤的合理开发利用参考.