Application of mixture experimental design to simvastatin apparent solubility predictions in the microemulsifion formed by self-microemulsifying.

Science.gov (United States)

Meng, Jian; Zheng, Liangyuan

2007-09-01

Self-microemulsifying drug delivery systems (SMEDDS) are useful to improve the bioavailability of poorly water-soluble drugs by increasing their apparent solubility through solubilization. However, very few studies, to date, have systematically examined the level of drug apparent solubility in o/w microemulsion formed by self-microemulsifying. In this study, a mixture experimental design was used to simulate the influence of the compositions on simvastatin apparent solubility quantitatively through an empirical model. The reduced cubic polynomial equation successfully modeled the evolution of simvastatin apparent solubility. The results were presented using an analysis of response surface showing a scale of possible simvastatin apparent solubility between 0.0024 ~ 29.0 mg/mL. Moreover, this technique showed that simvastatin apparent solubility was mainly influenced by microemulsion concentration and, suggested that the drug would precipitate in the gastrointestinal tract due to dilution by gastrointestinal fluids. Furthermore, the model would help us design the formulation to maximize the drug apparent solubility and avoid precipitation of the drug.

I222 crystal form of despentapeptide (B26-B30) insulin provides new insights into the properties of monomeric insulin.

Science.gov (United States)

Whittingham, Jean L; Youshang, Zhang; Záková, Lenka; Dodson, Eleanor J; Turkenburg, Johan P; Brange, Jens; Dodson, G Guy

2006-05-01

Despentapeptide (des-B26-B30) insulin (DPI), an active modified insulin, has been crystallized in the presence of 20% acetic acid pH 2. A crystal structure analysis to 1.8 A spacing (space group I222) revealed that the DPI molecule, which is unable to make beta-strand interactions for physiological dimer formation and is apparently monomeric in solution, formed an alternative lattice-generated dimer. The formation of this dimer involved interactions between surfaces which included the B9-B19 alpha-helices (usually buried by the dimer-dimer contacts within the native hexamer). The two crystallographically independent molecules within the dimer were essentially identical and were similar in conformation to T-state insulin as seen in the T(6) insulin hexamer. An unusual feature of each molecule in the dimer was the presence of two independent conformations at the B-chain C-terminus (residues B20-B25). Both conformations were different from that of native insulin, involving a 3.5 A displacement of the B20-B23 beta-turn and a repositioning of residue PheB25 such that it made close van der Waals contact with the main body of the molecule, appearing to stabilize the B-chain C-terminus.

A scanning tunneling microscopy investigation of the phases formed by the sulfur adsorption on Au(100) from an alkaline solution of 1,4-piperazine(bis)-dithiocarbamate of potassium

Energy Technology Data Exchange (ETDEWEB)

Martínez, Javier A. [Instituto de Ciencia y Tecnología de Materiales (IMRE), Universidad de La Habana, Zapata y G, El Vedado, Plaza de la Revolución, La Habana 10400 (Cuba); Valenzuela B, José [Centro de Nanociencias y Nanotecnología (CNyN), Universidad Nacional Autónoma de México (UNAM) , km 107 Carretera Tijuana-Ensenada, Ensenada, BC 22860 (Mexico); Cao Milán, R. [Facultad de Química, Universidad de La Habana, Zapata y G, El Vedado, Plaza de la Revolución, La Habana 10400 (Cuba); Herrera, José [Instituto de Ciencia y Tecnología de Materiales (IMRE), Universidad de La Habana, Zapata y G, El Vedado, Plaza de la Revolución, La Habana 10400 (Cuba); Farías, Mario H. [Centro de Nanociencias y Nanotecnología (CNyN), Universidad Nacional Autónoma de México (UNAM) , km 107 Carretera Tijuana-Ensenada, Ensenada, BC 22860 (Mexico); Hernández, Mayra P., E-mail: mayrap@fisica.uh.cu [Instituto de Ciencia y Tecnología de Materiales (IMRE), Universidad de La Habana, Zapata y G, El Vedado, Plaza de la Revolución, La Habana 10400 (Cuba)

2014-11-30

Highlights: • New phases of sulfur on gold: hexamer and (√(2)×√(2)) were observed by STM. • Hexamers and (√(2)×√(2)) structures coexist with well-known octomers. • Formation of sulfur multilayer by K{sub 2}DTC{sub 2}pz hydrolysis under alkaline condition. • Top octomer layer have dynamic behavior while (√(2)×√(2)) and hexamer were static. • A model is presented to explain sulfur multilayer formation on Au(100). - Abstract: Piperazine-dithiocarbamate of potassium (K{sub 2}DTC{sub 2}pz) was used as a new precursor for the spontaneous deposition of sulfur on the Au(100) surface in alkaline solution. Two new sulfur phases were studied by scanning tunneling microscopy (STM). These phases were formed by six sulfur atoms (S{sub 6} phase, hexamer) and by four sulfur atoms (S{sub 4} phase, tetramer with (√(2)×√(2)) structure), and they were observed in coexistence with the well-known quasi-square patterns formed by eight sulfur atoms (S{sub 8} phase, octomer). A model was proposed where sulfur multilayers were formed by a (√(2)×√(2)) phase adsorbed directly on the gold surface while one of the other structures: hexamers or octomers were deposited on top. Sulfur layers were formed on gold terraces, vacancies and islands produced by lifting reconstructed surface. Sequential high-resolution STM images allowed the direct observation of the dynamic of the octomers, while the (√(2)×√(2)) structure remained static. Images also showed the reversible association/dissociation of the octomer.

A scanning tunneling microscopy investigation of the phases formed by the sulfur adsorption on Au(100) from an alkaline solution of 1,4-piperazine(bis)-dithiocarbamate of potassium

International Nuclear Information System (INIS)

Martínez, Javier A.; Valenzuela B, José; Cao Milán, R.; Herrera, José; Farías, Mario H.; Hernández, Mayra P.

2014-01-01

Highlights: • New phases of sulfur on gold: hexamer and (√(2)×√(2)) were observed by STM. • Hexamers and (√(2)×√(2)) structures coexist with well-known octomers. • Formation of sulfur multilayer by K 2 DTC 2 pz hydrolysis under alkaline condition. • Top octomer layer have dynamic behavior while (√(2)×√(2)) and hexamer were static. • A model is presented to explain sulfur multilayer formation on Au(100). - Abstract: Piperazine-dithiocarbamate of potassium (K 2 DTC 2 pz) was used as a new precursor for the spontaneous deposition of sulfur on the Au(100) surface in alkaline solution. Two new sulfur phases were studied by scanning tunneling microscopy (STM). These phases were formed by six sulfur atoms (S 6 phase, hexamer) and by four sulfur atoms (S 4 phase, tetramer with (√(2)×√(2)) structure), and they were observed in coexistence with the well-known quasi-square patterns formed by eight sulfur atoms (S 8 phase, octomer). A model was proposed where sulfur multilayers were formed by a (√(2)×√(2)) phase adsorbed directly on the gold surface while one of the other structures: hexamers or octomers were deposited on top. Sulfur layers were formed on gold terraces, vacancies and islands produced by lifting reconstructed surface. Sequential high-resolution STM images allowed the direct observation of the dynamic of the octomers, while the (√(2)×√(2)) structure remained static. Images also showed the reversible association/dissociation of the octomer

Analysis of the crystal structure of an active MCM hexamer.

Science.gov (United States)

Miller, Justin M; Arachea, Buenafe T; Epling, Leslie B; Enemark, Eric J

2014-09-29

In a previous Research article (Froelich et al., 2014), we suggested an MCM helicase activation mechanism, but were limited in discussing the ATPase domain because it was absent from the crystal structure. Here we present the crystal structure of a nearly full-length MCM hexamer that is helicase-active and thus has all features essential for unwinding DNA. The structure is a chimera of Sulfolobus solfataricus N-terminal domain and Pyrococcus furiosus ATPase domain. We discuss three major findings: 1) a novel conformation for the A-subdomain that could play a role in MCM regulation; 2) interaction of a universally conserved glutamine in the N-terminal Allosteric Communication Loop with the AAA+ domain helix-2-insert (h2i); and 3) a recessed binding pocket for the MCM ssDNA-binding motif influenced by the h2i. We suggest that during helicase activation, the h2i clamps down on the leading strand to facilitate strand retention and regulate ATP hydrolysis.

Mechanics of apparent horizons

International Nuclear Information System (INIS)

Collins, W.

1992-01-01

An equation for the variation in the surface area of an apparent horizon is derived which has the same form as the thermodynamic relation TdS=dQ. For a stationary vacuum black hole, the expression corresponding to a temperature equals the temperature of the event horizon. Also, if the black hole is perturbed infinitesimally by weak matter and gravitational fields, the area variation of the apparent horizon asymptotically approaches the Hartle-Hawking result for the event horizon. These results support the idea that a local version of black-hole thermodynamics in nonstationary systems can be constructed for apparent horizons

Cladribine and Fludarabine Nucleotides Induce Distinct Hexamers Defining a Common Mode of Reversible RNR Inhibition.

Science.gov (United States)

Wisitpitthaya, Somsinee; Zhao, Yi; Long, Marcus J C; Li, Minxing; Fletcher, Elaine A; Blessing, William A; Weiss, Robert S; Aye, Yimon

2016-07-15

The enzyme ribonucleotide reductase (RNR) is a major target of anticancer drugs. Until recently, suicide inactivation in which synthetic substrate analogs (nucleoside diphosphates) irreversibly inactivate the RNR-α2β2 heterodimeric complex was the only clinically proven inhibition pathway. For instance, this mechanism is deployed by the multifactorial anticancer agent gemcitabine diphosphate. Recently reversible targeting of RNR-α-alone coupled with ligand-induced RNR-α-persistent hexamerization has emerged to be of clinical significance. To date, clofarabine nucleotides are the only known example of this mechanism. Herein, chemoenzymatic syntheses of the active forms of two other drugs, phosphorylated cladribine (ClA) and fludarabine (FlU), allow us to establish that reversible inhibition is common to numerous drugs in clinical use. Enzyme inhibition and fluorescence anisotropy assays show that the di- and triphosphates of the two nucleosides function as reversible (i.e., nonmechanism-based) inhibitors of RNR and interact with the catalytic (C site) and the allosteric activity (A site) sites of RNR-α, respectively. Gel filtration, protease digestion, and FRET assays demonstrate that inhibition is coupled with formation of conformationally diverse hexamers. Studies in 293T cells capable of selectively inducing either wild-type or oligomerization-defective mutant RNR-α overexpression delineate the central role of RNR-α oligomerization in drug activity, and highlight a potential resistance mechanism to these drugs. These data set the stage for new interventions targeting RNR oligomeric regulation.

Novel Structures for the Excess Electron State of the Water Hexamer and the Interaction Forces Governing the Structures

International Nuclear Information System (INIS)

Lee, S.; Kim, J.; Lee, S.J.; Kim, K.S.

1997-01-01

The geometrical and electronic structures of partially hydrated electron systems, in particular, the water hexamer, which have been controversial for decades, have been clarified by an exhaustive search for possible low-lying energy structures. Several competing interaction forces governing the conformation have been examined for the first time. The low-lying energy structures are hybrid (or partially internal and partially surface) excess electron states. Our prediction is evidenced from excellent agreements with available experimental data. The vertical electron-detachment energies are mainly determined by the number of dangling H atoms (H d ) . copyright 1997 The American Physical Society

Codon-Precise, Synthetic, Antibody Fragment Libraries Built Using Automated Hexamer Codon Additions and Validated through Next Generation Sequencing

Directory of Open Access Journals (Sweden)

Laura Frigotto

2015-05-01

Full Text Available We have previously described ProxiMAX, a technology that enables the fabrication of precise, combinatorial gene libraries via codon-by-codon saturation mutagenesis. ProxiMAX was originally performed using manual, enzymatic transfer of codons via blunt-end ligation. Here we present Colibra™: an automated, proprietary version of ProxiMAX used specifically for antibody library generation, in which double-codon hexamers are transferred during the saturation cycling process. The reduction in process complexity, resulting library quality and an unprecedented saturation of up to 24 contiguous codons are described. Utility of the method is demonstrated via fabrication of complementarity determining regions (CDR in antibody fragment libraries and next generation sequencing (NGS analysis of their quality and diversity.

Relationship of colony-stimulating activity to apparent kill of human colony-forming cells by irradiation and hydroxyurea

International Nuclear Information System (INIS)

Broxmeyer, H.E.; Galbraith, P.R.; Baker, F.L.

1976-01-01

Suspensions of human bone marrow cells were subjected to 137 Cs irradiation in vitro and then cultured in semisolid agar medium. Cultures of irradiated cells were stimulated with colony-stimulating activity (CSA) of different potencies, and it was found that the amount of stimulation applied to cultures influenced the apparent kill of colony-forming cells (CFC). It was also found that the effects of irradiation on colony formation were not confined to CFC kill since medium conditioned by cells during irradiation exhibited stimulatory and inhibitory properties after treatment by 600 and 1000 rads, respectively. Studies in which irradiated cells were pretreated with hydroxyurea indicated that CFC in the DNA synthetic phase of the cell cycle were particularly sensitive to low doses of irradiation. The proliferative capacity of CFC surviving 1000 rads was undiminished as judged by their ability to form large colonies. Estimates of CFC kill by hydroxyurea were also affected by the level of CSA

The effects of oligomerization on Saccharomyces cerevisiae Mcm4/6/7 function

Directory of Open Access Journals (Sweden)

Davey Megan J

2010-09-01

Full Text Available Abstract Background Minichromosome maintenance proteins (Mcm 2, 3, 4, 5, 6 and 7 are related by sequence and form a variety of complexes that unwind DNA, including Mcm4/6/7. A Mcm4/6/7 trimer forms one half of the Mcm2-7 hexameric ring and can be thought of as the catalytic core of Mcm2-7, the replicative helicase in eukaryotic cells. Oligomeric analysis of Mcm4/6/7 suggests that it forms a hexamer containing two Mcm4/6/7 trimers, however, under certain conditions trimeric Mcm4/6/7 has also been observed. The functional significance of the different Mcm4/6/7 oligomeric states has not been assessed. The results of such an assessment would have implications for studies of both Mcm4/6/7 and Mcm2-7. Results Here, we show that Saccharomyces cerevisiae Mcm4/6/7 reconstituted from individual subunits exists in an equilibrium of oligomeric forms in which smaller oligomers predominate in the absence of ATP. In addition, we found that ATP, which is required for Mcm4/6/7 activity, shifts the equilibrium towards larger oligomers, likely hexamers of Mcm4/6/7. ATPγS and to a lesser extent ADP also shift the equilibrium towards hexamers. Study of Mcm4/6/7 complexes containing mutations that interfere with the formation of inter-subunit ATP sites (arginine finger mutants indicates that full activity of Mcm4/6/7 requires all of its ATP sites, which are formed in a hexamer and not a trimer. In keeping with this observation, Mcm4/6/7 binds DNA as a hexamer. Conclusions The minimal functional unit of Mcm4/6/7 is a hexamer. One of the roles of ATP binding by Mcm4/6/7 may be to stabilize formation of hexamers.

Storage hexamer utilization in two lepidopterans: differences correlated with the timing of egg formation

Directory of Open Access Journals (Sweden)

M.L. Pan

2001-04-01

Full Text Available Most insects produce two or more storage hexamers whose constituents and developmental profiles are sufficiently different to suggest specialization in the ways that they support metamorphosis and reproduction. Hexamerin specializations are compared here in the Cecropia moth (Hyalophora cecropia, which produces eggs during the pupal-adult molt, and the Monarch butterfly (Danaus plexippus, which produces eggs under long-day conditions after adult eclosion. In both sexes of both species, reserves of arylphorin (ArH were exhausted by the end of metamorphosis. In Cecropia, the same was true for the high-methionine hexamerins, V-MtH and M-MtH. But in short day Monarch females 20-30% of the pupal reserves of V-MtH and M-MtH survived metamorphosis, persisting until long-day conditions were imposed to stimulate egg formation. Differences in storage sites have been documented in other lepidopterans, with MtH reserves being found primarily in fat body protein granules and the ArH reserve being found primarily in the hemolymph. Similar differences could explain how a fraction of the MtH's, but not of ArH, escapes utilization during metamorphosis in a species with post-eclosion egg formation. No differences in utilization schedules were detected between V- and M-MtH, despite divergent compositions and antigenic reactivity.

Apparent Contact Angle and Contact Angle Hysteresis on Liquid Infused Surfaces

OpenAIRE

Semprebon, Ciro; McHale, Glen; Kusumaatmaja, Halim

2016-01-01

We theoretically investigate the apparent contact angle and contact angle hysteresis of a droplet placed on a liquid infused surface. We show that the apparent contact angle is not uniquely defined by material parameters, but also has a strong dependence on the relative size between the droplet and its surrounding wetting ridge formed by the infusing liquid. We derive a closed form expression for the contact angle in the limit of vanishing wetting ridge, and compute the correction for small b...

Optimal geometries and harmonic vibrational frequencies of the global minima of water clusters (H2O)n, n = 2–6, and several hexamer local minima at the CCSD(T) level of theory

Energy Technology Data Exchange (ETDEWEB)

Miliordos, Evangelos; Aprà, Edoardo; Xantheas, Sotiris S.

2013-01-01

We report the first optimum geometries and harmonic vibrational frequencies for the ring pentamer and several water hexamer (prism, cage, cyclic and two book) at the CCSD(T)/aug-cc-pVDZ level of theory. All five hexamer isomer minima previously reported by MP2 are also minima on the CCSD(T) potential energy surface (PES). In addition, all CCSD(T) minimum energy structures for the n=2-6 cluster isomers are quite close to the ones previously obtained by MP2 on the respective PESs, as confirmed by a modified Procrustes analysis that quantifies the difference between any two cluster geometries. The CCSD(T) results confirm the cooperative effect of the homodromic ring networks (systematic contraction of the nearest-neighbor (nn) intermolecular separations with cluster size) previously reported by MP2, albeit with O-O distances shorter by ~0.02 Å, indicating that MP2 overcorrects this effect. The harmonic frequencies at the minimum geometries were obtained by the double differentiation of the CCSD(T) energy using an efficient scheme based on internal coordinates that reduces the number of required single point energy evaluations by ~15% when compared to the corresponding double differentiation using Cartesian coordinates. Negligible differences between MP2 and CCSD(T) are found for the librational modes, while uniform increases of ~15 and ~25 cm^-1 are observed for the bending and “free” OH harmonic frequencies. The largest differences between MP2 and CCSD(T) are observed for the harmonic hydrogen bonded frequencies. The CCSD(T) red shifts from the monomer frequencies (Δω) are smaller than the MP2 ones, due to the fact that the former produces shorter elongations (ΔR) of the respective hydrogen bonded OH lengths from the monomer value with respect to the latter. Both the MP2 and CCSD(T) results for the hydrogen bonded frequencies were found to closely follow the relation - Δω = s · ΔR, with a rate of s = 20.3 cm^-1 / 0.001 Å. The CCSD

Mutant p97 exhibits species-specific changes of its ATPase activity and compromises the UBXD9-mediated monomerisation of p97 hexamers.

Science.gov (United States)

Rijal, Ramesh; Arhzaouy, Khalid; Strucksberg, Karl-Heinz; Cross, Megan; Hofmann, Andreas; Schröder, Rolf; Clemen, Christoph S; Eichinger, Ludwig

2016-01-01

p97 (VCP) is a homo-hexameric triple-A ATPase that exerts a plethora of cellular processes. Heterozygous missense mutations of p97 cause at least five human neurodegenerative disorders. However, the specific molecular consequences of p97 mutations are hitherto widely unknown. Our in silico structural models of human and Dictyostelium p97 showed that the disease-causing human R93C, R155H, and R155C as well as Dictyostelium R154C, E219K, R154C/E219K p97 mutations constitute variations in surface-exposed locations. In-gel ATPase activity measurements of p97 monomers and hexamers revealed significant mutation- and species-specific differences. While all human p97 mutations led to an increase in ATPase activity, no changes could be detected for the Dictyostelium R154C mutant, which is orthologous to human R155C. The E219K mutation led to an almost complete loss of activity, which was partially recuperated in the R154C/E219K double-mutant indicating p97 inter-domain communication. By means of co-immunoprecipitation experiments we identified an UBX-domain containing Dictyostelium protein as a novel p97 interaction partner. We categorized all UBX-domain containing Dictyostelium proteins and named the interaction partner UBXD9. Pull-down assays and surface plasmon resonance analyses of Dictyostelium UBXD9 or the human orthologue TUG/ASPL/UBXD9 demonstrated direct interactions with p97 as well as species-, mutation- and ATP-dependent differences in the binding affinities. Sucrose density gradient assays revealed that both human and Dictyostelium UBXD9 proteins very efficiently disassembled wild-type, but to a lesser extent mutant p97 hexamers into monomers. Our results are consistent with a scenario in which p97 point mutations lead to differences in enzymatic activities and molecular interactions, which in the long-term result in a late-onset and progressive multisystem disease. Copyright © 2016 The Authors. Published by Elsevier GmbH.. All rights reserved.

Apparent contact angle and contact angle hysteresis on liquid infused surfaces.

Science.gov (United States)

Semprebon, Ciro; McHale, Glen; Kusumaatmaja, Halim

2016-12-21

We theoretically investigate the apparent contact angle and contact angle hysteresis of a droplet placed on a liquid infused surface. We show that the apparent contact angle is not uniquely defined by material parameters, but also has a dependence on the relative size between the droplet and its surrounding wetting ridge formed by the infusing liquid. We derive a closed form expression for the contact angle in the limit of vanishing wetting ridge, and compute the correction for small but finite ridge, which corresponds to an effective line tension term. We also predict contact angle hysteresis on liquid infused surfaces generated by the pinning of the contact lines by the surface corrugations. Our analytical expressions for both the apparent contact angle and contact angle hysteresis can be interpreted as 'weighted sums' between the contact angles of the infusing liquid relative to the droplet and surrounding gas phases, where the weighting coefficients are given by ratios of the fluid surface tensions.

CCD photometry of apparent dwarf galaxies in Fornax

International Nuclear Information System (INIS)

Phillipps, S.; Grimley, P.L.; Disney, M.J.; Cawson, M.G.M.; Kibblewhite, E.J.

1986-01-01

Blue and red CCD surface photometry of two apparent dwarf galaxies in the Fornax cluster region is presented. Luminosity profiles are derived and their form discussed. The fainter galaxy resembles an archetypal diffuse dwarf elliptical but the brighter of the pair is either an unusual red dwarf or a background galaxy in chance juxtaposition. (author)

Estimation of apparent kinetic parameters of polymer pyrolysis with complex thermal degradation behavior

International Nuclear Information System (INIS)

Srimachai, Taranee; Anantawaraskul, Siripon

2010-01-01

Full text: Thermal degradation behavior during polymer pyrolysis can typically be described using three apparent kinetic parameters (i.e., pre-exponential factor, activation energy, and reaction order). Several efficient techniques have been developed to estimate these apparent kinetic parameters for simple thermal degradation behavior (i.e., single apparent pyrolysis reaction). Unfortunately, these techniques cannot be directly extended to the case of polymer pyrolysis with complex thermal degradation behavior (i.e., multiple concurrent reactions forming single or multiple DTG peaks). In this work, we proposed a deconvolution method to determine the number of apparent reactions and estimate three apparent kinetic parameters and contribution of each reaction for polymer pyrolysis with complex thermal degradation behavior. The proposed technique was validated with the model and experimental pyrolysis data of several polymer blends with known compositions. The results showed that (1) the number of reaction and (2) three apparent kinetic parameters and contribution of each reaction can be estimated reasonably. The simulated DTG curves with estimated parameters also agree well with experimental DTG curves. (author)

Circadian clock protein KaiC forms ATP-dependent hexameric rings and binds DNA.

Science.gov (United States)

Mori, Tetsuya; Saveliev, Sergei V; Xu, Yao; Stafford, Walter F; Cox, Michael M; Inman, Ross B; Johnson, Carl H

2002-12-24

KaiC from Synechococcus elongatus PCC 7942 (KaiC) is an essential circadian clock protein in cyanobacteria. Previous sequence analyses suggested its inclusion in the RecADnaB superfamily. A characteristic of the proteins of this superfamily is that they form homohexameric complexes that bind DNA. We show here that KaiC also forms ring complexes with a central pore that can be visualized by electron microscopy. A combination of analytical ultracentrifugation and chromatographic analyses demonstrates that these complexes are hexameric. The association of KaiC molecules into hexamers depends on the presence of ATP. The KaiC sequence does not include the obvious DNA-binding motifs found in RecA or DnaB. Nevertheless, KaiC binds forked DNA substrates. These data support the inclusion of KaiC into the RecADnaB superfamily and have important implications for enzymatic activity of KaiC in the circadian clock mechanism that regulates global changes in gene expression patterns.

Thermodynamics of interacting holographic dark energy with the apparent horizon as an IR cutoff

International Nuclear Information System (INIS)

Sheykhi, Ahmad

2010-01-01

As soon as an interaction between holographic dark energy and dark matter is taken into account, the identification of an IR cutoff with the Hubble radius H -1 , in a flat universe, can simultaneously drive accelerated expansion and solve the coincidence problem. Based on this, we demonstrate that in a non-flat universe the natural choice for the IR cutoff could be the apparent horizon radius, r-tilde A =1/√(H 2 +k/a 2 ). We show that any interaction of dark matter with holographic dark energy, whose infrared cutoff is set by the apparent horizon radius, implies an accelerated expansion and a constant ratio of the energy densities of both components thus solving the coincidence problem. We also verify that for a universe filled with dark energy and dark matter, the Friedmann equation can be written in the form of the modified first law of thermodynamics, dE = T h dS h + WdV, at the apparent horizon. In addition, the generalized second law of thermodynamics is fulfilled in a region enclosed by the apparent horizon. These results hold regardless of the specific form of dark energy and interaction term. Our study might reveal that in an accelerating universe with spatial curvature, the apparent horizon is a physical boundary from the thermodynamical point of view.

Irreversible thermodynamics of dark energy on the entropy-corrected apparent horizon

Energy Technology Data Exchange (ETDEWEB)

Karami, K; Sahraei, N [Department of Physics, University of Kurdistan, Pasdaran Street, Sanandaj (Iran, Islamic Republic of); Jamil, M, E-mail: KKarami@uok.ac.i, E-mail: mjamil@camp.nust.edu.p [Center for Advanced Mathematics and Physics (CAMP), National University of Sciences and Technology (NUST), Islamabad (Pakistan)

2010-10-15

We study the irreversible (non-equilibrium) thermodynamics of the Friedmann-Robertson-Walker (FRW) universe containing only dark energy. Using the modified entropy-area relation that is motivated by loop quantum gravity, we calculate the entropy-corrected form of the apparent horizon of the FRW universe.

Crystal structure and self-interaction of the type VI secretion tail-tube protein from enteroaggregative Escherichia coli.

Directory of Open Access Journals (Sweden)

Badreddine Douzi

Full Text Available The type VI secretion system (T6SS is a widespread machine used by bacteria to control their environment and kill or disable bacterial species or eukaryotes through toxin injection. The T6SS comprises a central tube formed of stacked hexamers of hemolysin co-regulated proteins (Hcp and terminated by a trimeric valine-glycine repeat protein G (VgrG component, the cell puncturing device. A contractile tail sheath, formed by the TssB and TssC proteins, surrounds this tube. This syringe-like machine has been compared to an inverted phage, as both Hcp and VgrG share structural homology with tail components of Caudovirales. Here we solved the crystal structure of a tryptophan-substituted double mutant of Hcp1 from enteroaggregative Escherichia coli and compared it to the structures of other Hcps. Interestingly, we observed that the purified Hcp native protein is unable to form tubes in vitro. To better understand the rationale for observation, we measured the affinity of Hcp1 hexamers with themselves by surface plasmon resonance. The intra-hexamer interaction is weak, with a KD value of 7.2 µM. However, by engineering double cysteine mutants at defined positions, tubes of Hcp1 gathering up to 15 stacked hexamers formed in oxidative conditions. These results, together with those available in the literature regarding TssB and TssC, suggest that assembly of the T6SS tube differs significantly from that of Sipho- or Myoviridae.

Apparent Violation of the Fluctuation-Dissipation Theorem due to Dynamic Heterogeneity in a Model Glass-Forming Liquid

International Nuclear Information System (INIS)

Kawasaki, Takeshi; Tanaka, Hajime

2009-01-01

Here we study the relation between the mobility and the translational diffusion in supercooled two-dimensional polydisperse colloidal liquids, using numerical simulations. We find an apparent violation of the Einstein-Smoluchowski (ES) relation D=k B Tμ (D: diffusion constant; μ: mobility; k B ; Boltzmann's constant; T: temperature). The violation is a direct consequence of the fact that it is difficult for a driven particle to enter a jammed region with high order due to its yield stress. The degree of this apparent ES violation is controlled solely by the characteristic size of slow jammed regions, ξ. Our finding implies that the characteristic time of this problem is not the structural relaxation time τ α but the lifetime of dynamic heterogeneity, τ ξ . A supercooled liquid can be regarded to be ergodic only over τ ξ , which may be the slowest intrinsic time scale of the system.

Quaternary epitopes of α345(IV) collagen initiate Alport post-transplant anti-GBM nephritis

DEFF Research Database (Denmark)

Olaru, Florina; Luo, Wentian; Wang, Xu-Ping

2013-01-01

Alport post-transplant nephritis (APTN) is an aggressive form of anti-glomerular basement membrane disease that targets the allograft in transplanted patients with X-linked Alport syndrome. Alloantibodies develop against the NC1 domain of α5(IV) collagen, which occurs in normal kidneys, including...... of alloantibodies against allogeneic collagen IV. Some alloantibodies targeted alloepitopes within α5NC1 monomers, shared by α345NC1 and α1256NC1 hexamers. Other alloantibodies specifically targeted alloepitopes that depended on the quaternary structure of α345NC1 hexamers. In Col4a5-null mice, immunization...... with native forms of allogeneic collagen IV exclusively elicited antibodies to quaternary α345NC1 alloepitopes, whereas alloimmunogens lacking native quaternary structure elicited antibodies to shared α5NC1 alloepitopes. These results imply that quaternary epitopes within α345NC1 hexamers may initiate...

Structure-based design of a disulfide-linked oligomeric form of the simian virus 40 (SV40) large T antigen DNA-binding domain

International Nuclear Information System (INIS)

Meinke, Gretchen; Phelan, Paul; Fradet-Turcotte, Amélie; Archambault, Jacques; Bullock, Peter A.

2011-01-01

With the aim of forming the ‘lock-washer’ conformation of the origin-binding domain of SV40 large T antigen in solution, using structure-based analysis an intermolecular disulfide bridge was engineered into the origin-binding domain to generate higher order oligomers in solution. The 1.7 Å resolution structure shows that the mutant forms a spiral in the crystal and has the de novo disulfide bond at the protein interface, although structural rearrangements at the interface are observed relative to the wild type. The modular multifunctional protein large T antigen (T-ag) from simian virus 40 orchestrates many of the events needed for replication of the viral double-stranded DNA genome. This protein assembles into single and double hexamers on specific DNA sequences located at the origin of replication. This complicated process begins when the origin-binding domain of large T antigen (T-ag ODB) binds the GAGGC sequences in the central region (site II) of the viral origin of replication. While many of the functions of purified T-ag OBD can be studied in isolation, it is primarily monomeric in solution and cannot assemble into hexamers. To overcome this limitation, the possibility of engineering intermolecular disulfide bonds in the origin-binding domain which could oligomerize in solution was investigated. A recent crystal structure of the wild-type T-ag OBD showed that this domain forms a left-handed spiral in the crystal with six subunits per turn. Therefore, we analyzed the protein interface of this structure and identified two residues that could potentially support an intermolecular disulfide bond if changed to cysteines. SDS–PAGE analysis established that the mutant T-ag OBD formed higher oligomeric products in a redox-dependent manner. In addition, the 1.7 Å resolution crystal structure of the engineered disulfide-linked T-ag OBD is reported, which establishes that oligomerization took place in the expected manner

Spontaneous non-canonical assembly of CcmK hexameric components from β-carboxysome shells of cyanobacteria.

Directory of Open Access Journals (Sweden)

Luis F Garcia-Alles

Full Text Available CcmK proteins are major constituents of icosahedral shells of β-carboxysomes, a bacterial microcompartment that plays a key role for CO2 fixation in nature. Supported by the characterization of bidimensional (2D layers of packed CcmK hexamers in crystal and electron microscopy structures, CcmK are assumed to be the major components of icosahedral flat facets. Here, we reassessed the validity of this model by studying CcmK isoforms from Synechocystis sp. PCC6803. Native mass spectrometry studies confirmed that CcmK are hexamers in solution. Interestingly, potential pre-assembled intermediates were also detected with CcmK2. Atomic-force microscopy (AFM imaging under quasi-physiological conditions confirmed the formation of canonical flat sheets with CcmK4. Conversely, CcmK2 formed both canonical and striped-patterned patches, while CcmK1 assembled into remarkable supra-hexameric curved honeycomb-like mosaics. Mutational studies ascribed the propensity of CcmK1 to form round assemblies to a combination of two features shared by at least one CcmK isoform in most β-cyanobacteria: a displacement of an α helical portion towards the hexamer edge, where a potential phosphate binding funnel forms between packed hexamers, and the presence of a short C-terminal extension in CcmK1. All-atom molecular dynamics supported a contribution of phosphate molecules sandwiched between hexamers to bend CcmK1 assemblies. Formation of supra-hexameric curved structures could be reproduced in coarse-grained simulations, provided that adhesion forces to the support were weak. Apart from uncovering unprecedented CcmK self-assembly features, our data suggest the possibility that transitions between curved and flat assemblies, following cargo maturation, could be important for the biogenesis of β-carboxysomes, possibly also of other BMC.

The cosmological model with a wormhole and Hawking temperature near apparent horizon

Science.gov (United States)

Kim, Sung-Won

2018-05-01

In this paper, a cosmological model with an isotropic form of the Morris-Thorne type wormhole was derived in a similar way to the McVittie solution to the black hole in the expanding universe. By solving Einstein's field equation with plausible matter distribution, we found the exact solution of the wormhole embedded in Friedmann-Lemaître-Robertson-Walker universe. We also found the apparent cosmological horizons from the redefined metric and analyzed the geometric natures, including causal and dynamic structures. The Hawking temperature for thermal radiation was obtained by the WKB approximation using the Hamilton-Jacobi equation and Hamilton's equation, near the apparent cosmological horizon.

Structure of a hexameric form of RadA recombinase from Methanococcus voltae

International Nuclear Information System (INIS)

Du, Liqin; Luo, Yu

2012-01-01

Hexameric rings of RadA recombinase from M. voltae have been crystallized. Structural comparisons suggest that homologues of RadA tend to form double-ringed assemblies. Archaeal RadA proteins are close homologues of eukaryal Rad51 and DMC1 proteins and are remote homologues of bacterial RecA proteins. For the repair of double-stranded breaks in DNA, these recombinases promote a pivotal strand-exchange reaction between homologous single-stranded and double-stranded DNA substrates. This DNA-repair function also plays a key role in the resistance of cancer cells to chemotherapy and radiotherapy and in the resistance of bacterial cells to antibiotics. A hexameric form of a truncated Methanococcus voltae RadA protein devoid of its small N-terminal domain has been crystallized. The RadA hexamers further assemble into two-ringed assemblies. Similar assemblies can be observed in the crystals of Pyrococcus furiosus RadA and Homo sapiens DMC1. In all of these two-ringed assemblies the DNA-interacting L1 region of each protomer points inward towards the centre, creating a highly positively charged locus. The electrostatic characteristics of the central channels can be utilized in the design of novel recombinase inhibitors

Remembering apparent behavior

DEFF Research Database (Denmark)

Wagoner, Brady

2011-01-01

The present experiment systematically investigates the role of narrative templates (Wertsch, 2002) in remembering. To stimulate the construction of a diversity of narratives I used Heider and Simmel’s (1944) celebrated “apparent behavior” film, in which geometric shapes moving around a screen...

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 7:H7] pdb|2REC|F Chain F, Reca ... Hexamer Model, Electron Microscopy pdb|2REC|E Chain E, ... ...Reca Hexamer Model, Electron Microscopy pdb|2REC|D Chain ... D, Reca Hexamer Model, Electron Microscopy... pdb|2REC|C ... Chain C, Reca Hexamer Model, Electron Microscopy ... ... ... pdb|2REC|B Chain B, Reca Hexamer Model, Electron ... Microscopy pdb|2REC|A Chain A, Reca Hexamer ...Model, ... Electron Microscopy ... Length = 326 ... Query: 7 ... KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 7:H7] pdb|2REC|F Chain F, Reca ... Hexamer Model, Electron Microscopy pdb|2REC|E Chain E, ... ...Reca Hexamer Model, Electron Microscopy pdb|2REC|D Chain ... D, Reca Hexamer Model, Electron Microscopy... pdb|2REC|C ... Chain C, Reca Hexamer Model, Electron Microscopy ... ... ... pdb|2REC|B Chain B, Reca Hexamer Model, Electron ... Microscopy pdb|2REC|A Chain A, Reca Hexamer ...Model, ... Electron Microscopy ... Length = 326 ... Query: 7 ... KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 7:H7] pdb|2REC|F Chain F, Reca ... Hexamer Model, Electron Microscopy pdb|2REC|E Chain E, ... ...Reca Hexamer Model, Electron Microscopy pdb|2REC|D Chain ... D, Reca Hexamer Model, Electron Microscopy... pdb|2REC|C ... Chain C, Reca Hexamer Model, Electron Microscopy ... ... ... pdb|2REC|B Chain B, Reca Hexamer Model, Electron ... Microscopy pdb|2REC|A Chain A, Reca Hexamer ...Model, ... Electron Microscopy ... Length = 326 ... Query: 7 ... KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 7:H7] pdb|2REC|F Chain F, Reca ... Hexamer Model, Electron Microscopy pdb|2REC|E Chain E, ... ...Reca Hexamer Model, Electron Microscopy pdb|2REC|D Chain ... D, Reca Hexamer Model, Electron Microscopy... pdb|2REC|C ... Chain C, Reca Hexamer Model, Electron Microscopy ... ... ... pdb|2REC|B Chain B, Reca Hexamer Model, Electron ... Microscopy pdb|2REC|A Chain A, Reca Hexamer ...Model, ... Electron Microscopy ... Length = 326 ... Query: 7 ... KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 7:H7] pdb|2REC|F Chain F, Reca ... Hexamer Model, Electron Microscopy pdb|2REC|E Chain E, ... ...Reca Hexamer Model, Electron Microscopy pdb|2REC|D Chain ... D, Reca Hexamer Model, Electron Microscopy... pdb|2REC|C ... Chain C, Reca Hexamer Model, Electron Microscopy ... ... ... pdb|2REC|B Chain B, Reca Hexamer Model, Electron ... Microscopy pdb|2REC|A Chain A, Reca Hexamer ...Model, ... Electron Microscopy ... Length = 326 ... Query: 7 ... KQKALAAALGQIEKQFGKGSIMRLGEDRSMDVET

Small angle X-ray scattering-based elucidation of the self-association mechanism of human insulin analogue lys(B29)(N(e)¿-carboxyheptadecanoyl) des(B30)

DEFF Research Database (Denmark)

Jensen, Malene Hillerup; Wahlund, Per-Olof; Toft, Katrine Nørgaard

2013-01-01

of biophysical and structural methods (field flow fractionation, dynamic and multiangle light scattering, circular dichroism, size exclusion chromatography, and crystallography), we propose a mechanism for the self-association expected to occur upon subcutaneous injection of this insulin analogue. SAXS data...... provide evidence of the in solution structure of the self-associated oligomer, which is a long straight rod composed of "tense" state insulin hexamers (T(6)-hexamers) as the smallest repeating unit. The smallest oligomer building block in the process is a T(6)T(6)-dihexamer. This tense dihexamer is formed...... by the allosteric change of the initial equilibrium between a proposed "relaxed" state R(6)-hexamer and an R(3)T(3)T(3)R(3)-dihexamer. The allosteric change from relaxed to tense is triggered by removal of phenol, mimicking subcutaneous injection. The data hence provide the first unequivocal evidence...

Microstructures and mechanical properties of age-formed 7050 aluminum alloy

International Nuclear Information System (INIS)

Chen, J.F.; Zhen, L.; Jiang, J.T.; Yang, L.; Shao, W.Z.; Zhang, B.Y.

2012-01-01

Highlights: ► Age-forming leads to the grain elongation in 7050 alloy. ► Age-forming varies the texture components in 7050 alloy. ► Age-forming promotes precipitates growth and PFZ enlargement in 7050 alloy. ► Age-forming induces to descend apparently elongation in 7050 alloy. ► The effect of age-forming on microstructure and properties is discussed in-depth. - Abstract: The effects of age-forming on microstructures and mechanical properties of 7050 Al alloy were investigated in this work. The alloy was subjected to age-forming as well as stress-free ageing at 160 °C for 6, 12, 18 and 24 h, and its microstructures were characterized by electron backscatter diffraction (EBSD) and transmission electron microscopy (TEM). It was shown that creep might lead to grain elongation during age-forming, and the applied stress induces the coarsening of precipitates in 7050 Al alloy. The texture in the alloy was also influenced by age-forming. Consequently, the differences in microstructures result in differences in mechanical properties of age-forming versus traditional stress-free ageing. The ultimate tensile strength of age-formed samples were slightly lower than that of stress-free aged samples, while the yield strength of age-formed samples were apparently lower than that of stress-free aged samples. Specifically, the elongation of samples age-formed displays apparently decrease.

Mechanical Components from Highly Recoverable, Low Apparent Modulus Materials

Science.gov (United States)

Padula, Santo, II (Inventor); Noebe, Ronald D. (Inventor); Stanford, Malcolm K. (Inventor); DellaCorte, Christopher (Inventor)

2015-01-01

A material for use as a mechanical component is formed of a superelastic intermetallic material having a low apparent modulus and a high hardness. The superelastic intermetallic material is conditioned to be dimensionally stable, devoid of any shape memory effect and have a stable superelastic response without irrecoverable deformation while exhibiting strains of at least 3%. The method of conditioning the superelastic intermetallic material is described. Another embodiment relates to lightweight materials known as ordered intermetallics that perform well in sliding wear applications using conventional liquid lubricants and are therefore suitable for resilient, high performance mechanical components such as gears and bearings.

Attention and apparent motion.

Science.gov (United States)

Horowitz, T; Treisman, A

1994-01-01

Two dissociations between short- and long-range motion in visual search are reported. Previous research has shown parallel processing for short-range motion and apparently serial processing for long-range motion. This finding has been replicated and it has also been found that search for short-range targets can be impaired both by using bicontrast stimuli, and by prior adaptation to the target direction of motion. Neither factor impaired search in long-range motion displays. Adaptation actually facilitated search with long-range displays, which is attributed to response-level effects. A feature-integration account of apparent motion is proposed. In this theory, short-range motion depends on specialized motion feature detectors operating in parallel across the display, but subject to selective adaptation, whereas attention is needed to link successive elements when they appear at greater separations, or across opposite contrasts.

Low polarity water, a novel transition species at the polyethylene-water interface.

Science.gov (United States)

Kosower, Edward M; Borz, Galina

2015-10-14

The bridge between water repelling and water-attracting regions is recognized here as low polarity water, a novel "neutral" form of water; its identity as a dipole-dipole water dimer is supported by spectroscopic evidence of its presence in thin films of water on a polyethylene surface. High resolution (0.5 cm(-1)), low signal energies (Sg 100) and short scans (0.1 s) are used to ensure that all peaks are detected. Thin films may be trapped between two polyethylene windows, affirming the low polarity of such water; the spectra of the trapped films ("sandwich") are similar to those from a subtraction procedure. Use of the "sandwich" is a new and useful technique in surface studies. In general, intermediate forms might bridge incompatibility between different regimes, from sets of molecules (chemistry and physics) to sets of organisms (biology and sociology). Thin films of water on polyethylene also display strong and transient peaks of water oligomers, cyclic pentamers and cyclic hexamers (chair and boat), bicyclic hexamers (books 1 and 2) and tricyclic hexamers (prism) that have been previously identified in thin films of water on a silver halide surface.

Effects of Red Blood Cell Aggregation on the Apparent Viscosity of Blood Flow in Tubes.

Science.gov (United States)

Hitt, Darren L.; Lowe, Mary L.

1996-11-01

In arterioles and venules (20-200μ diameter), the low shear rates enable red blood cells to form aggregate structures of varying sizes and morphology. The size and distribution of the aggregates affect the flow impedance within a microvascular network; this effect may be characterized by an "apparent viscosity". In this study, we measure the apparent viscosity of blood flow in 50μ glass tubes as a function of shear rate and red blood cell volume fraction (hematocrit); for a fixed tube geometry and an imposed flow rate, the viscosity is determined by measuring the pressure drop across the tube. To correlate the apparent viscosity with the size and spatial distribution of the aggregates in the flow, video images of the flow are recorded and analyzed using power spectral techniques. Pig blood and sheep blood are used as the models for aggregating and non-aggregating blood, respectively. Supported by NSF PFF Award CTS-9253633

Effects of liquid morphology and distribution on the apparent properties of porous media made of stacked particles

Directory of Open Access Journals (Sweden)

Mingzhi Yu

2015-05-01

Full Text Available To understand the effects of liquid morphology on the apparent transfer properties of porous media formed by stacked particles, the authors investigate the particles’ aggregation state, apparent volume, thermal conductivity, and electrical conductivity of wet stacked glass beads. It shows that the liquid mainly exists as liquid bridges when the liquid content is low and connects each other when high. The transformation of liquid morphology and distribution influences the liquid effects on particles, thus changing the aggregation state of the particles and the apparent properties of the porous media in turn. A model is developed for predicting the critical liquid content at which the liquid morphology shifts from the state of liquid bridges into the state of interconnectedness. The prediction from the model is in good agreement with the experiment.

Fermions tunneling from apparent horizon of FRW universe

International Nuclear Information System (INIS)

Li Ran; Ren Jirong; Shi Dunfu

2009-01-01

In the paper [R.-G. Cai, L.-M. Cao, Y.-P. Hu, (arXiv: 0809.1554)], the scalar particles' Hawking radiation from the apparent horizon of Friedmann-Robertson-Walker (FRW) universe was investigated by using the tunneling formalism. They obtained the Hawking temperature associated with the apparent horizon, which was extensively applied in investigating the relationship between the first law of thermodynamics and Friedmann equations. In this Letter, we calculate fermions' Hawking radiation from the apparent horizon of FRW universe via tunneling formalism. Applying WKB approximation to the general covariant Dirac equation in FRW spacetime background, the radiation spectrum and Hawking temperature of apparent horizon are correctly recovered, which supports the arguments presented in the paper [R.-G. Cai, L.-M. Cao, Y.-P. Hu, (arXiv: 0809.1554)

Figure-ground segregation modulates apparent motion.

Science.gov (United States)

Ramachandran, V S; Anstis, S

1986-01-01

We explored the relationship between figure-ground segmentation and apparent motion. Results suggest that: static elements in the surround can eliminate apparent motion of a cluster of dots in the centre, but only if the cluster and surround have similar "grain" or texture; outlines that define occluding surfaces are taken into account by the motion mechanism; the brain uses a hierarchy of precedence rules in attributing motion to different segments of the visual scene. Being designated as "figure" confers a high rank in this scheme of priorities.

Structure and molecular assignment of lactococcal phage TP901-1 baseplate

DEFF Research Database (Denmark)

Bebeacua, Cecilia; Bron, Patrick; Lai, Livia

2010-01-01

on the host cell surface. We report here the electron microscopic structure of the phage TP901-1 wild-type BP as well as those of two mutants bppL (-) and bppU(-), lacking BppL (the RBPs) or both peripheral BP components (BppL and BppU), respectively. We also achieved an electron microscopic reconstruction...... of a partial BP complex, formed by BppU and BppL. This complex exhibits a tripod shape and is composed of nine BppLs and three BppUs. These structures, combined with light-scattering measurements, led us to propose that the TP901-1 BP harbors six tripods at its periphery, located around the central tube formed...... by ORF46 (Dit) hexamers, at its proximal end, and a ORF47 (Tal) trimer at its distal extremity. A total of 54 BppLs (18 RBPs) are thus available to mediate host anchoring with a large apparent avidity. TP901-1 BP exhibits an infection-ready conformation and differs strikingly from the lactococcal phage p...

Apparent directional selection by biased pleiotropic mutation.

Science.gov (United States)

Tanaka, Yoshinari

2010-07-01

Pleiotropic effects of deleterious mutations are considered to be among the factors responsible for genetic constraints on evolution by long-term directional selection acting on a quantitative trait. If pleiotropic phenotypic effects are biased in a particular direction, mutations generate apparent directional selection, which refers to the covariance between fitness and the trait owing to a linear association between the number of mutations possessed by individuals and the genotypic values of the trait. The present analysis has shown how the equilibrium mean value of the trait is determined by a balance between directional selection and biased pleiotropic mutations. Assuming that genes act additively both on the trait and on fitness, the total variance-standardized directional selection gradient was decomposed into apparent and true components. Experimental data on mutation bias from the bristle traits of Drosophila and life history traits of Daphnia suggest that apparent selection explains a small but significant fraction of directional selection pressure that is observed in nature; the data suggest that changes induced in a trait by biased pleiotropic mutation (i.e., by apparent directional selection) are easily compensated for by (true) directional selection.

Standard Test Method for Water Absorption, Bulk Density, Apparent Porosity, and Apparent Specific Gravity of Fired Whiteware Products

CERN Document Server

American Society for Testing and Materials. Philadelphia

2006-01-01

1.1 This test method covers procedures for determining water absorption, bulk density, apparent porosity, and apparent specific gravity of fired unglazed whiteware products. 1.2 This standard may involve hazardous materials, operations, and equipment. This standard does not purport to address all of the safety problems associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

Multiple Weather Factors Affect Apparent Survival of European Passerine Birds

Science.gov (United States)

Salewski, Volker; Hochachka, Wesley M.; Fiedler, Wolfgang

2013-01-01

Weather affects the demography of animals and thus climate change will cause local changes in demographic rates. In birds numerous studies have correlated demographic factors with weather but few of those examined variation in the impacts of weather in different seasons and, in the case of migrants, in different regions. Using capture-recapture models we correlated weather with apparent survival of seven passerine bird species with different migration strategies to assess the importance of selected facets of weather throughout the year on apparent survival. Contrary to our expectations weather experienced during the breeding season did not affect apparent survival of the target species. However, measures for winter severity were associated with apparent survival of a resident species, two short-distance/partial migrants and a long-distance migrant. Apparent survival of two short distance migrants as well as two long-distance migrants was further correlated with conditions experienced during the non-breeding season in Spain. Conditions in Africa had statistically significant but relatively minor effects on the apparent survival of the two long-distance migrants but also of a presumably short-distance migrant and a short-distance/partial migrant. In general several weather effects independently explained similar amounts of variation in apparent survival for the majority of species and single factors explained only relatively low amounts of temporal variation of apparent survival. Although the directions of the effects on apparent survival mostly met our expectations and there are clear predictions for effects of future climate we caution against simple extrapolations of present conditions to predict future population dynamics. Not only did weather explains limited amounts of variation in apparent survival, but future demographics will likely be affected by changing interspecific interactions, opposing effects of weather in different seasons, and the potential for

Apparent Solar Tornado-Like Prominences

Science.gov (United States)

Panasenco, Olga; Martin, Sara F.; Velli, Marco

2014-02-01

Recent high-resolution observations from the Solar Dynamics Observatory (SDO) have reawakened interest in the old and fascinating phenomenon of solar tornado-like prominences. This class of prominences was first introduced by Pettit ( Astrophys. J. 76, 9, 1932), who studied them over many years. Observations of tornado prominences similar to the ones seen by SDO had already been documented by Secchi ( Le Soleil, 1877). High-resolution and high-cadence multiwavelength data obtained by SDO reveal that the tornado-like appearance of these prominences is mainly an illusion due to projection effects. We discuss two different cases where prominences on the limb might appear to have a tornado-like behavior. One case of apparent vortical motions in prominence spines and barbs arises from the (mostly) 2D counterstreaming plasma motion along the prominence spine and barbs together with oscillations along individual threads. The other case of apparent rotational motion is observed in a prominence cavity and results from the 3D plasma motion along the writhed magnetic fields inside and along the prominence cavity as seen projected on the limb. Thus, the "tornado" impression results either from counterstreaming and oscillations or from the projection on the plane of the sky of plasma motion along magnetic-field lines, rather than from a true vortical motion around an (apparent) vertical or horizontal axis. We discuss the link between tornado-like prominences, filament barbs, and photospheric vortices at their base.

Radioimmunological determination of apparent free progesterone concentration in plasma samples of pregnant and non-pregnant women

International Nuclear Information System (INIS)

Clerico, A.; Del Chicca, M.G.; Strigini, F.; Melis, G.B.; Paoletti, A.M.; Mariani, G.; Fioretti, P.

1980-01-01

The determination of free steroids would be preferable with respect to total hormone plasma content, since it yields more reliable information about the most biologically active form of circulating steroids. The authors report a method for the determination of apparent free progesterone concentration (AFPC) in plasma, by means of direct radioimmunoassay of dialyzed progesterone after equilibrium dialysis. (Auth.)

Polymorphism of fibrillar structures depending on the size of assembled Aβ17-42 peptides

Science.gov (United States)

Cheon, Mookyung; Kang, Mooseok; Chang, Iksoo

2016-01-01

The size of assembled Aβ17-42 peptides can determine polymorphism during oligomerization and fibrillization, but the mechanism of this effect is unknown. Starting from separate random monomers, various fibrillar oligomers with distinct structural characteristics were identified using discontinuous molecular dynamics simulations based on a coarse-grained protein model. From the structures observed in the simulations, two characteristic oligomer sizes emerged, trimer and paranuclei, which generated distinct structural patterns during fibrillization. A majority of the simulations for trimers and tetramers formed non-fibrillar oligomers, which primarily progress to off-pathway oligomers. Pentamers and hexamers were significantly converted into U-shape fibrillar structures, meaning that these oligomers, called paranuclei, might be potent on-pathway intermediates in fibril formation. Fibrillar oligomers larger than hexamers generated substantial polymorphism in which hybrid structures were readily formed and homogeneous fibrillar structures appeared infrequently. PMID:27901087

Hemocyanin-derived phenoloxidase activity is dependent on dodecameric structure in shrimp Litopenaeus vannamei

Directory of Open Access Journals (Sweden)

Wang Ke-Zhou

2015-01-01

Full Text Available Hemocyanin (Hc is a multifunctional protein in both mollusks and arthropods. Phenoloxidase (PO activities are the most important physiological functions for Hcs after conversion. In shrimp, Hc occurs as two oligomer forms, dodecamers and hexamers. Differences in the transport oxygen capacity and agglutination activity between the two oligomers of shrimp Hc have been found. In the present study, we investigated the differences in the Hc-derived PO activity between the dodecameric and hexameric Hc forms of the shrimp Litopenaeus vannamei. The two oligomers were separated by non-denaturing polyacrylamide gel electrophoresis, converted by trypsin cleavage and their PO activities were determined by oxidation of L-DOPA. The dodecamers exhibited PO activity after enzymatic conversion while the hexamers did not exhibit PO activity. This result provides new insight into the structural/functional relationships of Hcs.

Forms and terminology of Direct Democracy

DEFF Research Database (Denmark)

Svensson, Palle

It is apparent that some confusion exits both among researchers and political actors about the various forms of direct democracy. Various institutions such as IRI and IDEA, various countries such as Switzerland and California, and various authors such as Pier Vincenzo Uleri and David Altman present...

Interaction of packaging motor with the polymerase complex of dsRNA bacteriophage

International Nuclear Information System (INIS)

Lisal, Jiri; Kainov, Denis E.; Lam, TuKiet T.; Emmett, Mark R.; Wei Hui; Gottlieb, Paul; Marshall, Alan G.; Tuma, Roman

2006-01-01

Many viruses employ molecular motors to package their genomes into preformed empty capsids (procapsids). In dsRNA bacteriophages the packaging motor is a hexameric ATPase P4, which is an integral part of the multisubunit procapsid. Structural and biochemical studies revealed a plausible RNA-translocation mechanism for the isolated hexamer. However, little is known about the structure and regulation of the hexamer within the procapsid. Here we use hydrogen-deuterium exchange and mass spectrometry to delineate the interactions of the P4 hexamer with the bacteriophage phi12 procapsid. P4 associates with the procapsid via its C-terminal face. The interactions also stabilize subunit interfaces within the hexamer. The conformation of the virus-bound hexamer is more stable than the hexamer in solution, which is prone to spontaneous ring openings. We propose that the stabilization within the viral capsid increases the packaging processivity and confers selectivity during RNA loading

Apparent molar volumes and compressibilities of selected electrolytes in dimethylsulfoxide

International Nuclear Information System (INIS)

Warminska, Dorota; Grzybkowski, Waclaw

2010-01-01

Densities at T = (293.15, 298.15, 303.15, 313.15, 323.15, and 333.15) K and sound velocities at T = 298.15 K of tetraphenylphosphonium bromide, sodium tetraphenylborate, sodium bromide, and sodium perchlorate in dimethylsulfoxide have been measured over the composition range from (0 to 0.3) mol . kg -1 . From these data, apparent molar volumes and apparent molar isentropic compressibilities at infinite dilution as well as the expansibilities have been evaluated. The results have been discussed in terms of employing tetraphenylphosphonium tetraphenylborate as a reference electrolyte in splitting the limiting apparent molar volumes and apparent molar isentropic compressibilities into ionic contributions.

Observations of apparent superslow wave propagation in solar prominences

Science.gov (United States)

Raes, J. O.; Van Doorsselaere, T.; Baes, M.; Wright, A. N.

2017-06-01

Context. Phase mixing of standing continuum Alfvén waves and/or continuum slow waves in atmospheric magnetic structures such as coronal arcades can create the apparent effect of a wave propagating across the magnetic field. Aims: We observe a prominence with SDO/AIA on 2015 March 15 and find the presence of oscillatory motion. We aim to demonstrate that interpreting this motion as a magneto hydrodynamic (MHD) wave is faulty. We also connect the decrease of the apparent velocity over time with the phase mixing process, which depends on the curvature of the magnetic field lines. Methods: By measuring the displacement of the prominence at different heights to calculate the apparent velocity, we show that the propagation slows down over time, in accordance with the theoretical work of Kaneko et al. We also show that this propagation speed drops below what is to be expected for even slow MHD waves for those circumstances. We use a modified Kippenhahn-Schlüter prominence model to calculate the curvature of the magnetic field and fit our observations accordingly. Results: Measuring three of the apparent waves, we get apparent velocities of 14, 8, and 4 km s-1. Fitting a simple model for the magnetic field configuration, we obtain that the filament is located 103 Mm below the magnetic centre. We also obtain that the scale of the magnetic field strength in the vertical direction plays no role in the concept of apparent superslow waves and that the moment of excitation of the waves happened roughly one oscillation period before the end of the eruption that excited the oscillation. Conclusions: Some of the observed phase velocities are lower than expected for slow modes for the circumstances, showing that they rather fit with the concept of apparent superslow propagation. A fit with our magnetic field model allows for inferring the magnetic geometry of the prominence. The movie attached to Fig. 1 is available at http://www.aanda.org

Gender-related differences in the apparent timing of skeletal density bands in the reef-building coral Siderastrea siderea

Science.gov (United States)

Carricart-Ganivet, J. P.; Vásquez-Bedoya, L. F.; Cabanillas-Terán, N.; Blanchon, P.

2013-09-01

Density banding in skeletons of reef-building corals is a valuable source of proxy environmental data. However, skeletal growth strategy has a significant impact on the apparent timing of density-band formation. Some corals employ a strategy where the tissue occupies previously formed skeleton during as the new band forms, which leads to differences between the actual and apparent band timing. To investigate this effect, we collected cores from female and male colonies of Siderastrea siderea and report tissue thicknesses and density-related growth parameters over a 17-yr interval. Correlating these results with monthly sea surface temperature (SST) shows that maximum skeletal density in the female coincides with low winter SSTs, whereas in the male, it coincides with high summer SSTs. Furthermore, maximum skeletal densities in the female coincide with peak Sr/Ca values, whereas in the male, they coincide with low Sr/Ca values. Both results indicate a 6-month difference in the apparent timing of density-band formation between genders. Examination of skeletal extension rates also show that the male has thicker tissue and extends faster, whereas the female has thinner tissue and a denser skeleton—but both calcify at the same rate. The correlation between extension and calcification, combined with the fact that density banding arises from thickening of the skeleton throughout the depth reached by the tissue layer, implies that S. siderea has the same growth strategy as massive Porites, investing its calcification resources into linear extension. In addition, differences in tissue thicknesses suggest that females offset the greater energy requirements of gamete production by generating less tissue, resulting in differences in the apparent timing of density-band formation. Such gender-related offsets may be common in other corals and require that environmental reconstructions be made from sexed colonies and that, in fossil corals where sex cannot be determined

Fertility and apparent genetic anticipation in Lynch syndrome.

Science.gov (United States)

Stupart, Douglas; Win, Aung Ko; Jenkins, Mark; Winship, Ingrid M; Goldberg, Paul; Ramesar, Rajkumar

2014-09-01

Genetic anticipation is the phenomenon in which age of onset of an inherited disorder decreases in successive generations. Inconsistent evidence suggests that this occurs in Lynch syndrome. A possible cause for apparent anticipation is fecundity bias, which occurs if the disease adversely affects fertility. The purpose of this study was to determine the effect of age of diagnosis of colorectal cancer (CRC) on lifetime fertility in Lynch syndrome, and whether this can falsely create the appearance of genetic anticipation. A computer model simulated age of diagnosis of CRC in hypothetical Lynch syndrome carriers and their offspring. The model assumed similar age distribution of CRC across generations (i.e. that there was no true anticipation). Age distribution of CRC diagnosis, and lifetime fertility rates (grouped by age of diagnosis of CRC) were determined from the Australasian Colorectal Cancer Family Registry (ACCFR). Apparent anticipation was calculated by comparing ages of diagnosis of CRC in affected parent-child pairs. A total of 1,088 patients with CRC were identified from the ACCFR. Total lifetime (cohort) fertility was related to age of diagnosis of CRC (correlation coefficient 0.13, P = 0.0001). In the simulation, apparent anticipation was 1.8 ± 0.54 years (P = 0.0044). Observed apparent anticipation in the ACCFR cohort was 4.8 ± 1.73 years (P = 0.0064). There was no difference in apparent anticipation between the simulate d and observed parent-child pairs (P = 0.89). The appearance of genetic anticipation in Lynch syndrome can be falsely created due to changes in fertility.

Shape reconstruction from apparent contours theory and algorithms

CERN Document Server

Bellettini, Giovanni; Paolini, Maurizio

2015-01-01

Motivated by a variational model concerning the depth of the objects in a picture and the problem of hidden and illusory contours, this book investigates one of the central problems of computer vision: the topological and algorithmic reconstruction of a smooth three dimensional scene starting from the visible part of an apparent contour. The authors focus their attention on the manipulation of apparent contours using a finite set of elementary moves, which correspond to diffeomorphic deformations of three dimensional scenes. A large part of the book is devoted to the algorithmic part, with implementations, experiments, and computed examples. The book is intended also as a user's guide to the software code appcontour, written for the manipulation of apparent contours and their invariants. This book is addressed to theoretical and applied scientists working in the field of mathematical models of image segmentation.

Modeling apparent color for visual evaluation of camouflage fabrics

Science.gov (United States)

Ramsey, S.; Mayo, T.; Shabaev, A.; Lambrakos, S. G.

2017-08-01

As the U.S. Navy, Army, and Special Operations Forces progress towards fielding more advanced uniforms with multi-colored and highly detailed camouflage patterning, additional test methodologies are necessary in evaluating color in these types of camouflage textiles. The apparent color is the combination of all visible wavelengths (380-760 nm) of light reflected from large (>=1m2 ) fabric sample sizes for a given standoff distance (10-25ft). Camouflage patterns lose resolution with increasing standoff distance, and eventually all colors within the pattern appear monotone (the "apparent color" of the pattern). This paper presents an apparent color prediction model that can be used for evaluation of camouflage fabrics.

Gravitational pressure, apparent horizon and thermodynamics of FLRW universe in the teleparallel gravity

Science.gov (United States)

da Rocha-Neto, J. F.; Morais, B. R.

2018-04-01

In the context of the teleparallel equivalent of general relativity the concept of gravitational pressure and gravitational energy-momentum arisen in a natural way. In the case of a Friedmann-Lemaitre-Robertson-Walker space FLRW we obtain the total energy contained inside the apparent horizon and the radial pressure over the apparent horizon area. We use these definitions to written a thermodynamics relation TAdSA = dEA+PAdVA at the apparent horizon, where EA is the total energy inside the apparent horizon, VA is the areal volume of the apparent horizon, PA is the radial pressure over the apparent horizon area, SA is the entropy which can be assumed as one quarter of the apparent horizon area only for a non stationary apparent horizon. We identify TA as the temperature at the surface of the apparent horizon. We shown that for all expanding accelerated FLRW model of universe the radial pressure is positive.

Prevalence of dyslipidaemia amongst apparently healthy staff of a ...

African Journals Online (AJOL)

The aim of this study is to determine the serum lipid profile of apparently healthy staff of University of Benin Teaching Hospital (UBTH), Benin City. Consenting staff of UBTH who were apparently healthy were recruited for the study. Data extracted included the patient's age, sex, body mass index, weight, height, waist ...

Thermodynamics of the Apparent Horizon in FRW Universe with Massive Gravity

International Nuclear Information System (INIS)

Li Hui; Zhang Yi

2013-01-01

Applying Clausius relation with energy-supply defined by the unified first law of thermodynamics formalism to the apparent horizon of a massive gravity model in cosmology proposed lately, the corrected entropic formula of the apparent horizon is obtained with the help of the modified Friedmann equations. This entropy-area relation, together with the identified Misner-Sharp internal energy, verifies the first law of thermodynamics for the apparent horizon with a volume change term for consistency. On the other hand, by means of the corrected entropy-area formula and the Clausius relation δQ = T d S, where the heat Bow δQ is the energy-supply of pure matter projecting on the vector ξ tangent to the apparent horizon and should be looked on as the amount of energy crossing the apparent horizon during the time interval dt and the temperature of the apparent horizon for energy crossing during the same interval is 1/(2πr A ), the modified Friedmann equations governing the dynamical evolution of the universe are reproduced with the known energy density and pressure of massive graviton. The integration constant is found to correspond to a cosmological term which could be absorbed into the energy density of matter. Having established the correspondence of massive cosmology with the unified first law of thermodynamics on the apparent horizon, the validity of the generalized second law of thermodynamics is also discussed by assuming the thermal equilibrium between the apparent horizon and the matter field bounded by the apparent horizon. It is found that, in the limit H c → 0, which recovers the Minkowski reference metric solution in the fiat case, the generalized second law of thermodynamics holds if α 3 + 4α 4 3 = α 4 = 0, the generalized second law of thermodynamics could be violated. (general)

Inhibition of apparent photosynthesis by nitrogen oxides

Energy Technology Data Exchange (ETDEWEB)

Hill, A C; Bennett, J H

1970-01-01

The nitrogen oxides (NO/sub 2/ and NO) inhibited apparent photosynthesis of oats and alfalfa at concentrations below those required to cause visible injury. There appeared to be a threshold concentration of about 0.6 ppm for each pollutant. An additive effect in depressing apparent photosynthesis occurred when the plants were exposed to a mixture of NO and NO/sub 2/. Although NO produced a more rapid effect on the plants, lower concentrations of NO/sub 2/ were required to cause a given inhibition after 2 hour of exposure. Inhibition by nitric oxide was more closely related to its partial pressure than was inhibition by NO/sub 2/.

Fenobody: A Ferritin-Displayed Nanobody with High Apparent Affinity and Half-Life Extension.

Science.gov (United States)

Fan, Kelong; Jiang, Bing; Guan, Zhe; He, Jiuyang; Yang, Dongling; Xie, Ni; Nie, Guohui; Xie, Can; Yan, Xiyun

2018-04-10

Nanobodies consist of a single domain variable fragment of a camelid heavy-chain antibody. Nanobodies have potential applications in biomedical fields because of their simple production procedures and low cost. Occasionally, nanobody clones of interest exhibit low affinities for their target antigens, which, together with their short half-life limit bioanalytical or therapeutic applications. Here, we developed a novel platform we named fenobody, in which a nanobody developed against H5N1 virus is displayed on the surface of ferritin in the form of a 24mer. We constructed a fenobody by substituting the fifth helix of ferritin with the nanobody. TEM analysis showed that nanobodies were displayed on the surface of ferritin in the form of 6 × 4 bundles, and that these clustered nanobodies are flexible for antigen binding in spatial structure. Comparing fenobodies with conventional nanobodies currently used revealed that the antigen binding apparent affinity of anti-H5N1 fenobody was dramatically increased (∼360-fold). Crucially, their half-life extension in a murine model was 10-fold longer than anti-H5N1 nanobody. In addition, we found that our fenobodies are highly expressed in Escherichia coli, and are both soluble and thermo-stable nanocages that self-assemble as 24-polymers. In conclusion, our results demonstrate that fenobodies have unique advantages over currently available systems for apparent affinity enhancement and half-life extension of nanobodies. Our fenobody system presents a suitable platform for various large-scale biotechnological processes and should greatly facilitate the application of nanobody technology in these areas.

Hawking radiation of an apparent horizon in a FRW universe

International Nuclear Information System (INIS)

Cai Ronggen; Cao Liming; Hu Yapeng

2009-01-01

Hawking radiation is an important quantum phenomenon of a black hole, which is closely related to the existence of an event horizon of a black hole. The cosmological event horizon of de Sitter space is also of Hawking radiation with a thermal spectrum. By use of the tunneling approach, we show that there is indeed a Hawking radiation with temperature, T=1/(2πr-tilde A , for a locally defined apparent horizon of a Friedmann-Robertson-Walker universe with any spatial curvature, where r-tilde A is the apparent horizon radius. Thus we fill in the gap existing in the literature investigating the relation between the first law of thermodynamics and Friedmann equations; there the apparent horizon is assumed to have such a temperature without any proof. In addition, we stress the implication of the Hawking temperature associated with the apparent horizon.

Functional Apparent Moduli (FAMs) as Predictors of Oral Implant Osseointegration Dynamics

OpenAIRE

Chang, Po-Chun; Seol, Yang-Jo; Kikuchi, Noboru; Goldstein, Steven A.; Giannobile, William V.

2010-01-01

At present, limited functional data exists regarding the application and use of biomechanical and imaging technologies for oral implant osseointegration assessment. The objective of this investigation was to determine the functional apparent moduli (FAMs) that could predict the dynamics of oral implant osseointegration. Using an in vivo dental implant osseous healing model, two FAMs, functional bone apparent modulus (FBAM) and composite tissue apparent modulus (FCAM), of the selected peri-imp...

Crystallization and preliminary X-ray diffraction study of phosphopantetheine adenylyltransferase from M. tuberculosis crystallizing in space group P3{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Timofeev, V. I., E-mail: tostars@mail.ru [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Chupova, L. A.; Esipov, R. S. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Kuranova, I. P. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)

2015-09-15

Crystals of M. tuberculosis phosphopantetheine adenylyltransferase were grown in microgravity by the capillary counter-diffusion method through a gel layer. The X-ray diffraction data set suitable for the determination of the three-dimensional structure at atomic resolution was collected from one crystal at the Spring-8 synchrotron facility to 2.00-Å resolution. The crystals belong to sp. gr. P3{sub 2} and have the following unit-cell parameters: a = b = 106.47 Å, c = 71.32 Å, α = γ = 90°, β = 120°. The structure was solved by the molecular-replacement method. There are six subunits of the enzyme comprising a hexamer per asymmetric unit. The hexamer is a biologically active form of phosphopantetheine adenylyltransferase from M. tuberculosis.

Nearly extremal apparent horizons in simulations of merging black holes

Science.gov (United States)

Lovelace, Geoffrey; Scheel, Mark; Owen, Robert; Giesler, Matthew; Katebi, Reza; Szilagyi, Bela; Chu, Tony; Demos, Nicholas; Hemberger, Daniel; Kidder, Lawrence; Pfeiffer, Harald; Afshari, Nousha; SXS Collaboration

2015-04-01

The spin S of a Kerr black hole is bounded by the surface area A of its apparent horizon: 8 πS A and e0 > 1 , but these surfaces are always surrounded by apparent horizons with 8 πS < A and e0 < 1 .

Energy flow in a bound electromagnetic field: resolution of apparent paradoxes

International Nuclear Information System (INIS)

Kholmetskii, A L; Yarman, T

2008-01-01

In this paper, we present a resolution of apparent paradoxes formulated in (Kholmetskii A L 2006 Apparent paradoxes in classical electrodynamics: the energy-momentum conservation law for a bound electromagnetic field Eur. J. Phys. 27 825-38; Kholmetskii A L and Yarman T 2008 Apparent paradoxes in classical electrodynamics: a fluid medium in an electromagnetic field Eur. J. Phys. 29 1127) and dealing with the energy flux in a bound electromagnetic field

Radiographic and manometric correlation in achalasia with apparent lower esophageal sphincter relaxation

International Nuclear Information System (INIS)

Ott, D.J.; Richter, J.E.; Chen, Y.M.; Wu, W.C.; Gelfand, D.W.; Castell, D.O.

1987-01-01

The authors compared the clinical, radiographic, and manometric findings in ten patients with atypical achalasia showing complete but short-duration lower esophageal sphincter (LES) relaxation with findings in 39 patients with classic achalasia. Patients with atypical achalasia were younger, had dysphagia and weight loss of shorter duration, and had less esophageal dilation than patients with classic achalesia. LES pressure and esophagogastric junction caliber, however, were similar in the two groups. The majority of patients in both groups responded well to pneumatic dilation. They conclude that achalasia with apparent LES relaxation may represent an early form of this motor disorder and that the radiographic findings remain characteristic except for less dilation of the esophagus

Roles of conserved arginines in ATP-binding domains of AAA+ chaperone ClpB from Thermus thermophilus.

Science.gov (United States)

Yamasaki, Takashi; Nakazaki, Yosuke; Yoshida, Masasuke; Watanabe, Yo-hei

2011-07-01

ClpB, a member of the expanded superfamily of ATPases associated with diverse cellular activities (AAA+), forms a ring-shaped hexamer and cooperates with the DnaK chaperone system to reactivate aggregated proteins in an ATP-dependent manner. The ClpB protomer consists of an N-terminal domain, an AAA+ module (AAA-1), a middle domain, and a second AAA+ module (AAA-2). Each AAA+ module contains highly conserved WalkerA and WalkerB motifs, and two arginines (AAA-1) or one arginine (AAA-2). Here, we investigated the roles of these arginines (Arg322, Arg323, and Arg747) of ClpB from Thermus thermophilus in the ATPase cycle and chaperone function by alanine substitution. These mutations did not affect nucleotide binding, but did inhibit the hydrolysis of the bound ATP and slow the threading of the denatured protein through the central pore of the T. thermophilus ClpB ring, which severely impaired the chaperone functions. Previously, it was demonstrated that ATP binding to the AAA-1 module induced motion of the middle domain and stabilized the ClpB hexamer. However, the arginine mutations of the AAA-1 module destabilized the ClpB hexamer, even though ATP-induced motion of the middle domain was not affected. These results indicated that the three arginines are crucial for ATP hydrolysis and chaperone activity, but not for ATP binding. In addition, the two arginines in AAA-1 and the ATP-induced motion of the middle domain independently contribute to the stabilization of the hexamer. © 2011 The Authors Journal compilation © 2011 FEBS.

Primary visual cortex activity along the apparent-motion trace reflects illusory perception.

Directory of Open Access Journals (Sweden)

Lars Muckli

2005-08-01

Full Text Available The illusion of apparent motion can be induced when visual stimuli are successively presented at different locations. It has been shown in previous studies that motion-sensitive regions in extrastriate cortex are relevant for the processing of apparent motion, but it is unclear whether primary visual cortex (V1 is also involved in the representation of the illusory motion path. We investigated, in human subjects, apparent-motion-related activity in patches of V1 representing locations along the path of illusory stimulus motion using functional magnetic resonance imaging. Here we show that apparent motion caused a blood-oxygenation-level-dependent response along the V1 representations of the apparent-motion path, including regions that were not directly activated by the apparent-motion-inducing stimuli. This response was unaltered when participants had to perform an attention-demanding task that diverted their attention away from the stimulus. With a bistable motion quartet, we confirmed that the activity was related to the conscious perception of movement. Our data suggest that V1 is part of the network that represents the illusory path of apparent motion. The activation in V1 can be explained either by lateral interactions within V1 or by feedback mechanisms from higher visual areas, especially the motion-sensitive human MT/V5 complex.

The Riddle of the Apparently Hollow Himalaya

Indian Academy of Sciences (India)

The Riddle of the Apparently Hollow Himalaya. Ramesh .... It was as if the Himalayas were hollow inside. ... block would be consistent with the ground elevation in such a ... Alternative models and possible preference: Many refinements of.

Specificity of DNA-binding by the FAX-1 and NHR-67 nuclear receptors of Caenorhabditis elegans is partially mediated via a subclass-specific P-box residue

Directory of Open Access Journals (Sweden)

Smith Eric L

2008-01-01

Full Text Available Abstract Background The nuclear receptors of the NR2E class play important roles in pattern formation and nervous system development. Based on a phylogenetic analysis of DNA-binding domains, we define two conserved groups of orthologous NR2E genes: the NR2E1 subclass, which includes C. elegans nhr-67, Drosophila tailless and dissatisfaction, and vertebrate Tlx (NR2E2, NR2E4, NR2E1, and the NR2E3 subclass, which includes C. elegans fax-1 and vertebrate PNR (NR2E5, NR2E3. PNR and Tll nuclear receptors have been shown to bind the hexamer half-site AAGTCA, instead of the hexamer AGGTCA recognized by most other nuclear receptors, suggesting unique DNA-binding properties for NR2E class members. Results We show that NR2E3 subclass member FAX-1, unlike NHR-67 and other NR2E1 subclass members, binds to hexamer half-sites with relaxed specificity: it will bind hexamers with the sequence ANGTCA, although it prefers a purine to a pyrimidine at the second position. We use site-directed mutagenesis to demonstrate that the difference between FAX-1 and NHR-67 binding preference is partially mediated by a conserved subclass-specific asparagine or aspartate residue at position 19 of the DNA-binding domain. This amino acid position is part of the "P box" that plays a critical role in defining binding site specificity and has been shown to make hydrogen-bond contacts to the second position of the hexamer in co-crystal structures for other nuclear receptors. The relaxed specificity allows FAX-1 to bind a much larger repertoire of half-sites than NHR-67. While NR2E1 class proteins bind both monomeric and dimeric sites, the NR2E3 class proteins bind only dimeric sites. The presence of a single strong site adjacent to a very weak site allows dimeric FAX-1 binding, further increasing the number of dimeric binding sites to which FAX-1 may bind in vivo. Conclusion These findings identify subclass-specific DNA-binding specificities and dimerization properties for the NR2E1

The apparent and effective chloride migration coefficients obtained in migration tests

NARCIS (Netherlands)

Spiesz, P.R.; Brouwers, H.J.H.

2013-01-01

The apparent (Dapp) and effective (Deff) migration coefficients obtained in chloride migration tests are investigated in this study. The presented Dapp profiles in concrete show that the apparent migration coefficient is strongly concentration-dependent. As demonstrated, the binding of chlorides is

Interactions between motion and form processing in the human visual system.

Science.gov (United States)

Mather, George; Pavan, Andrea; Bellacosa Marotti, Rosilari; Campana, Gianluca; Casco, Clara

2013-01-01

The predominant view of motion and form processing in the human visual system assumes that these two attributes are handled by separate and independent modules. Motion processing involves filtering by direction-selective sensors, followed by integration to solve the aperture problem. Form processing involves filtering by orientation-selective and size-selective receptive fields, followed by integration to encode object shape. It has long been known that motion signals can influence form processing in the well-known Gestalt principle of common fate; texture elements which share a common motion property are grouped into a single contour or texture region. However, recent research in psychophysics and neuroscience indicates that the influence of form signals on motion processing is more extensive than previously thought. First, the salience and apparent direction of moving lines depends on how the local orientation and direction of motion combine to match the receptive field properties of motion-selective neurons. Second, orientation signals generated by "motion-streaks" influence motion processing; motion sensitivity, apparent direction and adaptation are affected by simultaneously present orientation signals. Third, form signals generated by human body shape influence biological motion processing, as revealed by studies using point-light motion stimuli. Thus, form-motion integration seems to occur at several different levels of cortical processing, from V1 to STS.

Apparent Coefficient of Friction of Wheat on Denim.

Science.gov (United States)

Schwab, Charles V

2017-07-31

Calculation of the extraction force for a grain entrapment victim requires a coefficient of friction between the grain and the surface of the victim. Because denim is a common fabric for the work clothes that cover entrapment victims, the coefficient of friction between grain and denim becomes necessary. The purpose of this research was to calculate the apparent coefficient of friction of wheat on denim fabric using a proven procedure. The expectation is to improve the current understanding of conditions that influence extraction forces for victims buried in wheat. The apparent coefficient of friction of wheat on denim fabric was calculated to be 0.167 with a standard deviation of ±0.013. The wheat had a moisture content of 10.7% (w.b.) and bulk density of 778.5 kg m-3. The apparent coefficient of friction of wheat on denim was not significantly affected by pull speeds of 0.004, 0.008, and 0.021 mm s-1 nor normal grain pressures of 3.2, 4.8, 6.3, 7.9, and 11.1 kPa. This is a beginning of understanding the conditions that influence the extraction forces for grain entrapment victims. Copyright© by the American Society of Agricultural Engineers.

Apparent resistivity for transient electromagnetic induction logging and its correction in radial layer identification

Science.gov (United States)

Meng, Qingxin; Hu, Xiangyun; Pan, Heping; Xi, Yufei

2018-04-01

We propose an algorithm for calculating all-time apparent resistivity from transient electromagnetic induction logging. The algorithm is based on the whole-space transient electric field expression of the uniform model and Halley's optimisation. In trial calculations for uniform models, the all-time algorithm is shown to have high accuracy. We use the finite-difference time-domain method to simulate the transient electromagnetic field in radial two-layer models without wall rock and convert the simulation results to apparent resistivity using the all-time algorithm. The time-varying apparent resistivity reflects the radially layered geoelectrical structure of the models and the apparent resistivity of the earliest time channel follows the true resistivity of the inner layer; however, the apparent resistivity at larger times reflects the comprehensive electrical characteristics of the inner and outer layers. To accurately identify the outer layer resistivity based on the series relationship model of the layered resistance, the apparent resistivity and diffusion depth of the different time channels are approximately replaced by related model parameters; that is, we propose an apparent resistivity correction algorithm. By correcting the time-varying apparent resistivity of radial two-layer models, we show that the correction results reflect the radially layered electrical structure and the corrected resistivities of the larger time channels follow the outer layer resistivity. The transient electromagnetic fields of radially layered models with wall rock are simulated to obtain the 2D time-varying profiles of the apparent resistivity and corrections. The results suggest that the time-varying apparent resistivity and correction results reflect the vertical and radial geoelectrical structures. For models with small wall-rock effect, the correction removes the effect of the low-resistance inner layer on the apparent resistivity of the larger time channels.

Novel covalently linked insulin dimer engineered to investigate the function of insulin dimerization.

Directory of Open Access Journals (Sweden)

Tine N Vinther

Full Text Available An ingenious system evolved to facilitate insulin binding to the insulin receptor as a monomer and at the same time ensure sufficient stability of insulin during storage. Insulin dimer is the cornerstone of this system. Insulin dimer is relatively weak, which ensures dissociation into monomers in the circulation, and it is stabilized by hexamer formation in the presence of zinc ions during storage in the pancreatic β-cell. Due to the transient nature of insulin dimer, direct investigation of this important form is inherently difficult. To address the relationship between insulin oligomerization and insulin stability and function, we engineered a covalently linked insulin dimer in which two monomers were linked by a disulfide bond. The structure of this covalent dimer was identical to the self-association dimer of human insulin. Importantly, this covalent dimer was capable of further oligomerization to form the structural equivalent of the classical hexamer. The covalently linked dimer neither bound to the insulin receptor, nor induced a metabolic response in vitro. However, it was extremely thermodynamically stable and did not form amyloid fibrils when subjected to mechanical stress, underlining the importance of oligomerization for insulin stability.

Structure of the C-terminal effector-binding domain of AhrC bound to its corepressor l-arginine

International Nuclear Information System (INIS)

Garnett, James A.; Baumberg, Simon; Stockley, Peter G.; Phillips, Simon E. V.

2007-01-01

The crystal structure of the C-terminal domain hexameric core of AhrC, with bound corepressor (l-arginine), has been solved at 1.95 Å resolution. Binding of l-arginine results in a rotation between the two trimers of the hexamer, leading to the activation of the DNA-binding state. The arginine repressor/activator protein (AhrC) from Bacillus subtilis belongs to a large family of multifunctional transcription factors that are involved in the regulation of bacterial arginine metabolism. AhrC interacts with operator sites in the promoters of arginine biosynthetic and catabolic operons, acting as a transcriptional repressor at biosynthetic sites and an activator of transcription at catabolic sites. AhrC is a hexamer of identical subunits, each having two domains. The C-terminal domains form the core of the protein and are involved in oligomerization and l-arginine binding. The N-terminal domains lie on the outside of the compact core and play a role in binding to 18 bp DNA operators called ARG boxes. The C-terminal domain of AhrC has been expressed, purified and characterized, and also crystallized as a hexamer with the bound corepressor l-arginine. Here, the crystal structure refined to 1.95 Å is presented

Evidence that a Highway Reduces Apparent Survival Rates of Squirrel Gliders

Directory of Open Access Journals (Sweden)

Sarah C. McCall

2010-09-01

Full Text Available Roads and traffic are prominent components of most landscapes throughout the world, and their negative effects on the natural environment can extend for hundreds or thousands of meters beyond the road. These effects include mortality of wildlife due to collisions with vehicles, pollution of soil and air, modification of wildlife behavior in response to noise, creation of barriers to wildlife movement, and establishment of dispersal conduits for some plant and animal species. In southeast Australia, much of the remaining habitat for the squirrel glider, Petaurus norfolcensis, is located in narrow strips of Eucalyptus woodland that is adjacent to roads and streams, as well as in small patches of woodland vegetation that is farther from roads. We evaluated the effect of traffic volume on squirrel gliders by estimating apparent annual survival rates of adults along the Hume Freeway and nearby low-traffic-volume roads. We surveyed populations of squirrel gliders by trapping them over 2.5 years, and combined these data with prior information on apparent survival rates in populations located away from freeways to model the ratio of apparent annual survival rates in both site types. The apparent annual survival rate of adult squirrel gliders living along the Hume Freeway was estimated to be approximately 60% lower than for squirrel gliders living near local roads. The cause of the reduced apparent survival rate may be due to higher rates of mortality and/or higher emigration rates adjacent to the Hume Freeway compared with populations near smaller country roads. Management options for population persistence will be influenced by which of these factors is the primary cause of a reduced apparent survival rate.

Apparent nutrient digestibility and performance of Heterobranchus ...

African Journals Online (AJOL)

Apparent digestibility coefficients (ADCs) of nutrients is a useful tool for fish diet formulation, which gives the right estimation of growth, thereby reducing waste products. The ADCs of crude protein, energy and dry matter of processed earthworm, Libyodrilus violaceus meal by Heterobranchus longifilis fingerlings ...

Reverse transcription using random pentadecamer primers increases yield and quality of resulting cDNA

DEFF Research Database (Denmark)

Stangegaard, Michael; Dufva, I.H.; Dufva, Hans Martin

2006-01-01

oligonucleotides (pentadecamers) consistently, yielded at least 2 fold as much cDNA as did random hexamers using either-poly(A) RNA or an amplified version of messenger RNA (aRNA) as a template. The cDNA generated using pentadecamers did not differ in size distribution or the amount of incorporated label compared...... with cDNA generated with random hexamers. The increased efficiency of priming using random pentadecamers resulted in reverse transcription of > 80% of the template aRNA, while random hexamers induced reverse transcription of only 40% of the template aRNA. This suggests a better coverage...... that random pentadecamers can replace random hexamers in reverse transcription reactions on both poly(A) RNA and amplified RNA, resulting in higher cDNA yields and quality....

Blood pressure and pulse rate of apparently healthy adults on land ...

African Journals Online (AJOL)

Blood pressure and pulse rate of apparently healthy adults on land and in water: A comparative study. AI Bello, BOA Adegoke, OA Abass, O Addo. Abstract. Objective: The study compared cardiovascular parameters of apparently healthy adults in erect standing posture on land and whilst immersed in water at rest. Methods: ...

A New Perspective on the Apparent Solubility of Dissolved Black Carbon

Directory of Open Access Journals (Sweden)

Sasha Wagner

2017-09-01

Full Text Available Black carbon (BC, pyrogenic organic matter generated from the incomplete combustion of biomass, is ubiquitous in the environment. The molecular structures which comprise the BC pool of compounds are defined by their condensed aromatic core structures polysubstituted with O-containing functionalities (e.g., carboxyl groups. Despite the apparent hydrophobicity of BC molecules, a considerable portion of BC is translocated from terrestrial to aquatic systems in the form of dissolved BC (DBC. However, the specific biogeochemical mechanisms which control the transfer of BC from the land to the water remain elusive. In the current study, the apparent solubility of DBC was inferred from octanol-water partition coefficients (Kow modeled for proposed DBC structures with varying degrees of polycondensation and polar functionality. Modeled Kow values indicated that DBC molecules with small aromatic ring systems and high degrees of hydrophilic functionality may be truly solubilized in the aqueous phase. However, large and highly condensed DBC structures yielded high Kow values, which suggested that a considerable portion of the DBC pool which has been quantified in aquatic environments is not truly dissolved. We hypothesized that other DOM components may act as mediators in the solubilization of condensed aromatic molecules and serve to increase the solubility of DBC via hydrophobic, intermolecular associations. This hypothesis was tested through controlled leaching experiments to determine whether the mobilization of DBC from particulate soils and chars became enhanced in the presence of DOM. However, we observed that characteristics inherent to each sample type had a greater influence than added DOM on the apparent solubility of DBC. In addition, the direct comparison of molecular marker (benzenepolycarboxylic acids and ultrahigh resolution mass spectral data (FT-ICR/MS on leachates obtained from the same set of soils and char did not show a clear overlap

A new perspective on the apparent solubility of dissolved black carbon

Science.gov (United States)

Wagner, Sasha; Ding, Yan; Jaffé, Rudolf

2017-09-01

Black carbon (BC), pyrogenic organic matter generated from the incomplete combustion of biomass, is ubiquitous in the environment. The molecular structures which comprise the BC pool of compounds are defined by their condensed aromatic core structures polysubstituted with O-containing functionalities (e.g., carboxyl groups). Despite the apparent hydrophobicity of BC molecules, a considerable portion of BC is translocated from terrestrial to aquatic systems in the form of dissolved BC (DBC). However, the specific biogeochemical mechanisms which control the transfer of BC from the land to the water remain elusive. In the current study, the apparent solubility of DBC was inferred from octanol-water partition coefficients (Kow) modeled for proposed DBC structures with varying degrees of polycondensation and polar functionality. Modeled Kow values indicated that DBC molecules with small aromatic ring systems and high degrees of hydrophilic functionality may be truly solubilized in the aqueous phase. However, large and highly condensed DBC structures yielded high Kow values, which suggested that a considerable portion of the DBC pool which has been quantified in aquatic environments is not truly dissolved. We hypothesized that other DOM components may act as mediators in the solubilization of condensed aromatic molecules and serve to increase the solubility of DBC via hydrophobic, intermolecular associations. This hypothesis was tested through controlled leaching experiments to determine whether the mobilization of DBC from particulate soils and chars became enhanced in the presence of DOM. However, we observed that characteristics inherent to each sample type had a greater influence than added DOM on the apparent solubility of DBC. In addition, the direct comparison of molecular marker (benzenepolycarboxylic acids) and ultrahigh resolution mass spectral data (FT-ICR/MS) on leachates obtained from the same set of soils and char did not show a clear overlap in DBC

Multiple isoelectric forms of poliovirus RNA-dependent RNA polymerase: Evidence for phosphorylation

International Nuclear Information System (INIS)

Ransone, L.J.; Dasgupta, A.

1989-01-01

Poliovirus-specific RNA-dependent RNA polymerase (3Dpol) was purified to apparent homogeneity. A single polypeptide of an apparent molecular weight of 63,000 catalyzes the synthesis of dimeric and monomeric RNA products in response to the poliovirion RNA template. Analysis of purified 3Dpol by two-dimensional electrophoresis showed multiple forms of 3Dpol, suggesting posttranslational modification of the protein in virus-infected cells. The two major forms of 3Dpol appear to have approximate pI values of 7.1 and 7.4. Incubation of purified 3Dpol with calf intestinal phosphatase resulted in almost complete disappearance of the pI 7.1 form and a concomitant increase in the intensity of the pI 7.4 form of 3Dpol. Addition of 32P-labeled Pi during infection of HeLa cells with poliovirus resulted in specific labeling of 3Dpol and 3CD, a viral protein which contains the entire 3Dpol sequence. Both 3Dpol and 3CD appear to be phosphorylated at serine residues. Ribosomal salt washes prepared from both mock- and poliovirus-infected cells contain phosphatases capable of dephosphorylating quantitatively the phosphorylated form (pI 7.1) of 3Dpol

Oral temperature and cardiovascular responses of apparently ...

African Journals Online (AJOL)

Oral temperature and cardiovascular responses of apparently healthy subjects to passive and active warm-up. BOA Adegoke, OO Ogwumike, FA Maruf. Abstract. This study investigated and compared the effects of active and passive warm-up on oral temperature and cardiovascular parameters of forty (20 males and 20 ...

Interactions between motion and form processing in the human visual system

Directory of Open Access Journals (Sweden)

George eMather

2013-05-01

Full Text Available The predominant view of motion and form processing in the human visual system assumes that these two attributes are handled by separate and independent modules. Motion processing involves filtering by direction-selective sensors, followed by integration to solve the aperture problem. Form processing involves filtering by orientation-selective and size-selective receptive fields, followed by integration to encode object shape. It has long been known that motion signals can influence form processing in the well-known Gestalt principle of common fate; texture elements which share a common motion property are grouped into a single contour or texture region. However recent research in psychophysics and neuroscience indicates that the influence of form signals on motion processing is more extensive than previously thought. First, the salience and apparent direction of moving lines depends on how the local orientation and direction of motion combine to match the receptive field properties of motion-selective neurons. Second, orientation signals generated by ‘motion-streaks’ influence motion processing; motion sensitivity, apparent direction and adaptation are affected by simultaneously present orientation signals. Third, form signals generated by human body shape influence biological motion processing, as revealed by studies using point-light motion stimuli. Thus form-motion integration seems to occur at several different levels of cortical processing, from V1 to STS.

Apparent molar volumes and compressibilities of electrolytes and ions in γ-butyrolactone

International Nuclear Information System (INIS)

Krakowiak, Joanna; Wawer, Jarosław; Farmas, Aleksander

2012-01-01

Highlights: ► Density and speed of sound for salts solutions in γ-butyrolactone were measured. ► The apparent molar volumes and compressibilities have been determined. ► The limiting molar quantities are split into independent ionic contributions. ► These data are used to describe ion–solvent interactions. - Abstract: The densities of tetraphenylphosphonium bromide, sodium tetraphenylborate, lithium perchlorate, sodium perchlorate and lithium bromide in γ-butyrolactone at (288.15, 293.15, 298.15, 303.15, 308.15 and 313.15) K and speed of sound at 298.15 K have been measured. From these data apparent molar volumes V Φ at (288.15, 293.15, 298.15, 303.15, 308.15 and 313.15) K and the apparent molar isentropic compressibility K S,Φ , at T = 298.15 K of the salts have been determined. The apparent molar volumes and the apparent molar isentropic compressibilities were fitted to the Redlich, Rosenfeld and Mayer equation as well as to the Pitzer and Masson equations yielding infinite dilution data. The obtained limiting values have been used to estimate the ionic data of the standard partial molar volume and the standard partial isentropic compressibility in γ-butyrolactone solutions.

Multi-epoch VLBA Imaging of 20 New TeV Blazars: Apparent Jet Speeds

Science.gov (United States)

Piner, B. Glenn; Edwards, Philip G.

2018-01-01

We present 88 multi-epoch Very Long Baseline Array (VLBA) images (most at an observing frequency of 8 GHz) of 20 TeV blazars, all of the high-frequency-peaked BL Lac (HBL) class, that have not been previously studied at multiple epochs on the parsec scale. From these 20 sources, we analyze the apparent speeds of 43 jet components that are all detected at four or more epochs. As has been found for other TeV HBLs, the apparent speeds of these components are relatively slow. About two-thirds of the components have an apparent speed that is consistent (within 2σ) with no motion, and some of these components may be stationary patterns whose apparent speed does not relate to the underlying bulk flow speed. In addition, a superluminal tail to the apparent speed distribution of the TeV HBLs is detected for the first time, with eight components in seven sources having a 2σ lower limit on the apparent speed exceeding 1c. We combine the data from these 20 sources with an additional 18 sources from the literature to analyze the complete apparent speed distribution of all 38 TeV HBLs that have been studied with very long baseline interferometry at multiple epochs. The highest 2σ apparent speed lower limit considering all sources is 3.6c. This suggests that bulk Lorentz factors of up to about 4, but probably not much higher, exist in the parsec-scale radio-emitting regions of these sources, consistent with estimates obtained in the radio by other means such as brightness temperatures. This can be reconciled with the high Lorentz factors estimated from the high-energy data if the jet has velocity structures consisting of different emission regions with different Lorentz factors. In particular, we analyze the current apparent speed data for the TeV HBLs in the context of a model with a fast central spine and a slower outer layer.

First-principles study of helium clustering at initial stage in ThO2

International Nuclear Information System (INIS)

Shao Kuan; Han Han; Zhang Wei; Wang Chang-Ying; Guo Yong-Liang; Ren Cui-Lan; Huai Ping

2017-01-01

The clustering behavior of helium atoms in thorium dioxide has been investigated by first-principles calculations. The results show that He atoms tend to form a cluster around an octahedral interstitial site (OIS). As the concentration of He atoms in ThO 2 increases, the strain induced by the He atoms increases and the octahedral interstitial site is not large enough to accommodate a large cluster, such as a He hexamer. We considered three different Schottky defect (SD) configurations (SD 1 , SD 2 , and SD 3 . When He atoms are located in the SD sites, the strain induced by the He atoms is released and the incorporation and binding energies decrease. The He trimer is the most stable cluster in SD 1 . Large He clusters, such as a He hexamer, are also stable in the SDs. (paper)

Microbially influenced degradation of cement-solidified low-level radioactive waste forms

International Nuclear Information System (INIS)

Rogers, R.D.; Hamilton, M.A.; Veeh, R.H.; McConnell, J.W. Jr.

1996-01-01

Because of its apparent structural integrity, cement has been widely used in the United States as a binder to solidify Class B and C low-level radioactive waste (LLW). However, the resulting cement preparations are susceptible to failure due to the actions of stress and environment. This paper contains information on three groups of microoganisms that are associated with the degradation of cement materials: sulfur-oxidizing bacteria (Thiobacillus), nitrifying bacteria (Nitrosomonas and Nitrobacter), and heterotrophic bacteria, which produce organic acids. Preliminary work using laboratory- and vendor-manufactured, simulated waste forms exposed to thiobacilli has shown that microbiologically influenced degradation has the potential to severely compromise the structural integrity of ion-exchange resin and evaporator-bottoms waste that is solidified with cement. In addition, it was found that a significant percentage of calcium was leached from the treated waste forms. Also, the surface pH of the treated specimens was decreased to below 2. These conditions apparently contributed to the physical deterioration of simulated waste forms after 30 to 60 days of exposure

A rare case of a familial form of nonsyndromic trigonocephaly ...

African Journals Online (AJOL)

The psychomotor development of patients is usually normal and the majority of cases are mild. Most cases are sporadic but familial forms with apparently autosomal dominant transmission have been reported (7-8%). However, the concordance rate of isolated trigonocephaly in monozygotic twins is 43%, suggesting that ...

The effect of particle structure on apparent density of electrolytic copper powder

Directory of Open Access Journals (Sweden)

K. I. POPOV

2001-12-01

Full Text Available The quantitative microstructural analysis and the sieve analysis of copper powder as well as the scanning electron microscopy analysis of the copper powders particles were performed. It was found that the structure of the copper powder particles determines the apparent density of copper powder. The powder particles from the same fractions of different powders occupy approximately the same volume, but the structure of metallic copper is very different. This causes the difference in apparent densities of copper powder obtained under different conditions. The more dendritic is the structure of powder particles the smaller is the apparent density of copper powder.

Chemical and thermal stability of insulin

DEFF Research Database (Denmark)

Huus, Kasper; Havelund, Svend; Olsen, Helle B

2006-01-01

To study the correlation between the thermal and chemical stability of insulin formulations with various insulin hexamer ligands.......To study the correlation between the thermal and chemical stability of insulin formulations with various insulin hexamer ligands....

Tertiary work-up of apparent treatment-resistant hypertension.

Science.gov (United States)

Heimark, Sondre; Eskås, Per Anders; Mariampillai, Julian Eek; Larstorp, Anne Cecilie K; Høieggen, Aud; Fadl Elmula, Fadl Elmula M

2016-10-01

Treatment-resistant hypertension (TRH) has regained attention with development of new methods for treatment. However, the prevalence of TRH varies considerably from primary to secondary and tertiary care. We aimed to assess the prevalence of true TRH in a population of patients with apparent TRH in a university hospital setting of tertiary work-up and also investigate reasons for poor BP control and evaluate how work-up can be performed in general practice and secondary care. In this cohort study, we characterize a study population from Oslo Renal Denervation (RDN) Study. Patients (n = 83) were referred for RDN from secondary care. All patients underwent thorough medical investigation and 24-h ambulatory blood pressure measurements (24ABPM) after directly observed therapy (DOT). We then assessed reasons for lack of BP control. Fifty-three of 83 patients did not have true TRH. Main reasons for non-TRH were poor drug adherence (32%), secondary hypertension (30%) and white coat hypertension (15%). Forty-seven percent achieved blood pressure control after DOT with subsequent 24ABPM. There were otherwise no statistically significant differences in patient characteristics between the true TRH and the non-TRH group. Despite being a highly selected cohort referred for tertiary work-up of apparent TRH, BP control was achieved or secondary causes were identified in almost two thirds of the patients. Thorough investigation according to guidelines and DOT with subsequent 24ABPM is needed in work-up of apparent TRH.

Event and Apparent Horizon Finders for 3 + 1 Numerical Relativity.

Science.gov (United States)

Thornburg, Jonathan

2007-01-01

Event and apparent horizons are key diagnostics for the presence and properties of black holes. In this article I review numerical algorithms and codes for finding event and apparent horizons in numerically-computed spacetimes, focusing on calculations done using the 3 + 1 ADM formalism. The event horizon of an asymptotically-flat spacetime is the boundary between those events from which a future-pointing null geodesic can reach future null infinity and those events from which no such geodesic exists. The event horizon is a (continuous) null surface in spacetime. The event horizon is defined nonlocally in time : it is a global property of the entire spacetime and must be found in a separate post-processing phase after all (or at least the nonstationary part) of spacetime has been numerically computed. There are three basic algorithms for finding event horizons, based on integrating null geodesics forwards in time, integrating null geodesics backwards in time, and integrating null surfaces backwards in time. The last of these is generally the most efficient and accurate. In contrast to an event horizon, an apparent horizon is defined locally in time in a spacelike slice and depends only on data in that slice, so it can be (and usually is) found during the numerical computation of a spacetime. A marginally outer trapped surface (MOTS) in a slice is a smooth closed 2-surface whose future-pointing outgoing null geodesics have zero expansion Θ. An apparent horizon is then defined as a MOTS not contained in any other MOTS. The MOTS condition is a nonlinear elliptic partial differential equation (PDE) for the surface shape, containing the ADM 3-metric, its spatial derivatives, and the extrinsic curvature as coefficients. Most "apparent horizon" finders actually find MOTSs. There are a large number of apparent horizon finding algorithms, with differing trade-offs between speed, robustness, accuracy, and ease of programming. In axisymmetry, shooting algorithms work well

A Non-Mainstream Viewpoint on Apparent Superluminal ...

Indian Academy of Sciences (India)

Abstract. The group velocity of light in material around the AGN jet is acquiescently one (c as a unit), but this is only a hypothesis. Here, we re-derive apparent superluminal and Doppler formulas for the general case (it is assumed that the group velocity of light in the uniform and isotropic medium around a jet (a beaming ...

A report of two cases of Al-Awadi Raas-Rothschild syndrome (AARRS) supporting that "apparent" Phocomelia differentiates AARRS from Schinzel Phocomelia syndrome (SPS).

Science.gov (United States)

AlQattan, Mohammad M; AlAbdulkareem, Ibrahim; Ballow, Mariam; Al Balwi, Mohammed

2013-09-15

Although there is a long list of syndromes with phocomelia, there are only two syndromes in which there is concurrent pelvic dysplasia and phocomelia: Al-Awadi-Raas-Rothschild syndrome (AARRS) and Schinzel phocomelia syndrome (SPS). Currently, there is a diagnostic confusion between the two syndromes and both have the same MIM entry (MIM 276820). We believe that the two syndromes are different entities and we also believe that the limb defect in SPS is a "true" phocomelia while the limb defect in AARRS is an "apparent" phocomelia. "Apparent" phocomelia describes the most severe form of ulnar ray deficiency in which there is absent ulna with radio-humeral synostosis. "Apparent" phocomelia is diagnosed radiologically by three radiological features: the apparently single bone occupying the arm/forearm appears relatively long, the area of radio-humeral synostosis will have thicker cortex with or without slight angulation, and the lower end of the bone resembles the lower end of a radius and not a humerus. In this paper, we present two new cases of AARRS from two different Saudi Arabian tribes: one case with R292C mutation of WNT7A with bilateral "apparent" phocomelia and a second case with a novel c.814G>T mutation of the WNT7A gene (resulting in wnt7a protein truncation at position 272) with unilateral "apparent" phocomelia. We reviewed previously reported cases of AARRS and SPS to further delineate the differences between these two syndromes. We make the argument that these two syndromes are two different entities and hence require two different MIM entries. Copyright © 2013 Elsevier B.V. All rights reserved.

Intersubunit ionic interactions stabilize the nucleoside diphosphate kinase of Mycobacterium tuberculosis

DEFF Research Database (Denmark)

Georgescauld, Florian; Moynie, Lucile; Habersetzer, Johann

2013-01-01

activity and for protein stability to thermal and chemical denaturation. We identified the intersubunit salt bridge Arg(80) -Asp(93) as essential for hexamer stability, compensating for the decreased intersubunit contact area. Breaking the salt bridge by the mutation D93N dramatically decreased protein...... of the wild type simultaneously occur at higher urea concentrations. The dissociation step was not observed in guanidine hydrochloride, suggesting that low concentration of salt may stabilize the hexamer. Indeed, guanidinium and many other salts stabilized the hexamer with a half maximum effect of about 0.1 M...

Hjertestop associeret med syndrome of apparent mineralocorticoid excess

DEFF Research Database (Denmark)

Meldgaard-Nielsen, Anne; Laugesen, Esben; Poulsen, Per Løgstrup

2014-01-01

Ventricular fibrillation is an unknown complication to the syndrome of apparent mineralocorticoid excess (SAME). This case report describes a young woman admitted with hypo-kalaemia and hypertension. Concentrations of both P-renin and P-aldosterone were low and urinary steroid metabolites revealed...

Genetic overlap between apparently sporadic motor neuron diseases

NARCIS (Netherlands)

van Blitterswijk, Marka; Vlam, Lotte; van Es, Michael A.; van der Pol, W.-Ludo; Hennekam, Eric A. M.; Dooijes, Dennis; Schelhaas, Helenius J.; van der Kooi, Anneke J.; de Visser, Marianne; Veldink, Jan H.; van den Berg, Leonard H.

2012-01-01

Progressive muscular atrophy (PMA) and amyotrophic lateral sclerosis (ALS) are devastating motor neuron diseases (MNDs), which result in muscle weakness and/or spasticity. We compared mutation frequencies in genes known to be associated with MNDs between patients with apparently sporadic PMA and

Assessing the intersection/remagnetization puzzle with synthetic apparent polar wander paths

Science.gov (United States)

Pivarunas, Anthony F.; Meert, Joseph G.; Miller, Scott R.

2018-05-01

Paleomagnetic data are of variable quality. To assist in a systematic assessment of data, a set of seven quality criteria (VQ1 - VQ7) were introduced by Van der Voo (1990). The last of those criteria `VQ7' concerns the possibility of remagnetization when a particular paleomagnetic pole resembles a younger paleopole from the same stable region. While remagnetizations are often the culprit, the mere resemblance of an older pole to a younger pole does not a priori require that the rocks under investigation are remagnetized. Given that the Earth has a finite surface area; that apparent polar wander paths are represented as wide swathes rather than points, and that continental motion has taken place over several billion years, we ask the question `How likely is it for an apparent polar wander path to loop back on itself?' To answer this question, we constructed synthetic apparent polar wander paths (APWPs) in an effort to evaluate the likelihood of self-intersection. We find that given 500 Myr of apparent polar wander, ˜60 per cent of the synthetic APWPs show self-intersection. Given 1000 Myr of apparent polar wander, ˜95 per cent of the synthetic APWPs show self-intersection. These results show that resemblance to younger paleopoles, over the long term, may be governed by simple probability rather than only remagnetization. We recognize that remagnetization does occur, sometimes pervasively, and must be reckoned with in the assessment of paleomagnetic data. Perhaps VQ7 should be amended to the first sentence in the original discussion (Van der Voo, 1990), and focus on satisfying `No suspicion of remagnetization' via other means rather than solely a resemblance to younger poles.

APPARENT CROSS-FIELD SUPERSLOW PROPAGATION OF MAGNETOHYDRODYNAMIC WAVES IN SOLAR PLASMAS

Energy Technology Data Exchange (ETDEWEB)

Kaneko, T.; Yokoyama, T. [Department of Earth and Planetary Science, The University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo, 113-0033 (Japan); Goossens, M.; Doorsselaere, T. Van [Centre for Mathematical Plasma Astrophysics, Katholieke Universiteit Leuven, Celestijnenlaan 200B, Bus 2400, B-3001 Herverlee (Belgium); Soler, R.; Terradas, J. [Departament de Física, Universitat de les Illes Balears, E-07122 Palma de Mallorca (Spain); Wright, A. N., E-mail: kaneko@eps.s.u-tokyo.ac.jp [School of Mathematics and Statistics, University of St Andrews, St Andrews, KY16 9SS (United Kingdom)

2015-10-20

In this paper we show that the phase-mixing of continuum Alfvén waves and/or continuum slow waves in the magnetic structures of the solar atmosphere as, e.g., coronal arcades, can create the illusion of wave propagation across the magnetic field. This phenomenon could be erroneously interpreted as fast magnetosonic waves. The cross-field propagation due to the phase-mixing of continuum waves is apparent because there is no real propagation of energy across the magnetic surfaces. We investigate the continuous Alfvén and slow spectra in two-dimensional (2D) Cartesian equilibrium models with a purely poloidal magnetic field. We show that apparent superslow propagation across the magnetic surfaces in solar coronal structures is a consequence of the existence of continuum Alfvén waves and continuum slow waves that naturally live on those structures and phase-mix as time evolves. The apparent cross-field phase velocity is related to the spatial variation of the local Alfvén/slow frequency across the magnetic surfaces and is slower than the Alfvén/sound velocities for typical coronal conditions. Understanding the nature of the apparent cross-field propagation is important for the correct analysis of numerical simulations and the correct interpretation of observations.

Apparent exchange rate imaging in anisotropic systems

DEFF Research Database (Denmark)

Sønderby, Casper Kaae; Lundell, Henrik M; Søgaard, Lise V

2014-01-01

Double-wave diffusion experiments offer the possibility of probing correlation between molecular diffusion at multiple time points. It has recently been shown that this technique is capable of measuring the exchange of water across cellular membranes. The aim of this study was to investigate...... the effect of macroscopic tissue anisotropy on the measurement of the apparent exchange rate (AXR) in multicompartment systems....

Apparent competition with an invasive plant hastens the extinction of an endangered lupine.

Science.gov (United States)

Dangremond, Emily M; Pardini, Eleanor A; Knight, Tiffany M

2010-08-01

Invasive plants may compete with native plants by increasing the pressure of native consumers, a mechanism known as "apparent competition." Apparent competition can be as strong as or stronger than direct competition, but the role of apparent competition has rarely been examined in biological invasions. We used four years of demographic data and seed-removal experiments to determine if introduced grasses caused elevated levels of seed consumption on native plant species in a coastal dune system in California, USA. We show that the endangered, coastal dune plant Lupinus tidestromii experiences high levels of pre-dispersal seed consumption by the native rodent Peromyscus maniculatus due to its proximity to the invasive grass, Ammophila arenaria. We use stage-structured, stochastic population models to project that two of three study populations will decline toward extinction under ambient levels of consumption. For one of these declining populations, a relatively small decrease in consumption pressure should allow for persistence. We show that apparent competition with an invasive species significantly decreases the population growth rate and persistence of a native species. We expect that apparent competition is an important mechanism in other ecosystems because invasive plants often change habitat structure and plant-consumer interactions. Possible implications of the apparent-competition mechanism include selective extinction of species preferred by seed consumers in the presence of an invasive species and biological homogenization of communities toward non-preferred native plant species.

Second-order processing of four-stroke apparent motion.

Science.gov (United States)

Mather, G; Murdoch, L

1999-05-01

In four-stroke apparent motion displays, pattern elements oscillate between two adjacent positions and synchronously reverse in contrast, but appear to move unidirectionally. For example, if rightward shifts preserve contrast but leftward shifts reverse contrast, consistent rightward motion is seen. In conventional first-order displays, elements reverse in luminance contrast (e.g. light elements become dark, and vice-versa). The resulting perception can be explained by responses in elementary motion detectors turned to spatio-temporal orientation. Second-order motion displays contain texture-defined elements, and there is some evidence that they excite second-order motion detectors that extract spatio-temporal orientation following the application of a non-linear 'texture-grabbing' transform by the visual system. We generated a variety of second-order four-stroke displays, containing texture-contrast reversals instead of luminance contrast reversals, and used their effectiveness as a diagnostic test for the presence of various forms of non-linear transform in the second-order motion system. Displays containing only forward or only reversed phi motion sequences were also tested. Displays defined by variation in luminance, contrast, orientation, and size were effective. Displays defined by variation in motion, dynamism, and stereo were partially or wholly ineffective. Results obtained with contrast-reversing and four-stroke displays indicate that only relatively simple non-linear transforms (involving spatial filtering and rectification) are available during second-order energy-based motion analysis.

Event and Apparent Horizon Finders for 3+1 Numerical Relativity

Directory of Open Access Journals (Sweden)

Thornburg Jonathan

2007-06-01

Full Text Available Event and apparent horizons are key diagnostics for the presence and properties of black holes. In this article I review numerical algorithms and codes for finding event and apparent horizons in numerically-computed spacetimes, focusing on calculations done using the 3+1 ADM formalism. The event horizon of an asymptotically-flat spacetime is the boundary between those events from which a future-pointing null geodesic can reach future null infinity and those events from which no such geodesic exists. The event horizon is a (continuous null surface in spacetime. The event horizon is defined nonlocally in time: it is a global property of the entire spacetime and must be found in a separate post-processing phase after all (or at least the nonstationary part of spacetime has been numerically computed.There are three basic algorithms for finding event horizons, based on integrating null geodesics forwards in time, integrating null geodesics backwards in time, and integrating null surfaces backwards in time. The last of these is generally the most efficient and accurate.In contrast to an event horizon, an apparent horizon is defined locally in time in a spacelike slice and depends only on data in that slice, so it can be (and usually is found during the numerical computation of a spacetime. A marginally outer trapped surface (MOTS in a slice is a smooth closed 2-surface whose future-pointing outgoing null geodesics have zero expansion Theta. An apparent horizon is then defined as a MOTS not contained in any other MOTS. The MOTS condition is a nonlinear elliptic partial differential equation (PDE for the surface shape, containing the ADM 3-metric, its spatial derivatives, and the extrinsic curvature as coefficients. Most “apparent horizon” finders actually find MOTSs.There are a large number of apparent horizon finding algorithms, with differing trade-offs between speed, robustness, accuracy, and ease of programming. In axisymmetry, shooting

Kidney Function Decline and Apparent Treatment-Resistant Hypertension in the Elderly.

Directory of Open Access Journals (Sweden)

Jean Kaboré

Full Text Available Cross-sectional studies show a strong association between chronic kidney disease and apparent treatment-resistant hypertension, but the longitudinal association of the rate of kidney function decline with the risk of resistant hypertension is unknown.The population-based Three-City included 8,695 participants older than 65 years, 4265 of them treated for hypertension. We estimated the odds ratios (OR of new-onset apparent treatment-resistant hypertension, defined as blood pressure ≥ 140/90 mmHg despite use of 3 antihypertensive drug classes or ≥ 4 classes regardless of blood pressure, associated with the mean estimated glomerular filtration rate (eGFR level and its rate of decline over 4 years, compared with both controlled hypertension and uncontrolled nonresistant hypertension with ≤ 2 drugs. GFR was estimated with three different equations.Baseline prevalence of apparent treatment-resistant hypertension and of controlled and uncontrolled nonresistant hypertension, were 6.5%, 62.3% and 31.2%, respectively. During follow-up, 162 participants developed apparent treatment-resistant hypertension. Mean eGFR decline with the MDRD equation was 1.5±2.9 mL/min/1.73 m² per year: 27.7% of the participants had an eGFR ≥3 and 10.1% ≥ 5 mL/min/1.73 m² per year. After adjusting for age, sex, obesity, diabetes, and cardiovascular history, the ORs for new-onset apparent treatment-resistant hypertension associated with a mean eGFR level, per 15 mL/min/1.73 m² drop, were 1.23 [95% confidence interval 0.91-1.64] compared to controlled hypertension and 1.10 [0.83-1.45] compared to uncontrolled nonresistant hypertension; ORs associated with a decline rate ≥ 3 mL/min/1.73 m² per year were 1.89 [1.09-3.29] and 1.99 [1.19-3.35], respectively. Similar results were obtained when we estimated GFR with the CKDEPI and the BIS1 equations. ORs tended to be higher for an eGFR decline rate ≥ 5 mL/min/1.73 m² per year.The speed of kidney function decline is

Minor Forms in a Badlands Landscape Framework

Energy Technology Data Exchange (ETDEWEB)

Diaz-Hernandez, J. L.; Yepes, J.; Romero-Diaz, A.

2009-07-01

We describe and classify some medium-scale erosional morphologies in badlands areas. They have been categorized in three different types: A) Surficial forms on horizontal surfaces (soil surface crusts, cracks, popcorn) and walls (slips, pseudo-stalactites). B) Punctual fingerprints: rain impact and micro-collapses (dimples). C) Ruiniform morphologies (caves, shelters, residual pinnacles). The A type shapes are caused by damping-desiccation phenomena on clayey soils; morphologies on walls are due to laminar runoff on weak lithologies (clay, loam), also dubbed pseudo-spleleothemes. Their scale is centimetric-decimetric. B-Type forms may be an external passive process (impact) or an internal dynamic process (dimples) occurring in granular sediments inside shelters, in conditions of apparent calm, measuring up to a few centimetres. The caves and shelters of type C generally involve an excavation following stratification or jointing planes, while the residual pinnacles are vertical forms linked to advanced piping and fluting. Both forms are decametric in scale. (Author) 7 refs.

Clinical forms of chronic dust-induced bronchitis

Energy Technology Data Exchange (ETDEWEB)

Levin, A.I.; Blokhina, L.M.

1984-08-01

Clinical study of 837 coal miners with chronic dust-induced bronchitis reveals three different forms of the disease: emphysematous, asthmatic and infectious. From development of clinical manifestations different etiologies of the disease are apparent. In early stages, three different types of chronic dust-induced bronchitis (CDB) are clearly distinguishable. With progression of condition differences are obliterated. Formulation of a diagnosis must reflect the form of illness, stage of respiratory insufficiency and status of blood exchange. Discrimination of different varieties of CDB has significant practical value in determining tactics for treating patients. Emphysematous CDB is treated by improvement of draining function of bronchi and elimination of respiratory insufficiency by prescribing respiratory gymnastics, broncholytic preparations and oxygen therapy. Treatment of asthmatic form of CDB is directed at restoring disturbances of bronchial passability by use of broncholytics and expectorants. In inflammatory form of CDB in addition to restoring the draining function of the lungs, active antibacterial therapy is introduced. 5 references.

Minor Forms in a Badlands Landscape Framework

International Nuclear Information System (INIS)

Diaz-Hernandez, J. L.; Yepes, J.; Romero-Diaz, A.

2009-01-01

We describe and classify some medium-scale erosional morphologies in badlands areas. They have been categorized in three different types: A) Surficial forms on horizontal surfaces (soil surface crusts, cracks, popcorn) and walls (slips, pseudo-stalactites). B) Punctual fingerprints: rain impact and micro-collapses (dimples). C) Ruiniform morphologies (caves, shelters, residual pinnacles). The A type shapes are caused by damping-desiccation phenomena on clayey soils; morphologies on walls are due to laminar runoff on weak lithologies (clay, loam), also dubbed pseudo-spleleothemes. Their scale is centimetric-decimetric. B-Type forms may be an external passive process (impact) or an internal dynamic process (dimples) occurring in granular sediments inside shelters, in conditions of apparent calm, measuring up to a few centimetres. The caves and shelters of type C generally involve an excavation following stratification or jointing planes, while the residual pinnacles are vertical forms linked to advanced piping and fluting. Both forms are decametric in scale. (Author) 7 refs.

Prevalence of Mantoux test positivity among apparently healthy ...

African Journals Online (AJOL)

Prevalence of Mantoux test positivity among apparently healthy children in Maiduguri, Nigeria. MG Mustapha, AM Garba, AI Rabasa, MS Gimba. Abstract. Background. The impact of tuberculosis (TB) is highest in the developing countries of Asia and Africa, especially among children, in whom the diagnosis is challenging.

Discovery of an Apparent Nova in M81

Science.gov (United States)

Hornoch, K.; Alfaro, M. Diaz; Ordonez-Etxeberria, I.; Vaduvescu, O.

2015-01-01

We report the discovery of an apparent nova in M81 on a co-added 1600-s narrow-band H-alpha CCD image taken with the 2.5-m Isaac Newton Telescope (INT) + WFC at La Palma under ~2.4" seeing on 2015 Jan. 15.126 UT.

Effective Treatment of an Apparent Meniscal Injury Using the Mulligan Concept

Directory of Open Access Journals (Sweden)

Alex J. Rhinehart

2015-05-01

Full Text Available Objective: Present a clinic case demonstrating the effectiveness of the Mulligan Concept (MC in treating an apparent meniscal injury. The utilization of the MC in the evaluation and treatment of a 20-year-old soccer player with an apparent acute meniscal injury is presented. Background: Meniscal injuries are common knee injuries. The MC is a therapeutic intervention strategy applied as both a treatment-based evaluation and therapeutic intervention. Treatment: The patient was successfully treated in four treatment sessions using the MC. The patient experienced minimal clinically-important differences on a variety of global and regional patient-rated outcomes. Uniqueness: To the author’s knowledge, there are currently no published case reports of using the MC in clinical practice to treat an apparent meniscal pathology. Conclusion: The MC can be utilized as an evaluation and treatment technique in patients suspected of having meniscal pathology in the knee.

Spatio-temporal evolution of apparent resistivity during coal-seam hydraulic flushing

Science.gov (United States)

Li, Dexing; Wang, Enyuan; Song, Dazhao; Qiu, Liming; Kong, Xiangguo

2018-06-01

Hydraulic flushing in gas predrainage is widely used, but the hydraulic-flushing effect is evaluated in a traditional way, by determining the desorption volume, moisture content, gas drainage rate and other conventional indices. To verify the rationality and feasibility of the multielectrode resistivity method in the evaluation of coal-seam hydraulic flushing and to research the spatio-temporal evolution of apparent resistivity during hydraulic flushing, a field test was conducted in 17# coal seam at Nuodong Mine, Guizhou. During hydraulic flushing, four stages were defined according to the variation in coal rock resistivity with time, namely, the preparation stage, the sharply decreasing stage, the rapidly increasing stage and the steady stage. The apparent resistivity of the coal rock mass is affected mainly by its own degree of fragmentation and flushing volume. A more serious rupture and a greater flushing volume yield a smaller apparent resistivity during the sharply decreasing stage and a higher resistivity during the stable stage. After three months of gas predrainage, the residual gas content and the gas pressure at different points in the expected affected area decrease below the critical value. Changes in the residual gas content and gas pressure at these points are consistent with the apparent resistivity, which validates the rationality and feasibility of the multielectrode resistivity method in evaluating coal-seam hydraulic flushing.

Spatial Attention and Audiovisual Interactions in Apparent Motion

Science.gov (United States)

Sanabria, Daniel; Soto-Faraco, Salvador; Spence, Charles

2007-01-01

In this study, the authors combined the cross-modal dynamic capture task (involving the horizontal apparent movement of visual and auditory stimuli) with spatial cuing in the vertical dimension to investigate the role of spatial attention in cross-modal interactions during motion perception. Spatial attention was manipulated endogenously, either…

45 CFR 73.735-904 - Resolution of apparent or actual conflicts of interest.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Resolution of apparent or actual conflicts of... ADMINISTRATION STANDARDS OF CONDUCT Reporting Financial Interests § 73.735-904 Resolution of apparent or actual conflicts of interest. (a) Disqualification from participating in a particular matter or category of matters...

INTAKE AND APPARENT DIGESTIBILITY OF Andropogon gayanus HAY AT THREE DIFFERENT AGES

Directory of Open Access Journals (Sweden)

André Cayô Cavalcanti

2016-10-01

Full Text Available The aim of this study was to evaluate the voluntary intake and apparent digestibility of dry matter, crude protein, fiber fractions, energy, and the nitrogen balance of Andropogon gayanus hay at three different stages (56, 84 and 112 days. The statistical design was completely randomized, with three treatments and six replicates. Dry matter, fiber fractions, and energy apparent digestibility were higher (P<0.05 for hay harvested at 56 and 84 days. Crude protein intake and apparent digestibility of A. gayanus hay harvested at 56 days of growth were greater (P<0.05 than the hay harvested at 84 and 112 days. The A. gayanus hay showed the best voluntary intake and digestibility at 56 and 84 days of age. Keywords: forage; nutritive value; sheep.

True versus apparent shapes of bow shocks

Science.gov (United States)

Tarango-Yong, Jorge A.; Henney, William J.

2018-06-01

Astrophysical bow shocks are a common result of the interaction between two supersonic plasma flows, such as winds or jets from stars or active galaxies, or streams due to the relative motion between a star and the interstellar medium. For cylindrically symmetric bow shocks, we develop a general theory for the effects of inclination angle on the apparent shape. We propose a new two-dimensional classification scheme for bow shapes, which is based on dimensionless geometric ratios that can be estimated from observational images. The two ratios are related to the flatness of the bow's apex, which we term planitude, and the openness of its wings, which we term alatude. We calculate the expected distribution in the planitude-alatude plane for a variety of simple geometrical and physical models: quadrics of revolution, wilkinoids, cantoids, and ancantoids. We further test our methods against numerical magnetohydrodynamical simulations of stellar bow shocks and find that the apparent planitude and alatude measured from infrared dust continuum maps serve as accurate diagnostics of the shape of the contact discontinuity, which can be used to discriminate between different physical models. We present an algorithm that can determine the planitude and alatude from observed bow shock emission maps with a precision of 10 to 20 per cent.

Combined Diffusion Tensor Imaging and Apparent Transverse Relaxation Rate Differentiate Parkinson Disease and Atypical Parkinsonism.

Science.gov (United States)

Du, G; Lewis, M M; Kanekar, S; Sterling, N W; He, L; Kong, L; Li, R; Huang, X

2017-05-01

Both diffusion tensor imaging and the apparent transverse relaxation rate have shown promise in differentiating Parkinson disease from atypical parkinsonism (particularly multiple system atrophy and progressive supranuclear palsy). The objective of the study was to assess the ability of DTI, the apparent transverse relaxation rate, and their combination for differentiating Parkinson disease, multiple system atrophy, progressive supranuclear palsy, and controls. A total of 106 subjects (36 controls, 35 patients with Parkinson disease, 16 with multiple system atrophy, and 19 with progressive supranuclear palsy) were included. DTI and the apparent transverse relaxation rate measures from the striatal, midbrain, limbic, and cerebellar regions were obtained and compared among groups. The discrimination performance of DTI and the apparent transverse relaxation rate among groups was assessed by using Elastic-Net machine learning and receiver operating characteristic curve analysis. Compared with controls, patients with Parkinson disease showed significant apparent transverse relaxation rate differences in the red nucleus. Compared to those with Parkinson disease, patients with both multiple system atrophy and progressive supranuclear palsy showed more widespread changes, extending from the midbrain to striatal and cerebellar structures. The pattern of changes, however, was different between the 2 groups. For instance, patients with multiple system atrophy showed decreased fractional anisotropy and an increased apparent transverse relaxation rate in the subthalamic nucleus, whereas patients with progressive supranuclear palsy showed an increased mean diffusivity in the hippocampus. Combined, DTI and the apparent transverse relaxation rate were significantly better than DTI or the apparent transverse relaxation rate alone in separating controls from those with Parkinson disease/multiple system atrophy/progressive supranuclear palsy; controls from those with Parkinson

Two forms of acid alpha-D-mannosidase in monkey brain: evidence for the co-existence of high mannose and complex oligosaccharides in one form.

Science.gov (United States)

Mathur, R; Alvares, K; Balasubramanian, A S

1984-09-28

Lysosomal alpha-D-mannosidase of monkey brain existed in two forms. One form of mannosidase was bound to the Ricinus communis agglutinin120 (RCA1)-Sepharose and could be specifically eluted with lactose. The other form did not bind to the RCA1-Sepharose. Both forms of mannosidase could bind to a similar extent to the immobilized brain lysosomal receptor protein. Both the forms were purified to apparent homogeneity. Neutral sugar analysis by GLC showed the presence of glucose, mannose and galactose in the RCA1-Sepharose bindable mannosidase and glucose and mannose in the non-bindable mannosidase. Several other brain lysosomal hydrolases did not bind to the RCA1-Sepharose. The results suggested the existence of only high mannose oligosaccharides in the RCA1 non-bindable mannosidase and both high mannose and complex oligosaccharides in the bindable mannosidase.

Estimating true instead of apparent survival using spatial Cormack-Jolly-Seber models

Science.gov (United States)

Schaub, Michael; Royle, J. Andrew

2014-01-01

Survival is often estimated from capture–recapture data using Cormack–Jolly–Seber (CJS) models, where mortality and emigration cannot be distinguished, and the estimated apparent survival probability is the product of the probabilities of true survival and of study area fidelity. Consequently, apparent survival is lower than true survival unless study area fidelity equals one. Underestimation of true survival from capture–recapture data is a main limitation of the method.

The frequency-domain approach for apparent density mapping

Science.gov (United States)

Tong, T.; Guo, L.

2017-12-01

Apparent density mapping is a technique to estimate density distribution in the subsurface layer from the observed gravity data. It has been widely applied for geologic mapping, tectonic study and mineral exploration for decades. Apparent density mapping usually models the density layer as a collection of vertical, juxtaposed prisms in both horizontal directions, whose top and bottom surfaces are assumed to be horizontal or variable-depth, and then inverts or deconvolves the gravity anomalies to determine the density of each prism. Conventionally, the frequency-domain approach, which assumes that both top and bottom surfaces of the layer are horizontal, is usually utilized for fast density mapping. However, such assumption is not always valid in the real world, since either the top surface or the bottom surface may be variable-depth. Here, we presented a frequency-domain approach for apparent density mapping, which permits both the top and bottom surfaces of the layer to be variable-depth. We first derived the formula for forward calculation of gravity anomalies caused by the density layer, whose top and bottom surfaces are variable-depth, and the formula for inversion of gravity anomalies for the density distribution. Then we proposed the procedure for density mapping based on both the formulas of inversion and forward calculation. We tested the approach on the synthetic data, which verified its effectiveness. We also tested the approach on the real Bouguer gravity anomalies data from the central South China. The top surface was assumed to be flat and was on the sea level, and the bottom surface was considered as the Moho surface. The result presented the crustal density distribution, which was coinciding well with the basic tectonic features in the study area.

Iron deficiency anaemia among apparently healthy pre-school ...

African Journals Online (AJOL)

ing working hours of 8:00 am till 4:00 pm and caters ... Consecutive apparently healthy children whose parents ... Children on long-term transfusion therapy b. ... Social class was determined from occupation and ed- .... gression model was used to assess the effects of the .... iron stores in 6–24-month-old New Zealanders.

Apparent Consumption vs. Total Consumption--A Lead-Acid Battery Case Study

Science.gov (United States)

Wilburn, David R.; Buckingham, David A.

2006-01-01

Introduction: This report compares estimates of U.S. apparent consumption of lead with estimates of total U.S. consumption of this mineral commodity from a materials flow perspective. The difference, attributed to the amount of lead contained in imported and exported products, was found to be significant for this sector. The study also assesses the effects of including mineral commodities incorporated in manufactured products on the interpretation of observed trends in minerals consumption and trade. Materials flow is a systems approach to understanding what happens to the materials we use from the time a material is extracted, through its processing and manufacturing, to its ultimate disposition. The U.S. Geological Survey (USGS) provides accurate and detailed mineral production and mineral commodity consumption statistics that are essential for government, nongovernment organizations, and the public to gain a better understanding of how and where materials are used and their effect on the environment and society. Published statistics on mineral apparent consumption are limited to estimates of consumption of raw material forms (ore, concentrate, and [or] refined metal). For this study, apparent consumption is defined as mine production + secondary refined production + imports (concentrates and refined metal) ? exports (concentrates and refined metal) + adjustments for government and industry stock changes. These estimates do not account for the amount of mineral commodities contained in manufactured products that are imported to the United States, nor do they deduct the amount of these mineral commodities contained in manufactured products that are exported from the United States. When imports or exports of manufactured products contribute significantly to the total use of a particular raw material, an estimate of consumption that does not consider the incorporated forms of these mineral commodities within imported or exported manufactured products can be either

Conformational alteration in alpha-toxin from Staphylococcus aureus concomitant with the transformation of the water-soluble monomer to the membrane oligomer.

Science.gov (United States)

Ikigai, H; Nakae, T

1985-07-16

The membrane-damaging alpha-toxin aggregate of Staphylococcus aureus was characterized physicochemically. The aggregate weight of the toxin formed by various methods appeared to be 6 times higher than the molecular weight of the monomer as determined by the laser light scattering technique, suggesting the presence of a hexamer in the membrane. The aggregates fluoresced 20 to 50% more than the monomer at 336 nm. Circular dichroism measurements revealed that both the monomer and the oligomer showed essentially beta-sheet structure with the maximum ellipticity about -8,400 deg.cm2.dmol-1 at 215 nm. Circular dichroism spectrum of the oligomers showed ellipticity difference of -6,600, -44 and +84 deg.cm2.dmol-1, at 200, 250 and 280 nm, respectively, compared with the monomer. All these results suggest that the conformational change in the toxin molecule occurs concomitant with the transformation of the water-soluble monomer to the membrane-embedded hexamer.

Apparent-contact-angle model at partial wetting and evaporation: impact of surface forces.

Science.gov (United States)

Janeček, V; Nikolayev, V S

2013-01-01

This theoretical and numerical study deals with evaporation of a fluid wedge in contact with its pure vapor. The model describes a regime where the continuous wetting film is absent and the actual line of the triple gas-liquid-solid contact appears. A constant temperature higher than the saturation temperature is imposed at the solid substrate. The fluid flow is solved in the lubrication approximation. The introduction of the surface forces in the case of the partial wetting is discussed. The apparent contact angle (the gas-liquid interface slope far from the contact line) is studied numerically as a function of the substrate superheating, contact line velocity, and parameters related to the solid-fluid interaction (Young and microscopic contact angles, Hamaker constant, etc.). The dependence of the apparent contact angle on the substrate temperature is in agreement with existing approaches. For water, the apparent contact angle may be 20° larger than the Young contact angle for 1 K superheating. The effect of the surface forces on the apparent contact angle is found to be weak.

Apparent splitting of S waves propagating through an isotropic lowermost mantle

KAUST Repository

Parisi, Laura

2018-03-24

Observations of shear‐wave anisotropy are key for understanding the mineralogical structure and flow in the mantle. Several researchers have reported the presence of seismic anisotropy in the lowermost 150–250 km of the mantle (i.e., D” layer), based on differences in the arrival times of vertically (SV) and horizontally (SH) polarized shear waves. By computing waveforms at period > 6 s for a wide range of 1‐D and 3‐D Earth structures we illustrate that a time shift (i.e., apparent splitting) between SV and SH may appear in purely isotropic simulations. This may be misinterpreted as shear wave anisotropy. For near‐surface earthquakes, apparent shear wave splitting can result from the interference of S with the surface reflection sS. For deep earthquakes, apparent splitting can be due to the S‐wave triplication in D”, reflections off discontinuities in the upper mantle and 3‐D heterogeneity. The wave effects due to anomalous isotropic structure may not be easily distinguished from purely anisotropic effects if the analysis does not involve full waveform simulations.

Apparent splitting of S waves propagating through an isotropic lowermost mantle

KAUST Repository

Parisi, Laura; Ferreira, Ana M. G.; Ritsema, Jeroen

2018-01-01

Observations of shear‐wave anisotropy are key for understanding the mineralogical structure and flow in the mantle. Several researchers have reported the presence of seismic anisotropy in the lowermost 150–250 km of the mantle (i.e., D” layer), based on differences in the arrival times of vertically (SV) and horizontally (SH) polarized shear waves. By computing waveforms at period > 6 s for a wide range of 1‐D and 3‐D Earth structures we illustrate that a time shift (i.e., apparent splitting) between SV and SH may appear in purely isotropic simulations. This may be misinterpreted as shear wave anisotropy. For near‐surface earthquakes, apparent shear wave splitting can result from the interference of S with the surface reflection sS. For deep earthquakes, apparent splitting can be due to the S‐wave triplication in D”, reflections off discontinuities in the upper mantle and 3‐D heterogeneity. The wave effects due to anomalous isotropic structure may not be easily distinguished from purely anisotropic effects if the analysis does not involve full waveform simulations.

Effectively semi-relativistic Hamiltonians of nonrelativistic form

International Nuclear Information System (INIS)

Lucha, W.; Schoeberl, F.F.; Moser, M.

1993-12-01

We construct effective Hamiltonians which despite their apparently nonrelativistic form incorporate relativistic effects by involving parameters which depend on the relevant momentum. For some potentials the corresponding energy eigenvalues may be determined analytically. Applied to two-particle bound states, it turns out that in this way a nonrelativistic treatment may indeed be able to simulate relativistic effects. Within the framework of hadron spectroscopy, this lucky circumstance may be an explanation for the sometimes extremely good predictions of nonrelativistic potential models even in relativistic regions. (authors)

Pressurization effects on the polymorphic forms of famotidine

International Nuclear Information System (INIS)

Nemet, Zoltan; Hegedues, Bela; Szantay, Csaba; Sztatisz, Janisz; Pokol, Gyoergy

2005-01-01

The effects of high static pressure on the polymorphic modifications A and B of famotidine were examined by differential scanning calorimetry, infrared and Raman spectroscopy, and X-ray powder diffractometry. The obtained effects appeared to differ significantly depending on whether they were monitored by DSC or any of the other above techniques. In particular, DSC measurements tend to deceptively amplify a tendency of the pure modification B to turn into the more stable form A under pressurization, while the spectroscopic methods and XRPD exhibit no essential change in the crystal structure of the metastable form B. The apparent morphological transformation in the pressed samples stems from the nature of the DSC method itself

Infective endocarditis involving an apparently structurally normal valve: new epidemiological trend?

Science.gov (United States)

Song, Jae-Kwan

2015-07-01

Infective endocarditis (IE) has been increasingly diagnosed in patients without previously detected predisposing heart disease, but its clinical features have yet to be fully determined. A recent single-center study including echocardiographic images and surgical findings investigated the incidence of undiagnosed, clinically silent valvular or congenital heart diseases and healthcare-associated infective endocarditis (HAIE). The study confirmed that a large proportion of patients with IE have no previous history of heart disease. Analysis of underlying disease in these patients showed that undetected mitral valve prolapse was the most common disease, followed by an apparently structurally normal valve. The patients who developed IE of apparently structurally normal valves had different clinical characteristics and worse outcomes. IE involving a structurally normal valve was associated with both nosocomial and non-nosocomial HAIE, whereas community-acquired IE was more frequent than HAIE. The pathophysiologic mechanism involving the development of non-HAIE or community-acquired IE due to predominantly staphylococcal infection in an apparently structurally normal valve is not yet clearly understood. Structurally normal valves are not necessarily free of regurgitation or abnormal turbulence and, given the dynamic nature and fluctuating hemodynamic effects of conditions such as poorly controlled hypertension, end-stage renal disease, and sleep apnea, further investigation is necessary to evaluate the potential role of these diseases in the development of IE. An apparently normal-looking valve is associated with IE development in patients without previously recognized predisposing heart disease, warranting repartition of at-risk groups to achieve better clinical outcomes.

The Apparent Solubility Of Aluminum(III) In Hanford High-Level Waste Tanks

International Nuclear Information System (INIS)

Reynolds, J.G.

2012-01-01

The solubility of aluminum in Hanford nuclear waste impacts on the process ability of the waste by a number of proposed treatment options. For many years, Hanford staff has anecdotally noted that aluminum appears to be considerably more soluble in Hanford waste than the simpler electrolyte solutions used as analogues. There has been minimal scientific study to confirm these anecdotal observations, however. The present study determines the apparent solubility product for gibbsite in 50 tank samples. The ratio of hydroxide to aluminum in the liquid phase for the samples is calculated and plotted as a function of total sodium molarity. Total sodium molarity is used as a surrogate for ionic strength, because the relative ratios of mono, di and trivalent anions are not available for all of the samples. These results were compared to the simple NaOH-NaAl(OH 4 )H 2 O system, and the NaOH-NaAl(OH 4 )NaCl-H 2 O system data retrieved from the literature. The results show that gibbsite is apparently more soluble in the samples than in the simple systems whenever the sodium molarity is greater than two. This apparent enhanced solubility cannot be explained solely by differences in ionic strength. The change in solubility with ionic strength in simple systems is small compared to the difference between aluminum solubility in Hanford waste and the simple systems. The reason for the apparent enhanced solubility is unknown, but could include. kinetic or thermodynamic factors that are not present in the simple electrolyte systems. Any kinetic explanation would have to explain why the samples are always supersaturated whenever the sodium molarity is above two. Real waste characterization data should not be used to validate thermodynamic solubility models until it can be confirmed that the apparent enhanced gibbsite solubility is a thermodynamic effect and not a kinetic effect.

Value of apparent diffusion coefficient (ADC) in evaluating response ...

African Journals Online (AJOL)

Objective. To determine whether the apparent diffusion coefficient (ADC) value obtained by diffusion-weighted magnetic resonance imaging (DW-MRI) can be used as a reliable detector of response of carcinoma of the cervix treated with chemoradiotherapy, compared with conventional. T2-weighted MRI. Design.

Can oscillating physics explain an apparently periodic universe?

International Nuclear Information System (INIS)

Hill, C.T.; Steinhardt, P.J.; Turner, M.S.; Chicago Univ., IL; Fermi National Accelerator Lab., Batavia, IL

1990-01-01

Recently, Broadhurst et al. have reported an apparent periodicity in a north-south pencil-beam red-shift survey of galaxies. We consider whether the periodicity may be an illusion caused by the oscillations of physical constants. Should the periodicity be disproven by subsequent observations, the same analysis can be used to derive new, stringent limits on the variations of physical constants. (orig.)

Electrochemistry of end-capped oligothienyls. New insights into the polymerization mechanism and the charge storage, conduction and capacitive properties of polythiophene

Energy Technology Data Exchange (ETDEWEB)

Zotti, G. (Ist. di Polarografia ed Elettrochimica Preparativa, Consiglio Nazionale delle Ricerche, Padua (Italy)); Schiavon, G. (Ist. di Polarografia ed Elettrochimica Preparativa, Consiglio Nazionale delle Ricerche, Padua (Italy)); Berlin, A. (Dipt. di Chimica Organica e Industriale dell' Univ. e Centro CNR, Speciali Sistemi Organici, Milan (Italy)); Pagani, G. (Dipt. di Chimica Organica e Industriale dell' Univ. e Centro CNR, Speciali Sistemi Organici, Milan (Italy))

1993-11-23

The kinetics of anodic coupling to dimers of thiophene oligomers (n=3-5), methyl protected at one [alpha]-terminal position, is second order in oligomer concentration and evidences high activation enthalpies and negative activation entropies. Activation free energies are linearly related to the inverse of the oligomer length n (the dimerization rate decreases as n is increased). Thin films of methyl end-capped thiophene oligomers (n=4, 6, 8 and 10) display reversible oxidations from a single one-electron step (tetramer) to a single two-electron step (octamer and decamer) through two separate one-electron steps (hexamer). ESR indicates strong magnetic dimerization for the one-electron-oxidized hexamer. The close resemblance of the electrochemical and ESR behaviour of the hexamer with that of polythiophene suggests that oxidation of the latter occurs via hexameric spin-dimerized polarons. The conductive and capacitive properties of the end-capped oligomers (n=6, 8 and 10) were investigated by in situ conductivity and chronopotentiometry. While conductivity of octamer and decamer is displayed at the two-electron (bipolaron) state, the hexamer, insulating at this state, is conducting at the mixed-valence polaron-bipolaron state; capacitive responses are evidenced at the bipolaron state for the octamer and decamer only. The difference of conductive and capacitive behaviour between the hexamer and the higher oligomers is explained by charge localization in hexameric segments. (orig.)

Monitoring of multiple solvent induced form changes during high shear wet granulation and drying processes using online Raman spectroscopy.

Science.gov (United States)

Reddy, Jay Poorna; Jones, John W; Wray, Patrick S; Dennis, Andrew B; Brown, Jonathan; Timmins, Peter

2018-04-25

Form changes during drug product processing can be a risk to the final product quality in terms of chemical stability and bioavailability. In this study, online Raman spectroscopy was used to monitor the form changes in real time during high shear wet granulation of Compound A, a highly soluble drug present at a high drug load in an extended release formulation. The effect of water content, temperature, wet massing time and drying technique on the degree of drug transformation were examined. A designed set of calibration standards were employed to develop quantitative partial least square regression models to predict the concentration of each drug form during both wet granulation and the drying process. Throughout all our experiments we observed complex changes of the drug form during granulation, manifest as conversions between the initial non-solvated form of Compound A, the hemi-hydrate form and the "apparent" amorphous form (dissolved drug). The online Raman data demonstrate that the non-solvated form converts to an "apparent" amorphous form (dissolved drug) due to drug dissolution with no appearance of the hemi-hydrate form during water addition stage. The extent of conversion of the non-solvated form was governed by the amount of water added and the rate of conversion was accelerated at higher temperatures. Interestingly, in the wet massing zone, the formation of the hemi-hydrate form was observed at a rate equivalent to the rate of depletion of the non-solvated form with no change in the level of the "apparent amorphous" form generated. The level of hemi-hydrate increased with an increase in wet massing time. The drying process had a significant effect on the proportion of each form. During tray drying, changes in drug form continued for hours. In contrast fluid bed drying appeared to lock the final proportions of drug form product attained during granulation, with comparatively small changes observed during drying. In conclusion, it was possible to

Adaptations in the glucose metabolism of procyclic Trypanosoma brucei isolates from Tsetse flies and during differentiation of bloodstream forms.

NARCIS (Netherlands)

van Grinsven, K.W.A.; van den Abbeele, J.; van den Bossche, P.; van Hellemond, J.J.; Tielens, A.G.M.

2009-01-01

Procyclic forms of Trypanosoma brucei isolated from the midguts of infected tsetse flies, or freshly transformed from a strain that is close to field isolates, do not use a complete Krebs cycle. Furthermore, short stumpy bloodstream forms produce acetate and are apparently metabolically preadapted

Radioimmunological determination of apparent free cortisol concentration: Some physiological and clinical applications

International Nuclear Information System (INIS)

Clerico, A.; Del Chicca, M.G.; Ghione, S.; Zucchelli, G.C.

1979-01-01

A new method has been developed for the determination of the apparent free plasma cortisol concentration by means of direct radioimmunological measurement of dialyzed cortisol. This method is characterized by a sufficient degree of reproducibility and high sensitivity. Apparent free cortisol concentration in 40 control subjects of both sexes (blood drawn at 8 a.m.) was 9.00 +- 4.6 ng/ml. The mean value of free cortisol concentration in blood samples drawn at 11-12 p.m. from 21 of these subjects was highly significantly different (2.3 +- 1.6 ng/ml, p < 0.001). In addition, in 13 of these subjects circadian variation of the apparent free cortisol concentration showed a pattern similar to that of total cortisol concentration. The mean free cortisol concentration found in a group of women during normal pregnancy was significant higher than in non-pregnant women. Patients with renal insufficiency do not show a significant difference in free cortisol plasma levels, whereas higher values were found in hepatic cyrrhosis. (Auth.)

Corrections to the apparent value of the cosmological constant due to local inhomogeneities

International Nuclear Information System (INIS)

Romano, Antonio Enea; Chen, Pisin

2011-01-01

Supernovae observations strongly support the presence of a cosmological constant, but its value, which we will call apparent, is normally determined assuming that the Universe can be accurately described by a homogeneous model. Even in the presence of a cosmological constant we cannot exclude nevertheless the presence of a small local inhomogeneity which could affect the apparent value of the cosmological constant. Neglecting the presence of the inhomogeneity can in fact introduce a systematic misinterpretation of cosmological data, leading to the distinction between an apparent and true value of the cosmological constant. We establish the theoretical framework to calculate the corrections to the apparent value of the cosmological constant by modeling the local inhomogeneity with a ΛLTB solution. Our assumption to be at the center of a spherically symmetric inhomogeneous matter distribution correspond to effectively calculate the monopole contribution of the large scale inhomogeneities surrounding us, which we expect to be the dominant one, because of other observations supporting a high level of isotropy of the Universe around us. By performing a local Taylor expansion we analyze the number of independent degrees of freedom which determine the local shape of the inhomogeneity, and consider the issue of central smoothness, showing how the same correction can correspond to different inhomogeneity profiles. Contrary to previous attempts to fit data using large void models our approach is quite general. The correction to the apparent value of the cosmological constant is in fact present for local inhomogeneities of any size, and should always be taken appropriately into account both theoretically and observationally

Apparent diffusive motion of centrin foci in living cells: implications for diffusion-based motion in centriole duplication

Science.gov (United States)

Rafelski, Susanne M.; Keller, Lani C.; Alberts, Jonathan B.; Marshall, Wallace F.

2011-04-01

The degree to which diffusion contributes to positioning cellular structures is an open question. Here we investigate the question of whether diffusive motion of centrin granules would allow them to interact with the mother centriole. The role of centrin granules in centriole duplication remains unclear, but some proposed functions of these granules, for example, in providing pre-assembled centriole subunits, or by acting as unstable 'pre-centrioles' that need to be captured by the mother centriole (La Terra et al 2005 J. Cell Biol. 168 713-22), require the centrin foci to reach the mother. To test whether diffusive motion could permit such interactions in the necessary time scale, we measured the motion of centrin-containing foci in living human U2OS cells. We found that these centrin foci display apparently diffusive undirected motion. Using the apparent diffusion constant obtained from these measurements, we calculated the time scale required for diffusion to capture by the mother centrioles and found that it would greatly exceed the time available in the cell cycle. We conclude that mechanisms invoking centrin foci capture by the mother, whether as a pre-centriole or as a source of components to support later assembly, would require a form of directed motility of centrin foci that has not yet been observed.

'Thermal ghosts': apparent decay of fixed surfaces caused by heat diffusion

International Nuclear Information System (INIS)

Livadiotis, George

2007-01-01

The behaviour concerning classical heat diffusion on fixed thermal surfaces, studied by observations, still holds surprises. As soon as convective and radiative processes are negligible within the medium, this is considered to be free from energy sources and sinks. Then, the heat diffusion equation is conveniently solved using standard Fourier methods. Some considerations about the contrast effect suggest that the surface boundary would rather be observed to follow specific area decay dynamics than remaining fixed and static. Here it is shown that the apparent boundary lies on a specific isothermal spatiotemporal curve, which depends on the observing device. This is characterized by a slight, though determinative, difference between its radiance and that of the ambient background. Thereafter, the heat diffusion yields apparent boundary shrinkage with the passing of time. This phenomenon is particularly notable for two reasons: its lifetime and final decay rate depend only on the medium thermal properties, while being independent of the apparent boundary spatiotemporal curve. Thus, the former provides a suitable method for measuring the medium thermal properties via the observational data. The latter strongly reveal a kind of universality of some characteristic properties of the phenomenon, common to all observers

Erratum An Apparent Phenomenal Descriptive Method for Judging ...

Indian Academy of Sciences (India)

Li Lin-sen. (J. Astrophys. Astr., (2004) Vol. 25, Nos. 3 & 4, pp. 203–211). Table 1. The calculated results for synchronous parameters of twenty components in ten eclipsing binary systems by using the apparent descriptive method of formula (4). Sp. (V1,2 sin i)M. Name type. P(d) i(deg) R1,2(R⊙). (km/s). Qe,e. PR ≷ P Synch.

Particle reacceleration and apparent radio source structure

International Nuclear Information System (INIS)

Eilek, J.A.

1982-01-01

The radio galaxy model which uses magnetohydrodynamic turbulence generated by surface instabilities to reaccelerate the radiating electrons has striking consequences for apparent source structure. Strong wave damping in the plasma results in a narrow turbulent edge. Particles accelerated in this edge must diffuse across field lines into the radio source; this predicts strong limb brightening in some cases. The structure of this edge and diffusion into the source are described. The relevance of this model to jets, radio tails, and standard double sources is discussed

Effects of Coated Compound Proteases on Apparent Total Tract Digestibility of Nutrients and Apparent Ileal Digestibility of Amino Acids for Pigs.

Science.gov (United States)

Pan, L; Zhao, P F; Yang, Z Y; Long, S F; Wang, H L; Tian, Q Y; Xu, Y T; Xu, X; Zhang, Z H; Piao, X S

2016-12-01

Two experiments were conducted to evaluate effects of coated compound proteases (CC protease) on apparent total tract digestibility (ATTD) of nitrogen (N) and energy, and apparent ileal digestibility (AID) of amino acids (AA) and nutrients in diets for pigs. In Exp. 1, 12 crossbred barrows (initial body weight: 20.14±1.71 kg) were housed in individual metabolism crates and allotted into 2 treatments with 6 piglets per treatment according to weight in a randomized complete block design. The 2 diets were corn-soybean meal basal diets with (0.2 g/kg) or without CC protease supplementation. The CC protease supplementation increased (pdigestible and metabolizable N and energy values and the digestibility and retention rate of N in the diet. The ATTD of energy and nutrients had been improved (pdigestibility of nutrients was unaffected. Overall, the CC protease improved the ATTD of N and energy and AID of some indispensible AA and nutrients in the corn-soybean meal diet for pigs. Therefore, the CC protease supplement could improve the utilization of protein in the corn-soybean meal diet and thus contribute to lower N excretion to the environment.

Construction of Insulin 18-mer Nanoassemblies Driven by Coordination to Iron(II) and Zinc(II) Ions at Distinct Sites

DEFF Research Database (Denmark)

Munch, Henrik K.; Nygaard, Jesper; Christensen, Niels Johan

2016-01-01

coordination with two different metal ions. Selective attachment of an abiotic 2,2′-bipyridine (bipy) ligand to HI, yielding HI–bipy, enabled ZnII-binding hexamers to SA into trimers of hexamers, [[HI–bipy]6]3, driven by octahedral coordination to a FeII ion. The structures were studied in solution by small...

Ambiguity in Tactile Apparent Motion Perception.

Directory of Open Access Journals (Sweden)

Emanuela Liaci

Full Text Available In von Schiller's Stroboscopic Alternative Motion (SAM stimulus two visually presented diagonal dot pairs, located on the corners of an imaginary rectangle, alternate with each other and induce either horizontal, vertical or, rarely, rotational motion percepts. SAM motion perception can be described by a psychometric function of the dot aspect ratio ("AR", i.e. the relation between vertical and horizontal dot distances. Further, with equal horizontal and vertical dot distances (AR = 1 perception is biased towards vertical motion. In a series of five experiments, we presented tactile SAM versions and studied the role of AR and of different reference frames for the perception of tactile apparent motion.We presented tactile SAM stimuli and varied the ARs, while participants reported the perceived motion directions. Pairs of vibration stimulators were attached to the participants' forearms and stimulator distances were varied within and between forearms. We compared straight and rotated forearm conditions with each other in order to disentangle the roles of exogenous and endogenous reference frames.Increasing the tactile SAM's AR biased perception towards vertical motion, but the effect was weak compared to the visual modality. We found no horizontal disambiguation, even for very small tactile ARs. A forearm rotation by 90° kept the vertical bias, even though it was now coupled with small ARs. A 45° rotation condition with crossed forearms, however, evoked a strong horizontal motion bias.Existing approaches to explain the visual SAM bias fail to explain the current tactile results. Particularly puzzling is the strong horizontal bias in the crossed-forearm conditions. In the case of tactile apparent motion, there seem to be no fixed priority rule for perceptual disambiguation. Rather the weighting of available evidence seems to depend on the degree of stimulus ambiguity, the current situation and on the perceptual strategy of the individual

Apparent Power, Expanded Definitions, Transient Operating Conditions, Network Reactions, Compensation, Papers Presented at ETG Conference (Energy Technology Society), 1979

Energy Technology Data Exchange (ETDEWEB)

1980-01-01

The Proceedings of the Conference comprises 12 papers dealing with the following themes: the history of apparent power; active and apparent power of periodical currents in single-phase and multiphase systems with periodical voltages of any shape of curve; power values in unsteady state processes; power and harmonic relations in mains-controlled direct frequency converters; power electronic devices for apparent power compensation; electric arc effects on power system: characteristics, measurement methods, compensation; harmonic compensation by means of impedance wave trap filters in rectifiers; compensation of apparent power by filter circuits; apparent power effects on ac railroad power systems; effects of apparent power in low-voltage networks of public power supply.

Understanding sexual violence as a form of caste violence

OpenAIRE

Prachi Patil

2016-01-01

The paper attempts to understand narratives of sexual violence anchored within the dynamics of social location of caste and gender. Apparent caste-patriarchy and gender hierarchies which are at play in cases of sexual violence against lower-caste and dalit women speak about differential experiences of rape and sexual abuse that women have in India. The paper endeavours to establish that sexual violence is also a form of caste violence by rereading the unfortunate cases of Bhanwari Devi, Khair...

Apparent thermal inertia and the surface heterogeneity of Mars

Science.gov (United States)

Putzig, Nathaniel E.; Mellon, Michael T.

2007-11-01

Thermal inertia derivation techniques generally assume that surface properties are uniform at horizontal scales below the footprint of the observing instrument and to depths of several decimeters. Consequently, surfaces with horizontal or vertical heterogeneity may yield apparent thermal inertia which varies with time of day and season. To investigate these temporal variations, we processed three Mars years of Mars Global Surveyor Thermal Emission Spectrometer observations and produced global nightside and dayside seasonal maps of apparent thermal inertia. These maps show broad regions with diurnal and seasonal differences up to 200 J m -2 K -1s -1/2 at mid-latitudes (60° S to 60° N) and 600 J m -2 K -1s -1/2 or greater in the polar regions. We compared the seasonal mapping results with modeled apparent thermal inertia and created new maps of surface heterogeneity at 5° resolution, delineating regions that have thermal characteristics consistent with horizontal mixtures or layers of two materials. The thermal behavior of most regions on Mars appears to be dominated by layering, with upper layers of higher thermal inertia (e.g., duricrusts or desert pavements over fines) prevailing in mid-latitudes and upper layers of lower thermal inertia (e.g., dust-covered rock, soils with an ice table at shallow depths) prevailing in polar regions. Less common are regions dominated by horizontal mixtures, such as those containing differing proportions of rocks, sand, dust, and duricrust or surfaces with divergent local slopes. Other regions show thermal behavior that is more complex and not well-represented by two-component surface models. These results have important implications for Mars surface geology, climate modeling, landing-site selection, and other endeavors that employ thermal inertia as a tool for characterizing surface properties.

Identifying apparent local stable isotope equilibrium in a complex non-equilibrium system.

Science.gov (United States)

He, Yuyang; Cao, Xiaobin; Wang, Jianwei; Bao, Huiming

2018-02-28

Although being out of equilibrium, biomolecules in organisms have the potential to approach isotope equilibrium locally because enzymatic reactions are intrinsically reversible. A rigorous approach that can describe isotope distribution among biomolecules and their apparent deviation from equilibrium state is lacking, however. Applying the concept of distance matrix in graph theory, we propose that apparent local isotope equilibrium among a subset of biomolecules can be assessed using an apparent fractionation difference (|Δα|) matrix, in which the differences between the observed isotope composition (δ') and the calculated equilibrium fractionation factor (1000lnβ) can be more rigorously evaluated than by using a previous approach for multiple biomolecules. We tested our |Δα| matrix approach by re-analyzing published data of different amino acids (AAs) in potato and in green alga. Our re-analysis shows that biosynthesis pathways could be the reason for an apparently close-to-equilibrium relationship inside AA families in potato leaves. Different biosynthesis/degradation pathways in tubers may have led to the observed isotope distribution difference between potato leaves and tubers. The analysis of data from green algae does not support the conclusion that AAs are further from equilibrium in glucose-cultured green algae than in the autotrophic ones. Application of the |Δα| matrix can help us to locate potential reversible reactions or reaction networks in a complex system such as a metabolic system. The same approach can be broadly applied to all complex systems that have multiple components, e.g. geochemical or atmospheric systems of early Earth or other planets. Copyright © 2017 John Wiley & Sons, Ltd.

Mathematical Models for the Apparent Mass of the Seated Human Body Exposed to Vertical Vibration

Science.gov (United States)

Wei, L.; Griffin, M. J.

1998-05-01

Alternative mathematical models of the vertical apparent mass of the seated human body are developed. The optimum parameters of four models (two single-degree-of-freedom models and two two-degree-of-freedom models) are derived from the mean measured apparent masses of 60 subjects (24 men, 24 women, 12 children) previously reported. The best fits were obtained by fitting the phase data with single-degree-of-freedom and two-degree-of-freedom models having rigid support structures. For these two models, curve fitting was performed on each of the 60 subjects (so as to obtain optimum model parameters for each subject), for the averages of each of the three groups of subjects, and for the entire group of subjects. The values obtained are tabulated. Use of a two-degree-of-freedom model provided a better fit to the phase of the apparent mass at frequencies greater than about 8 Hz and an improved fit to the modulus of the apparent mass at frequencies around 5 Hz. It is concluded that the two-degree-of-freedom model provides an apparent mass similar to that of the human body, but this does not imply that the body moves in the same manner as the masses in this optimized two-degree-of-freedom model.

Effect of autoclave processing and gamma irradiation on apparent ...

African Journals Online (AJOL)

The objective of this study was to investigate the effect of autoclaving and different doses of gamma irradiation on the apparent ileal digestibility of amino acids of cottonseed meal in male broiler breeders. Samples were irradiated in a gamma cell at total doses of 15, 30 and 45 kGy. One package (control) was left at room ...

Nitrogen mineralization from sheep faeces can be predicted from the apparent digestibility of the feed

DEFF Research Database (Denmark)

Kyvsgaard, P.; Sørensen, P.; Møller, E.

2000-01-01

It is difficult to predict plant availability of N in faeces because most faecal N is bound in organic form. In this study the influence of diet and faeces composition on mineralization of sheep faeces in soil were investigated. Net mineralization of C and N from 16 different samples of sheep...... faeces originating from sheep fed different known diets was studied after incubation in a sandy soil. After 4 weeks net mineralization of N ranged from -41 to 9% of faeces N and after 12 weeks -28 to 43% was net mineralized. Mineralization was related to different feed and faeces characteristics...... of the mineralization of sheep faeces N in soil based on chemical analyses of the feed. However, when using a biological measure of the feed quality (apparent digestibility) a robust prediction of faeces N mineralization was possible....

LONG-TERM STARVATION-INDUCED LOSS OF APPARENT ANTIBIOTIC RESISTANCE IN CELLS CONTAINING THE PLASMID PSA

Science.gov (United States)

Escherichia coli, Pseudomonas fluorescens, and a Pseudomonas sp. strain 133B containing the pSa plasmid were starved in well water for up to 523 days. There were two patterns of apparent antibiotic resistance loss observed. In Pseudomonas sp. strain 133B, there was no apparent lo...

75 FR 51869 - CAFTA-DR Consultation Request Regarding Guatemala's Apparent Failure to Effectively Enforce its...

Science.gov (United States)

2010-08-23

... Request Regarding Guatemala's Apparent Failure to Effectively Enforce its Labor Laws AGENCY: Office of the... (CAFTA-DR), the United States requested consultations with the Government of Guatemala to discuss Guatemala's apparent failure to meet its obligation under Article 16.2.1(a) to effectively enforce its labor...

Detection of visual events along the apparent motion trace in patients with paranoid schizophrenia.

Science.gov (United States)

Sanders, Lia Lira Olivier; Muckli, Lars; de Millas, Walter; Lautenschlager, Marion; Heinz, Andreas; Kathmann, Norbert; Sterzer, Philipp

2012-07-30

Dysfunctional prediction in sensory processing has been suggested as a possible causal mechanism in the development of delusions in patients with schizophrenia. Previous studies in healthy subjects have shown that while the perception of apparent motion can mask visual events along the illusory motion trace, such motion masking is reduced when events are spatio-temporally compatible with the illusion, and, therefore, predictable. Here we tested the hypothesis that this specific detection advantage for predictable target stimuli on the apparent motion trace is reduced in patients with paranoid schizophrenia. Our data show that, although target detection along the illusory motion trace is generally impaired, both patients and healthy control participants detect predictable targets more often than unpredictable targets. Patients had a stronger motion masking effect when compared to controls. However, patients showed the same advantage in the detection of predictable targets as healthy control subjects. Our findings reveal stronger motion masking but intact prediction of visual events along the apparent motion trace in patients with paranoid schizophrenia and suggest that the sensory prediction mechanism underlying apparent motion is not impaired in paranoid schizophrenia. Copyright © 2012. Published by Elsevier Ireland Ltd.

Unified first law and the thermodynamics of the apparent horizon in the FRW universe

International Nuclear Information System (INIS)

Cai Ronggen; Cao Liming

2007-01-01

In this paper we revisit the relation between the Friedmann equations and the first law of thermodynamics. We find that the unified first law first proposed by Hayward to treat the outertrapping horizon of a dynamical black hole can be used to the apparent horizon (a kind of inner trapping horizon in the context of the FRW cosmology) of the FRW universe. We discuss three kinds of gravity theorties: Einstein theory, Lovelock thoery, and scalar-tensor theory. In Einstein theory, the first law of thermodynamics is always satisfied on the apparent horizon. In Lovelock theory, treating the higher derivative terms as an effective energy-momentum tensor, we find that this method can give the same entropy formula for the apparent horizon as that of black hole horizon. This implies that the Clausius relation holds for the Lovelock theory. In scalar-tensor gravity, we find, by using the same procedure, the Clausius relation no longer holds. This indicates that the apparent horizon of the FRW universe in the scalar-tensor gravity corresponds to a system of nonequilibrium thermodynamics. We show this point by using the method developed recently by Eling et al. for dealing with the f(R) gravity

The Effect of the Operating Conditions on the Apparent Viscosity of Crude Palm Oil During Oil Clarification

Directory of Open Access Journals (Sweden)

Sulaiman Al-Zuhair, Mirghani I. Ahmed and Yousif A. Abakr

2012-10-01

Full Text Available This paper discusses the apparent viscosity of crude palm oil, using rotary viscometer, under different boundary conditions. It was experimentally shown that the apparent viscosity of palm oil drops with increasing of the shear rate and the temperature.  However, the effect of temperature on the viscosity tends to fade at temperatures beyond 80 oC.  A correlation between the apparent viscosity of crude palm oil and the operating conditions was developed. This correlation can be used in design of crude palm oil settlers and in determining the optimum operating conditions.Key Words:  Crude palm oil, apparent viscosity, shear rate, modelling, separation 

Apparent molar volumes and apparent molar heat capacities of aqueous lead nitrate at temperatures from 278.15 K to 393.15 K and at the pressure 0.35 MPa

International Nuclear Information System (INIS)

Brown, B.R.; Niederhauser, T.L.; Merkley, E.D.; Woolley, E.M.

2004-01-01

Apparent molar volumes V phi and apparent molar heat capacities C p,phi were determined for aqueous solutions of lead nitrate [Pb(NO 3 ) 2 ] at m=(0.02 to 0.5) mol · kg -1 , at T=(278.15 to 393.15) K, and at the pressure 0.35 MPa. Our V phi values were calculated from densities obtained using a vibrating-tube densimeter, and our C p,phi values were obtained using a twin fixed-cell, power-compensation, differential-output, temperature-scanning calorimeter. Our results were fitted to functions of m and T and compared with results from the literature

Apparent diffusive motion of centrin foci in living cells: implications for diffusion-based motion in centriole duplication

International Nuclear Information System (INIS)

Rafelski, Susanne M; Keller, Lani C; Marshall, Wallace F; Alberts, Jonathan B

2011-01-01

The degree to which diffusion contributes to positioning cellular structures is an open question. Here we investigate the question of whether diffusive motion of centrin granules would allow them to interact with the mother centriole. The role of centrin granules in centriole duplication remains unclear, but some proposed functions of these granules, for example, in providing pre-assembled centriole subunits, or by acting as unstable 'pre-centrioles' that need to be captured by the mother centriole (La Terra et al 2005 J. Cell Biol. 168 713–22), require the centrin foci to reach the mother. To test whether diffusive motion could permit such interactions in the necessary time scale, we measured the motion of centrin-containing foci in living human U2OS cells. We found that these centrin foci display apparently diffusive undirected motion. Using the apparent diffusion constant obtained from these measurements, we calculated the time scale required for diffusion to capture by the mother centrioles and found that it would greatly exceed the time available in the cell cycle. We conclude that mechanisms invoking centrin foci capture by the mother, whether as a pre-centriole or as a source of components to support later assembly, would require a form of directed motility of centrin foci that has not yet been observed

N114S mutation causes loss of ATP-induced aggregation of human phosphoribosylpyrophosphate synthetase 1

International Nuclear Information System (INIS)

Liu Honglin; Peng, Xiaohui; Zhao Fang; Zhang Guobin; Tao Ye; Luo Zhaofeng; Li Yang; Teng Maikun; Li Xu; Wei Shiqiang

2009-01-01

This study examined recombinant wild-type human phosphoribosylpyrophosphate synthetase 1 (wt-PRS1, EC 2.7.6.1) and the point mutant Asn114Ser PRS1 (N114S-Mutant) in cells of a patient with primary gout. Dynamic light-scattering and sedimentation velocity experiments indicated that the monomeric wt-PRS1 in solution was assembled into hexamers after adding the substrate ATP. However, this ATP-induced aggregation effect was not observed with N114S-Mutant, which has a 50% higher enzymatic activity than that of wt-PRS1. Synchrotron radiation circular dichroism spectroscopy revealed that the point mutation causes an increase of α-helix content and a decrease of turn content. Examination of the crystal structure of wt-PRS1 indicated that 12 hydrogen bonds formed by 6 pairs of N114 and D139 have an important role in stabilizing the hexamer. We suggest that the substitution of S114 for N114 in N114S-Mutant leads to the rupture of 12 hydrogen bonds and breakage of the PO 4 3- allosteric site where PO 4 3- functions as a fixer of the ATP-binding loop. Therefore, we consider that formation of the hexamer as the structural basis of the ADP allosteric inhibition is greatly weakened by the N114S mutation, and that alteration of the ATP-binding loop conformation is the key factor in the increased activity of N114S-Mutant. These two factors could be responsible for the high level of activity of N114S-Mutant in this patient.

Apparent dynamic contact angle of an advancing gas--liquid meniscus

International Nuclear Information System (INIS)

Kalliadasis, S.; Chang, H.

1994-01-01

The steady motion of an advancing meniscus in a gas-filled capillary tube involves a delicate balance of capillary, viscous, and intermolecular forces. The limit of small capillary numbers Ca (dimensionless speeds) is analyzed here with a matched asymptotic analysis that links the outer capillary region to the precursor film in front of the meniscus through a lubricating film. The meniscus shape in the outer region is constructed and the apparent dynamic contact angle Θ that the meniscus forms with the solid surface is derived as a function of the capillary number, the capillary radius, and the Hamaker's constant for intermolecular forces, under conditions of weak gas--solid interaction, which lead to fast spreading of the precursor film and weak intermolecular forces relative to viscous forces within the lubricating film. The dependence on intermolecular forces is very weak and the contact angle expression has a tight upper bound tan Θ=7.48 Ca 1/3 for thick films, which is independent of the Hamaker constant. This upper bound is in very good agreement with existing experimental data for wetting fluids in any capillary and for partially wetting fluids in a prewetted capillary. Significant correction to the Ca 1/3 dependence occurs only at very low Ca, where the intermolecular forces become more important and tan Θ diverges slightly from the above asymptotic behavior toward lower values

Subducted bathymetric features linked to variations in earthquake apparent stress along the northern Japan Trench

Science.gov (United States)

Moyer, P. A.; Bilek, S. L.; Phillips, W. S.

2010-12-01

Ocean floor bathymetric features such as seamounts and ridges are thought to influence the earthquake rupture process when they enter the subduction zone by causing changes in frictional conditions along the megathrust contact between the subducting and overriding plates. Once subducted, these features have been described as localized areas of heterogeneous plate coupling, with some controversy over whether these features cause an increase or decrease in interplate coupling. Along the northern Japan Trench, a number of bathymetric features, such as horst and graben structures and seamounts, enter the subduction zone where they may vary earthquake behavior. Using seismic coda waves, scattered energy following the direct wave arrivals, we compute apparent stress (a measure of stress drop proportional to radiated seismic energy that has been tied to the strength of the fault interface contact) for 329 intermediate magnitude (3.2 earthquake spectra for path and site effects and compute apparent stress using the seismic moment and corner frequency determined from the spectra. Preliminary results indicate apparent stress values between 0.3 - 22.6 MPa for events over a depth range of 2 - 55 km, similar to those found in other studies of the region although within a different depth range, with variations both along-strike and downdip. Off the Sanriku Coast, horst and graben structures enter the Japan Trench in an area where a large number of earthquakes occur at shallow (< 30 km) depth. These shallow events have a mean apparent stress of 1.2 MPa (range 0.3 - 3.8 MPa) which is approximately 2 times lower then the mean apparent stress for other events along the northern portion of this margin in the same shallow depth range. The relatively low apparent stress for events related to subducting horst and graben structures suggests weak interplate coupling between the subducting and overriding plates due to small, irregular contact zones with these features at depth. This is in

Determination of Apparent Amylose Content in Rice by Using Paper-Based Microfluidic Chips.

Science.gov (United States)

Hu, Xianqiao; Lu, Lin; Fang, Changyun; Duan, Binwu; Zhu, Zhiwei

2015-11-11

Determination of apparent amylose content in rice is a key function for rice research and the rice industry. In this paper, a novel approach with paper-based microfluidic chip is reported to determine apparent amylose content in rice. The conventional color reaction between amylose and iodine was employed. Blue color of amylose-iodine complex generated on-chip was converted to gray and measured with Photoshop after the colored chip was scanned. The method for preparation of the paper chip is described. In situ generation of iodine for on-chip color reaction was designed, and factors influencing color reaction were investigated in detail. Elimination of yellow color interference of excess iodine by exploiting color removal function of Photoshop was presented. Under the optimized conditions, apparent amylose content in rice ranging from 1.5 to 26.4% can be determined, and precision was 6.3%. The analytical results obtained with the developed approach were in good agreement with those with the continuous flow analyzer method.

An Apparent Descriptive Method for Judging the Synchronization of ...

Indian Academy of Sciences (India)

R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

So this method brings certain difficulty for judgement. Hence the author further explores how one can use a great deal of the observational data such as a1,2 sin i, m1,2 sin3 i, K1,2 and f (m) in tables of binary stars to judge synchronization of rotation of binary stars by using apparent phenomenal descriptive methods. These.

Evaluation of apparent viscosity of Para rubber latex by diffuse reflection near-infrared spectroscopy.

Science.gov (United States)

Sirisomboon, Panmanas; Chowbankrang, Rawiphan; Williams, Phil

2012-05-01

Near-infrared spectroscopy in diffuse reflection mode was used to evaluate the apparent viscosity of Para rubber field latex and concentrated latex over the wavelength range of 1100 to 2500 nm, using partial least square regression (PLSR). The model with ten principal components (PCs) developed using the raw spectra accurately predicted the apparent viscosity with correlation coefficient (r), standard error of prediction (SEP), and bias of 0.974, 8.6 cP, and -0.4 cP, respectively. The ratio of the SEP to the standard deviation (RPD) and the ratio of the SEP to the range (RER) for the prediction were 4.4 and 16.7, respectively. Therefore, the model can be used for measurement of the apparent viscosity of field latex and concentrated latex in quality assurance and process control in the factory.

Blood parameters and apparent digestibility of concentrate with rice oil for horses

Directory of Open Access Journals (Sweden)

Helio Alberto Cumani Garcia

2013-10-01

Full Text Available Apparent digestibility coefficients and serum parameters were measured to evaluate the effect of supplementing feed concentrates with rice bran oil in horses. Twelve horses (6 males and 6 females with a mean age of 18 ± 4 months old and mean live weight of 306 ± 22.6 kg were used. Treatments consisted of increasing rice bran oil concentrate levels of 0, 3.5, 7.0, 10.5, 14.0 and 17.5%, considering a daily intake of 2.25% live weight on a dry matter basis. A dietary effect of supplementation on the apparent digestibility of gross energy (y = 64.55 - 0.58x was observed (P0.05. Supplementation did not affect serum glucose levels (P>0.05, but cholesterol was affected (P0.05. A dietary effect on the triglyceride (y = 15.73 - 0.96x + 0.0524x² and HDL (high-density lipoprotein (y = 45.24 + 1.0499x parameters was observed (P<0.01. While the use of rice bran oil does affect blood parameters associated with lipid metabolism, rice bran oil levels up to 17.5% concentrate do not negatively affect the apparent digestibility of dietary nutrients.

Definition of apparent activation energy on DTG curves

Directory of Open Access Journals (Sweden)

A. K. Serikbayeva

2016-07-01

Full Text Available The article gives the results of sulphidation oxidized copper ores and tailings with sulfur. Defined by the apparent activation energy in the conditions of heating the mixture of substances interacting with a constant speed by differential thermogravimetry (DTG. It was established that the sulfiding may occur in a kinetic mode , since the interaction is charged, in the presence of liquid and gaseous sulfur , i.e. transport of sulfur to the surface of the mineral is not a limiting process.

Apparent embrittlement saturation and radiation mechanisms of reactor pressure vessel steels

International Nuclear Information System (INIS)

Pachur, D.

1981-01-01

The irradiation and annealing results of three different reactor pressure vessel steels are reported. Steel A, a basic material according to ASTM A-533 B having 0.15 percent vanadium; and Steel C contained 3.2 percent nickel. The steels were irradiated at 150, 300, and 400 degree C with neutron fluxes of 6 multiplied by 10 11 and 3 multiplied by 10 13 neutrons (n)/cm 2 /s. An apparent saturation-in-irradiation effect was found within certain neutron fluence ranges. During the annealing, various recovery processes occur in different temperature ranges. These are characterized by various activation energies. The individual processes were determined by the different time dependencies at various temperatures. Two causes for the apparent saturation were discovered from the behavior of the annealing curves

Two classes of ouabain binding sites in ferret heart and two forms of Na+-K+-ATPase

Energy Technology Data Exchange (ETDEWEB)

Ng, Y.C.; Akera, T.

1987-05-01

In partially purified Na+-K+-adenosinetriphosphatase (ATPase) obtained from ferret heart, ouabain produced a monophasic inhibition curve; however, the curve spanned over 5 logarithmic units, indicating the presence of more than one classes of enzyme. (/sup 3/H)ouabain binding studies revealed high-and low-affinity binding sites in approximately equal abundance, with apparent dissociation constants of 10 and 230 nM, respectively. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis of phosphoenzyme formed from (gamma-/sup 32/P)ATP showed two distinct K+-sensitive bands of approximately 100,000 molecular weight. Phosphoenzyme formation from the high-molecular-weight alpha(+) form was selectively inhibited by N-ethylmaleimide. Ouabain caused a 50% inhibition of phosphorylation of the alpha(+) form at 40 nM and the lower-molecular-weight alpha form at 300 nM. In papillary muscle preparations, 1-30 nM ouabain produced a modest positive inotropic effect that reached an apparent plateau at 30 nM. Further increases in ouabain concentrations, however, produced additional and prominent inotropic effects at 0.1-10 microM. These results indicate for the first time in cardiac muscle that the high- and low-affinity ouabain binding sites are associated with the alpha(+) and alpha forms of the Na+-K+-ATPase, respectively, and that binding of ouabain to either of these sites causes enzyme inhibition and the positive inotropic effect.

Apparent stress-strain relationships in experimental equipment where magnetorheological fluids operate under compression mode

International Nuclear Information System (INIS)

Mazlan, S A; Ekreem, N B; Olabi, A G

2008-01-01

This paper presents an experimental investigation of two different magnetorheological (MR) fluids, namely, water-based and hydrocarbon-based MR fluids in compression mode under various applied currents. Finite element method magnetics was used to predict the magnetic field distribution inside the MR fluids generated by a coil. A test rig was constructed where the MR fluid was sandwiched between two flat surfaces. During the compression, the upper surface was moved towards the lower surface in a vertical direction. Stress-strain relationships were obtained for arrangements of equipment where each type of fluid was involved, using compression test equipment. The apparent compressive stress was found to be increased with the increase in magnetic field strength. In addition, the apparent compressive stress of the water-based MR fluid showed a response to the compressive strain of greater magnitude. However, during the compression process, the hydrocarbon-based MR fluid appeared to show a unique behaviour where an abrupt pressure drop was discovered in a region where the apparent compressive stress would be expected to increase steadily. The conclusion is drawn that the apparent compressive stress of MR fluids is influenced strongly by the nature of the carrier fluid and by the magnitude of the applied current

Apparent digestibility of nutrients, energy, and amino acid of nontoxic and detoxified physic nut cakes for Nile tilapia

Directory of Open Access Journals (Sweden)

Hamilton Hisano

2015-09-01

Full Text Available Abstract:The objective of this work was to evaluate the apparent digestibility coefficients of nutrients, energy, and amino acids of nontoxic and detoxified physic nut cakes treated with solvent plus posterior extrusion, for Nile tilapia. The apparent digestibility coefficients of crude protein and gross energy were higher for detoxified than for nontoxic physic nut cake. However, the apparent digestibility coefficient of ether extract of the nontoxic physic nut cake was higher than that of the detoxified one. The apparent digestibility coefficient of amino acids of both feed ingredients was superior to 80%, except for glycine, for the nontoxic psychic nut cake, and for threonine, for the detoxified one. Nontoxic and detoxified physic nut cakes show apparent digestibility coefficient values equivalent to those of the other evaluated oilseeds and potential for inclusion in Nile tilapia diets.

The Effect of the Operating Conditions on the Apparent Viscosity of Crude Palm Oil During Oil Clarification

OpenAIRE

Sulaiman Al-Zuhair, Mirghani I. Ahmed and Yousif A. Abakr

2012-01-01

This paper discusses the apparent viscosity of crude palm oil, using rotary viscometer, under different boundary conditions. It was experimentally shown that the apparent viscosity of palm oil drops with increasing of the shear rate and the temperature.  However, the effect of temperature on the viscosity tends to fade at temperatures beyond 80 oC.  A correlation between the apparent viscosity of crude palm oil and the operating conditions was developed. This correlation can be used...

The influence of sex on the haematological values of apparently ...

African Journals Online (AJOL)

Blood samples were collected from fifty apparently healthy adult Sahel goats, twenty five each of male and female in Maiduguri to assess the influence of sex on their haematology. The red blood cell (RBC) counts, white blood cell (WBC) counts, haemoglobin (Hb) concentration, packed cell volume (PCV), platelet counts, ...

Flipping about the Sun and Its Pattern of Apparent Motion

Science.gov (United States)

Betts, Crystal M.; Pattee, Allison

2016-01-01

Arts integration has shown to enhance student comprehension, retention, and engagement, while connecting to rich science content. The integration of the Next Generation Science Standards and the National Arts Standards into a first grade lesson illustrated how the arts enhanced the students' understandings of the sun's apparent motion during the…

Spray Drying as a Reliable Route to Produce Metastable Carbamazepine Form IV.

Science.gov (United States)

Halliwell, Rebecca A; Bhardwaj, Rajni M; Brown, Cameron J; Briggs, Naomi E B; Dunn, Jaclyn; Robertson, John; Nordon, Alison; Florence, Alastair J

2017-07-01

Carbamazepine (CBZ) is an active pharmaceutical ingredient used in the treatment of epilepsy that can form at least 5 polymorphic forms. Metastable form IV was originally discovered from crystallization with polymer additives; however, it has not been observed from subsequent solvent-only crystallization efforts. This work reports the reproducible formation of phase pure crystalline form IV by spray drying of methanolic CBZ solution. Characterization of the material was carried out using diffraction, scanning electron microscopy, and differential scanning calorimetry. In situ Raman spectroscopy was used to monitor the spray-dried product during the spray drying process. This work demonstrates that spray drying provides a robust method for the production of form IV CBZ, and the combination of high supersaturation and rapid solid isolation from solution overcomes the apparent limitation of more traditional solution crystallization approaches to produce metastable crystalline forms. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

Creep Forming of Carbon-Reinforced Ceramic-Matrix Composites

Science.gov (United States)

Vaughn, Wallace L.; Scotti, Stephan J.; Ashe, Melissa P.; Connolly, Liz

2007-01-01

A set of lecture slides describes an investigation of creep forming as a means of imparting desired curvatures to initially flat stock plates of carbon-reinforced ceramic-matrix composite (C-CMC) materials. The investigation is apparently part of a continuing effort to develop improved means of applying small CCMC repair patches to reinforced carbon-carbon leading edges of aerospace vehicles (e.g., space shuttles) prior to re-entry into the atmosphere of the Earth. According to one of the slides, creep forming would be an intermediate step in a process that would yield a fully densified, finished C-CMC part having a desired size and shape (the other steps would include preliminary machining, finish machining, densification by chemical vapor infiltration, and final coating). The investigation included experiments in which C-CMC disks were creep-formed by heating them to unspecified high temperatures for time intervals of the order of 1 hour while they were clamped into single- and double-curvature graphite molds. The creep-formed disks were coated with an oxidation- protection material, then subjected to arc-jet tests, in which the disks exhibited no deterioration after exposure to high-temperature test conditions lasting 490 seconds.

Osmotic and apparent molar properties of binary mixtures alcohol + 1-butyl-3-methylimidazolium trifluoromethanesulfonate ionic liquid

International Nuclear Information System (INIS)

González, Emilio J.; Calvar, Noelia; Domínguez, Ángeles; Macedo, Eugénia A.

2013-01-01

Highlights: ► Osmotic and physical properties of binary mixtures {alcohol + [BMim][TfO]} were measured. ► From experimental data, apparent molar properties and osmotic coefficients were calculated. ► The apparent properties were fitted using a Redlich–Meyer type equation. ► The osmotic coefficients were correlated using the Extended Pitzer model. -- Abstract: In this work, physical properties (densities and speeds of sound) for the binary systems {1-propanol, or 2-propanol, or 1-butanol, or 2-butanol, or 1-pentanol + 1-butyl-3-methylimidazolium trifluoromethanesulfonate} were experimentally measured from T = (293.15 to 323.15) K and at atmospheric pressure. These data were used to calculate the apparent molar volume and apparent molar isentropic compression which were fitted to a Redlich–Meyer type equation. This fit was used to obtain the corresponding apparent molar properties at infinite dilution. On the other hand, the osmotic and activity coefficients and vapor pressures of these binary mixtures were also determined at T = 323.15 K using the vapor pressure osmometry technique. The Extended Pitzer model of Archer was employed to correlate the experimental osmotic coefficients. From the parameters obtained in the correlation, the mean molal activity coefficients and the excess Gibbs free energy for the studied mixtures were calculated

Apparent losses due to domestic water meter under-registration in ...

African Journals Online (AJOL)

By combining these results with the average age of meters in South Africa, estimated from the National Water Demand Archive, it was possible to estimate the average meter under-registration due to meter aging. The study concluded that apparent losses due to water meter under-registration are around 5% of consumption ...

Does apparent size capture attention in visual search? Evidence from the Muller-Lyer illusion.

Science.gov (United States)

Proulx, Michael J; Green, Monique

2011-11-23

Is perceived size a crucial factor for the bottom-up guidance of attention? Here, a visual search experiment was used to examine whether an irrelevantly longer object can capture attention when participants were to detect a vertical target item. The longer object was created by an apparent size manipulation, the Müller-Lyer illusion; however, all objects contained the same number of pixels. The vertical target was detected more efficiently when it was also perceived as the longer item that was defined by apparent size. Further analysis revealed that the longer Müller-Lyer object received a greater degree of attentional priority than published results for other features such as retinal size, luminance contrast, and the abrupt onset of a new object. The present experiment has demonstrated for the first time that apparent size can capture attention and, thus, provide bottom-up guidance on the basis of perceived salience.

The effect of interaural-time-difference fluctuations on apparent source width

DEFF Research Database (Denmark)

Käsbach, Johannes; May, Tobias; Oskarsdottir, Gudrun

2014-01-01

For the perception of spaciousness, the temporal fluctuations of the interaural time differences (ITDs) and interaural level differences (ILDs) provide important binaural cues. One major characteristic of spatial perception is apparent source width (ASW), which describes the perceived width of a ...

Microbial nitrilases: versatile, spiral forming, industrial enzymes.

Science.gov (United States)

Thuku, R N; Brady, D; Benedik, M J; Sewell, B T

2009-03-01

The nitrilases are enzymes that convert nitriles to the corresponding acid and ammonia. They are members of a superfamily, which includes amidases and occur in both prokaryotes and eukaryotes. The superfamily is characterized by having a homodimeric building block with a alpha beta beta alpha-alpha beta beta alpha sandwich fold and an active site containing four positionally conserved residues: cys, glu, glu and lys. Their high chemical specificity and frequent enantioselectivity makes them attractive biocatalysts for the production of fine chemicals and pharmaceutical intermediates. Nitrilases are also used in the treatment of toxic industrial effluent and cyanide remediation. The superfamily enzymes have been visualized as dimers, tetramers, hexamers, octamers, tetradecamers, octadecamers and variable length helices, but all nitrilase oligomers have the same basic dimer interface. Moreover, in the case of the octamers, tetradecamers, octadecamers and the helices, common principles of subunit association apply. While the range of industrially interesting reactions catalysed by this enzyme class continues to increase, research efforts are still hampered by the lack of a high resolution microbial nitrilase structure which can provide insights into their specificity, enantioselectivity and the mechanism of catalysis. This review provides an overview of the current progress in elucidation of structure and function in this enzyme class and emphasizes insights that may lead to further biotechnological applications.

Evaluation of the apparent losses caused by water meter under-registration in intermittent water supply.

Science.gov (United States)

Criminisi, A; Fontanazza, C M; Freni, G; Loggia, G La

2009-01-01

Apparent losses are usually caused by water theft, billing errors, or revenue meter under-registration. While the first two causes are directly related to water utility management and may be reduced by improving company procedures, water meter inaccuracies are considered to be the most significant and hardest to quantify. Water meter errors are amplified in networks subjected to water scarcity, where users adopt private storage tanks to cope with the intermittent water supply. The aim of this paper is to analyse the role of two variables influencing the apparent losses: water meter age and the private storage tank effect on meter performance. The study was carried out in Palermo (Italy). The impact of water meter ageing was evaluated in laboratory by testing 180 revenue meters, ranging from 0 to 45 years in age. The effects of the private water tanks were determined via field monitoring of real users and a mathematical model. This study demonstrates that the impact on apparent losses from the meter starting flow rapidly increases with meter age. Private water tanks, usually fed by a float valve, overstate meter under-registration, producing additional apparent losses between 15% and 40% for the users analysed in this study.

Mixing effects on apparent reaction rates and isotope fractionation during denitrification in a heterogeneous aquifer

Science.gov (United States)

Green, Christopher T.; Böhlke, John Karl; Bekins, Barbara A.; Phillips, Steven P.

2010-01-01

Gradients in contaminant concentrations and isotopic compositions commonly are used to derive reaction parameters for natural attenuation in aquifers. Differences between field‐scale (apparent) estimated reaction rates and isotopic fractionations and local‐scale (intrinsic) effects are poorly understood for complex natural systems. For a heterogeneous alluvial fan aquifer, numerical models and field observations were used to study the effects of physical heterogeneity on reaction parameter estimates. Field measurements included major ions, age tracers, stable isotopes, and dissolved gases. Parameters were estimated for the O2 reduction rate, denitrification rate, O2 threshold for denitrification, and stable N isotope fractionation during denitrification. For multiple geostatistical realizations of the aquifer, inverse modeling was used to establish reactive transport simulations that were consistent with field observations and served as a basis for numerical experiments to compare sample‐based estimates of “apparent” parameters with “true“ (intrinsic) values. For this aquifer, non‐Gaussian dispersion reduced the magnitudes of apparent reaction rates and isotope fractionations to a greater extent than Gaussian mixing alone. Apparent and true rate constants and fractionation parameters can differ by an order of magnitude or more, especially for samples subject to slow transport, long travel times, or rapid reactions. The effect of mixing on apparent N isotope fractionation potentially explains differences between previous laboratory and field estimates. Similarly, predicted effects on apparent O2threshold values for denitrification are consistent with previous reports of higher values in aquifers than in the laboratory. These results show that hydrogeological complexity substantially influences the interpretation and prediction of reactive transport.

Correlation of human papillomavirus status with apparent diffusion coefficient of diffusion-weighted MRI in head and neck squamous cell carcinomas.

Science.gov (United States)

Driessen, Juliette P; van Bemmel, Alexander J M; van Kempen, Pauline M W; Janssen, Luuk M; Terhaard, Chris H J; Pameijer, Frank A; Willems, Stefan M; Stegeman, Inge; Grolman, Wilko; Philippens, Marielle E P

2016-04-01

Identification of prognostic patient characteristics in head and neck squamous cell carcinoma (HNSCC) is of great importance. Human papillomavirus (HPV)-positive HNSCCs have favorable response to (chemo)radiotherapy. Apparent diffusion coefficient, derived from diffusion-weighted MRI, has also shown to predict treatment response. The purpose of this study was to evaluate the correlation between HPV status and apparent diffusion coefficient. Seventy-three patients with histologically proven HNSCC were retrospectively analyzed. Mean pretreatment apparent diffusion coefficient was calculated by delineation of total tumor volume on diffusion-weighted MRI. HPV status was analyzed and correlated to apparent diffusion coefficient. Six HNSCCs were HPV-positive. HPV-positive HNSCC showed significantly lower apparent diffusion coefficient compared to HPV-negative. This correlation was independent of other patient characteristics. In HNSCC, positive HPV status correlates with low mean apparent diffusion coefficient. The favorable prognostic value of low pretreatment apparent diffusion coefficient might be partially attributed to patients with a positive HPV status. © 2015 Wiley Periodicals, Inc. Head Neck 38: E613-E618, 2016. © 2015 Wiley Periodicals, Inc.

The CoxD protein, a novel AAA+ ATPase involved in metal cluster assembly: hydrolysis of nucleotide-triphosphates and oligomerization.

Directory of Open Access Journals (Sweden)

Tobias Maisel

Full Text Available CoxD of the α-proteobacterium Oligotropha carboxidovorans is a membrane protein which is involved in the posttranslational biosynthesis of the [CuSMoO₂] cluster in the active site of the enzyme CO dehydrogenase. The bacteria synthesize CoxD only in the presence of CO. Recombinant CoxD produced in E. coli K38 pGP1-2/pETMW2 appeared in inclusion bodies from where it was solubilized by urea and refolded by stepwise dilution. Circular dichroism spectroscopy revealed the presence of secondary structural elements in refolded CoxD. CoxD is a P-loop ATPase of the AAA-protein family. Refolded CoxD catalyzed the hydrolysis of MgATP yielding MgADP and inorganic phosphate at a 1∶1∶1 molar ratio. The reaction was inhibited by the slow hydrolysable MgATP-γ-S. GTPase activity of CoxD did not exceed 2% of the ATPase activity. Employing different methods (non linear regression, Hanes and Woolf, Lineweaver-Burk, preparations of CoxD revealed a mean K(M value of 0.69±0.14 mM ATP and an apparent V(max value of 19.3±2.3 nmol ATP hydrolyzed min⁻¹ mg⁻¹. Sucrose density gradient centrifugation and gel filtration showed that refolded CoxD can exist in various multimeric states (2-mer, 4-mer or 6-mer, preferentially as hexamer or dimer. Within weeks the hexamer dissociates into the dimer, a process which can be reversed by MgATP or MgATP-γ-S within hours. Only the hexamers and the dimers exhibited MgATPase activity. Transmission electron microscopy of negatively stained CoxD preparations revealed distinct particles within a size range of 10-16 nm, which further corroborates the oligomeric organization. The 3D structure of CoxD was modeled with the 3D structure of BchI from Rhodobacter capsulatus as template. It has the key elements of an AAA+ domain in the same arrangement and at same positions as in BchI and displays the characteristic inserts of the PS-II-insert clade. Possible functions of CoxD in [CuSMoO₂] cluster assembly are discussed.

Tunnelling of Massive/Massless Bosons from the Apparent Horizon of FRW Universe

Directory of Open Access Journals (Sweden)

Kimet Jusufi

2017-01-01

Full Text Available We investigate the Hawking radiation of vector particles from the apparent horizon of a Friedmann-Robertson-Walker (FRW universe in the framework of quantum tunnelling method. Furthermore we use Proca equation, a relativistic wave equation for a massive/massless spin-1 particle (massless γ photons, weak massive W± and Z0 bosons, strong massless gluons, and ρ and ω mesons together with a Painlevé space-time metric for the FRW universe. We solve the Proca equation via Hamilton-Jacobi (HJ equation and the WKB approximation method. We recover the same result for the Hawking temperature associated with vector particles as in the case of scalar and Dirac particles tunnelled from outside to the inside of the apparent horizon in a FRW universe.

APPARENT DIGESTIBILTY EXPERIMENT WITH NILE TILAPIA (OREOCHROMIS NILOTICUS FED DIETS CONTAINING CITRULLUS LANATUS SEEDMEAL

Directory of Open Access Journals (Sweden)

Wasiu Adeyemi JIMOH

2015-12-01

Full Text Available Apparent digestibility coefficients of nutrients in Citrullus lanatus based diets were determined for Nile tilapia (Oreochromis niloticus using AIA as marker or indicator. 150 tilapia fingerlings of average weight 6.12±0.05g were acclimatized for a week, weighed and allotted into five dietary treatments; CTR, DT2, DT3, DT4 and DT5 containing 0, 15, 30, 45 and 60% Citrullus lanatus respectively. The diets were isonitrogenous, isocaloric and isolipidic. Each treatment was replicated three times with ten fish per replicate. Fish were fed 5% body weight on two equal proportions per day. The results from the study indicated that there was no significant variation (p>0.05 in the apparent organic matter and gross energy digestibility coefficients of the diets; that there was significant (p0.05 in the apparent digestibility coefficients of nutrients (protein, energy, lipid and carbohydrates between the diets up to 30% replacement levels for tilapia.

Evidence of deterministic components in the apparent randomness of GRBs: clues of a chaotic dynamic.

Science.gov (United States)

Greco, G; Rosa, R; Beskin, G; Karpov, S; Romano, L; Guarnieri, A; Bartolini, C; Bedogni, R

2011-01-01

Prompt γ-ray emissions from gamma-ray bursts (GRBs) exhibit a vast range of extremely complex temporal structures with a typical variability time-scale significantly short - as fast as milliseconds. This work aims to investigate the apparent randomness of the GRB time profiles making extensive use of nonlinear techniques combining the advanced spectral method of the Singular Spectrum Analysis (SSA) with the classical tools provided by the Chaos Theory. Despite their morphological complexity, we detect evidence of a non stochastic short-term variability during the overall burst duration - seemingly consistent with a chaotic behavior. The phase space portrait of such variability shows the existence of a well-defined strange attractor underlying the erratic prompt emission structures. This scenario can shed new light on the ultra-relativistic processes believed to take place in GRB explosions and usually associated with the birth of a fast-spinning magnetar or accretion of matter onto a newly formed black hole.

Cosmological and black hole apparent horizons

CERN Document Server

Faraoni, Valerio

2015-01-01

This book overviews the extensive literature on apparent cosmological and black hole horizons. In theoretical gravity, dynamical situations such as gravitational collapse, black hole evaporation, and black holes interacting with non-trivial environments, as well as the attempts to model gravitational waves occurring in highly dynamical astrophysical processes, require that the concept of event horizon be generalized. Inequivalent notions of horizon abound in the technical literature and are discussed in this manuscript. The book begins with a quick review of basic material in the first one and a half chapters, establishing a unified notation. Chapter 2 reminds the reader of the basic tools used in the analysis of horizons and reviews the various definitions of horizons appearing in the literature. Cosmological horizons are the playground in which one should take baby steps in understanding horizon physics. Chapter 3 analyzes cosmological horizons, their proposed thermodynamics, and several coordinate systems....

Channel-forming activities in the glycosomal fraction from the bloodstream form of Trypanosoma brucei.

Directory of Open Access Journals (Sweden)

Melisa Gualdron-López

apparently contains several types of pore-forming channels connecting the glycosomal lumen and the cytosol.

Morphology and solubility of multiple crystal forms of Taka-amylase A

Science.gov (United States)

Ninomiya, Kumiko; Yamamoto, Tenyu; Oheda, Tadashi; Sato, Kiyotaka; Sazaki, Gen; Matsuura, Yoshiki

2001-01-01

An α-amylase originating from a mold Aspergillus oryzae, Taka-amylase A (Mr of 52 kDa, pI of 3.8), has been purified to an electrophoretically single band grade. Crystallization behaviors were investigated using ammonium sulfate and polyethleneglycol 8000 as precipitants. The variations in the morphology of the crystals obtained with changing crystallization parameters are described. Five apparently different crystal forms were obtained, and their morphology and crystallographic data have been determined. Solubility values of four typical forms were measured using a Michelson-type two-beam interferometer. The results of these experiments showed that this protein can be a potentially interesting and useful model for crystal growth study with a gram-amount availability of pure protein sample.

Thermal conductivity as influenced by the temperature and apparent viscosity of dairy products.

Science.gov (United States)

Gonçalves, B J; Pereira, C G; Lago, A M T; Gonçalves, C S; Giarola, T M O; Abreu, L R; Resende, J V

2017-05-01

This study aimed to evaluate the rheological behavior and thermal conductivity of dairy products, composed of the same chemical components but with different formulations, as a function of temperature. Subsequently, thermal conductivity was related to the apparent viscosity of yogurt, fermented dairy beverage, and fermented milk. Thermal conductivity measures and rheological tests were performed at 5, 10, 15, 20, and 25°C using linear probe heating and an oscillatory rheometer with concentric cylinder geometry, respectively. The results were compared with those calculated using the parallel, series, and Maxwell-Eucken models as a function of temperature, and the discrepancies in the results are discussed. Linear equations were fitted to evaluate the influence of temperature on the thermal conductivity of the dairy products. The rheological behavior, specifically apparent viscosity versus shear rate, was influenced by temperature. Herschel-Bulkley, power law, and Newton's law models were used to fit the experimental data. The Herschel-Bulkley model best described the adjustments for yogurt, the power law model did so for fermented dairy beverages, and Newton's law model did so for fermented milk and was then used to determine the rheological parameters. Fermented milk showed a Newtonian trend, whereas yogurt and fermented dairy beverage were shear thinning. Apparent viscosity was correlated with temperature by the Arrhenius equation. The formulation influenced the effective thermal conductivity. The relationship between the 2 properties was established by fixing the temperature and expressing conductivity as a function of apparent viscosity. Thermal conductivity increased with viscosity and decreased with increasing temperature. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Parallel search for conjunctions with stimuli in apparent motion.

Science.gov (United States)

Casco, C; Ganis, G

1999-01-01

A series of experiments was conducted to determine whether apparent motion tends to follow the similarity rule (i.e. is attribute-specific) and to investigate the underlying mechanism. Stimulus duration thresholds were measured during a two-alternative forced-choice task in which observers detected either the location or the motion direction of target groups defined by the conjunction of size and orientation. Target element positions were randomly chosen within a nominally defined rectangular subregion of the display (target region). The target region was presented either statically (followed by a 250 ms duration mask) or dynamically, displaced by a small distance (18 min of arc) from frame to frame. In the motion display, the position of both target and background elements was changed randomly from frame to frame within the respective areas to abolish spatial correspondence over time. Stimulus duration thresholds were lower in the motion than in the static task, indicating that target detection in the dynamic condition does not rely on the explicit identification of target elements in each static frame. Increasing the distractor-to-target ratio was found to reduce detectability in the static, but not in the motion task. This indicates that the perceptual segregation of the target is effortless and parallel with motion but not with static displays. The pattern of results holds regardless of the task or search paradigm employed. The detectability in the motion condition can be improved by increasing the number of frames and/or by reducing the width of the target area. Furthermore, parallel search in the dynamic condition can be conducted with both short-range and long-range motion stimuli. Finally, apparent motion of conjunctions is insufficient on its own to support location decision and is disrupted by random visual noise. Overall, these findings show that (i) the mechanism underlying apparent motion is attribute-specific; (ii) the motion system mediates temporal

Effect of dietary carbohydrate sources on apparent nutrient digestibility of olive flounder (Paralichthys olivaceus feed

Directory of Open Access Journals (Sweden)

Md Mostafizur Rahman

2016-06-01

Full Text Available Abstract Apparent digestibility coefficients (ADCs of dry matter, crude protein, crude lipid, nitrogen-free extract, and energy in selected carbohydrate sources including wheat flour (WF, α-potato starch (PS, α-corn starch (CS, Na alginate (AL, dextrin (DEX, and carboxymethyl cellulose (CMC were determined for olive flounder. The olive flounder averaging 150 ± 8.0 g were held in 300-L tanks at a density of 30 fish per tank. Chromic oxide was used as the inert marker. Feces were collected from the flounder by a fecal collector attached to a fish rearing tank. Apparent dry matter and energy digestibilities of flounder fed WF, PS, CS, and DEX diets were significantly higher than those of fish fed AL and CMC diets. Apparent crude protein digestibility coefficients of flounder fed PS and CS diets were significantly higher than those of fish fed AL, DEX, and CMC diets. Apparent crude lipid and nitrogen-free extract digestibility coefficients of flounder fed PS and DEX diets were significantly higher than those of fish fed WF, CS, AL, and CMC diets. The present findings indicate that PS and DEX could be effectively used as dietary carbohydrate energy compared to WF, CS, AL, and CMC for olive flounder.

Apparent Barrier Height in Scanning Tunneling Microscopy Revisited

DEFF Research Database (Denmark)

Olesen, L.; Brandbyge, Mads; Sørensen, Mads Reinholdt

1996-01-01

The apparent barrier height phi(ap), that is, the rate of change of the logarithm of the conductance with tip-sample separation in a scanning tunneling microscope (STM), has been measured for Ni, Pt, and Au single crystal surfaces. The results show that phi(ap) is constant until point contact...... is reached rather than decreasing at small tunneling gap distances, as previously reported. The findings for phi(ap) can be accounted for theoretically by including the relaxations of the tip-surface junction in an STM due to the strong adhesive forces at close proximity. These relaxation effects are shown...

The apparent motion of the Sun revisited

Science.gov (United States)

Probst, Oliver

2002-05-01

The knowledge of the apparent motion of the Sun - due to the combined effects of the rotation of the Earth around its proper axis and the translation around the Sun - is important both in natural and man-made systems. In particular, a proper explanation of the seasons requires an understanding of this solar geometry. In this paper we present a simple derivation of the relevant formulae based on vector algebra. The possible trajectories are discussed in detail. An approximate explicit formula for the seasonal variations of solar radiation is derived and discussed. The calculations give useful insights into the geometry of the problem and are thought to be helpful for the undergraduate teaching of solar energy engineering, classical mechanics and astronomy.

Apparently Ipsilateral Parkinsonism in a Patient with Chronic Subdural Hematoma

Directory of Open Access Journals (Sweden)

Tae Hwan Roh

2012-05-01

Full Text Available Symptomatic parkinsonism secondary to ipsilateral lesion is rarely reported. Although the contribution of the contralateral lesions was assumed in some cases, the pathomechanism remains undetermined. Herein we report a patient with a subdural hematoma, who developed parkinsonism in the ipsilateral hemibody. Structural and functional imaging suggests the contralateral dopaminergic dysfunction as the major culprit of apparently ipsilateral parkinsonism.

Imaging malignant and apparent malignant transformation of benign gynaecological disease

Energy Technology Data Exchange (ETDEWEB)

Lee, A.Y.; Poder, L.; Qayyum, A.; Wang, Z.J.; Yeh, B.M. [Department of Radiology, University of California San Francisco, San Francisco, CA (United States); Coakley, F.V., E-mail: Fergus.Coakley@radiology.ucsf.ed [Department of Radiology, University of California San Francisco, San Francisco, CA (United States)

2010-12-15

Common benign gynaecological diseases, such as leiomyoma, adenomyosis, endometriosis, and mature teratoma, rarely undergo malignant transformation. Benign transformations that may mimic malignancy include benign metastasizing leiomyoma, massive ovarian oedema, decidualization of endometrioma, and rupture of mature teratoma. The aim of this review is to provide a contemporary overview of imaging findings in malignant and apparent malignant transformation of benign gynaecological disease.

Bacterial flora in the Urinary bladder of apparently healthy cattle in ...

African Journals Online (AJOL)

Fifty apparently healthy adult cattle presented for slaughter at the Maiduguri Metropolitan Abattoir were examined to determine the bacterial flora in the urinary bladder. Isolation and identification of the isolates in the aseptic urine samples from the urinary bladder were done according to standard bacteriological techniques.

Apparent molar volumes and compressibilities of alkaline earth metal ions in methanol and dimethylsulfoxide

International Nuclear Information System (INIS)

Warminska, Dorota; Wawer, Jaroslaw; Grzybkowski, Waclaw

2010-01-01

Temperature dependencies of density of magnesium (II), calcium (II), strontium (II), barium (II) perchlorates as well as beryllium (II), and sodium trifluoromethanesulfonates in methanol and dimethylsulfoxide have been determined over the composition range studied. From density data the apparent molar volumes and partial molar volumes of the salts at infinite dilution as well as the expansibilities have been evaluated. The apparent molar isentropic compressibilities of alkaline earth metal perchlorates and beryllium (II) and sodium triflates in methanol and DMSO have been calculated from sound speed data obtained at T = 298.15 K.

Acid-induced movements in the glycoprotein shell of an alphavirus turn the spikes into membrane fusion mode

OpenAIRE

Haag, Lars; Garoff, Henrik; Xing, Li; Hammar, Lena; Kan, Sin-Tau; Cheng, R.Holland

2002-01-01

In the icosahedral (T = 4) Semliki Forest virus, the envelope protomers, i.e. E1–E2 heterodimers, make one-to-one interactions with capsid proteins below the viral lipid bilayer, transverse the membrane and form an external glycoprotein shell with projections. The shell is organized by protomer domains interacting as hexamers and pentamers around shell openings at icosahedral 2- and 5-fold axes, respectively, and the projections by other domains associating as trimers at 3- and quasi 3-fold a...

Avian influenza virus infection in apparently healthy domestic birds in Sokoto, Nigeria

Directory of Open Access Journals (Sweden)

Innocent Okwundu Nwankwo

2012-09-01

Full Text Available The study was conducted among apparently healthy birds brought from different local government areas, neighbouring states and across international boundaries to the Sokoto central live bird market between October 2008 and March 2009. Tracheal and cloacal swabs were collected from 221 apparently healthy birds comprising 182 chickens, 3 turkeys, 11 guineafowl, 17 ducks and 8 pigeons. These samples were analysed using nested polymerase chain reaction (nPCR to check for the presence of avian influenza virus. An overall prevalence of 1.4% (3 positive cases was detected with two cases observed in chickens and one in a pigeon. The findings indicate the circulation of avian influenza in the study area. This raises concern for human and animal health due to zoonotic and economic implications of this virus.

Climate control of decadal-scale increases in apparent ages of eogenetic karst spring water

Science.gov (United States)

Martin, Jonathan B.; Kurz, Marie J.; Khadka, Mitra B.

2016-09-01

Water quantity and quality in karst aquifers may depend on decadal-scale variations in recharge or withdrawal, which we hypothesize could be assessed through time-series measurements of apparent ages of spring water. We tested this hypothesis with analyses of various age tracers (3H/3He, SF6, CFC-11, CFC-12, CFC-113) and selected solute concentrations [dissolved oxygen (DO), NO3, Mg, and SO4] from 6 springs in a single spring complex (Ichetucknee springs) in northern Florida over a 16-yr period. These springs fall into two groups that reflect shallow short (Group 1) and deep long (Group 2) flow paths. Some tracer concentrations are altered, with CFC-12 and CFC-113 concentrations yielding the most robust apparent ages. These tracers show a 10-20-yr monotonic increase in apparent age from 1997 to 2013, including the flood recession that followed Tropical Storm Debby in mid-2012. This increase in age indicates most water discharged during the study period recharged the aquifer within a few years of 1973 for Group 2 springs and 1980 for Group 1 springs. Inverse correlations between apparent age and DO and NO3 concentrations reflect reduced redox state in older water. Positive correlations between apparent age and Mg and SO4 concentrations reflect increased water-rock reactions. Concentrated recharge in the decade around 1975 resulted from nearly 2 m of rain in excess of the monthly average that fell between 1960 and 2014, followed by a nearly 4 m deficit to 2014. This excess rain coincided with two major El Niño events during the maximum cool phase in the Atlantic Multidecadal Oscillation. Although regional water withdrawal increased nearly 5-fold between 1980 and 2005, withdrawals represent only 2-5% of Ichetucknee River flow and are less important than decadal-long variations in precipitation. These results suggest that groundwater management should consider climate cycles as predictive tools for future water resources.

Mars Surface Heterogeneity From Variations in Apparent Thermal Inertia

Science.gov (United States)

Putzig, N. E.; Mellon, M. T.

2005-12-01

Current techniques used in the calculation of thermal inertia from observed brightness temperatures typically assume that planetary surface properties are uniform on the scale of the instrument's observational footprint. Mixed or layered surfaces may yield different apparent thermal inertia values at different seasons or times of day due to the nonlinear relationship between temperature and thermal inertia. To obtain sufficient data coverage for investigating temporal changes, we processed three Mars years of observations from the Mars Global Surveyor Thermal Emission Spectrometer and produced seasonal nightside and dayside maps of apparent thermal inertia. These maps show broad regions with seasonal and diurnal differences as large as 200 J m-2 K-1 s-½ at mid-latitudes (60°S to 60°N) and ranging up to 600 J m-2 K-1 s-½ or greater in the polar regions. Comparison of the maps with preliminary results from forward-modeling of heterogeneous surfaces indicates that much of the martian surface may be dominated by (1) horizontally mixed surfaces, such as those containing differing proportions of rocks, sand, dust, duricrust, and localized frosts; (2) higher thermal inertia layers over lower thermal inertia substrates, such as duricrust or desert pavements; and (3) lower thermal inertia layers over higher thermal inertia substrates, such as dust over sand or rocks and soils with an ice table at depth.

The Problems of Proving Actual or Apparent Bias: An Analysis of ...

African Journals Online (AJOL)

This article takes a critical look at the divergent approaches of courts in constructing the meaning of actual and apparent bias in adjudicative contexts. ... which has seemingly emerged is that which weighs the allegations of bias against the presumption of impartiality and the requirements of the double reasonableness test.

CoBOP: Microbial Biofilms: A Parameter Altering the Apparent Optical Properties of Sediments, Seagrasses and Surfaces

Science.gov (United States)

2002-09-30

CoBOP: Microbial Biofilms: A Parameter Altering the Apparent Optical Properties of Sediments, Seagrasses and Surfaces Alan W. Decho Department...TITLE AND SUBTITLE CoBOP: Microbial Biofilms: A Parameter Altering the Apparent Optical Properties of Sediments, Seagrasses and Surfaces 5a. CONTRACT...structures produced by bacteria. Their growth appears to depend on biofilm processes and light distributions ( photosynthesis ). Therefore, the data acquired

Statistical evidence against simple forms of wavefunction collapse

International Nuclear Information System (INIS)

Page, Don N.

2013-01-01

If the initial quantum state of the universe is a multiverse superposition over many different sets of values of the effective coupling ‘constants’ of physics, and if this quantum state collapses to an eigenstate of the set of coupling ‘constants’ with a probability purely proportional to the absolute square of the amplitude (with no additional factor for something like life or consciousness), then one should not expect that the coupling ‘constants’ would be so biophilic as they are observed to be. Therefore, the observed biophilic values (apparent fine tuning) of the coupling ‘constants’ is statistical evidence against such simple forms of wavefunction collapse

Statistical evidence against simple forms of wavefunction collapse

Energy Technology Data Exchange (ETDEWEB)

Page, Don N., E-mail: profdonpage@gmail.com [Theoretical Physics Institute, Department of Physics, University of Alberta, Room 238 CEB, 11322-89 Avenue, Edmonton, Alberta, T6G 2G7 (Canada)

2013-02-26

If the initial quantum state of the universe is a multiverse superposition over many different sets of values of the effective coupling ‘constants’ of physics, and if this quantum state collapses to an eigenstate of the set of coupling ‘constants’ with a probability purely proportional to the absolute square of the amplitude (with no additional factor for something like life or consciousness), then one should not expect that the coupling ‘constants’ would be so biophilic as they are observed to be. Therefore, the observed biophilic values (apparent fine tuning) of the coupling ‘constants’ is statistical evidence against such simple forms of wavefunction collapse.

Comparison between apparent viscosity related to irradiation dose for corn starch and black pepper

International Nuclear Information System (INIS)

Casandroiu, T.; Oprita, N.; Ferdes, O.S.

1999-01-01

Dose-effect relationship was studied in the rheoviscometric behaviour of geliffied suspensions of irradiated corn starch and black pepper, as the variation of the apparent viscosity and the shear stress related to the dose. Irradiation has been performed up to 16 kGy. Black pepper was ground and sieved to three particle sizes to analyse also the influence of particle size on the apparent viscosity variation by dose. The rheoviscometric measurements have been carried out by a rotationary viscometer on geliffied suspensions of starch and black pepper, into equivalent starch concentration and alkalinised suspensions for pepper. For starch, shear stress variation by dose is exponential, where the coefficients depend on the shear rate. For black pepper, the curves of apparent viscosity relation to dose also fit an exponential equation and the influence of particle size is discussed, too. Viscometric behaviour similar to irradiation of both corn starch and black pepper could be attributed to starch degradation at relatively high doses and should be used to develop an identification and control method for the ionizing treatment of starch-based food materials. (author)

An Estimation of the Gamma-Ray Burst Afterglow Apparent Optical Brightness Distribution Function

Science.gov (United States)

Akerlof, Carl W.; Swan, Heather F.

2007-12-01

By using recent publicly available observational data obtained in conjunction with the NASA Swift gamma-ray burst (GRB) mission and a novel data analysis technique, we have been able to make some rough estimates of the GRB afterglow apparent optical brightness distribution function. The results suggest that 71% of all burst afterglows have optical magnitudes with mRa strong indication that the apparent optical magnitude distribution function peaks at mR~19.5. Such estimates may prove useful in guiding future plans to improve GRB counterpart observation programs. The employed numerical techniques might find application in a variety of other data analysis problems in which the intrinsic distributions must be inferred from a heterogeneous sample.

Supplementing lactating dairy cows with a vitamin B12 precursor, 5,6-dimethylbenzimidazole, increases the apparent ruminal synthesis of vitamin B12.

Science.gov (United States)

Brito, A; Chiquette, J; Stabler, S P; Allen, R H; Girard, C L

2015-01-01

Cobalamin (CBL), the biologically active form of vitamin B12, and its analogs, are produced by bacteria only if cobalt supply is adequate. The analogs differ generally by the nucleotide moiety of the molecule. In CBL, 5,6-dimethylbenzimidazole (5,6-DMB) is the base in the nucleotide moiety. The present study aimed to determine if a supplement of 5,6-DMB could increase utilization of dietary cobalt for synthesis of CBL and change ruminal fermentation, nutrient digestibility, omasal flow of nutrients and ruminal protozoa counts. Eight ruminally cannulated multiparous Holstein cows (mean±standard deviation=238±21 days in milk and 736±47 kg of BW) were used in a crossover design. Cows were randomly assigned to a daily supplement of a gelatin capsule containing 1.5 g of 5,6-DMB via the rumen cannula or no supplement. Each period lasted 29 days and consisted of 21 days for treatment adaptation and 8 days for data and samples collection. Five corrinoids, CBL and four cobamides were detected in the total mixed ration and the omasal digesta from both treatments. The dietary supplement of 5,6-DMB increased (P=0.02) apparent ruminal synthesis of CBL from 14.6 to 19.6 (s.e.m. 0.8) mg/day but had no effect (P>0.1) on apparent ruminal synthesis of the four analogs. The supplement of 5,6-DMB had no effect (P>0.1) on milk production and composition, or on protozoal count, ruminal pH and concentrations of volatile fatty acids and ammonia nitrogen in rumen content. The supplement had also no effect (P>0.1) on intake, omasal flow and apparent ruminal digestibility of dry matter, organic matter, NDF, ADF and nitrogenous fractions. Plasma concentration of CBL was not affected by treatments (P=0.98). Providing a preformed part of the CBL molecule, that is, 5,6-DMB, increased by 34% the apparent ruminal synthesis of CBL by ruminal bacteria but had no effect on ruminal fermentation or protozoa count and it was not sufficient to increase plasma concentrations of the vitamin. Even though

Understanding sexual violence as a form of caste violence

Directory of Open Access Journals (Sweden)

Prachi Patil

2016-07-01

Full Text Available The paper attempts to understand narratives of sexual violence anchored within the dynamics of social location of caste and gender. Apparent caste-patriarchy and gender hierarchies which are at play in cases of sexual violence against lower-caste and dalit women speak about differential experiences of rape and sexual abuse that women have in India. The paper endeavours to establish that sexual violence is also a form of caste violence by rereading the unfortunate cases of Bhanwari Devi, Khairlanji, Lalasa Devi and Delta Meghwal Keywords: caste-patriarchy, Dalit women, POA Act, rape, sexual violence

Gas Phase Pressure Effects on the Apparent Thermal Conductivity of JSC-1A Lunar Regolith Simulant

Science.gov (United States)

Yuan, Zeng-Guang; Kleinhenz, Julie E.

2011-01-01

Gas phase pressure effects on the apparent thermal conductivity of a JSC-1A/air mixture have been experimentally investigated under steady state thermal conditions from 10 kPa to 100 kPa. The result showed that apparent thermal conductivity of the JSC-1A/air mixture decreased when pressure was lowered to 80 kPa. At 10 kPa, the conductivity decreased to 0.145 W/m/degree C, which is significantly lower than 0.196 W/m/degree C at 100 kPa. This finding is consistent with the results of previous researchers. The reduction of the apparent thermal conductivity at low pressures is ascribed to the Knudsen effect. Since the characteristic length of the void space in bulk JSC-1A varies over a wide range, both the Knudsen regime and continuum regime can coexist in the pore space. The volume ratio of the two regimes varies with pressure. Thus, as gas pressure decreases, the gas volume controlled by Knudsen regime increases. Under Knudsen regime the resistance to the heat flow is higher than that in the continuum regime, resulting in the observed pressure dependency of the apparent thermal conductivity.

Apparent mineralocorticoid excess syndrome: report of one family with three affected children.

Science.gov (United States)

Al-Harbi, Taiba; Al-Shaikh, Adnan

2012-01-01

The syndrome of apparent mineralocorticoid excess (AME) is an autosomal recessive disorder characterized by hypertension, hypokalemia, low renin, and hypoaldosteronism. It is caused by deficiency of 11β-hydroxysteroid dehydrogenase, which results in a defect of the peripheral metabolism of cortisol to cortisone. As a consequence, the serum cortisol half-life (T½) is prolonged, ACTH is suppressed, and serum cortisol concentration is normal. The hormonal diagnosis of the disorder is made by the increased ratio of urine-free cortisol to cortisone. In patients with AME, this ratio is 5-18, while in normal individuals it is syndrome of AME. We report three siblings - two female and one male - with the syndrome of apparent mineralocorticoid excess who presented with hypertension, hypokalemia, low renin, and low aldosterone levels. The finding of abnormally high ratios of 24-h urine-free cortisol to cortisone in our three patients (case 1, 8.4; case 2, 25; and case 3, 7.5) confirmed the diagnosis of apparent mineralocorticoid excess syndrome in these children. They were treated with oral potassium supplements. The addition of spironolactone resulted in a decrease in blood pressure, rise in serum potassium and a gradual increase in plasma renin activity in all three. In this study, the genetic testing of those three siblings with the typical clinical features of AME has detected missense mutation c.662C>T (p.Arg208Cys) in exon 3 of the HSD11B2 gene in the homozygous state.

Apparent rates of production and loss of dissolved gaseous mercury (DGM) in a southern reservoir lake (Tennessee, USA)

International Nuclear Information System (INIS)

Zhang Hong; Dill, Christopher

2008-01-01

Apparent rates of dissolved gaseous mercury (DGM) concentration changes in a southern reservoir lake (Cane Creek Lake, Cookeville, Tennessee) were investigated using the DGM data collected in a 12-month study from June 2003 to May 2004. The monthly mean apparent DGM production rates rose from January (3.2 pg L -1 /h), peaked in the summer months (June-August: 8.9, 8.0, 8.6 pg L -1 /h), and fell to the lowest in December (1.6 pg L -1 /h); this trend followed the monthly insolation march for both global solar radiation and UVA radiation. The monthly apparent DGM loss rates failed to show the similar trend with no consistent pattern recognizable. The spring and summer had higher seasonal mean apparent DGM production rates than the fall and winter (6.8, 9.0, 3.9, 5.0 pg L -1 /h, respectively), and the seasonal trend also appeared to closely follow the solar radiation variation. The seasonal apparent DGM loss featured similar rate values for the four seasons (5.5, 4.3, 3.3, and 3.9 pg L -1 /h for spring, summer, fall, and winter, respectively). Correlation was found of the seasonal mean apparent DGM production rate with the seasonal mean morning solar radiation (r = 0.9084, p < 0.01) and with the seasonal mean morning UVA radiation (r = 0.9582, p < 0.01). No significant correlation was found between the seasonal apparent DGM loss rate and the corresponding afternoon solar radiation (r = 0.5686 for global radiation and 0.6098 for UVA radiation). These results suggest that DGM production in the lake engaged certain photochemical processes, either primary or secondary, but the DGM loss was probably driven by some dark processes

Temporal ventriloquism along the path of apparent motion: speed perception under different spatial grouping principles.

Science.gov (United States)

Ogulmus, Cansu; Karacaoglu, Merve; Kafaligonul, Hulusi

2018-03-01

The coordination of intramodal perceptual grouping and crossmodal interactions plays a critical role in constructing coherent multisensory percepts. However, the basic principles underlying such coordinating mechanisms still remain unclear. By taking advantage of an illusion called temporal ventriloquism and its influences on perceived speed, we investigated how audiovisual interactions in time are modulated by the spatial grouping principles of vision. In our experiments, we manipulated the spatial grouping principles of proximity, uniform connectedness, and similarity/common fate in apparent motion displays. Observers compared the speed of apparent motions across different sound timing conditions. Our results revealed that the effects of sound timing (i.e., temporal ventriloquism effects) on perceived speed also existed in visual displays containing more than one object and were modulated by different spatial grouping principles. In particular, uniform connectedness was found to modulate these audiovisual interactions in time. The effect of sound timing on perceived speed was smaller when horizontal connecting bars were introduced along the path of apparent motion. When the objects in each apparent motion frame were not connected or connected with vertical bars, the sound timing was more influential compared to the horizontal bar conditions. Overall, our findings here suggest that the effects of sound timing on perceived speed exist in different spatial configurations and can be modulated by certain intramodal spatial grouping principles such as uniform connectedness.

Apparent mineral retention is similar in control and hyperinsulinemic men after consumption of high amylose cornstarch.

Science.gov (United States)

Behall, Kay M; Howe, Juliette C; Anderson, Richard A

2002-07-01

The effects on apparent mineral retention after long-term consumption of a high amylose diet containing 30 g resistant starch (RS) were investigated in 10 control and 14 hyperinsulinemic men. Subjects consumed products (bread, muffins, cookies, corn flakes and cheese puffs) made with standard (70% amylopectin, 30% amylose; AP) or high amylose (70% amylose, 30% amylopectin; AM) cornstarch for two 14-wk periods in a crossover pattern. Starch products replaced usual starches in the habitual diet for 10 wk followed by 4 wk of consuming the controlled diets. During wk 12, all urine, feces and duplicate foods were collected for 7 d. Urinary chromium losses after a glucose tolerance test or 24-h collections of the hyperinsulinemic and control subjects did not differ and were not altered by diet. Except for zinc, the two subject types did not differ significantly in apparent mineral balance. Apparent retentions of calcium and magnesium were not significantly affected by diet (AM vs. AP) or type-by-diet interaction. Apparent iron retention tended to be greater after AM than AP consumption (P copper retention was greater after consuming AP than after AM (P < 0.02), whereas apparent zinc retention was greater after consuming AM than after AP (P < 0.018). Zinc also showed a significant type-by-diet interaction (P < 0.034) with control subjects retaining less zinc after consuming AP than after AM. In summary, a high amylose cornstarch diet containing 30 g RS could be consumed long term without markedly affecting, and possibly enhancing, retention of some minerals.

Apparent molal volumes of HMT and TATD in aqueous solutions around the temperature of maximum density of water

International Nuclear Information System (INIS)

Clavijo Penagos, J.A.; Blanco, L.H.

2012-01-01

Highlights: ►V φ for HMT and TATD in aqueous solutions around the temperature of maximum density of water are reported. ► V φ is linear in m form m = 0.025 for all the aqueous solutions investigated. ► Variation of V ¯ 2 ∞ with T obeys a second grade polynomial trend. ► The solutes are classified as structure breakers according to Hepler’s criterion. - Abstract: Apparent molal volumes V φ have been determined from density measurements for several aqueous solutions of 1,3,5,7-tetraazatricyclo[3.3.1.1(3,7)]decane (HMT) and 1,3,6,8-tetraazatricyclo[4.4.1.1(3,8)]dodecane (TATD) at T = (275.15, 275.65, 276.15, 276.65, 277.15, 277.65 and 278.15) K as function of composition. The infinite dilution partial molar volumes of solutes in aqueous solution are evaluated through extrapolation. Interactions of the solutes with water are discussed in terms of the effect of the temperature on the volumetric properties and the structure of the solutes. The results are interpreted in terms of water structure-breaking or structure forming character of the solutes.

Accurate treatment of nanoelectronics through improved description of van der Waals Interactions

DEFF Research Database (Denmark)

Kelkkanen, Kari André

, or even as broken. The hexamer experience of the criteria and effects of vdW forces can be used in interpretation of results of molecular dynamics (MD) simulations of ambient water, where vdW forces qualitatively result in liquid water with fewer, more distorted HBs. This is interesting...... and relevance of van der Waals (vdW) forces in molecular surface adsorption and water through density- functional theory (DFT), using the exchange-correlation functional vdW-DF [Dion et al., Phys. Rev. Lett. 92, 246401 (2004)] and developments based on it. Results are first computed for adsorption with vd...... functionals. DFT calculations are performed for water dimer and hexamer, and for liquid water. Calculations on four low-energetic isomers of the water hexamer show that the vdW-DF accurately determines the energetic trend on these small clusters. How- ever, the dissociation-energy values with the vd...

Apparent relationship between thermal regime in Antarctic waters and Indian summer monsoon

Digital Repository Service at National Institute of Oceanography (India)

Menon, H.B.; RameshBabu, V.; Sastry, J.S.

) charts for the Indian Ocean sector of the Southern Ocean during 2 contrasting years (1977 and 1979) of summer monsoon over India. The results suggest an apparent relationship between the thermal regimes in the Antarctic waters of the Indian Ocean sector...

Sulfatide promotes the folding of proinsulin, preserves insulin crystals, and mediates its monomerization.

Science.gov (United States)

Osterbye, T; Jørgensen, K H; Fredman, P; Tranum-Jensen, J; Kaas, A; Brange, J; Whittingham, J L; Buschard, K

2001-06-01

Sulfatide is a glycolipid that has been associated with insulin-dependent diabetes mellitus. It is present in the islets of Langerhans and follows the same intracellular route as insulin. However, the role of sulfatide in the beta cell has been unclear. Here we present evidence suggesting that sulfatide promotes the folding of reduced proinsulin, indicating that sulfatide possesses molecular chaperone activity. Sulfatide associates with insulin by binding to the insulin domain A8--A10 and most likely by interacting with the hydrophobic side chains of the dimer-forming part of the insulin B-chain. Sulfatide has a dual effect on insulin. It substantially reduces deterioration of insulin hexamer crystals at pH 5.5, conferring stability comparable to those in beta cell granules. Sulfatide also mediates the conversion of insulin hexamers to the biological active monomers at neutral pH, the pH at the beta-cell surface. Finally, we report that inhibition of sulfatide synthesis with chloroquine and fumonisine B1 leads to inhibition of insulin granule formation in vivo. Our observations suggest that sulfatide plays a key role in the folding of proinsulin, in the maintenance of insulin structure, and in the monomerization process.

Apparent competition and native consumers exacerbate the strong competitive effect of an exotic plant species.

Science.gov (United States)

Orrock, John L; Dutra, Humberto P; Marquis, Robert J; Barber, Nicholas

2015-04-01

Direct and indirect effects can play a key role in invasions, but experiments evaluating both are rare. We examined the roles of direct competition and apparent competition by exotic Amur honeysuckle (Lonicera maackii) by manipulating (1) L. maackii vegetation, (2) presence of L. maackii fruits, and (3) access to plants by small mammals and deer. Direct competition with L. maackii reduced the abundance and richness of native and exotic species, and native consumers significantly reduced the abundance and richness of native species. Although effects of direct competition and consumption were more pervasive, richness of native plants was also reduced through apparent competition, as small-mammal consumers reduced richness only when L. maackii fruits were present. Our experiment reveals the multiple, interactive pathways that affect the success and impact of an invasive exotic plant: exotic plants may directly benefit from reduced attack by native consumers, may directly exert strong competitive effects on native plants, and may also benefit from apparent competition.

Atmospheric tritium concentration in the different chemical forms

International Nuclear Information System (INIS)

Akata, Naofumi; Kakiuchi, Hideki; Hisamatsu, Shun'ichi; Shima, Nagayoshi

2012-01-01

This study aimed at obtaining background tritium concentrations in air at Rokkasho where the first commercial spent nuclear fuel reprocessing plant in Japan has been under construction. Atmospheric tritium was operationally separated into HTO, HT and hydrocarbon (CH 3 T) fractions, and analyzed for the samples collected every 3 d to 14 d during fiscal year 2005. The HT concentration was the highest among the chemical forms analyzed, followed by the HTO and CH 3 T concentrations. The HT and CH 3 T concentrations did not have clear seasonal variation patterns through the HTO concentrations in spring were higher than those in summer. The HT concentration followed the decline previously reported by Mason and Östlund with an apparent half-life of 4.8 y. The apparent and environmental half-lives of CH 3 T were estimated as 9.2 y and 36.5 y, respectively, by combining the present data with literature data. The Intergovernmental Panel on Climate Change used the atmospheric lifetime of 12 y for CH 4 to estimate global warming in its 2007 report. The longer environmental half-life of CH 3 T suggested its supply from other sources than past nuclear weapon testing in the atmosphere. (author)

Short form of Demodex species mite in the dog: occurrence and measurements.

Science.gov (United States)

Chesney, C J

1999-02-01

A form of Demodex species mite shorter in length than Demodex canis was found in six consecutive cases of canine demodicosis. The mean length of the parasite was 122.6 microns (SD 12.0 microns, 39 mites counted), significantly shorter than either male or female forms of D canis (P < 0.0001). The proportion of short to long mites in each case varied from 0.5 to 22 per 100. In young dogs, skin signs associated with the presence of mites were first noted after about seven months, while in the oldest subject the disease became apparent at 10 years of age. This form of mite has now been found in four countries over three continents, the findings suggesting that it is not uncommon and is acquired in puppyhood, although it may be carried unnoticed for many years.

Apparent quasar disc sizes in the "bird's nest" paradigm

Science.gov (United States)

Abolmasov, P.

2017-04-01

Context. Quasar microlensing effects make it possible to measure the accretion disc sizes around distant supermassive black holes that are still well beyond the spatial resolution of contemporary instrumentation. The sizes measured with this technique appear inconsistent with the standard accretion disc model. Not only are the measured accretion disc sizes larger, but their dependence on wavelength is in most cases completely different from the predictions of the standard model. Aims: We suggest that these discrepancies may arise not from non-standard accretion disc structure or systematic errors, as it was proposed before, but rather from scattering and reprocession of the radiation of the disc. In particular, the matter falling from the gaseous torus and presumably feeding the accretion disc may at certain distances become ionized and produce an extended halo that is free from colour gradients. Methods: A simple analytical model is proposed assuming that a geometrically thick translucent inflow acts as a scattering mirror changing the apparent spatial properties of the disc. This inflow may be also identified with the broad line region or its inner parts. Results: Such a model is able to explain the basic properties of the apparent disc sizes, primarily their large values and their shallow dependence on wavelength. The only condition required is to scatter a significant portion of the luminosity of the disc. This can easily be fulfilled if the scattering inflow has a large geometrical thickness and clumpy structure.

Apparent temperature and cause-specific emergency hospital admissions in Greater Copenhagen, Denmark

DEFF Research Database (Denmark)

Wichmann, Janine; Andersen, Zorana; Ketzel, Matthias

2011-01-01

One of the key climate change factors, temperature, has potentially grave implications for human health. We report the first attempt to investigate the association between the daily 3-hour maximum apparent temperature (Tapp(max)) and respiratory (RD), cardiovascular (CVD), and cerebrovascular (CBD...

Concurrent temporal stability of the apparent electrical conductivity and soil water content

Science.gov (United States)

Knowledge of spatio-temporal soil water content (SWC) variability within agricultural fields is useful to improve crop management. Spatial patterns of soil water contents can be characterized using the temporal stability analysis, however high density sampling is required. Soil apparent electrical c...

Development of methodology to evaluate microbially influenced degradation of cement-solidified low-level radioactive waste forms

International Nuclear Information System (INIS)

Rogers, R.D.; Hamilton, M.A.; Veeh, R.H.; McConnell, J.W.

1994-01-01

Because of its apparent structural integrity, cement has been widely used in the United States as a binder to solidify Class B and C low-level radioactive waste (LLW). However, the resulting cement preparations are susceptible to failure due to the actions of stress and environment. An environmentally mediated process that could affect cement stability is the action of naturally occurring microorganisms. The US Nuclear Regulatory Commission (NRC), recognizing this eventuality, stated that the effects of microbial action on waste form integrity must be addressed. This paper provides present results from an ongoing program that addresses the effects of microbially influenced degradation (MID) on cement-solidified LLW. Data are provided on the development of an evaluation method using acid-producing bacteria. Results are from work with one type of these bacteria, the sulfur-oxidizing Thiobacillus. This work involved the use of a system in which laboratory- and vendor-manufactured, simulated waste forms were exposed on an intermittent basis to media containing thiobacilli. Testing demonstrated that MID has the potential to severely compromise the structural integrity of ion-exchange resin and evaporator-bottoms waste that is solidified with cement. In addition, it was found that a significant percentage of calcium and other elements were leached from the treated waste forms. Also, the surface pH of the treated specimens decreased to below 2. These conditions apparently contributed to the physical deterioration of simulated waste forms after 60 days of exposure to the thiobacilli

Measurement of Apparent Thermal Conductivity of JSC-1A Under Ambient Pressure

Science.gov (United States)

Yuan, Zeng-Guang; Kleinhenz, Julie E.

2011-01-01

The apparent thermal conductivity of JSC-1A lunar regolith simulant was measured experimentally using a cylindrical apparatus. Eleven thermocouples were embedded in the simulant bed to obtain the steady state temperature distribution at various radial, axial, and azimuthal locations. The high aspect ratio of a cylindrical geometry was proven to provide a one-dimensional, axisymmetric temperature field. A test series was performed at atmospheric pressure with varying heat fluxes. The radial temperature distribution in each test fit a logarithmic function, indicating a constant thermal conductivity throughout the soil bed. However, thermal conductivity was not constant between tests at different heat fluxes. This variation is attributed to stresses created by thermal expansion of the simulant particles against the rigid chamber wall. Under stress-free conditions (20 deg C), the data suggest a temperature independent apparent conductivity of 0.1961 +/- 0.0070 W/m/ deg C

A Case of Apparent Contact Dermatitis Caused by Toxocara Infection

Directory of Open Access Journals (Sweden)

Rosanna Qualizza

2014-01-01

Full Text Available Infection from Toxocara species may give rise to a large array of clinical symptoms, including apparent manifestations of allergy such as asthma, urticaria/angioedema, and dermatitis. We report a case, thus far not described, of contact dermatitis attributed to nickel allergy but caused by Toxocara infection. The patient was a 53-year-old woman presenting from 10 years a dermatitis affecting head, neck, and thorax. Patch tests initially performed gave a positive result to nickel, but avoidance of contact with nickel did not result in recovery. The patient referred to our Allergy Service in 2010 because of dermatitis to feet. Patch testing confirmed the positive result for nickel, but expanding the investigation a positive result for IgG antibodies to Toxocara was detected by Western blotting and ELISA. Treatment with mebendazole achieved immediate efficacy on feet dermatitis. Then, two courses of treatment with albendazole resulted in complete regression of dermatitis accompanied by development of negative ELISA and Western blotting for Toxocara antibodies. This report adds another misleading presentation of Toxocara infection as apparent contact dermatitis caused by nickel and suggests bearing in mind, in cases of contact dermatitis not responding to avoidance of the responsible hapten and to medical treatment, the possible causative role of Toxocara.

Prevalence of upper airway obstruction in patients with apparently asymptomatic euthyroid multi nodular goitre

Directory of Open Access Journals (Sweden)

Sunil K Menon

2011-01-01

Full Text Available Aims: To study the prevalence of upper airway obstruction (UAO in "apparently asymptomatic" patients with euthyroid multinodular goitre (MNG and find correlation between clinical features, UAO on pulmonary function test (PFT and tracheal narrowing on computerised tomography (CT. Materials and Methods: Consecutive patients with apparently asymptomatic euthyroid MNG attending thyroid clinic in a tertiary centre underwent clinical examination to elicit features of UAO, PFT, and CT of neck and chest. Statistical Analysis Used: Statistical analysis was done with SPSS version 11.5 using paired t-test, Chi square test, and Fisher′s exact test. P value of <0.05 was considered to be significant. Results: Fifty-six patients (52 females and four males were studied. The prevalence of UAO (PFT and significant tracheal narrowing (CT was 14.3%. and 9.3%, respectively. Clinical features failed to predict UAO or significant tracheal narrowing. Tracheal narrowing (CT did not correlate with UAO (PFT. Volume of goitre significantly correlated with degree of tracheal narrowing. Conclusions: Clinical features do not predict UAO on PFT or tracheal narrowing on CT in apparently asymptomatic patients with euthyroid MNG.

Prevalence of upper airway obstruction in patients with apparently asymptomatic euthyroid multi nodular goitre

Science.gov (United States)

Menon, Sunil K.; Jagtap, Varsha S.; Sarathi, Vijaya; Lila, Anurag R.; Bandgar, Tushar R.; Menon, Padmavathy S; Shah, Nalini S.

2011-01-01

Aims: To study the prevalence of upper airway obstruction (UAO) in “apparently asymptomatic” patients with euthyroid multinodular goitre (MNG) and find correlation between clinical features, UAO on pulmonary function test (PFT) and tracheal narrowing on computerised tomography (CT). Materials and Methods: Consecutive patients with apparently asymptomatic euthyroid MNG attending thyroid clinic in a tertiary centre underwent clinical examination to elicit features of UAO, PFT, and CT of neck and chest. Statistical Analysis Used: Statistical analysis was done with SPSS version 11.5 using paired t-test, Chi square test, and Fisher's exact test. P value of <0.05 was considered to be significant. Results: Fifty-six patients (52 females and four males) were studied. The prevalence of UAO (PFT) and significant tracheal narrowing (CT) was 14.3%. and 9.3%, respectively. Clinical features failed to predict UAO or significant tracheal narrowing. Tracheal narrowing (CT) did not correlate with UAO (PFT). Volume of goitre significantly correlated with degree of tracheal narrowing. Conclusions: Clinical features do not predict UAO on PFT or tracheal narrowing on CT in apparently asymptomatic patients with euthyroid MNG. PMID:21966649

Functional ecomorphology: Feedbacks between form and function in fluvial landscape ecosystems

Science.gov (United States)

Fisher, Stuart G.; Heffernan, James B.; Sponseller, Ryan A.; Welter, Jill R.

2007-09-01

The relationship between form and function has been a central organizing principle in biology throughout its history as a formal science. This concept has been relevant from molecules to organisms but loses meaning at population and community levels where study targets are abstract collectives and assemblages. Ecosystems include organisms and abiotic factors but ecosystem ecology too has developed until recently without a strong spatially explicit reference. Landscape ecology provides an opportunity to once again anneal form and function and to consider reciprocal causation between them. This ecomorphologic view can be applied at a variety of ecologically relevant scales and consists of an investigation of how geomorphology provides a structural template that shapes, and is shaped by ecological processes. Running water ecosystems illustrate several principles governing the interaction of landscape form and ecological function subsumed by the concept of "Functional Ecomorphology". Particularly lucrative are ecosystem-level interactions between geologic form and biogeochemical processes integrated by hydrologic flowpaths. While the utility of a flowpath-based approach is most apparent in streams, spatially explicit biogeochemical processing pervades all landscapes and may be of general ecological application.

Effects of a 6-phytase on the apparent ileal digestibility of minerals and amino acids in ileorectal anastomosed pigs fed on a corn-soybean meal-barley diet.

Science.gov (United States)

Guggenbuhl, P; Waché, Y; Simoes Nunes, C; Fru, F

2012-12-01

Phosphorus of plant-based feedstuffs for monogastric animals is mainly in the form of phytic P, which has a very low bioavailability. The nondigested phytic P may contribute to P pollution. Furthermore, phytic acid may reduce digestibility of other minerals and protein. This study evaluated effects of the microbial 6-phytase RONOZYME HiPhos on apparent ileal digestibility of P, phytic acid, Ca, CP, energy, and AA in six 60-d-old ileorectal anastomosed pigs. In a duplicated 3 × 3 Latin square design, pigs had free access to alternatively a corn (Zea mays)-soybean (Glycine max) meal-barley (Hordeum vulgare)-based diet or this diet supplemented with RONOZYME HiPhos at either 500 units/kg (RH500) or 1000 units/kg (RH1000). Pigs fed diets supplemented with RH500 or RH1000 increased (P phytase increased apparent ileal digestibility of these indispensable minerals and phytate. The phytase increased digestibility of CP and indispensable AA indicating a better availability of plant-based proteins.

Stewart analysis of apparently normal acid-base state in the critically ill

NARCIS (Netherlands)

Moviat, M.; Boogaard, M. van den; Intven, F.; Voort, P. van der; Hoeven, H. van der; Pickkers, P.

2013-01-01

PURPOSE: This study aimed to describe Stewart parameters in critically ill patients with an apparently normal acid-base state and to determine the incidence of mixed metabolic acid-base disorders in these patients. MATERIALS AND METHODS: We conducted a prospective, observational multicenter study of

Serum high molecular weight complex of adiponectin correlates better with glucose tolerance than total serum adiponectin in Indo-Asian males.

Science.gov (United States)

Fisher, F F M; Trujillo, M E; Hanif, W; Barnett, A H; McTernan, P G; Scherer, P E; Kumar, S

2005-06-01

It is well established that total systemic adiponectin is reduced in type 2 diabetic subjects. To date most studies have been concerned with the singular full-length protein or proteolytically cleaved globular domain. It is, however, apparent that the native protein circulates in serum as a lower molecular weight hexamer and as larger multimeric structures of high molecular weight (HMW). In this study we address the clinical significance of each form of the protein with respect to glucose tolerance. Serum was obtained from 34 Indo-Asian male subjects (BMI 26.5+/-3.1; age 52.15+/-10.14 years) who had undertaken a 2-h oral glucose tolerance test. An aliquot of serum was fractionated using velocity sedimentation followed by reducing SDS-PAGE. Western blots were probed for adiponectin, and HMW adiponectin as a percentage of total adiponectin (percentage of higher molecular weight adiponectin [S(A)] index) was calculated from densitometry readings. Total adiponectin was measured using ELISA; leptin, insulin and IL-6 were determined using ELISA. Analysis of the cohort demonstrated that total adiponectin (r = 0.625, p = 0.0001), fasting insulin (r = -0.354, p = 0.040) and age (r = 0.567, p = 0.0001) correlated with S(A). S(A) showed a tighter, inverse correlation with 2-h glucose levels (r = -0.58, p = 0.0003) than total adiponectin (r = -0.38, p = 0.0001). This study demonstrates the importance of the S(A) index as a better determinant of glucose intolerance than measurements of total adiponectin. Our findings suggest that HMW adiponectin is the active form of the protein.

Apparent diffusion coefficient measurements in progressive supranuclear palsy

Energy Technology Data Exchange (ETDEWEB)

Ohshita, T.; Oka, M.; Imon, Y.; Yamaguchi, S.; Mimori, Y.; Nakamura, S. [Hiroshima Univ. (Japan). School of Medicine

2000-09-01

We measured the apparent diffusion coefficient (ADC), using diffusion-weighted imaging (DWI) and signal intensity on T2-weighted MRI in the cerebral white matter of patients with progressive supranuclear palsy (PSP) and age-matched normal subjects. In PSP, ADC in the prefrontal and precentral white matter was significantly higher than in controls. There was no significant difference in signal intensity on T2-weighted images. The ADC did correlate with signal intensity. The distribution of the elevation of ADC may be the consequence of underlying pathological changes, such as neurofibrillary tangles or glial fibrillary tangles in the cortex. Our findings suggest that ADC measurement might be useful for demonstrating subtle neuropathological changes. (orig.)

Descriptions of four larval forms of Nilodosis Kieffer from East Asia

Directory of Open Access Journals (Sweden)

Hongqu Tang

2012-10-01

Full Text Available Larval material putatively assigned to the genus Nilodosis Kieffer from Korea, China and Japan has been compared. The results show that the Japanese larval form has the club- to balloon-shaped cephalic setae S7 and S9 in common with the Korean larval form, but it can be separated from the latter by the shape of the inner mandibular teeth and the premandibular teeth. The larval forms from China (Guangdong and Yunnan apparently consist of two independent species. It is most likely that there will be more species in this genus found in Asia. Larvae are mud-sandy bottom-dwellers that can occur in the littoral of lakes and the potamal of larger rivers, up to a maximum depth of 5 meters. The specific larval characters show that it probably is a semi-psammorheophilic predator. doi: 10.5324/fn.v31i0.1406.Published online: 17 October 2012. 

Phorbol-ester-induced activation of the NF-κB transcription factor involves dissociation of an apparently cytoplasmic NF-κB/inhibitor complex

International Nuclear Information System (INIS)

Baeuerle, P.A.; Lenardo, M.; Pierce, J.W.; Baltimore, D.

1988-01-01

There is increasing evidence that inducible transcription of genes is mediated through the induction of the activity of trans-acting protein factors. The NF-κB transcription factor provides a model system to study the posttranslational activation of a phorbol-ester-inducible transcription factor. The finding that NF-κB activity is undectable in subcellular fractions from unstimulated cells suggests that NF-κB exists as an inactive precursor. The authors showed that NF-κB is detectable in two different forms. After selective removal of endogenous NF-κB, they demonstrate the existence of a protein inhibitor in cytosolic fractions of unstimulated cells that is able in vitro to convert NF-κB into an inactive desoxycholate-dependent form. The data are consistent with a molecular mechanism of inducible gene expression by which an apparently cytoplasmic transcription factor-inhibitor complex is dissociated by the action of TPA-activated protein kinase C

Apparent CFC and 3H/ 3He age differences in water from Floridan Aquifer springs

Science.gov (United States)

Happell, James D.; Opsahl, Stephen; Top, Zafer; Chanton, Jeffrey P.

2006-03-01

The apparent CFC-11, -12 and -113 ages of Upper Floridan Aquifer water discharged from 31 springs located in Florida and Georgia ranged from 11 to 44 years when samples were collected in 2002 and 2003. Apparent 3H/ 3He ages in these springs ranged from 12 to 66 years. Some of the springs sampled did not yield valid CFC ages because one or more of the CFCs were contaminated by non-atmospheric sources. Of the 31 springs sampled, six were contaminated with all three CFCs and nine were contaminated with one or two CFCs. Of the remaining 16 springs, the CFC distributions of four could be modeled assuming a single source of water, and 11 were best modeled by assuming two sources of water, with one of the water sources >60 years old. The CFC and 3H/ 3He apparent ages and the simple mixing models applied to these ages suggest that past impacts to the water quality of water recharging the sampled springs may take anywhere from 0 to ˜60 years or more to appear in the discharging spring water. In 27 springs where both 3H/ 3He ages and CFC ages were available, five springs gave similar results between the two techniques, while in the other 22 cases the 3H/ 3He apparent ages were 8-40 years greater than the CFC ages. Large excesses of 4He were observed in many of the springs, consistent with a source of older water. This older water may also carry an additional and unaccounted for source of 3He, which may be responsible for the greater 3H/ 3He ages relative to the CFC ages. We believe that the large excess 3He and 4He values and apparent age differences are related to regional climate variations because our samples were obtained at the end of a 4-year drought.

Des apparences fantasmées dans les fabliaux érotiques

Directory of Open Access Journals (Sweden)

Sophie Poitral

2008-08-01

Full Text Available Résumé : Composés de la fin du XIIe siècle au XIVe siècle, les fabliaux érotiques posent la question du corps et de son langage. Ses composantes - vêtement, physionomie, allure et gestuelle - participent à la duperie qui caractérise bien souvent l’univers des fabliaux. L’analyse des emplois de l’apparence dans quelques fabliaux érotiques français, aux auteurs anonymes ou connus, permet de définir le rôle central des apparences dans les stratagèmes mis en œuvre et montre la richesse des enjeux du paraître dans l’érotisme occidental du Moyen Âge : le travestissement sexuel est traité de manières différentes selon les sexes. L’apparence féminine de l’homme leurre le mari et permet à la femme rusée de commettre l’adultère, tandis que la femme travestie en homme soulève la question du pouvoir et du sexe dans la relation conjugale et dans la société. D’autre part, le déguisement parodique masque l’identité de celui qui trompe par ses faux-semblants et accumule les situations carnavalesques qui tournent à l’avantage de l’imposteur. Le mirage érotique met quant à lui en question le regard du voyeur, victime d’une illusion d’optique, et enfin le langage métamorphose l’apparence des organes sexuels, aux dépens des jeunes filles innocentes.Abstract : Analysing fantasised appearances in erotic fabliaux Erotic fabliaux, poems composed from the late 12th to the 14th century, bring into focus the question of the body and its language. Its various constituents - clothes, physionomy, bearing and body movements - all contribute to producing the deceit which is so characteristic of the world of fabliaux. Analysing how looks are exploited in a couple of French fabliaux both by unknown or renowned writers enables us better to define the key function of looks in the various strategies thus developed and to see just how complex and fundamental questions of aspect are in medieval western eroticism

Apparent molar volumes and compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates in dimethylsulfoxide

International Nuclear Information System (INIS)

Warmińska, Dorota; Wawer, Jarosław

2012-01-01

Highlights: ► Sequence of volumes and compressibilities of Ln 3+ ions in DMSO is: La 3+ > Gd 3+ 3+ . ► Sequence of the partial molar volumes do not change with temperature. ► These results are the consequence of nature of the ion–solvent bonding. - Abstract: Temperature dependencies of the densities of dimethylsulfoxide solutions of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been determined over a wide range of concentrations. The apparent molar volumes and partial molar volumes of the salts at infinite dilution, as well as the expansibilities of the salts, have been calculated from density data. Additionally, the apparent molar isentropic compressibilities of lanthanum, gadolinium and lutetium trifluoromethanesulfonates have been calculated from sound velocity data at 298.15 K. The data obtained have been interpreted in terms of ion−solvent interactions.

Gels with exceptional thermal stability formed by bis(amino acid) oxalamide gelators and solvents of low polarity.

Science.gov (United States)

Makarević, Janja; Jokić, Milan; Frkanec, Leo; Katalenić, Darinka; Zinić, Mladen

2002-10-07

Some bis (amino acid) oxalamide gelators form common thermo-reversible gels with various organic solvents but also gels of exceptional thermal stability with some solvents of medium and low polarity; the latter gels can be heated up to 50 degrees C higher temperatures than the bp of the solvent without apparent gel-to-sol transition.

Origin Licensing Requires ATP Binding and Hydrolysis by the MCM Replicative Helicase

Science.gov (United States)

Coster, Gideon; Frigola, Jordi; Beuron, Fabienne; Morris, Edward P.; Diffley, John F.X.

2014-01-01

Summary Loading of the six related Minichromosome Maintenance (MCM) proteins as head-to-head double hexamers during DNA replication origin licensing is crucial for ensuring once-per-cell-cycle DNA replication in eukaryotic cells. Assembly of these prereplicative complexes (pre-RCs) requires the Origin Recognition Complex (ORC), Cdc6, and Cdt1. ORC, Cdc6, and MCM are members of the AAA+ family of ATPases, and pre-RC assembly requires ATP hydrolysis. Here we show that ORC and Cdc6 mutants defective in ATP hydrolysis are competent for origin licensing. However, ATP hydrolysis by Cdc6 is required to release nonproductive licensing intermediates. We show that ATP binding stabilizes the wild-type MCM hexamer. Moreover, by analyzing MCM containing mutant subunits, we show that ATP binding and hydrolysis by MCM are required for Cdt1 release and double hexamer formation. This work alters our view of how ATP is used by licensing factors to assemble pre-RCs. PMID:25087873

The ATPase of the phi29 DNA packaging motor is a member of the hexameric AAA+ superfamily.

Science.gov (United States)

Schwartz, Chad; De Donatis, Gian Marco; Fang, Huaming; Guo, Peixuan

2013-08-15

The AAA+ superfamily of proteins is a class of motor ATPases performing a wide range of functions that typically exist as hexamers. The ATPase of phi29 DNA packaging motor has long been a subject of debate in terms of stoichiometry and mechanism of action. Here, we confirmed the stoichiometry of phi29 motor ATPase to be a hexamer and provide data suggesting that the phi29 motor ATPase is a member of the classical hexameric AAA+ superfamily. Native PAGE, EMSA, capillary electrophoresis, ATP titration, and binomial distribution assay show that the ATPase is a hexamer. Mutations in the known Walker motifs of the ATPase validated our previous assumptions that the protein exists as another member of this AAA+ superfamily. Our data also supports the finding that the phi29 DNA packaging motor uses a revolution mechanism without rotation or coiling (Schwartz et al., this issue). Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.

The effect of probe choice and solution conditions on the apparent photoreactivity of dissolved organic matter.

Science.gov (United States)

Maizel, Andrew C; Remucal, Christina K

2017-08-16

Excited triplet states of dissolved organic matter ( 3 DOM) are quantified directly with the species-specific probes trans,trans-hexadienoic acid (HDA) and 2,4,6-trimethylphenol (TMP), and indirectly with the singlet oxygen ( 1 O 2 ) probe furfuryl alcohol (FFA). Although previous work suggests that these probe compounds may be sensitive to solution conditions, including dissolved organic carbon concentration ([DOC]) and pH, and may quantify different 3 DOM subpopulations, the probes have not been systematically compared. Therefore, we quantify the apparent photoreactivity of diverse environmental waters using HDA, TMP, and FFA. By conducting experiments under ambient [DOC] and pH, with standardized [DOC] and pH, and with solid phase extraction isolates, we demonstrate that much of the apparent dissimilarity in photochemical measurements is attributable to solution conditions, rather than intrinsic differences in 3 DOM production. In general, apparent quantum yields (Φ 1 O 2 ≥ Φ 3 DOM,TMP ≫ Φ 3 DOM,HDA ) and pseudo-steady state concentrations ([ 1 O 2 ] ss > [ 3 DOM] ss,TMP > [ 3 DOM] ss,HDA ) show consistent relationships in all waters under standardized conditions. However, intrinsic differences in 3 DOM photoreactivity are apparent between DOM from diverse sources, as seen in the higher Φ 1 O 2 and lower Φ 3 DOM,TMP of wastewater effluents compared with oligotrophic lakes. Additionally, while conflicting trends in photoreactivity are observed under ambient conditions, all probes observe quantum yields increasing from surface wetlands to terrestrially influenced waters to oligotrophic lakes under standardized conditions. This work elucidates how probe selection and solution conditions influence the apparent photoreactivity of environmental waters and confirms that 3 DOM or 1 O 2 probes cannot be used interchangeably in waters that vary in [DOC], pH, or DOM source.

Interactions between masculinity--femininity and apparent health in face preferences

OpenAIRE

Finlay G. Smith; Benedict C. Jones; Lisa M. DeBruine; Anthony C. Little

2009-01-01

Consistent with Getty's (2002. Signaling health versus parasites. Am Nat. 159:363--371.) proposal that cues to long-term health and cues to current condition are at least partly independent, recent research on human face preferences has found divergent effects of masculinity--femininity, a cue to long-term health, and apparent health, a cue to current condition. In light of this, we tested for interactions between these 2 cues. Participants viewed composite images of opposite-sex faces that h...

Unagreement is an Illusion: Apparent person mismatches and nominal structure

OpenAIRE

Höhn, Georg F.K.

2015-01-01

This is the author accepted manuscript. The final version is available from Springer via http://dx.doi.org/10.1007/s11049-015-9311-y This paper proposes an analysis of unagreement, a phenomenon involving an apparent mismatch between a definite third person plural subject and first or second person plural subject agreement observed in various null subject languages (e.g. Spanish, Modern Greek and Bulgarian), but notoriously absent in others (e.g. Italian, European Portuguese). A cross-lingu...

Modeling a space-variant cortical representation for apparent motion.

Science.gov (United States)

Wurbs, Jeremy; Mingolla, Ennio; Yazdanbakhsh, Arash

2013-08-06

Receptive field sizes of neurons in early primate visual areas increase with eccentricity, as does temporal processing speed. The fovea is evidently specialized for slow, fine movements while the periphery is suited for fast, coarse movements. In either the fovea or periphery discrete flashes can produce motion percepts. Grossberg and Rudd (1989) used traveling Gaussian activity profiles to model long-range apparent motion percepts. We propose a neural model constrained by physiological data to explain how signals from retinal ganglion cells to V1 affect the perception of motion as a function of eccentricity. Our model incorporates cortical magnification, receptive field overlap and scatter, and spatial and temporal response characteristics of retinal ganglion cells for cortical processing of motion. Consistent with the finding of Baker and Braddick (1985), in our model the maximum flash distance that is perceived as an apparent motion (Dmax) increases linearly as a function of eccentricity. Baker and Braddick (1985) made qualitative predictions about the functional significance of both stimulus and visual system parameters that constrain motion perception, such as an increase in the range of detectable motions as a function of eccentricity and the likely role of higher visual processes in determining Dmax. We generate corresponding quantitative predictions for those functional dependencies for individual aspects of motion processing. Simulation results indicate that the early visual pathway can explain the qualitative linear increase of Dmax data without reliance on extrastriate areas, but that those higher visual areas may serve as a modulatory influence on the exact Dmax increase.

Apparent soil electrical conductivity in two different soil types

Directory of Open Access Journals (Sweden)

Wilker Nunes Medeiros

Full Text Available ABSTRACT Mapping the apparent soil electrical conductivity (ECa has become important for the characterization of the soil variability in precision agriculture systems. Could the ECa be used to locate the soil sampling points for mapping the chemical and physical soil attributes? The objective of this work was to examine the relations between ECa and soil attributes in two fields presenting different soil textures. In each field, 50 sampling points were chosen using a path that presented a high variability of ECa obtained from a preliminary ECa map. At each sampling point, the ECa was measured in soil depths of 0-20, 0-40 and 0-60 cm. In addition, at each point, soil samples were collected for the determination of physical and chemical attributes in the laboratory. The ECa data obtained for different soil depths was very similar. A large number of significant correlations between ECa and the soil attributes were found. In the sandy clay loam texture field there was no correlation between ECa and organic matter or between ECa and soil clay and sand content. However, a significant positive correlation was shown for the remaining phosphorus. In the sandy loam texture field the ECa had a significant positive correlation with clay content and a significant negative correlation with sand content. The results suggest that the mapping of apparent soil electrical conductivity does not replace traditional soil sampling, however, it can be used as information to delimit regions in a field that have similar soil attributes.

A chromogranin A ELISA absent of an apparent high-dose hook effect observed in other chromogranin A ELISAs.

Science.gov (United States)

Erickson, J Alan; Grenache, David G

2016-01-15

Routine testing for chromogranin A (CgA) using an established commercial ELISA revealed an apparent high-dose hook effect in approximately 15% of specimens. Investigations found the same effect in two additional ELISAs. We hypothesized that a CgA derived peptide(s) at high concentrations was responsible but experiments were inconclusive. Here we describe the analytical performance characteristics of the Chromoa™ CgA ELISA that did not display the apparent high-dose hook effect. Performance characteristics of the Chromoa ELISA were assessed. The reference interval was established utilizing healthy volunteers. Specimens producing the apparent high-dose hook effect in other assays were evaluated using the Chromoa ELISA. The limit of detection was 8ng/ml. Linearity was acceptable (slope=1.04, intercept=18.1 and r(2)=0.997). CVs were ≤4.6 and ≤9.3% for repeatability and within-laboratory imprecision, respectively. CgA was stable at ambient and refrigerated temperatures for a minimum of two and 14days, respectively. An upper reference interval limit of 95ng/ml was established. Specimens demonstrating the apparent high-dose hook effect in other ELISAs did not exhibit the phenomenon using the Chromoa ELISA. The Chromoa ELISA demonstrates acceptable performance for quantifying serum CgA. The apparent high-dose hook effect exhibited in other ELISAs was absent using the Chromoa assay. Copyright © 2015 Elsevier B.V. All rights reserved.

Contrast configuration influences grouping in apparent motion.

Science.gov (United States)

Ma-Wyatt, Anna; Clifford, Colin W G; Wenderoth, Peter

2005-01-01

We investigated whether the same principles that influence grouping in static displays also influence grouping in apparent motion. Using the Ternus display, we found that the proportion of group motion reports was influenced by changes in contrast configuration. Subjects made judgments of completion of these same configurations in a static display. Generally, contrast configurations that induced a high proportion of group motion responses were judged as more 'complete' in static displays. Using a stereo display, we then tested whether stereo information and T-junction information were critical for this increase in group motion. Perceived grouping was consistently higher for same contrast polarity configurations than for opposite contrast polarity configurations, regardless of the presence of stereo information or explicit T-junctions. Thus, while grouping in static and moving displays showed a similar dependence on contrast configuration, motion grouping showed little dependence on stereo or T-junction information.

Apparent CPT violation in neutrino oscillation experiments

International Nuclear Information System (INIS)

Engelhardt, Netta; Nelson, Ann E.; Walsh, Jonathan R.

2010-01-01

We consider searching for light sterile fermions and new forces by using long baseline oscillations of neutrinos and antineutrinos. A new light sterile state and/or a new force can lead to apparent CPT violation in muon neutrino and antineutrino oscillations. As an example, we present an economical model of neutrino masses containing a sterile neutrino. The potential from the standard model weak neutral current gives rise to a difference between the disappearance probabilities of neutrinos and antineutrinos, when mixing with a light sterile neutrino is considered. The addition of a B-L interaction adds coherently to the neutrino current potential and increases the difference between neutrino and antineutrino disappearance. We find that this model can improve the fit to the results of MINOS for both neutrinos and antineutrinos, without any CPT violation, and that the regions of parameter space which improve the fit are within experimental constraints.

Role of Rhinovirus C in Apparently Life-Threatening Events in Infants, Spain

Science.gov (United States)

García, M. Luz; Pozo, Francisco; Reyes, Noelia; Pérez-Breña, Pilar; Casas, Inmaculada

2009-01-01

To assess whether infants hospitalized after an apparently life-threatening event had an associated respiratory virus infection, we analyzed nasopharyngeal aspirates from 16 patients. Nine of 11 infants with positive virus results were infected by rhinoviruses. We detected the new genogroup of rhinovirus C in 6 aspirates. PMID:19788827

Apparent clusters of childhood lymphoid malignancy in Northern England

International Nuclear Information System (INIS)

Craft, A.W.; Openshaw, S.; Birch, J.

1984-01-01

The authors have reanalysed their previous data on the incidence of childhood malignancy in the North of England by very small geographical areas. Seascale, which ranks first by Poisson probability for all lymphoid malignancies is the village closest to the Sellafield plant. However, it is not unique in the region; nor are wards of apparent excess confined to coastal areas of Cumbria. The highest rate of lymphoid malignancies is in Whittingham, a village in north Northumberland. For other varieties of childhood cancer, there is a similar spread of 'Highly ranked', but different, wards throughout the region. (U.K.)

Use of apparent thickness for preprocessing of low-frequency electromagnetic data in inversion-based multibarrier evaluation workflow

Science.gov (United States)

Omar, Saad; Omeragic, Dzevat

2018-04-01

The concept of apparent thicknesses is introduced for the inversion-based, multicasing evaluation interpretation workflow using multifrequency and multispacing electromagnetic measurements. A thickness value is assigned to each measurement, enabling the development of two new preprocessing algorithms to remove casing collar artifacts. First, long-spacing apparent thicknesses are used to remove, from the pipe sections, artifacts ("ghosts") caused by the transmitter crossing a casing collar or corrosion. Second, a collar identification, localization, and assignment algorithm is developed to enable robust inversion in collar sections. Last, casing eccentering can also be identified on the basis of opposite deviation of short-spacing phase and magnitude apparent thicknesses from the nominal value. The proposed workflow can handle an arbitrary number of nested casings and has been validated on synthetic and field data.

Détection précoce du cancer de la prostate chez des apparentés de ...

African Journals Online (AJOL)

B. Fall

de consentement éclairé leur a été remis et le dépistage effectué. Les apparentés qui n'avaient pas respecté le rendez-vous étaient recon- tactés par téléphone pour fixer un autre rendez-vous. Si après 3 tentatives l'apparenté ne se présentait pas au rendez-vous nous arrê- tions de l'appeler. Sur les 145 cas de cancer de ...

Osmotic and apparent molar properties of binary mixtures alcohol+1-butyl-3-methylimidazolium trifluoromethanesulfonate ionic liquid

OpenAIRE

Emilio Gomez; Noelia Simón; Ángeles Domínguez; Maria Eugénia Macedo

2013-01-01

In this work, physical properties (densities and speeds of sound) for the binary systems {1-propanol, or 2-propanol, or 1-butanol, or 2-butanol, or 1-pentanol + 1-butyl-3-methylimidazolium trifluoromethanesulfonate} were experimentally measured from T = (293.15 to 323.15) K and at atmospheric pressure. These data were used to calculate the apparent molar volume and apparent molar isentropic compression which were fitted to a Redlich-Meyer type equation. This fit was used to obtain the corresp...

Efficiency of Transcription from Promoter Sequence Variants in Lactobacillus Is Both Strain and Context Dependent

OpenAIRE

McCracken, Andrea; Timms, Peter

1999-01-01

The introduction of consensus −35 (TTGACA) and −10 (TATAAT) hexamers and a TG motif into the Lactobacillus acidophilus ATCC 4356 wild-type slpA promoter resulted in significant improvements (4.3-, 4.1-, and 10.7-fold, respectively) in transcriptional activity in Lactobacillus fermentum BR11. In contrast, the same changes resulted in decreased transcription in Lactobacillus rhamnosus GG. The TG motif was shown to be important in the context of weak −35 and −10 hexamers (L. fermentum BR11) or a...

Apparent survival rates of forest birds in eastern Ecuador revisited: improvement in precision but no change in estimates.

Directory of Open Access Journals (Sweden)

John G Blake

Full Text Available Knowledge of survival rates of Neotropical landbirds remains limited, with estimates of apparent survival available from relatively few sites and species. Previously, capture-mark-recapture models were used to estimate apparent survival of 31 species (30 passerines, 1 Trochilidae from eastern Ecuador based on data collected from 2001 to 2006. Here, estimates are updated with data from 2001-2012 to determine how additional years of data affect estimates; estimates for six additional species are provided. Models assuming constant survival had highest support for 19 of 31 species when based on 12 years of data compared to 27 when based on six; models incorporating effects of transients had the highest support for 12 of 31 species compared to four when based on 12 and six years, respectively. Average apparent survival based on the most highly-supported model (based on model averaging, when appropriate was 0.59 (± 0.02 SE across 30 species of passerines when based on 12 years and 0.57 (± 0.02 when based on six. Standard errors of survival estimates based on 12 years were approximately half those based on six years. Of 31 species in both data sets, estimates of apparent survival were somewhat lower for 13, somewhat higher for 17, and remained unchanged for one; confidence intervals for estimates based on six and 12 years of data overlapped for all species. Results indicate that estimates of apparent survival are comparable but more precise when based on longer-term data sets; standard error of the estimates was negatively correlated with numbers of captures (rs  = -0.72 and recaptures (rs  = -0.93, P<0.001 in both cases. Thus, reasonable estimates of apparent survival may be obtained with relatively few years of data if sample sizes are sufficient.

Apparent quality-of-life in nations : how long and happy people live

NARCIS (Netherlands)

R. Veenhoven (Ruut)

2005-01-01

textabstractQuality-of-life in nations can be measured by how long and happy people live. This is assessed by combining data on life expectancy drawn from civil registration with survey data on subjective enjoyment of life as a whole. This measure of 'apparent' quality-of-life is a good alternative

Apparent competition in canopy trees determined by pathogen transmission rather than susceptibility.

Science.gov (United States)

Richard Cobb; Ross Meentemeyer; David Rizzo

2010-01-01

Epidemiological theory predicts that asymmetric transmission, susceptibility, and mortality within a community will drive pathogen and disease dynamics. These epidemiological asymmetries can result in apparent competition, where a highly infectious host reduces the abundance of less infectious or more susceptible members in a community via a shared pathogen. We show...

The use of n-alkane markers to estimate the intake and apparent ...

African Journals Online (AJOL)

However, the effect of the higher recovery of the dosed marker needs further investigation. The estimates of apparent dry matter digestibility corresponded well with measured values, provided the factor for the incomplete faecal recovery of the internal alkanes was included in the calculation. It was concluded that the alkane ...

Presence of European bat lyssavirus RNas in apparently healthy Rousettus aegyptiacus bats

NARCIS (Netherlands)

Wellenberg, G.J.; Audry, L.; Ronsholt, L.; Poel, van der W.H.M.; Bruschke, C.J.M.; Bourhy, H.

2002-01-01

Apparently healthy Rousettus aegyptiacus bats were randomly chosen from a Dutch colony naturally infected with European bat lyssavirus subgenotype 1a (EBL1a). These bats were euthanised three months after the first evidence of an EBL1a infection in the colony. EBL1a genomic and antigenomic RNAs of

Apparent molar volumes and apparent molar heat capacities of Pr(NO3)3(aq), Gd(NO3)3(aq), Ho(NO3)3(aq), and Y(NO3)3(aq) at T (288.15, 298.15, 313.15, and 328.15) K and p = 0.1 MPa

International Nuclear Information System (INIS)

Hakin, Andrew W.; Liu Jinlian; Erickson, Kristy; Munoz, Julie-Vanessa; Rard, Joseph A.

2005-01-01

Relative densities and relative massic heat capacities have been measured for acidified solutions of Y(NO 3 ) 3 (aq), Pr(NO 3 ) 3 (aq), and Gd(NO 3 ) 3 (aq) at T = (288.15, 298.15, 313.15, and 328.15) K and p = 0.1 MPa. In addition, relative densities and massic heat capacities have been measured at the same temperatures and pressure for Y(NO 3 ) 3 (aq) and Ho(NO 3 ) 3 (aq) solutions without excess acid (n.b. measurements at T = 328.15 K for Ho(NO 3 ) 3 (aq) were not performed due to the limited volume of solution available). Apparent molar volumes and apparent molar heat capacities for the aqueous salt solutions have been calculated from the experimental apparent molar properties of the acidified solutions using Young's rule, whereas the apparent molar properties of the solutions without excess acid were calculated directly from the measured densities and massic heat capacities. The two sets of data for the Y(NO 3 ) 3 (aq) systems provide a check of the internal consistency of the Young's rule approach we have utilised. The concentration dependences of the apparent molar volumes and heat capacities of the aqueous salt solutions have been modelled at each investigated temperature using the Pitzer ion interaction equations to yield apparent molar properties at infinite dilution. Complex formation within the aqueous rare earth nitrate systems is discussed qualitatively by probing the concentration dependence of apparent molar volumes and heat capacities. In spite of the complex formation in the aqueous rare earth nitrate systems, there is a high degree of self-consistency between the apparent molar volumes and heat capacities at infinite dilution reported in this manuscript and those previously reported for aqueous rare earth perchlorates

Apparent molar heat capacities and apparent molar volumes of Pr(ClO4)3(aq), Gd(ClO4)3(aq), Ho(ClO4)3(aq), and Tm(ClO4)3(aq) at T=(288.15, 298.15, 313.15, and 328.15) K and p=0.1 MPa

International Nuclear Information System (INIS)

Hakin, Andrew W.; Lian Liu, Jin; Erickson, Kristy; Munoz, Julie-Vanessa

2004-01-01

Acidified aqueous solutions of Pr(ClO 4 ) 3 (aq), Gd(ClO 4 ) 3 (aq), Ho(ClO 4 ) 3 (aq), and Tm(ClO 4 ) 3 (aq) were prepared from the corresponding oxides by dissolution in dilute perchloric acid. Once characterized with respect to trivalent metal cation and acid content, the relative densities of the solutions were measured at T=(288.15, 298.15, 313.15, and 328.15) K and p=0.1 MPa using a Sodev O2D vibrating tube densimeter. The relative massic heat capacities of the aqueous systems were also determined, under the same temperature and pressure conditions, using a Picker Flow Microcalorimeter. All measurements were made on solutions containing rare earth salt in the concentration range 0.01 ≤ m/(mol · kg -1 ) ≤ 0.2. Relative densities and relative massic heat capacities were used to calculate the apparent molar volumes and apparent molar heat capacities of the acidified salt solutions from which the apparent molar properties of the aqueous salt solutions were extracted by the application of Young's Rule. The concentration dependences of the isothermal apparent molar volumes and heat capacities of each aqueous salt solution were modelled using Pitzer ion-interaction equations. These models produced estimates of apparent molar volumes and apparent molar heat capacities at infinite dilution for each set of isothermal V phi,2 and C pphi,2 values. In addition, the temperature and concentration dependences of the apparent molar volumes and apparent molar heat capacities of the aqueous rare earth perchlorate salt solutions were modelled using modified Pitzer ion-interaction equations. The latter equations utilized the Helgeson, Kirkham, and Flowers equations of state to model the temperature dependences (at p=0.1 MPa) of apparent molar volumes and apparent molar heat capacities at infinite dilution. The results of the latter models were compared to those previously published in the literature. Apparent molar volumes and apparent heat capacities at infinite dilution

Viking-Age Sails: Form and Proportion

Science.gov (United States)

Bischoff, Vibeke

2017-04-01

Archaeological ship-finds have shed much light on the design and construction of vessels from the Viking Age. However, the exact proportions of their sails remain unknown due to the lack of fully preserved sails, or other definite indicators of their proportions. Key Viking-Age ship-finds from Scandinavia—the Oseberg Ship, the Gokstad Ship and Skuldelev 3—have all revealed traces of rigging. In all three finds, the keelson—with the mast position—is preserved, together with fastenings for the sheets and the tack, indicating the breadth of the sail. The sail area can then be estimated based on practical experience of how large a sail the specific ship can carry, in conjunction with hull form and displacement. This article presents reconstructions of the form and dimensions of rigging and sail based on the archaeological finds, evidence from iconographic and written sources, and ethnographic parallels with traditional Nordic boats. When these sources are analysed, not only do the similarities become apparent, but so too does the relative disparity between the archaeological record and the other sources. Preferential selection in terms of which source is given the greatest merit is therefore required, as it is not possible to afford them all equal value.

Apparent temperature and cause-specific mortality in copenhagen, denmark: a case-crossover analysis

DEFF Research Database (Denmark)

Wichmann, Janine; Andersen, Zorana Jovanovic; Ketzel, Matthias

2011-01-01

Temperature, a key climate change indicator, is expected to increase substantially in the Northern Hemisphere, with potentially grave implications for human health. This study is the first to investigate the association between the daily 3-hour maximum apparent temperature (Tapp...

Bisphosphonate treatment affects trabecular bone apparent modulus through micro-architecture rather than matrix properties

DEFF Research Database (Denmark)

Ding, Ming

2004-01-01

and trabecular architecture independently. Conventional histomorphometry and microdamage data were obtained from the second and third lumbar vertebrae of the same dogs [Bone 28 (2001) 524]. Bisphosphonate treatment resulted in an increased apparent Young's modulus, decreased bone turnover, increased calcified...... matrix density, and increased microdamage. We could not detect any change in the effective Young's modulus of the calcified matrix in the bisphosphonate treated groups. The observed increase in apparent Young's modulus was due to increased bone mass and altered trabecular architecture rather than changes...... in the calcified matrix modulus. We hypothesize that the expected increase in the Young's modulus of the calcified matrix due to the increased calcified matrix density was counteracted by the accumulation of microdamage. Udgivelsesdato: 2004 May...

Dynamic inter-subunit interactions in thermophilic F1-ATPase subcomplexes studied by cross-correlated relaxation-enhanced polarization transfer NMR

International Nuclear Information System (INIS)

Kobayashi, Masumi; Yagi, Hiromasa; Yamazaki, Toshio; Yoshida, Masasuke; Akutsu, Hideo

2008-01-01

F 1 -ATPase is a unique enzyme in terms of its rotational catalytic activity. The smallest unit showing this property is the α 3 β 3 γ complex (351 kDa). For investigation of such a huge system by means of solution NMR, we have explored a suitable NMR method using F 1 -ATPase subcomplexes from a thermophilic Bacillus PS3 including an α 3 β 3 hexamer (319 kDa). Pulse sequences for large molecules, effects of deuteration and simplification of the spectra were examined in this work. Since the β subunit includes the catalytic site, this was the target of the analysis in this work. The combination of [ 15 N, 1 H]-CRINEPT-HMQC-[ 1 H]-TROSY, deuteration of both α and β subunits, and segmental isotope-labeling was found essential to analyze such a huge and complex molecular system. Utilizing this method, subcomplexes composed of α and β subunits were investigated in terms of inter-subunit interactions. It turned out that there is equilibrium among monomers, heterodimers and the α 3 β 3 hexamers in solution. The rate of exchange between the dimer and hexamer is in the slow regime on the NMR time scale. In chemical shift perturbation experiments, the N-terminal domain was found to be involved in strong inter-subunit interactions. In contrast, the C-terminal domain was found to be mobile even in the hexamer

What Causes the High Apparent Speeds in Chromospheric and Transition Region Spicules on the Sun?

Energy Technology Data Exchange (ETDEWEB)

De Pontieu, Bart; Martínez-Sykora, Juan; Chintzoglou, Georgios, E-mail: bdp@lmsal.com [Lockheed Martin Solar and Astrophysics Laboratory, Palo Alto, CA 94304 (United States)

2017-11-01

Spicules are the most ubuiquitous type of jets in the solar atmosphere. The advent of high-resolution imaging and spectroscopy from the Interface Region Imaging Spectrograph ( IRIS ) and ground-based observatories has revealed the presence of very high apparent motions of order 100–300 km s{sup −1} in spicules, as measured in the plane of the sky. However, line of sight measurements of such high speeds have been difficult to obtain, with values deduced from Doppler shifts in spectral lines typically of order 30–70 km s{sup −1}. In this work, we resolve this long-standing discrepancy using recent 2.5D radiative MHD simulations. This simulation has revealed a novel driving mechanism for spicules in which ambipolar diffusion resulting from ion-neutral interactions plays a key role. In our simulation, we often see that the upward propagation of magnetic waves and electrical currents from the low chromosphere into already existing spicules can lead to rapid heating when the currents are rapidly dissipated by ambipolar diffusion. The combination of rapid heating and the propagation of these currents at Alfvénic speeds in excess of 100 km s{sup −1} leads to the very rapid apparent motions, and often wholesale appearance, of spicules at chromospheric and transition region temperatures. In our simulation, the observed fast apparent motions in such jets are actually a signature of a heating front, and much higher than the mass flows, which are of order 30–70 km s{sup −1}. Our results can explain the behavior of transition region “network jets” and the very high apparent speeds reported for some chromospheric spicules.

Isolation of sphere-forming stem cells from the mouse inner ear.

Science.gov (United States)

Oshima, Kazuo; Senn, Pascal; Heller, Stefan

2009-01-01

The mammalian inner ear has very limited ability to regenerate lost sensory hair cells. This deficiency becomes apparent when hair cell loss leads to hearing loss as a result of either ototoxic insult or the aging process. Coincidently, with this inability to regenerate lost hair cells, the adult cochlea does not appear to harbor cells with a proliferative capacity that could serve as progenitor cells for lost cells. In contrast, adult mammalian vestibular sensory epithelia display a limited ability for hair cell regeneration, and sphere-forming cells with stem cell features can be isolated from the adult murine vestibular system. The neonatal inner ear, however, does harbor sphere-forming stem cells residing in cochlear and vestibular tissues. Here, we provide protocols to isolate sphere-forming stem cells from neonatal vestibular and cochlear sensory epithelia as well as from the spiral ganglion. We further describe procedures for sphere propagation, cell differentiation, and characterization of inner ear cell types derived from spheres. Sphere-forming stem cells from the mouse inner ear are an important tool for the development of cellular replacement strategies of damaged inner ears and are a bona fide progenitor cell source for transplantation studies.

Multiple concurrent temporal recalibrations driven by audiovisual stimuli with apparent physical differences.

Science.gov (United States)

Yuan, Xiangyong; Bi, Cuihua; Huang, Xiting

2015-05-01

Out-of-synchrony experiences can easily recalibrate one's subjective simultaneity point in the direction of the experienced asynchrony. Although temporal adjustment of multiple audiovisual stimuli has been recently demonstrated to be spatially specific, perceptual grouping processes that organize separate audiovisual stimuli into distinctive "objects" may play a more important role in forming the basis for subsequent multiple temporal recalibrations. We investigated whether apparent physical differences between audiovisual pairs that make them distinct from each other can independently drive multiple concurrent temporal recalibrations regardless of spatial overlap. Experiment 1 verified that reducing the physical difference between two audiovisual pairs diminishes the multiple temporal recalibrations by exposing observers to two utterances with opposing temporal relationships spoken by one single speaker rather than two distinct speakers at the same location. Experiment 2 found that increasing the physical difference between two stimuli pairs can promote multiple temporal recalibrations by complicating their non-temporal dimensions (e.g., disks composed of two rather than one attribute and tones generated by multiplying two frequencies); however, these recalibration aftereffects were subtle. Experiment 3 further revealed that making the two audiovisual pairs differ in temporal structures (one transient and one gradual) was sufficient to drive concurrent temporal recalibration. These results confirm that the more audiovisual pairs physically differ, especially in temporal profile, the more likely multiple temporal perception adjustments will be content-constrained regardless of spatial overlap. These results indicate that multiple temporal recalibrations are based secondarily on the outcome of perceptual grouping processes.

The determination of bulk (apparent) density of plant fibres by density method

International Nuclear Information System (INIS)

Sharifah Hanisah Syed Abd Aziz; Raja Jamal Raja hedar; Zahid Abdullah

2004-01-01

The absolute density of plant fibres excludes all pores and lumen and therefore is a measure of the solid matter of the fibres. On the other hand the bulk density, which is being discussed here, includes all the solid matter and the pores of the fibres. In this work, the apparent density of the fibre was measured by using the Archimedes principle, which involves the immersion of a known weight of fibre into a solvent of lower density than the fibre. Toluene with a density of about 860 kg/m3 was chosen as a solvent. A tuft of fibre was weighed and recorded as W fa . The fibre was then immersed in toluene, which wetted the fibre, and made to rest on the weighing pan submerged in the solvent and the weight of the immersed fibre was recorded as W fs . The apparent density was then calculated using the equation. All the measurements were taken at room temperature. The fibre samples were not oven dried prior to measurement. (Author)

Informed consent for clinical trials: a comparative study of standard versus simplified forms.

Science.gov (United States)

Davis, T C; Holcombe, R F; Berkel, H J; Pramanik, S; Divers, S G

1998-05-06

A high level of reading skill and comprehension is necessary to understand and complete most consent forms that are required for participation in clinical research studies. This study was conducted to test the hypothesis that a simplified consent form would be less intimidating and more easily understood by individuals with low-to-marginal reading skills. During July 1996, 183 adults (53 patients with cancer or another medical condition and 130 apparently healthy participants) were tested for reading ability and then asked to read either the standard Southwestern Oncology Group (SWOG) consent form (16th grade level) or a simplified form (7th grade level) developed at Louisiana State University Medical Center-Shreveport (LSU). Participants were interviewed to assess their attitudes toward and comprehension of the form read. Then they were given the alternate consent form and asked which one they preferred and why. Overall, participants preferred the LSU form (62%; 95% confidence interval [CI] = 54.8%-69.2%) over the SWOG form (38%; 95% CI = 30.8%-45.2%) (P = .0033). Nearly all participants thought that the LSU form was easier to read (97%; 95% CI = 93.1%-99.9%) than the SWOG form (75%; 95% CI = 65.1%-85.7%) (Pinformed consent documents for the substantial proportion of Americans with low-to-marginal literacy skills.

Calculated apparent yields of rare gas fission products

International Nuclear Information System (INIS)

Delucchi, A.A.

1975-01-01

The apparent fission yield of the rare gas fission products from four mass chains is calculated as a function of separation time for six different fissioning systems. A plot of the calculated fission yield along with a one standard deviation error band is given for each rare gas fission product and for each fissioning system. Those parameters in the calculation that were major contributors to the calculated standard deviation at each separation time were identified and the results presented on a separate plot. To extend the usefulness of these calculations as new and better values for the input parameters become available, a third plot was generated for each system which shows how sensitive the derived fission yield is to a change in any given parameter used in the calculation. (U.S.)

Device for measuring active, reactive and apparent power

Energy Technology Data Exchange (ETDEWEB)

Bartosinski, E.; Wieland, J.

1982-09-30

The plan consists of a traditional electrodynamic mechanism for measuring power (IM) supplemented by three switches, two rectifiers, resistor, included in parallel, and phaseshifting throttle included in series with the voltage coil of the IM. This makes it possible by selection to perform three types of measurements: active power of alternating current or power of direct current, only the voltage coils and the IM current are engaged; reactive power, the resistor and the throttle are additionally engaged by the aforementioned method; complete (apparent) power--the current and the voltage are supplied directly to the IM coils, but in contrast to the first case, through rectifiers. The influence of the highest harmonic components of voltage and current which are not significant for industrial measurements can be eliminated in necessary cases using filtering devices.

Evaluation of a radioactive concrete waste form recovered from an ocean dumpsite

International Nuclear Information System (INIS)

Colombo, P.; Neilson, R.M. Jr.

1982-01-01

Little dissolution of the concrete waste form in the ocean environment occurred as evidenced by a maximum waste package weight loss of approximately 5%. Water loss through evaporation during curing and dissolution of calcium hydroxide in disposal or inaccuracy of the initial weighing are believed to be responsible for the apparent weight loss. A conservative estimate that assumes a constant 0.33%/yr weight loss due solely to cement-phase dissolution predicts that it would require a minimum of 300 years in this environment before the concrete waste form would lose its integrity. The measured compression strength of the concrete waste form is in the range expected for concrete formulations. This indicates the absence of appreciable attack which is also supported by the observation that negligible deterioration of the waste form surface has occurred. The concrete waste form contained Cs-137, Cs-134, and Co-60. Based on the assumed initial Cs-137 distribution in the waste form, a bulk leach rate for this radionuclide of 2.4x10 -3 g/(cm 2 -day) was calculated. This corresponds to an average fractional activity loss rate of 3.7x10 -2 per year (neglecting decay). 7 figures, 1 table

Physico-chemical properties of different forms of bovine lactoferrin.

Science.gov (United States)

Bokkhim, Huma; Bansal, Nidhi; Grøndahl, Lisbeth; Bhandari, Bhesh

2013-12-01

Three forms of bovine lactoferrin (Lf), apo-, native- and holo- with 0.9%, 12.9% and 99.7% iron content, respectively, were characterised for their physico-chemical properties. Colour, surface tension, thermal properties, particle charge and rheological behaviour of Lf were found to be affected by the form of Lf. The surface tension of Lf tends to decrease with decrease in iron content. The Circular Dichroism (CD) spectra confirmed that all forms of Lf had similar secondary structures while the tertiary structure was different for holo-Lf. The Differential Scanning Calorimeter (DSC) analysis showed that the apo- and holo-Lf in aqueous solution displayed thermal denaturation temperatures of 71±0.2 and 91±0.5 °C, respectively, suggesting that the iron saturation of Lf tends to increase its thermal stability. The study of particle charge properties (ζ-potential) in 1 mM KCl salt solution showed that apo-Lf reached the net charge of zero in the pH range 5.5-6.5 whereas native and holo-Lf in the pH range 8.0-9.0. The apparent viscosity of 1% (wt/wt) solution of the different forms of Lf showed no difference between apo- and native-Lf (≈1.4 mPas) while the value was significantly higher (2.38 mPas) for holo-Lf. Copyright © 2013 Elsevier Ltd. All rights reserved.

Apparent digestibility coefficient of chickpea, maize, high-quality protein maize, and beans diets in juvenile and adult Nile tilapia ( Oreochromis niloticus

Directory of Open Access Journals (Sweden)

Magnolia Montoya-Mejía

Full Text Available ABSTRACT The objective of our study was to assess the apparent digestibility of plant ingredients in diets for juvenile (50 g and adult (220 g Nile tilapia (Oreochromis niloticus. Dietary dry matter and protein apparent digestibility coefficients of four plant-derived feedstuffs (chickpea, maize, high-quality maize protein, and beans were tested. The beans diet had the lowest apparent digestibility coefficient of dry matter (ADCDM (69.41%, while no significant differences were detected in ADCDM among the other diets; ADCDM was significantly higher in adults compared with juveniles (77.02 vs. 73.76%. Apparent dry matter digestibility coefficient of ingredients (ADCI was significantly higher in the chickpea (70.48% and high-quality protein maize (71.09% ingredients, and lower in the beans (52.79% ingredient. Apparent dry matter digestibility coefficient of ingredients was significantly higher in juveniles compared with adults (72.56 vs. 56.80%. The protein digestibility of diet (ADCCP was significantly higher in the reference diet (93.68%, while the lowest corresponded to the maize (87.86% and beans (87.29% diets. Significantly lower apparent digestibility coefficient of protein (ADCICP was obtained with the high-quality maize protein (59.11% and maize (49.48% ingredients, while higher ADCICP was obtained with the chickpea and beans ingredients (71.31 and 63.89%, respectively. The apparent digestibility coefficient of ingredient crude protein ADCICP was significantly higher in juveniles compared with adults (67.35 vs. 53.46. Digestibility is generally higher in juveniles, and we recommend using chickpea as an ingredient in diets for Nile tilapia.

An apparent Acanthamoeba genotype is the product of a chimeric 18S rDNA artifact.

Science.gov (United States)

Corsaro, Daniele; Venditti, Danielle

2018-02-01

Free-living amoebae of the genus Acanthamoeba are potentially pathogenic protozoa widespread in the environment. The detection/diagnosis as well as environmental survey strategies is mainly based on the identification of the 18S rDNA sequences of the strains that allow the recovery of various distinct genotypes/subgenotypes. The accurate recording of such data is important to better know the environmental distribution of distinct genotypes and how they may be preferentially associated with disease. Recently, a putative new acanthamoebal genotype T99 was introduced, which comprises only environmental clones apparently with some anomalous features. Here, we analyze these sequences through partial treeing and BLAST analyses and find that they are actually chimeras. Our results show that the putative T99 genotype is very likely formed by chimeric sequences including a middle fragment from acanthamoebae of genotype T13, while the 5'- and 3'-end fragments came from a nematode and a cercozoan, respectively. Molecular phylogenies of Acanthamoeba including T99 are consequently erroneous as genotype T99 does not exist in nature. Careful identification of Acanthamoeba genotypes is therefore critical for both phylogenetic and diagnostic applications.

Apparent diffusion coefficient correlation with oesophageal tumour stroma and angiogenesis

Energy Technology Data Exchange (ETDEWEB)

Aoyagi, Tomoyoshi; Shuto, Kiyohiko; Okazumi, Shinichi; Hayano, Kohichi; Satoh, Asami; Saitoh, Hiroshige; Shimada, Hideaki; Nabeya, Yoshihiro; Matsubara, Hisahiro [Chiba University, Department of Frontier Surgery, Graduate School of Medicine, Chiba (Japan); Kazama, Toshiki [Chiba University, Department of Radiology, Graduate School of Medicine, Chiba (Japan)

2012-06-15

Because diffusion-weighted imaging (DWI) can predict the prognosis of patients with oesophageal squamous cell carcinoma (ESCC), we hypothesised that apparent diffusion coefficient (ADC) values might be correlated with the collagen content and tumour angiogenesis. The purpose of this study was to determine the correlation between ADC values of ESCC before treatment and oesophageal tumour stroma and angiogenesis. Seventeen patients with ESCC were enrolled. The ADC values were calculated from the DWI score. Seventeen patients who had undergone oesophagectomy were analysed for tumour stroma, vascular endothelial growth factor (VEGF) and CD34. Tissue collagen was stained with azocarmine and aniline blue to quantitatively analyse the extracellular matrix in cancer stroma. Tissues were stained with VEGF and CD34 to analyse the angiogenesis. The ADC values decreased with stromal collagen growth. We found a negative correlation between the tumour ADC and the amount of stromal collagen (r = -0.729, P = 0.001), i.e. the ADC values decreased with growth of VEGF. We also found a negative correlation between the ADC of the tumours and the amount of VEGF (r = 0.538, P = 0.026). Our results indicated that the ADC value may be a novel prognostic factor and contribute to the treatment of oesophageal cancer. circle Magnetic resonance apparent diffusion coefficient values inversely indicate tumour stromal collagen circle There is also negative correlation between ADCs and vascular endothelial growth factor circle ADC values may contribute to the treatment of oesophageal cancer. (orig.)

Apparent diffusion coefficient correlation with oesophageal tumour stroma and angiogenesis

International Nuclear Information System (INIS)

Aoyagi, Tomoyoshi; Shuto, Kiyohiko; Okazumi, Shinichi; Hayano, Kohichi; Satoh, Asami; Saitoh, Hiroshige; Shimada, Hideaki; Nabeya, Yoshihiro; Matsubara, Hisahiro; Kazama, Toshiki

2012-01-01

Because diffusion-weighted imaging (DWI) can predict the prognosis of patients with oesophageal squamous cell carcinoma (ESCC), we hypothesised that apparent diffusion coefficient (ADC) values might be correlated with the collagen content and tumour angiogenesis. The purpose of this study was to determine the correlation between ADC values of ESCC before treatment and oesophageal tumour stroma and angiogenesis. Seventeen patients with ESCC were enrolled. The ADC values were calculated from the DWI score. Seventeen patients who had undergone oesophagectomy were analysed for tumour stroma, vascular endothelial growth factor (VEGF) and CD34. Tissue collagen was stained with azocarmine and aniline blue to quantitatively analyse the extracellular matrix in cancer stroma. Tissues were stained with VEGF and CD34 to analyse the angiogenesis. The ADC values decreased with stromal collagen growth. We found a negative correlation between the tumour ADC and the amount of stromal collagen (r = -0.729, P = 0.001), i.e. the ADC values decreased with growth of VEGF. We also found a negative correlation between the ADC of the tumours and the amount of VEGF (r = 0.538, P = 0.026). Our results indicated that the ADC value may be a novel prognostic factor and contribute to the treatment of oesophageal cancer. circle Magnetic resonance apparent diffusion coefficient values inversely indicate tumour stromal collagen circle There is also negative correlation between ADCs and vascular endothelial growth factor circle ADC values may contribute to the treatment of oesophageal cancer. (orig.)

The effect of the Holling type II functional response on apparent competition

Czech Academy of Sciences Publication Activity Database

Křivan, Vlastimil; Eisner, Jan

2006-01-01

Roč. 70, č. 4, (2006), s. 421-430 ISSN 0040-5809 R&D Projects: GA AV ČR(CZ) IAA100070601 Grant - others:Center funded by NSF(US) DEB-0072909 Institutional research plan: CEZ:AV0Z50070508 Keywords : apparent competition * optimal foraging * the ideal free distribution Subject RIV: EH - Ecology, Behaviour Impact factor: 2.491, year: 2006

The apparent monovalency of human IgG4 is due to bispecificity

NARCIS (Netherlands)

Aalberse, R. C.; Schuurman, J.; van Ree, R.

1999-01-01

A hypothesis is put forward to explain the apparent monovalency of human IgG4. It is based upon the known instability of the IgG4 hinge. IgG4 is secreted as a regular bivalent antibody, but after secretion interacts with another IgG4 molecule. This interaction results in the exchange of half

Influence of surface conductivity on the apparent zeta potential of calcite.

Science.gov (United States)

Li, Shuai; Leroy, Philippe; Heberling, Frank; Devau, Nicolas; Jougnot, Damien; Chiaberge, Christophe

2016-04-15

Zeta potential is a physicochemical parameter of particular importance in describing the surface electrical properties of charged porous media. However, the zeta potential of calcite is still poorly known because of the difficulty to interpret streaming potential experiments. The Helmholtz-Smoluchowski (HS) equation is widely used to estimate the apparent zeta potential from these experiments. However, this equation neglects the influence of surface conductivity on streaming potential. We present streaming potential and electrical conductivity measurements on a calcite powder in contact with an aqueous NaCl electrolyte. Our streaming potential model corrects the apparent zeta potential of calcite by accounting for the influence of surface conductivity and flow regime. We show that the HS equation seriously underestimates the zeta potential of calcite, particularly when the electrolyte is diluted (ionic strength ⩽ 0.01 M) because of calcite surface conductivity. The basic Stern model successfully predicted the corrected zeta potential by assuming that the zeta potential is located at the outer Helmholtz plane, i.e. without considering a stagnant diffuse layer at the calcite-water interface. The surface conductivity of calcite crystals was inferred from electrical conductivity measurements and computed using our basic Stern model. Surface conductivity was also successfully predicted by our surface complexation model. Copyright © 2016 Elsevier Inc. All rights reserved.

Driven to distraction: The nature and apparent purpose of interruptions in critical care and implications for HIT.

Science.gov (United States)

Mamykina, Lena; Carter, Eileen J; Sheehan, Barbara; Stanley Hum, R; Twohig, Bridget C; Kaufman, David R

2017-05-01

To examine the apparent purpose of interruptions in a Pediatric Intensive Care Unit and opportunities to reduce their burden with informatics solutions. In this prospective observational study, researchers shadowed clinicians in the unit for one hour at a time, recording all interruptions participating clinicians experienced or initiated, their starting time, duration, and a short description that could help to infer their apparent purpose. All captured interruptions were classified inductively on their source and apparent purpose and on the optimal representational media for fulfilling their apparent purpose. The researchers observed thirty-four one-hour sessions with clinicians in the unit, including 21 nurses and 13 residents and house physicians. The physicians were interrupted on average 11.9 times per hour and interrupted others 8.8 times per hour. Nurses were interrupted 8.6 times per hour and interrupted others 5.1 times per hour. The apparent purpose of interruptions included Information Seeking and Sharing (n=259, 46.3%), Directives and Requests (n=70, 12%), Shared Decision-Making (n=49, 8.8%), Direct Patient Care (n=36, 6.4%), Social (n=71, 12.7%), Device Alarms (n=28, 5%), and Non-Clinical (n=10, 1.8%); 6.6% were not classified due to insufficient description. Of all captured interruptions, 29.5% were classified as being better served with informational displays or computer-mediated communication. Deeper understanding of the purpose of interruptions in critical care can help to distinguish between interruptions that require face-to-face conversation and those that can be eliminated with informatics solutions. The proposed taxonomy of interruptions and representational analysis can be used to further advance the science of interruptions in clinical care. Copyright © 2017 Elsevier Inc. All rights reserved.

An effective medium approach to predict the apparent contact angle of drops on super-hydrophobic randomly rough surfaces.

Science.gov (United States)

Bottiglione, F; Carbone, G

2015-01-14

The apparent contact angle of large 2D drops with randomly rough self-affine profiles is numerically investigated. The numerical approach is based upon the assumption of large separation of length scales, i.e. it is assumed that the roughness length scales are much smaller than the drop size, thus making it possible to treat the problem through a mean-field like approach relying on the large-separation of scales. The apparent contact angle at equilibrium is calculated in all wetting regimes from full wetting (Wenzel state) to partial wetting (Cassie state). It was found that for very large values of the roughness Wenzel parameter (r(W) > -1/ cos θ(Y), where θ(Y) is the Young's contact angle), the interface approaches the perfect non-wetting condition and the apparent contact angle is almost equal to 180°. The results are compared with the case of roughness on one single scale (sinusoidal surface) and it is found that, given the same value of the Wenzel roughness parameter rW, the apparent contact angle is much larger for the case of a randomly rough surface, proving that the multi-scale character of randomly rough surfaces is a key factor to enhance superhydrophobicity. Moreover, it is shown that for millimetre-sized drops, the actual drop pressure at static equilibrium weakly affects the wetting regime, which instead seems to be dominated by the roughness parameter. For this reason a methodology to estimate the apparent contact angle is proposed, which relies only upon the micro-scale properties of the rough surface.

Phase-contrast MRI and CFD modeling of apparent 3He gas flow in rat pulmonary airways

Science.gov (United States)

Minard, Kevin R.; Kuprat, Andrew P.; Kabilan, Senthil; Jacob, Richard E.; Einstein, Daniel R.; Carson, James P.; Corley, Richard A.

2012-08-01

Phase-contrast (PC) magnetic resonance imaging (MRI) with hyperpolarized 3He is potentially useful for developing and testing patient-specific models of pulmonary airflow. One challenge, however, is that PC-MRI provides apparent values of local 3He velocity that not only depend on actual airflow but also on gas diffusion. This not only blurs laminar flow patterns in narrow airways but also introduces anomalous airflow structure that reflects gas-wall interactions. Here, both effects are predicted in a live rat using computational fluid dynamics (CFD), and for the first time, simulated patterns of apparent 3He gas velocity are compared with in vivo PC-MRI. Results show (1) that correlations (R2) between measured and simulated airflow patterns increase from 0.23 to 0.79 simply by accounting for apparent 3He transport, and (2) that remaining differences are mainly due to uncertain airway segmentation and partial volume effects stemming from relatively coarse MRI resolution. Higher-fidelity testing of pulmonary airflow predictions should therefore be possible with future imaging improvements.

Osmotic coefficients and apparent molar volumes of 1-hexyl-3-methylimidazolium trifluoromethanesulfonate ionic liquid in alcohols

International Nuclear Information System (INIS)

González, Emilio J.; Calvar, Noelia; Macedo, Eugénia A.

2014-01-01

Highlights: • Physical and osmotic properties of [HMim][TfO] in alcohols are reported. • Apparent molar properties and osmotic coefficients were obtained. • Apparent molar volumes were fitted using a Redlich–Meyer type equation. • The osmotic coefficients were modeled with the Extended Pitzer and the MNRTL models. -- Abstract: In this work, density for the binary mixtures of 1-hexyl-3-methylimidazolium trifluoromethanesulfonate in alcohols (1-propanol, or 2-propanol, or 1-butanol, or 2-butanol, or 1-pentanol) was measured at T = 323.15 K and atmospheric pressure. From this property, the corresponding apparent molar volumes were calculated and fitted to a Redlich–Meyer type equation. For these mixtures, the osmotic and activity coefficients, and vapor pressures of these binary systems were also determined at the same temperature using the vapor pressure osmometry technique. The experimental osmotic coefficients were modeled by the Extended Pitzer model of Archer. The parameters obtained in this correlation were used to calculate the mean molal activity coefficients and the excess Gibbs free energy for the studied mixtures

Calculation of the apparent neutron parameters in a borehole geometry for neutron porosity tools

International Nuclear Information System (INIS)

Woznicka, U.; Drabina, A.

2001-01-01

This paper presents the next step of a development of the theoretical solutions, which gives a possibility to calculate the apparent neutron slowing down and migration lengths in the three region cylindrical system which represents the borehole, the intermediate zone (e.g. mud cake at the borehole walls), and the geological formation. A solution of the neutron diffusion equation in energy two-group approach for spatial moments of the neutron flux is given for the three-region cylindrical coaxial geometry. The influence of the intermediate zone is presented. The numerical code MOM3 has been written to calculate the apparent slowing down and migration lengths for the three-region cylindrical system as mentioned above. Additionally the MCNP calculation for the three-region borehole geometry is presented in the paper

Apparent molar volumes and apparent molar heat capacities of aqueous D-lactose · H2O at temperatures from (278.15 to 393.15) K and at the pressure 0.35 MPa

International Nuclear Information System (INIS)

Sargent, J.D.; Niederhauser, T.L.; Woolley, E.M.

2004-01-01

Apparent molar volumes V phi and apparent molar heat capacities C p,phi were determined for aqueous solutions of D-lactose · H 2 O at molalities (0.01 to 0.34) mol · kg -1 at temperatures (278.15 to 393.15) K, and at the pressure 0.35 MPa. Our V phi values were calculated from densities obtained using a vibrating tube densimeter, and our C p,phi values were obtained using a twin fixed-cell, power-compensation, differential-output, temperature-scanning calorimeter. Our results for D-lactose(aq) and for D-lactcose · H 2 O were fitted to functions of m and T and compared with the literature results for aqueous D-glucose and D-galactose solutions. Infinite dilution partial molar volumes V 2 compfn and heat capacities C p,2 compfn are given over the range of temperatures

Apparent Molal Volumes of Sodium Fluoride in Mixed Aqueous-Ethanol Solvents

Directory of Open Access Journals (Sweden)

E. Gomaa

2010-09-01

Full Text Available The densities of different molal concentrations of sodium fluoride at ethanol-water mixtures, as solvent, have been measured over the whole composition range at three different temperatures, 293.15, 303.15 and 313.15oK. From the measured densities, the apparent and limiting molal volumes of the electrolytes have been evaluated. The limiting molal volumes for sodium and fluoride ions were estimated by splitting the ionic contributions as an asymmetric assumption.

High-Functioning Wetland Formed Atop Abandoned Pavement in Eutrophic Reservoir Watershed

Science.gov (United States)

Clifford, C.; Heffernan, J. B.

2017-12-01

Water scientists and managers regularly observe how wetlands, whether natural or created, can mitigate the influence of artificial impervious surfaces on water quality. However, we rarely study or mention wetlands accidentally (sensu Palta et al. 2017) formed atop impervious surfaces. This silence occurs even though many urbanites have likely noticed sedges rimming a clogged drainage grate or in the low bits of a poorly graded or aging parking lot, or similar. A more extreme example occurs in the Little River Waterfowl Impoundment vicinity of the Butner-Falls of Neuse Game Land in Durham, North Carolina. There, a macadam road that connected local residents and a store, and served as the primary route through the area, by 1910-1920, was apparently abandoned by 1951. Later, damming nearby downstream Falls Lake Reservoir in 1981, and smaller-scale construction locally, apparently increased water table depth and flow exposure. Yet, the road remains largely intact structurally, though mostly buried and sometimes underwater. In a particularly wet segment of the road, surrounded by and partially holding back standing water even in drought, a substantial, mostly native wetland plant community has formed. This community includes trees such as overcup oak (Quercus lyrata) as large as 15 cm in diameter, shrubs such as (Cephalanthus occidentalus), sedges such as woolgrass (Scirpus cyperinus), rushes (multiple Juncus species), grasses such as wood oats (Chasmanthium latifolium), crayfish and fish, and multiple orders of herptiles. The plants grow rooted in fluffy sediment three to rarely more than 20cm deep, over solid pavement. Alongside the old road, the ditches have widened and become shallower and less surficially connected through tree roots and debris dams; they resemble pools. Sediment in these abandoned ditches has accumulated to depths of tens of centimeters, generally reforming a clay-dominated, gleyed soil, in some places buried under more tens of centimeters of very

Motivation to hide emotion and children's understanding of the distinction between real and apparent emotions.

Science.gov (United States)

Gosselin, Pierre; Warren, Madeleine; Diotte, Michèle

2002-12-01

The authors investigated the extent to which children's understanding of the distinction between real and apparent emotions varied according to the motivation to hide emotions. Children, aged 6-7 and 10-11 years, were read stories designed to elicit either prosocial or self-protective motivated display rules and were asked to predict the facial expressions the protagonists would make to hide felt emotions. Children were found to understand the distinction between real and apparent emotions very well, independently of the type of motivation. Contrary to predictions, boys understood this distinction better than did girls when the motivation to hide positive emotions was prosocial. Children perceived neutralization as the most appropriate strategy to hide felt emotions, followed by masking.

Apparent and true resistant hypertension: definition, prevalence and outcomes.

Science.gov (United States)

Judd, E; Calhoun, D A

2014-08-01

Resistant hypertension, defined as blood pressure (BP) remaining above goal despite the use of > or =3 antihypertensive medications at maximally tolerated doses (one ideally being a diuretic) or BP that requires > or =4 agents to achieve control, has received more attention with increased efforts to improve BP control rates and the emergence of device-based therapies for hypertension. This classically defined resistant group consists of patients with true resistant hypertension, controlled resistant hypertension and pseudo-resistant hypertension. In studies where pseudo-resistant hypertension cannot be excluded (for example, 24-h ambulatory BP not obtained), the term apparent resistant hypertension has been used to identify 'apparent' lack of control on > or =3 medications. Large, well-designed studies have recently reported the prevalence of resistant hypertension. Pooling prevalence data from these studies and others within North America and Europe with a combined sample size of >600,000 hypertensive participants, the prevalence of resistant hypertension is 14.8% of treated hypertensive patients and 12.5% of all hypertensives. However, the prevalence of true resistant hypertension, defined as uncontrolled both by office and 24-h ambulatory BP monitoring with confirmed medication adherence, may be more meaningful in terms of identifying risk and estimating benefit from newer therapies like renal denervation. Rates of cardiovascular events and mortality follow mean 24-h ambulatory BPs in patients with resistant hypertension, and true resistant hypertension represents the highest risk. The prevalence of true resistant hypertension has not been directly measured in large trials; however, combined data from smaller studies suggest that true resistant hypertension is present in half of the patients with resistant hypertension who are uncontrolled in the office. Our pooled analysis shows prevalence rates of 10.1% and 7.9% for uncontrolled resistant hypertension among

The generalized second law of gravitational thermodynamics on the apparent and event horizons in FRW cosmology

International Nuclear Information System (INIS)

Karami, K; Ghaffari, S; Soltanzadeh, M M

2010-01-01

We investigate the validity of the generalized second law (GSL) of gravitational thermodynamics on the apparent and event horizons in a non-flat Friedmann-Robertson-Walker (FRW) universe containing dark energy interacting with dark matter. We show that for the dynamical apparent horizon, the GSL is always satisfied throughout the history of the universe for any spatial curvature and it is independent of the equation of state parameter of the interacting dark energy model. On the other hand, for the cosmological event horizon, the validity of the GSL depends on the equation of state parameter of the model.

The generalized second law of gravitational thermodynamics on the apparent and event horizons in FRW cosmology

Energy Technology Data Exchange (ETDEWEB)

Karami, K; Ghaffari, S; Soltanzadeh, M M, E-mail: KKarami@uok.ac.i [Department of Physics, University of Kurdistan, Pasdaran St, Sanandaj (Iran, Islamic Republic of)

2010-10-21

We investigate the validity of the generalized second law (GSL) of gravitational thermodynamics on the apparent and event horizons in a non-flat Friedmann-Robertson-Walker (FRW) universe containing dark energy interacting with dark matter. We show that for the dynamical apparent horizon, the GSL is always satisfied throughout the history of the universe for any spatial curvature and it is independent of the equation of state parameter of the interacting dark energy model. On the other hand, for the cosmological event horizon, the validity of the GSL depends on the equation of state parameter of the model.

Apparent activation energy for creep controlled by jog-drag and cell-formation

International Nuclear Information System (INIS)

Povolo, F.; Marzocca, A.J.

1983-01-01

The expression for the apparent activation energy for creep controlled by jog-drag and cell-formation is given in terms of the parameters of the physical model. It is shown that, in general, this energy does not coincide with that for self-diffusion. The results are applied to actual experimental data obtained in stress-relieved Zircaloy-4 at 673 K. (orig.)

IAU 2015 Resolution B2 on Recommended Zero Points for the Absolute and Apparent Bolometric Magnitude Scales

DEFF Research Database (Denmark)

Mamajek, E. E.; Torres, G.; Prsa, A.

2015-01-01

The XXIXth IAU General Assembly in Honolulu adopted IAU 2015 Resolution B2 on recommended zero points for the absolute and apparent bolometric magnitude scales. The resolution was proposed by the IAU Inter-Division A-G Working Group on Nominal Units for Stellar and Planetary Astronomy after...... consulting with a broad spectrum of researchers from the astronomical community. Resolution B2 resolves the long-standing absence of an internationally-adopted zero point for the absolute and apparent bolometric magnitude scales. Resolution B2 defines the zero point of the absolute bolometric magnitude scale...... such that a radiation source with $M_{\\rm Bol}$ = 0 has luminosity L$_{\\circ}$ = 3.0128e28 W. The zero point of the apparent bolometric magnitude scale ($m_{\\rm Bol}$ = 0) corresponds to irradiance $f_{\\circ}$ = 2.518021002e-8 W/m$^2$. The zero points were chosen so that the nominal solar luminosity (3.828e26 W...

Solving the apparent diversity-accuracy dilemma of recommender systems.

Science.gov (United States)

Zhou, Tao; Kuscsik, Zoltán; Liu, Jian-Guo; Medo, Matús; Wakeling, Joseph Rushton; Zhang, Yi-Cheng

2010-03-09

Recommender systems use data on past user preferences to predict possible future likes and interests. A key challenge is that while the most useful individual recommendations are to be found among diverse niche objects, the most reliably accurate results are obtained by methods that recommend objects based on user or object similarity. In this paper we introduce a new algorithm specifically to address the challenge of diversity and show how it can be used to resolve this apparent dilemma when combined in an elegant hybrid with an accuracy-focused algorithm. By tuning the hybrid appropriately we are able to obtain, without relying on any semantic or context-specific information, simultaneous gains in both accuracy and diversity of recommendations.

A conserved MCM single-stranded DNA binding element is essential for replication initiation.

Science.gov (United States)

Froelich, Clifford A; Kang, Sukhyun; Epling, Leslie B; Bell, Stephen P; Enemark, Eric J

2014-04-01

The ring-shaped MCM helicase is essential to all phases of DNA replication. The complex loads at replication origins as an inactive double-hexamer encircling duplex DNA. Helicase activation converts this species to two active single hexamers that encircle single-stranded DNA (ssDNA). The molecular details of MCM DNA interactions during these events are unknown. We determined the crystal structure of the Pyrococcus furiosus MCM N-terminal domain hexamer bound to ssDNA and define a conserved MCM-ssDNA binding motif (MSSB). Intriguingly, ssDNA binds the MCM ring interior perpendicular to the central channel with defined polarity. In eukaryotes, the MSSB is conserved in several Mcm2-7 subunits, and MSSB mutant combinations in S. cerevisiae Mcm2-7 are not viable. Mutant Mcm2-7 complexes assemble and are recruited to replication origins, but are defective in helicase loading and activation. Our findings identify an important MCM-ssDNA interaction and suggest it functions during helicase activation to select the strand for translocation. DOI: http://dx.doi.org/10.7554/eLife.01993.001.

Structural and Functional Analyses of the Severe Acute Respiratory Syndrome Coronavirus Endoribonuclease Nsp15

Energy Technology Data Exchange (ETDEWEB)

Bhardwaj, Kanchan; Palaninathan, Satheesh; Alcantara, Joanna Maria Ortiz; Yi, Lillian Li; Guarino, Linda; Sacchettini, James C.; Kao, C. Cheng (TAM)

2008-03-31

The severe acute respiratory syndrome (SARS) coronavirus encodes several RNA-processing enzymes that are unusual for RNA viruses, including Nsp15 (nonstructural protein 15), a hexameric endoribonuclease that preferentially cleaves 3' of uridines. We solved the structure of a catalytically inactive mutant version of Nsp15, which was crystallized as a hexamer. The structure contains unreported flexibility in the active site of each subunit. Substitutions in the active site residues serine 293 and proline 343 allowed Nsp15 to cleave at cytidylate, whereas mutation of leucine 345 rendered Nsp15 able to cleave at purines as well as pyrimidines. Mutations that targeted the residues involved in subunit interactions generally resulted in the formation of catalytically inactive monomers. The RNA-binding residues were mapped by a method linking reversible cross-linking, RNA affinity purification, and peptide fingerprinting. Alanine substitution of several residues in the RNA-contacting portion of Nsp15 did not affect hexamer formation but decreased the affinity of RNA binding and reduced endonuclease activity. This suggests a model for Nsp15 hexamer interaction with RNA.

Confounding Underlies the Apparent Month of Birth Effect in Multiple Sclerosis

OpenAIRE

Fiddes, Barnaby; Wason, James; Kemppinen, Anu; Ban, Maria; Compston, Alastair; Sawcer, Stephen

2013-01-01

Objective Several groups have reported apparent association between month of birth and multiple sclerosis. We sought to test the extent to which such studies might be confounded by extraneous variables such as year and place of birth. Methods Using national birth statistics from 2 continents, we assessed the evidence for seasonal variations in birth rate and tested the extent to which these are subject to regional and temporal variation. We then established the age and regional origin distrib...

One of the most massive stars in the Galaxy may have formed in isolation

OpenAIRE

Oskinova, L. M.; Steinke, M.; Hamann, W. -R.; Sander, A.; Todt, H.; Liermann, A.

2013-01-01

Very massive stars, 100 times heavier than the sun, are rare. It is not yet known whether such stars can form in isolation or only in star clusters. The answer to this question is of fundamental importance. The central region of our Galaxy is ideal for investigating very massive stars and clusters located in the same environment. We used archival infrared images to investigate the surroundings of apparently isolated massive stars presently known in the Galactic Center. We find that two such i...

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153Sm(113,117Snm) complexes

International Nuclear Information System (INIS)

Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin

2004-01-01

Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA

Greater sage-grouse apparent nest productivity and chick survival in Carbon County, Wyoming

Science.gov (United States)

Leslie A. Schreiber; Christopher P. Hansen; Mark A. Rumble; Joshua J. Millspaugh; Frank R. Thompson; R. Scott Gamo; Jon W. Kehmeier; Nate Wojik

2016-01-01

Greater sage-grouse Centrocercus urophasianus populations across North America have been declining due to degradation and fragmentation of sagebrush habitat. As part of a study quantifying greater sage-grouse demographics prior to construction of a wind energy facility, we estimated apparent net nest productivity and survival rate of chicks associated with...

In vitro suppression of fungi caused by combinations of apparently non-antagonistic soil bacteria

NARCIS (Netherlands)

De Boer, W.; Wagenaar, A.M.; Klein Gunnewiek, P.J.A.; Van Veen, J.A.

2007-01-01

We hypothesized that apparently non-antagonistic soil bacteria may contribute to suppression of fungi during competitive interactions with other bacteria. Four soil bacteria (Brevundimonas sp., Luteibacter sp., Pedobacter sp. and Pseudomonas sp.) that exhibited little or no visible antifungal

Older adults and the arts: the importance of aesthetic forms of expression in later life.

Science.gov (United States)

Wikström, Britt-Maj

2004-09-01

The purpose of this study was to examine the importance of aesthetic forms of expression in a randomly selected Swedish population age 65 to 89. Data were based on semi-structured interviews with 166 participants. Results revealed dance, music, literature, and pictures were important for this group of elderly individuals in promoting successful aging, and the connection to their everyday life was apparent. Participants considered viewing natural scenes and looking in a photo album as important aesthetic activities. The aesthetic forms of expression contributed to physical and intellectual activities, as well as to interaction with other individuals. Aesthetic experiences were related to feelings of timelessness and spacelessness, and served as sources of gratification.

The hetero-hexameric nature of a chloroplast AAA+ FtsH protease contributes to its thermodynamic stability.

Directory of Open Access Journals (Sweden)

Ofer Moldavski

Full Text Available FtsH is an evolutionary conserved membrane-bound metalloprotease complex. While in most prokaryotes FtsH is encoded by a single gene, multiple FtsH genes are found in eukaryotes. Genetic and biochemical data suggest that the Arabidopsis chloroplast FtsH is a hetero-hexamer. This raises the question why photosynthetic organisms require a heteromeric complex, whereas in most bacteria a homomeric one is sufficient. To gain structural information of the possible complexes, the Arabidopsis FtsH2 (type B and FtsH5 (type A were modeled. An in silico study with mixed models of FtsH2/5 suggests that heteromeric hexamer structure with ratio of 4:2 is more likely to exists. Specifically, calculation of the buried surface area at the interfaces between neighboring subunits revealed that a hetero-complex should be thermodynamically more stable than a homo-hexamer, due to the presence of additional hydrophobic and hydrophilic interactions. To biochemically assess this model, we generated Arabidopsis transgenic plants, expressing epitope-tagged FtsH2 and immuno-purified the protein. Mass-spectrometry analysis showed that FtsH2 is associated with FtsH1, FtsH5 and FtsH8. Interestingly, we found that 'type B' subunits (FtsH2 and FtsH8 were 2-3 fold more abundant than 'type A' (FtsH1 and FtsH5. The biochemical data corroborate the in silico model and suggest that the thylakoid FtsH hexamer is composed of two 'type A' and four 'type B' subunits.

Atrial Septal Aneurysm Presenting as Clubbing without Clinically Apparent Cyanosis.

Science.gov (United States)

Goyal, Laxmi Kant; Banerjee, S; Yadav, R N; Singh, Gajraj; Ganguli, Sujata; Isran, Rohit

2015-09-01

Atrial septal aneurysm (ASA) is a localised "saccular" deformity which protrudes to the right or the left atrium or on both sides. It is a rare, but well recognised cardiac abnormality. It is usually an incidental finding or may presents as atrial arrhythmias or arterial embolism. Though it is an acyanotic congenital heart disease but it may result in significant right to left shunt and cyanosis. We describe a patient of ASA with atrial septal defect who presented with clubbing and right to left shunt without clinically apparent cyanosis. © Journal of the Association of Physicians of India 2011.

Heterogeneous 40Ar/39Ar laser probe apparent ages in low-grade mylonitic rocks: Constraining a meaningful geological age

International Nuclear Information System (INIS)

Arancibia, G

2001-01-01

Obtaining meaningful geological ages from mylonitic rocks has been a major problem for structural geologist, because apparent ages have usually no geologic significance. Over the last years, in situ high spatial resolutions 40 Ar/ 39 Ar studies (e.g. Ruffet et al., 1991; Reddy et al., 1996; Pickles et al., 1997), permit obtain apparent ages of mineral and link them directly with textural, microstructural and chemical patterns that can previously be obtained by optical and scanning electron (SEM) microscopes and electron microprobe. In this work, heterogeneous 40 Ar/ 39 Ar laser probe ages from low-grade volcanic mylonites show complex argon distributions patterns. Inverse isochron analysis suggests that most obtained apparent ages contain argon excess and only younger ages have a meaningful geologically interpretation (au)

Seasonal variation in apparent conductivity and soil salinity at two Narragansett Bay salt marshes

Science.gov (United States)

Measurement of the apparent conductivity of salt marsh sediments using electromagnetic induction (EMI) is a rapid alternative to traditional methods of salinity determination that can be used to map soil salinity across a marsh surface. Soil salinity measures can provide informat...

Standardization of soil apparent electrical conductivity using multi-temporal surveys across multiple production fields

Science.gov (United States)

Apparent soil electrical conductivity (ECa) is an efficient technique for understanding within-field variability of physical and chemical soil characteristics. Commercial devices are readily available for collecting ECa on whole fields and used broadly for crop management in precision agriculture; h...

Wrong effects of apparent sustainable solutions. The Dutch impact on global biodiversity

International Nuclear Information System (INIS)

Rood, T.; Alkemade, R.

2005-01-01

What is the value of sustainable development in a specific country if imported products have negative effects in the country from where those products were imported. Apparently sustainable solutions in one's own country might have negative effects somewhere else, sooner or later. A clear picture of the ecological claim of a country is one of the methods to find the right way towards a sustainable future [nl

Exercise-induced ventricular arrhythmias and vagal dysfunction in Chagas disease patients with no apparent cardiac involvement

Directory of Open Access Journals (Sweden)

Henrique Silveira Costa

2015-04-01

Full Text Available INTRODUCTION : Exercise-induced ventricular arrhythmia (EIVA and autonomic imbalance are considered as early markers of heart disease in Chagas disease (ChD patients. The objective of the present study was to verify the differences in the occurrence of EIVA and autonomic maneuver indexes between healthy individuals and ChD patients with no apparent cardiac involvement. METHODS : A total of 75 ChD patients with no apparent cardiac involvement, aged 44.7 (8.5 years, and 38 healthy individuals, aged 44.0 (9.2 years, were evaluated using echocardiography, symptom-limited treadmill exercise testing and autonomic function tests. RESULTS : The occurrence of EIVA was higher in the chagasic group (48% than in the control group (23.7% during both the effort and the recovery phases. Frequent ventricular contractions occurred only in the patient group. Additionally, the respiratory sinus arrhythmia index was significantly lower in the chagasic individuals compared with the control group. CONCLUSIONS : ChD patients with no apparent cardiac involvement had a higher frequency of EIVA as well as more vagal dysfunction by respiratory sinus arrhythmia. These results suggest that even when asymptomatic, ChD patients possess important arrhythmogenic substrates and subclinical disease.

Purification and characterization of a thermostable glutamate dehydrogenase from a thermophilic bacterium isolated from a sterilization drying oven

Directory of Open Access Journals (Sweden)

Maximiliano J. Amenábar

2012-02-01

Full Text Available Glutamate dehydrogenase from axenic bacterial cultures of anew microorganism, called GWE1, isolated from the interior ofa sterilization drying oven, was purified by anion-exchange andmolecular-exclusion liquid chromatography. The apparent molecularmass of the native enzyme was 250.5 kDa and wasshown to be an hexamer with similar subunits of molecularmass 40.5 kDa. For glutamate oxidation, the enzyme showedan optimal pH and temperature of 8.0 and 70oC, respectively.In contrast to other glutamate dehydrogenases isolated frombacteria, the enzyme isolated in this study can use both NAD+and NADP+ as electron acceptors, displaying more affinity forNADP+ than for NAD+. No activity was detected with NADHor NADPH, 2-oxoglutarate and ammonia. The enzyme was exceptionallythermostable, maintaining more than 70% of activityafter incubating at 100oC for more than five hours suggestingbeing one of the most thermoestable enzymes reported inthe family of dehydrogenases. [BMB reports 2012; 45(2: 91-95

Winter fidelity and apparent survival of lesser snow goose populations in the Pacific flyway

Science.gov (United States)

Williams, C.K.; Samuel, M.D.; Baranyuk, Vasily V.; Cooch, E.G.; Kraege, Donald K.

2008-01-01

The Beringia region of the Arctic contains 2 colonies of lesser snow geese (Chen caerulescens caerulescens) breeding on Wrangel Island, Russia, and Banks Island, Canada, and wintering in North America. The Wrangel Island population is composed of 2 subpopulations from a sympatric breeding colony but separate wintering areas, whereas the Banks Island population shares a sympatric wintering area in California, USA, with one of the Wrangel Island subpopulations. The Wrangel Island colony represents the last major snow goose population in Russia and has fluctuated considerably since 1970, whereas the Banks Island population has more than doubled. The reasons for these changes are unclear, but hypotheses include independent population demographics (survival and recruitment) and immigration and emigration among breeding or wintering populations. These demographic and movement patterns have important ecological and management implications for understanding goose population structure, harvest of admixed populations, and gene flow among populations with separate breeding or wintering areas. From 1993 to 1996, we neckbanded molting birds at their breeding colonies and resighted birds on the wintering grounds. We used multistate mark-recapture models to evaluate apparent survival rates, resighting rates, winter fidelity, and potential exchange among these populations. We also compared the utility of face stain in Wrangel Island breeding geese as a predictor of their wintering area. Our results showed similar apparent survival rates between subpopulations of Wrangel Island snow geese and lower apparent survival, but higher emigration, for the Banks Island birds. Males had lower apparent survival than females, most likely due to differences in neckband loss. Transition between wintering areas was low (exchange between the Banks and northern Wrangel Island populations. Face staining was an unreliable indicator of wintering area. Our findings suggest that northern and southern

Laryngospasm With Apparent Aspiration During Sedation With Nitrous Oxide.

Science.gov (United States)

Babl, Franz E; Grindlay, Joanne; Barrett, Michael Joseph

2015-11-01

Nitrous oxide and oxygen mixture has become increasingly popular for the procedural sedation and analgesia of children in the emergency department. In general, nitrous oxide is regarded as a very safe agent according to large case series. We report a case of single-agent nitrous oxide sedation of a child, complicated by laryngospasm and radiographically confirmed bilateral upper lobe pulmonary opacities. Although rarely reported with parenteral sedative agents, laryngospasm and apparent aspiration has not been previously reported in isolated nitrous oxide sedation. This case highlights that, similar to other sedative agents, nitrous oxide administration also needs to be conducted by staff and in settings in which airway emergencies can be appropriately managed. Copyright © 2015 American College of Emergency Physicians. Published by Elsevier Inc. All rights reserved.

Isolation and Antibiogram of Aerobic Nasal Bacterial Flora of Apparently Healthy West African Dwarf Goats

Directory of Open Access Journals (Sweden)

B. O. Emikpe

2009-01-01

Full Text Available Goats are important in the livestock economy by their adaptability to adverse environmental conditions as they are good sources of protein and income for the rural poor. Studies conducted on the bacterial flora of the respiratory tract in goats focused on the pneumonic lungs, with fewer studies on the apparently normal nasal passage and antibiogram of isolated organisms. This study was carried out on 60 apparently healthy West African Dwarf goats. The nasal swab from each goat was analyzed using standard methods. The disc diffusion technique was used for the antibiotic sensitivity test. Three hundred and twenty-eight isolates were obtained. The most frequently isolated species was Streptococcus spp., while Escherichia coli and Staphylococcus aureus were the second dominant bacteria. Other species were isolated at relatively lower rates. The isolation of Mannheimia haemolytica and Pasteurella multocida from the nasal cavity of apparently healthy goats in this study reflects their possible role in most common respiratory diseases encountered in small ruminants. Most of the bacteria were found to be susceptible to streptomycin, quinolones (perfloxacin, ciprofloxacin and ofloxacin and gentamicin, while they were resistant to tetracycline, augmentin and erythromycin. This study shows the relationship between misuse or unrestricted use of antibiotics and drug resistance. Therefore, there is a need for practitioners and researchers to be informed of the appropriate antibiotics to be used in respiratory infections and during control programs.

Effect of oral administration of probiotics on growth performance, apparent nutrient digestibility and stress-related indicators in Holstein calves.

Science.gov (United States)

Zhang, R; Zhou, M; Tu, Y; Zhang, N F; Deng, K D; Ma, T; Diao, Q Y

2016-02-01

This study aimed to investigate the effect of dietary supplementation with Lactobacillus plantarum and Bacillus subtilis on growth performance, apparent nutrient digestibility and stress-related indicators in dairy calves. Twenty-four neonatal Holstein calves were randomly allocated to three treatments: a basal diet with no supplementation (control), the basal diet supplemented with 1.7 × 10(10) CFU per head per day (CFU/h.d) of L. plantarum GF103 (LB group) or the basal diet supplemented with a mixture of L. plantarum GF103 (1.7 × 10(10) CFU/h.d) and B. subtilis B27 (1.7 × 10(8) CFU/h.d) (LBS group). Dry matter intake (DMI), average daily gain (ADG), feed conversation ratio (FCR), apparent digestibility of nutrients and stress-related indicators were measured in this trail. The result indicated that no significant differences were observed in DMI or ADG (p > 0.05), but the FCR was improved in the LB group over the first 12 weeks (p > 0.05). The apparent digestibility of nutrients was not altered by probiotics in week 6 (p > 0.05), but the apparent digestibility of total phosphorus was significantly greater in the LB and LBS groups in week 8 (p > 0.05); additionally, an increase in the apparent digestibility of crude protein was detected in the LBS group (p > 0.05). Oral administration of L. plantarum alone improved the T-lymphocyte transformation rate on days 58 and 62 (p > 0.05), while adding the mixture of L. plantarum and B. subtilis increased the T-lymphocyte transformation rate (p > 0.05) but decreased the content of cortisol on day 58 (p > 0.05). No significant differences were detected between the LB and LBS groups in growth performance, apparent digestibility of nutrients and stress-related indicators (p > 0.05). The results suggested that oral administration of L. plantarum improved growth performance, nutrient digestibility and relieved weaning stress in calves, but no additional effect was obtained by supplementation with B. subtilis. Journal of

Radiation inactivation analysis of enzymes. Effect of free radical scavengers on apparent target sizes

International Nuclear Information System (INIS)

Eichler, D.C.; Solomonson, L.P.; Barber, M.J.; McCreery, M.J.; Ness, G.C.

1987-01-01

In most cases the apparent target size obtained by radiation inactivation analysis corresponds to the subunit size or to the size of a multimeric complex. In this report, we examined whether the larger than expected target sizes of some enzymes could be due to secondary effects of free radicals. To test this proposal we carried out radiation inactivation analysis on Escherichia coli DNA polymerase I, Torula yeast glucose-6-phosphate dehydrogenase, Chlorella vulgaris nitrate reductase, and chicken liver sulfite oxidase in the presence and absence of free radical scavengers (benzoic acid and mannitol). In the presence of free radical scavengers, inactivation curves are shifted toward higher radiation doses. Plots of scavenger concentration versus enzyme activity showed that the protective effect of benzoic acid reached a maximum at 25 mM then declined. Mannitol alone had little effect, but appeared to broaden the maximum protective range of benzoic acid relative to concentration. The apparent target size of the polymerase activity of DNA polymerase I in the presence of free radical scavengers was about 40% of that observed in the absence of these agents. This is considerably less than the minimum polypeptide size and may reflect the actual size of the polymerase functional domain. Similar effects, but of lesser magnitude, were observed for glucose-6-phosphate dehydrogenase, nitrate reductase, and sulfite oxidase. These results suggest that secondary damage due to free radicals generated in the local environment as a result of ionizing radiation can influence the apparent target size obtained by this method

Kinetic evidence of an apparent negative activation enthalpy in an organocatalytic process

KAUST Repository

Han, Xiao

2013-08-30

A combined kinetic and computational study on our tryptophan-based bifunctional thiourea catalyzed asymmetric Mannich reactions reveals an apparent negative activation enthalpy. The formation of the pre-transition state complex has been unambiguously confirmed and these observations provide an experimental support for the formation of multiple hydrogen bonding network between the substrates and the catalyst. Such interactions allow the creation of a binding cavity, a key factor to install high enantioselectivity.

Kinetic evidence of an apparent negative activation enthalpy in an organocatalytic process

KAUST Repository

Han, Xiao; Lee, Richmond; Chen, Tao; Luo, Jie; Lu, Yixin; Huang, Kuo-Wei

2013-01-01

A combined kinetic and computational study on our tryptophan-based bifunctional thiourea catalyzed asymmetric Mannich reactions reveals an apparent negative activation enthalpy. The formation of the pre-transition state complex has been unambiguously confirmed and these observations provide an experimental support for the formation of multiple hydrogen bonding network between the substrates and the catalyst. Such interactions allow the creation of a binding cavity, a key factor to install high enantioselectivity.

Apparent motion perception in lower limb amputees with phantom sensations: "obstacle shunning" and "obstacle tolerance".

Science.gov (United States)

Saetta, Gianluca; Grond, Ilva; Brugger, Peter; Lenggenhager, Bigna; Tsay, Anthony J; Giummarra, Melita J

2018-03-21

Phantom limbs are the phenomenal persistence of postural and sensorimotor features of an amputated limb. Although immaterial, their characteristics can be modulated by the presence of physical matter. For instance, the phantom may disappear when its phenomenal space is invaded by objects ("obstacle shunning"). Alternatively, "obstacle tolerance" occurs when the phantom is not limited by the law of impenetrability and co-exists with physical objects. Here we examined the link between this under-investigated aspect of phantom limbs and apparent motion perception. The illusion of apparent motion of human limbs involves the perception that a limb moves through or around an object, depending on the stimulus onset asynchrony (SOA) for the two images. Participants included 12 unilateral lower limb amputees matched for obstacle shunning (n = 6) and obstacle tolerance (n = 6) experiences, and 14 non-amputees. Using multilevel linear models, we replicated robust biases for short perceived trajectories for short SOA (moving through the object), and long trajectories (circumventing the object) for long SOAs in both groups. Importantly, however, amputees with obstacle shunning perceived leg stimuli to predominantly move through the object, whereas amputees with obstacle tolerance perceived leg stimuli to predominantly move around the object. That is, in people who experience obstacle shunning, apparent motion perception of lower limbs was not constrained to the laws of impenetrability (as the phantom disappears when invaded by objects), and legs can therefore move through physical objects. Amputees who experience obstacle tolerance, however, had stronger solidity constraints for lower limb apparent motion, perhaps because they must avoid co-location of the phantom with physical objects. Phantom limb experience does, therefore, appear to be modulated by intuitive physics, but not in the same way for everyone. This may have important implications for limb experience post

The impact of fibre orientation on T1-relaxation and apparent tissue water content in white matter.

Science.gov (United States)

Schyboll, Felix; Jaekel, Uwe; Weber, Bernd; Neeb, Heiko

2018-02-20

Recent MRI studies have shown that the orientation of nerve fibres relative to the main magnetic field affects the R 2 *(= 1/T 2 *) relaxation rate in white matter (WM) structures. The underlying physical causes have been discussed in several studies but are still not completely understood. However, understanding these effects in detail is of great importance since this might serve as a basis for the development of new diagnostic tools and/or improve quantitative susceptibility mapping techniques. Therefore, in addition to the known angular dependence of R 2 *, the current study investigates the relationship between fibre orientation and the longitudinal relaxation rate, R 1 (= 1/T 1 ), as well as the apparent water content. For a group of 16 healthy subjects, a series of gradient echo, echo-planar and diffusion weighted images were acquired at 3T from which the decay rates, the apparent water content and the diffusion direction were reconstructed. The diffusion weighted data were used to determine the angle between the principle fibre direction and the main magnetic field to examine the angular dependence of R 1 and apparent water content. The obtained results demonstrate that both parameters depend on the fibre orientation and exhibit a positive correlation with the angle between fibre direction and main magnetic field. These observations could be helpful to improve and/or constrain existing biophysical models of brain microstructure by imposing additional constraints resulting from the observed angular dependence R 1 and apparent water content in white matter.

Simulation of variation of apparent resistivity in resistivity surveys using finite difference modelling with Monte Carlo analysis

Science.gov (United States)

Aguirre, E. E.; Karchewski, B.

2017-12-01

DC resistivity surveying is a geophysical method that quantifies the electrical properties of the subsurface of the earth by applying a source current between two electrodes and measuring potential differences between electrodes at known distances from the source. Analytical solutions for a homogeneous half-space and simple subsurface models are well known, as the former is used to define the concept of apparent resistivity. However, in situ properties are heterogeneous meaning that simple analytical models are only an approximation, and ignoring such heterogeneity can lead to misinterpretation of survey results costing time and money. The present study examines the extent to which random variations in electrical properties (i.e. electrical conductivity) affect potential difference readings and therefore apparent resistivities, relative to an assumed homogeneous subsurface model. We simulate the DC resistivity survey using a Finite Difference (FD) approximation of an appropriate simplification of Maxwell's equations implemented in Matlab. Electrical resistivity values at each node in the simulation were defined as random variables with a given mean and variance, and are assumed to follow a log-normal distribution. The Monte Carlo analysis for a given variance of electrical resistivity was performed until the mean and variance in potential difference measured at the surface converged. Finally, we used the simulation results to examine the relationship between variance in resistivity and variation in surface potential difference (or apparent resistivity) relative to a homogeneous half-space model. For relatively low values of standard deviation in the material properties (<10% of mean), we observed a linear correlation between variance of resistivity and variance in apparent resistivity.

Linseed Dietary Fibers Reduce Apparent Digestibility of Energy and Fat and Weight Gain in Growing Rats

Directory of Open Access Journals (Sweden)

Arne Astrup

2013-08-01

Full Text Available Dietary fibers (DF may affect energy balance, an effect often ascribed to the viscous nature of some water soluble DF, which affect luminal viscosity and thus multiple physiological processes. We have tested the hypothesis that viscous linseed DF reduce apparent nutrient digestibility, and limit weight gain, in a randomized feeding trial where 60 male, growing, Wistar rats, with an initial weight of ~200 g, were fed different diets (n = 10 per group: low DF control (C, 5% DF from cellulose (5-CEL, CEL + 5% DF from whole (5-WL or ground linseed (5-GL, CEL + 5% DF from linseed DF extract (5-LDF, and CEL + 10% DF from linseed DF extract (10-LDF. Diets were provided ad libitum for 21 days. Feed intake and faecal output were measured during days 17–21. Faecal fat excretion increased with increasing DF content and was highest in the 10-LDF group. Apparent fat digestibility was highest with the C diet (94.9% ± 0.8% and lowest (74.3% ± 0.6% with the 10-LDF diet, and decreased in a non-linear manner with increasing DF (p < 0.001. Apparent fat digestibility also decreased with increased accessibility of DF (5-WL vs. 5-GL and when the proportion of viscous DF increased (5-GL vs. 5-LDF. The 10-LDF resulted in a lower final body weight (258 ± 6.2 g compared to C (282 ± 5.9 g, 5-CEL (281 ± 5.9 g, and 5-WL (285 ± 5.9 g (p < 0.05. The 10-LDF diet reduced body fat compared to 5-CEL (p < 0.01. In conclusion, DF extracted from linseed reduced apparent energy and fat digestibility and resulted in restriction of body weight gain in growing rats.

Acid dissociation constant and apparent nucleophilicity of lysine-501 of the alpha-polypeptide of sodium and potassium ion activated adenosinetriphosphatase

International Nuclear Information System (INIS)

Xu, K.Y.

1989-01-01

A combination of competitive labeling with [ 3 H]acetic anhydride and immunoaffinity chromatography is described that permits the assignment of the acid dissociation constant and the absolute nucleophilicity of individual lysines in a native enzyme. The acid dissociation constant of lysine-501 of the alpha-polypeptide in native (Na+ + K+)-ATPase was determined. This lysine had a normal pKa of 10.4. The rate constant for the reaction of the free base of lysine-501 with acetic anhydride at 10 degrees C is 400 M-1 s-1. This value is only 30% that for a fully accessible lysine in a protein. The lower than normal apparent nucleophilicity suggests that lysine-501 is hindered from reacting with its intrinsic nucleophilicity by the tertiary structure of the enzyme and is consistent with its location within a pocket that forms the active site upon the surface of the native protein

Apparent target strength in long-rod penetration

Energy Technology Data Exchange (ETDEWEB)

Godwin, R.P.; Chapyak, E.J. [Los Alamos National Lab., NM (United States). Applied Theoretical and Computational Physics Div.

1996-03-01

The authors investigate the apparent enhancement of target strength in the steady-state Tate model of long-rod penetration. They show that computing the effective area over which the target behaves as a fluid provides an explanation of the effective 1-D target strength measured empirically. Expressing the effective target strength as R{sub t} = a {times} Y{sub t}, they postulate that a = A{sub e}/A{sub p}, where Y{sub t} is the nominal strength; A{sub e} is the effective target fluid cross-sectional area and A{sub p} the projectile cross-sectional area. For the case of a rod and projectile of the same material, they use the Tate model together with the jet model of Birkhoff et al. to show a {approx} 4 is likely. Simultaneously satisfying Newton`s Second Law and the Tate model yields a very general derivation of a = 4. By explicitly including strength terms in both the Tate equation and Newton`s Second Law, an even more general a = f(v,{rho}{sub p},{rho}{sub t},Y{sub p},Y{sub t}) can be derived.

Considerations about the apparent 'superluminal expansions' in astrophysics

International Nuclear Information System (INIS)

Recami, E.; Castellino, A.; Maccarrone, G.D.; Rodono, M.

1984-01-01

The orthodox models devised to explain the apparent 'superluminal expansions' observed in astrophysics - and here briefly summarized and discussed together with the experimental data - do not seem to be too much succesful. Especially when confronted with the most recent observations, suggesting complicated expansion patterns, even with possible accelerations. At this point it may be, therefore, of some interest to explore the possible alternative models in which actual Superluminal motions take place. The ground is prepared starting from a variational principle, introducing the elements of a tachyon mechanics within special relativity, and arguing about the expected behaviour of tachyonic objects when interacting (gravitationally, for instance) among themselves or with ordinary matter. Then the simplest 'Superluminal models' are reviewed and developed, paying particular attention to the observations which they would give rise to. Itis concluded that some of them appear to be physically acceptable and are statistically favoured with respect to the orthodox ones. (Author) [pt

Considerations about the apparent superluminal expansions in astrophysics

International Nuclear Information System (INIS)

Recami, E.; Castellino, A.; Maccarrone, G. D.; Rodono, M.

1985-01-01

The ortodox models devised to explain the apparent ''superluminal expansions'' observed in astrophysics, and here briefly summarized and discussed together with th experimental data, do not seem to be to much successful. Especially when confronted with the most recent observations, suggesting complicated expansion patterns, even with possible accelerations. At this point it may be, therefore, of some interest to explore the possible alternative models in which actual superluminal motion take place. To prepare the ground one starts from a variational principle, introduces the elements of a tachyon mechanics within special relativity, and argues about the expected behaviour of tachyonic objects when interacting (gravitationally, for instance) among themselves or with ordinary matter. Then the simplest ''superluminal models'', paying particular attention to the observations which they would give rise to are revie wed and developed. It is concluded that some of them appear to be physically acceptable and are statistically favoured with respect to the ortodox ones

Mating type gene analysis in apparently asexual Cercospora species is suggestive of cryptic sex

NARCIS (Netherlands)

Groenewald, M.; Groenewald, J.Z.; Harrington, T.C.; Abeln, E.C.A.; Crous, P.W.

2006-01-01

The genus Cercospora consists of numerous important, apparently asexual plant pathogens. We designed degenerate primers from homologous sequences in related species to amplify part of the C. apii, C. apiicola, C. beticola, C. zeae-maydis and C. zeina mating type genes. Chromosome walking was used to

Apparent directional mass-transfer capacity coefficients in three-dimensional anisotropic heterogeneous aquifers under radial convergent transport

Science.gov (United States)

Pedretti, D.; Fernàndez-Garcia, D.; Sanchez-Vila, X.; Bolster, D.; Benson, D. A.

2014-02-01

Aquifer hydraulic properties such as hydraulic conductivity (K) are ubiquitously heterogeneous and typically only a statistical characterization can be sought. Additionally, statistical anisotropy at typical characterization scales is the rule. Thus, regardless of the processes governing solute transport at the local (pore) scale, transport becomes non-Fickian. Mass-transfer models provide an efficient tool that reproduces observed anomalous transport; in some cases though, these models lack predictability as model parameters cannot readily be connected to the physical properties of aquifers. In this study, we focus on a multirate mass-transfer model (MRMT), and in particular the apparent capacity coefficient (β), which is a strong indicator of the potential of immobile zones to capture moving solute. We aim to find if the choice of an apparent β can be phenomenologically related to measures of statistical anisotropy. We analyzed an ensemble of random simulations of three-dimensional log-transformed multi-Gaussian permeability fields with stationary anisotropic correlation under convergent flow conditions. It was found that apparent β also displays an anisotropic behavior, physically controlled by the aquifer directional connectivity, which in turn is controlled by the anisotropic correlation model. A high hydraulic connectivity results in large β values. These results provide new insights into the practical use of mass-transfer models for predictive purposes.

Sensitivity to ultraviolet radiation in a dominantly inherited form of xeroderma pigmentosum

International Nuclear Information System (INIS)

Imray, F.P.; Relf, W.; Ramsay, R.G.; Kidson, C.; Hockey, A.

1986-01-01

An Australian family is described in which a mild form of xeroderma pigmentosum (XP) is inherited as an autosomal dominant trait. Studies of lymphoblastoid cells and fibroblasts from affected person demonstrated sensitivity to ultraviolet (UV) light as judged by diminished clonogenicity and higher frequencies of UV induced chromosome aberrations compared to normal controls. After UV irradiation of dominant XP cells, replicative DNA synthesis was depressed to a greater extent than normal and the level of UV induced DNA repair synthesis was lower than that in normal cells. The level of sister chromatid exchanges and the numbers of 6-thioguanine resistant mutants induced by UV irradiation were equal to those found in normal controls. Although two subjects in the family had skin cancers, this dominant form of XP is not apparently associated with high risk, or large numbers of skin cancers in affected persons. (author)

Densities and apparent molar volumes of HClO4(aq) and Yb(ClO4)3(aq) at elevated temperatures and pressures

International Nuclear Information System (INIS)

Hakin, Andrew W.; Lukacs, Michael J.; Jin Lianliu

2004-01-01

Relative densities have been measured for acidified aqueous solutions of ytterbium perchlorate {Yb(ClO 4 ) 3 } at approximately T=(348.15, 373.15, 398.15, and 423.15) K and p=(10.0, 20.0, and 30.0) MPa over the concentration range 0.01624≤m 2 /(mol · kg -1 ) ≤ 0.2531 using an optically coupled vibrating tube densimeter (OCVTD). Experimental apparent molar volumes have been calculated from the density measurements, and apparent molar volumes for the aqueous perchlorate salt have been calculated using Young's rule. The application of Young's rule requires apparent molar volumes for aqueous perchloric acid (HClO 4 ) solutions over extended temperature and pressure ranges. These values were calculated from densities for aqueous HClO 4 solutions that were measured using the OCVTD at the same temperatures and pressures as those used to investigate the density surface of the acidified aqueous Yb(ClO 4 ) 3 solutions. The temperature, pressure, and composition surfaces of the apparent molar volumes for Yb(ClO 4 ) 3 (aq) and HClO 4 (aq) have been modelled using Pitzer ion-interaction equations. Apparent molar volumes at infinite dilution obtained from these models have been compared to those which can be calculated using the semi-empirical Helgeson, Kirkham, and Flowers equations of state. Values for the apparent molar volume at infinite dilution of the ytterbium trivalent cation have also been calculated using simple additivity principles

Allophycocyanin forms isolated from Nostoc sp. phycobilisomes

Energy Technology Data Exchange (ETDEWEB)

Zilinskas, B.A.; Zimmerman, B.K.; Gantt, E.

1978-01-01

Allophycocyanin from dissociated phycobilisomes of Nostoc sp. occurs in three spectrally identifiable forms that fractionate on calcium phosphate adsorption chromatography as: allophycocyanin (APC) I (15 to 20%), APC II (40 to 50%), and APC III (30 to 40%). APC I has a single absorption maximum at 654 nm, and a fluorescence emission peak at 678 nm. The absorption peaks of APC II and III are both at 650 nm, but the relative absorbance at 620/650 nm of APC III is less than that of APC II. The emission of both is maximum at 660 nm. On zone sedimentation in sucrose, their S/sub 20 w/ values of 6.0 +- 0.1 (APC I), 5.0 +- 0.1 (APC II), and 5.3 +-0.2 (APC III) were comparable to the order of their elution from Sephadex G-200. On SDS acrylamide gel electrophoresis two subunits were resolved with apparent molecular weights of 16,900 and 18,400 daltons. When stained by Coomassie blue, they were present in a ratio of 1..cap alpha..:1..beta.. in APC II and III, and a probable ratio of 2..cap alpha..:3..beta.. in APC I. The larger size of APC I may be accounted for by additional ..beta.. subunits, by the presence of an additional polypeptide of 35,000 daltons, or both. Over several days, bleaching as noted by a decrease in absorbance at 650 nm, occurred in all three forms; in addition, the more pronounced bleaching at 650 nm, relative to 620 nm, results in APC III becoming spectrally identical to APC II. A trace of a fourth pigment, probably comparable to allophycocyanin-B, was occasionally detected. The results suggest that several in vitro APC forms (sharing similar subunits) arise upon phycobilisome dissociation, and that APC I is the form most closely related to the final fluorescence emitter of intact phycobilisomes. In this form it probably serves as the bridging pigment in energy transfer from the phycobilisomes to chlorophyll.

High bone mineral apparent density in children with X-linked hypophosphatemia

DEFF Research Database (Denmark)

Beck-Nielsen, Signe; Brixen, K; Gram, J

2013-01-01

of the spine compared to femoral neck. INTRODUCTION: BMAD obtained by dual-energy X-ray absorptiometry scans in children with XLH was evaluated, as they are unlikely to have the extra-skeletal ossifications contributing to the elevated bone mineral density of the spine in adult patients. METHODS: A total of 15......Bone mineral apparent density (BMAD) in children with X-linked hypophosphatemia (XLH) was evaluated, as they are unlikely to have extra-skeletal ossifications contributing to the elevated bone mineral density of the spine in adult patients. Children with XLH also had significantly higher BMAD...

The reductive decomposition of calcium sulphate I. Kinetics of the apparent solid-solid reaction

NARCIS (Netherlands)

Kamphuis, B.; Potma, A.W.; Prins, W.; van Swaaij, Willibrordus Petrus Maria

1992-01-01

The reductive decomposition of calcium sulphate by hydrogen is used for the regeneration of calcium-based atmospheric fluidized bed combustion (AFBC) SO2 sorbents. The apparent solid¿solid reaction between CaS and CaSO4, one of the steps involved in the reaction mechanism of the reductive

Online manual movement adjustments in response to target position changes and apparent target motion

NARCIS (Netherlands)

Oostwoud Wijdenes, L.; Brenner, E.; Smeets, J.B.J.

2014-01-01

This study set out to determine whether the fastest online hand movement corrections are only responses to changing judgments of the targets' position or whether they are also influenced by the apparent target motion. Introducing a gap between when a target disappears and when it reappears at a new

Comparative analysis of the apparent saturation hysteresis approach and the domain theory of hysteresis in respect of prediction of scanning curves and air entrapment

Science.gov (United States)

Beriozkin, A.; Mualem, Y.

2018-05-01

This study theoretically analyzes the concept of apparent saturation hysteresis, combined with the Scott et al. (1983) scaling approach, as suggested by Parker and Lenhard (1987), to account for the effect of air entrapment and release on the soil water hysteresis. We found that the theory of Parker and Lenhard (1987) is comprised of some mutually canceling mathematical operations, and when cleared of the superfluous intermediate calculations, their model reduces to the original Scott et al.'s (1983) scaling method, supplemented with the requirement of closure of scanning loops. Our analysis reveals that actually there is no effect of their technique of accounting for the entrapped air on the final prediction of the effective saturation (or water content) scanning curves. Our consideration indicates that the use of the Land (1968) formula for assessing the amount of entrapped air is in disaccord with the apparent saturation concept as introduced by Parker and Lenhard (1987). In this paper, a proper routine is suggested for predicting hysteretic scanning curves of any order, given the two measured main curves, in the complete hysteretic domain and some verification tests are carried out versus measured results. Accordingly, explicit closed-form formulae for direct prediction (with no need of intermediate calculation) of scanning curves up to the third order are derived to sustain our analysis.

Application of the extreme value approaches to the apparent magnitude distribution of the earthquakes

Science.gov (United States)

Tinti, S.; Mulargia, F.

1985-03-01

The apparent magnitude of an earthquake y is defined as the observed magnitude value and differs from the true magnitude m because of the experimental noise n. If f(m) is the density distribution of the magnitude m, and if g(n) is the density distribution of the error n, then the density distribution of y is simply computed by convolving f and g, i.e. h(y)=f*g. If the distinction between y and m is not realized, any statistical analysis based on the frequency-magnitude relation of the earthquake is bound to produce questionable results. In this paper we investigate the impact of the apparent magnitude idea on the statistical methods that study the earthquake distribution by taking into account only the largest (or extremal) earthquakes. We use two approaches: the Gumbel method based on Gumbel theory ( Gumbel, 1958), and the Poisson method introduced by Epstein and Lomnitz (1966). Both methods are concerned with the asymptotic properties of the magnitude distributions. Therefore, we study and compare the asymptotic behaviour of the distributions h(y) and f(m) under suitable hypotheses on the nature of the experimental noise. We investigate in detail two dinstinct cases: first, the two-side limited symmetrical noise, i.e. the noise that is bound to assume values inside a limited region, and second, the normal noise, i.e. the noise that is distributed according to a normal symmetric distribution. We further show that disregarding the noise generally leads to biased results and that, in the framework of the apparent magnitude, the Poisson approach preserves its usefulness, while the Gumbel method gives rise to a curious paradox.

Glycerin and essential oils in the diet of Nellore bulls finished in feedlot: animal performance and apparent digestibility

Directory of Open Access Journals (Sweden)

Lorrayny Galoro da Silva

2014-05-01

Full Text Available Current research studied the effect of partial replacing corn by glycerin and essential oils addition in the diet of Nellore bulls finished in feedlot on feed intake, animal performance and three markers were assessed to estimate apparent digestibility. Thirty bulls with average weight 400 ± 34.1 kg and 22 ± 2 months old were housed in collective pens (10 x 20 m2 for 63 days. The bulls were randomly assigned to 3 diets (10 bulls per treatment: CON – Control (without glycerin or Essential® oils; GLY – Glycerin (15% on dry matter - DM; and GEO – Glycerin (15% on DM and Essential® oils (3 g animal day-1. Three different markers were used to estimate apparent digestibility in the diets: indigestible dry matter –iDM; indigestible neutral detergent fiber – iNDF; and purified lignin – LIPE®. Feed efficiency and animal performance were not affected by the corn partial replacing by glycerin. No effects were found in partial corn replacing by glycerin and Essential® oils addition in the diets on the fecal output, crude protein and ether extract digestibility among the diets. The DM and OM apparent digestibility were higher for bulls fed with glycerin and Essential® oils. The CHO digestibility was higher for CON diet. The markers iDM, iNDF and LIPE® were similarly to estimate apparent digestibility to all nutrients in the diets.

Must analysis of meaning follow analysis of form? A time course analysis

Directory of Open Access Journals (Sweden)

Laurie eFeldman

2015-03-01

Full Text Available Many models of word recognition assume that processing proceeds sequentially from analysis of form to analysis of meaning. In the context of morphological processing, this implies that morphemes are processed as units of form prior to any influence of their meanings. Some interpret the apparent absence of differences in recognition latencies to targets (SNEAK in form and semantically similar (sneaky-SNEAK and in form similar and semantically dissimilar (sneaker-SNEAK prime contexts at an SOA of 48 ms as consistent with this claim. To determine the time course over which degree of semantic similarity between morphologically structured primes and their targets influences recognition in the forward masked priming variant of the lexical decision paradigm, we compared facilitation for the same targets after semantically similar and dissimilar primes across a range of SOAs. The effect of shared semantics on recognition latency increased linearly with SOA when long SOAs were intermixed (Exp. 1 and latencies were significantly faster after semantically similar than dissimilar primes at homogeneous SOAs of 48 ms (Exp. 2 and 34 ms (Exp. 3. Results limit the scope of form-then-semantics models of recognition and demonstrate that semantics influences even the very early stages of recognition. Finally, once general behavior across trials has been accounted for, we fail to provide evidence for individual differences in morphological processing that can be linked to measures of reading proficiency.

Apparent heat capacity measurements and thermodynamic functions of D(−)-fructose by standard and temperature-modulated calorimetry

International Nuclear Information System (INIS)

Magoń, A.; Pyda, M.

2013-01-01

Highlights: ► Experimental, apparent heat capacity of fructose was investigated by advanced thermal analysis. ► Equilibrium melting parameters of fructose were determined. ► Decomposition, superheating of crystalline fructose during melting process were presented. ► TGA, DSC, and TMDSC are useful tools for characterisation of fructose. - Abstract: The qualitative and quantitative thermal analyses of crystalline and amorphous D(−)-fructose were studied utilising methods of standard differential scanning calorimetry (DSC), quasi-isothermal temperature-modulated differential scanning calorimetry (quasi-isothermal TMDSC), and thermogravimetric analysis (TGA). Advanced thermal analysis of fructose was performed based on heat capacity. The apparent total and apparent reversing heat capacities, as well as phase transition parameters were examined on heating and cooling. The melting temperature, T m , of crystalline D(−)-fructose shows a heating rate dependency, which increases with raising the heating rate and leads to superheating. The equilibrium melting temperatures: T m ∘ (onset) = 370 K and T m ∘ (peak) = 372 K, and the equilibrium enthalpy of fusion Δ fus H ° = 30.30 kJ · mol −1 , of crystalline D(−)-fructose were estimated on heating for the results at zero heating rate. Anomalies in the heat capacity in the liquid state of D(−)-fructose, assigned as possible tautomerisation equilibrium, were analysed by DSC and quasi-isothermal TMDSC, both on heating and cooling. Thermal stability of crystals in the region of the melting temperature was examined by TGA and quasi-isothermal TMDSC. Melting, mutarotation, and degradation processes occur simultaneously and there are differences in values of the liquid heat capacity of D(−)-fructose with varied thermal history, measured by quasi-isothermal TMDSC. Annealing of amorphous D(−)-fructose between the glass transition temperature, T g , and the melting temperature, T m , also leads to

Influence of apparent wave velocity on seismic performance of a super-long-span triple-tower suspension bridge

Directory of Open Access Journals (Sweden)

Hao Wang

2015-06-01

Full Text Available As one of the main characteristics of seismic waves, apparent wave velocity has great influence on seismic responses of long-span suspension bridges. Understanding these influences is important for seismic design. In this article, the critical issues concerning the traveling wave effect analysis are first reviewed. Taizhou Bridge, the longest triple-tower suspension bridge in the world, is then taken as an example for this investigation. A three-dimensional finite element model of the bridge is established in ABAQUS, and the LANCZOS eigenvalue solver is employed to calculate the structural dynamic characteristics. Traveling wave effect on seismic responses of these long-span triple-tower suspension bridges is investigated. Envelopes of seismic shear force and moment in the longitudinal direction along the three towers, relative displacements between the towers and the girder, and reaction forces at the bottoms of the three towers under different apparent wave velocities are calculated and presented in detail. The results show that the effect of apparent wave velocity on the seismic responses of triple-tower suspension bridge fluctuates when the velocity is lower than 2000 m/s, and the effects turn stable when the velocity becomes larger. In addition, the effects of traveling wave are closely related to spectral characteristics and propagation direction of the seismic wave, and seismic responses of components closer to the source are relatively larger. Therefore, reliable estimation of the seismic input and apparent wave velocity according to the characteristics of the bridge site are significant for accurate prediction of seismic responses. This study provides critical reference for seismic analysis and design of long-span triple-tower suspension bridges.

Teaching Form as Form

DEFF Research Database (Denmark)

Keiding, Tina Bering

2012-01-01

understanding of form per se, or, to use an expression from this text, of form as form. This challenge can be reduced to one question: how can design teaching support students in achieving not only the ability to recognize and describe different form-related concepts in existing design (i.e. analytical...

Laws of composition of Bäcklund transformations and the universal form of completely integrable systems in dimensions two and three.

Science.gov (United States)

Chudnovsky, D V; Chudnovsky, G V

1983-03-01

Bäcklund transformations are defined as operations on solutions of a Riemann boundary value problem (vector bundles over P(1)) that add apparent singularities. For solutions of difference and differential linear spectral problems, Bäcklund transformations are presented in explicit form through the Christoffel formula and its generalizations. Identities satisfied by iterations of elementary Bäcklund transformations are represented in the form of the law of addition or as the three-dimensional difference equation of Hirota's type. Matrix two-dimensional isospectral deformation equations are imbedded into three-dimensional scalar systems of Kadomtzev-Petviashvili (law of addition) form. Two-dimensional matrix systems correspond to reductions of Kadomtzev-Petviashvili equations with pseudodifferential operators satisfying algebraic equations.

Characterization of Two Distinct Amorphous Forms of Valsartan by Solid-State NMR.

Science.gov (United States)

Skotnicki, Marcin; Apperley, David C; Aguilar, Juan A; Milanowski, Bartłomiej; Pyda, Marek; Hodgkinson, Paul

2016-01-04

Valsartan (VAL) is an antihypertensive drug marketed in an amorphous form. Amorphous materials can have different physicochemical properties depending on preparation method, thermal history, etc., but the nature of such materials is difficult to study by diffraction techniques. This study characterizes two different amorphous forms of valsartan (AR and AM) using solid-state NMR (SSNMR) as a primary investigation tool, supported by solution-state NMR, FT-IR, TMDSC, and dissolution tests. The two forms are found to be clearly distinct, with a significantly higher level of structural arrangement in the AR form, as observed in (13)C, (15)N, and (1)H SSNMR. (13)C and (15)N NMR indicates that the fully amorphous material (AM) contains an approximately equal ratio of cis-trans conformers about the amide bond, whereas the AR form exists mainly as one conformer, with minor conformational "defects". (1)H ultrafast MAS NMR shows significant differences in the hydrogen bonding involving the tetrazole and acid hydrogens between the two materials, while (15)N NMR shows that both forms exist as a 1,2,3,4-tetrazole tautomer. NMR relaxation times show subtle differences in local and bulk molecular mobility, which can be connected with the glass transition, the stability of the glassy material, and its response to aging. Counterintuitively the fully amorphous material is found to have a significantly lower dissolution rate than the apparently more ordered AR material.

Study of apparent diffusion coefficient value in the normal breastq

International Nuclear Information System (INIS)

Cai Shifeng

2007-01-01

Objective: To investigate the differences of apparent diffusion coefficient (ADC) value in normal breasts and to evaluate the correlation between ADC value and corresponding histology. Methods: Sixty-two normal breasts including 42 normal breasts of 42 patients with unilateral lesions and 20 normal breasts of 10 volunteers were studied. The ADC value of all 62 normal breasts were calculated when b value was given from 1000 to 0 s/mm 2 , 1000 to 500 s/mm 2 and 500 to 0 s/mm 2 . The MRI features of 60 normal breasts were classified into 3 types (dense, lobular-speckled, degenerative types) according to Wolf's classification and histology. Results: DWI and ADC images were different in 3 types of normal breasts because of different histologic structures. The mean ADC value of the dense type breasts was (1.70 ± 0.37) x 10 -3 mm 2 /s, the lobular-speckled type was (1.93 ± 0.46) x 10 -3 mm 2 /s and the degenerative type was (1.18 ± 0.65) x 10 -3 mm 2 /s (F=12.998, P=0.000). There were no significant differences between the dense type and the lobular-speckled type (F=2.167, P=0.147), but significant differences between the dense type and the degenerative type, the lobular-speckled type and the degenerate type (F=5.593 and 19.128; P=0.029 and 0.000). When b value decreased, the ADC value of the dense type and the lobular-speckled type increased correspondingly, but the degenerative type didn't increase apparently. Conclusion: ADC value was influenced by histologic structures in normal breasts and also was influenced by b value in the dense type and lobular-speckled type breasts. (authors)

Prereplicative complexes assembled in vitro support origin-dependent and independent DNA replication

Science.gov (United States)

On, Kin Fan; Beuron, Fabienne; Frith, David; Snijders, Ambrosius P; Morris, Edward P; Diffley, John F X

2014-01-01

Eukaryotic DNA replication initiates from multiple replication origins. To ensure each origin fires just once per cell cycle, initiation is divided into two biochemically discrete steps: the Mcm2-7 helicase is first loaded into prereplicative complexes (pre-RCs) as an inactive double hexamer by the origin recognition complex (ORC), Cdt1 and Cdc6; the helicase is then activated by a set of “firing factors.” Here, we show that plasmids containing pre-RCs assembled with purified proteins support complete and semi-conservative replication in extracts from budding yeast cells overexpressing firing factors. Replication requires cyclin-dependent kinase (CDK) and Dbf4-dependent kinase (DDK). DDK phosphorylation of Mcm2-7 does not by itself promote separation of the double hexamer, but is required for the recruitment of firing factors and replisome components in the extract. Plasmid replication does not require a functional replication origin; however, in the presence of competitor DNA and limiting ORC concentrations, replication becomes origin-dependent in this system. These experiments indicate that Mcm2-7 double hexamers can be precursors of replication and provide insight into the nature of eukaryotic DNA replication origins. PMID:24566989

Apparent molar heat capacities and apparent molar volumes of Pr(ClO{sub 4}){sub 3}(aq), Gd(ClO{sub 4}){sub 3}(aq), Ho(ClO{sub 4}){sub 3}(aq), and Tm(ClO{sub 4}){sub 3}(aq) at T=(288.15, 298.15, 313.15, and 328.15) K and p=0.1 MPa

Energy Technology Data Exchange (ETDEWEB)

Hakin, Andrew W. E-mail: hakin@uleth.ca; Lian Liu, Jin; Erickson, Kristy; Munoz, Julie-Vanessa

2004-09-01

Acidified aqueous solutions of Pr(ClO{sub 4}){sub 3}(aq), Gd(ClO{sub 4}){sub 3}(aq), Ho(ClO{sub 4}){sub 3}(aq), and Tm(ClO{sub 4}){sub 3}(aq) were prepared from the corresponding oxides by dissolution in dilute perchloric acid. Once characterized with respect to trivalent metal cation and acid content, the relative densities of the solutions were measured at T=(288.15, 298.15, 313.15, and 328.15) K and p=0.1 MPa using a Sodev O2D vibrating tube densimeter. The relative massic heat capacities of the aqueous systems were also determined, under the same temperature and pressure conditions, using a Picker Flow Microcalorimeter. All measurements were made on solutions containing rare earth salt in the concentration range 0.01 {<=} m/(mol {center_dot} kg{sup -1}) {<=} 0.2. Relative densities and relative massic heat capacities were used to calculate the apparent molar volumes and apparent molar heat capacities of the acidified salt solutions from which the apparent molar properties of the aqueous salt solutions were extracted by the application of Young's Rule. The concentration dependences of the isothermal apparent molar volumes and heat capacities of each aqueous salt solution were modelled using Pitzer ion-interaction equations. These models produced estimates of apparent molar volumes and apparent molar heat capacities at infinite dilution for each set of isothermal V{sub phi,2} and C{sub pphi,2} values. In addition, the temperature and concentration dependences of the apparent molar volumes and apparent molar heat capacities of the aqueous rare earth perchlorate salt solutions were modelled using modified Pitzer ion-interaction equations. The latter equations utilized the Helgeson, Kirkham, and Flowers equations of state to model the temperature dependences (at p=0.1 MPa) of apparent molar volumes and apparent molar heat capacities at infinite dilution. The results of the latter models were compared to those previously published in the literature. Apparent

Apparent Diffusion Coefficient and Dynamic Contrast-Enhanced Magnetic Resonance Imaging in Pancreatic Cancer: Characteristics and Correlation With Histopathologic Parameters.

Science.gov (United States)

Ma, Wanling; Li, Na; Zhao, Weiwei; Ren, Jing; Wei, Mengqi; Yang, Yong; Wang, Yingmei; Fu, Xin; Zhang, Zhuoli; Larson, Andrew C; Huan, Yi

2016-01-01

To clarify diffusion and perfusion abnormalities and evaluate correlation between apparent diffusion coefficient (ADC), MR perfusion and histopathologic parameters of pancreatic cancer (PC). Eighteen patients with PC underwent diffusion-weighted imaging and dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI). Parameters of DCE-MRI and ADC of cancer and non-cancerous tissue were compared. Correlation between the rate constant that represents transfer of contrast agent from the arterial blood into the extravascular extracellular space (K, volume of the extravascular extracellular space per unit volume of tissue (Ve), and ADC of PC and histopathologic parameters were analyzed. The rate constant that represents transfer of contrast agent from the extravascular extracellular space into blood plasma, K, tissue volume fraction occupied by vascular space, and ADC of PC were significantly lower than nontumoral pancreases. Ve of PC was significantly higher than that of nontumoral pancreas. Apparent diffusion coefficient and K values of PC were negatively correlated to fibrosis content and fibroblast activation protein staining score. Fibrosis content was positively correlated to Ve. Apparent diffusion coefficient values and parameters of DCE-MRI can differentiate PC from nontumoral pancreases. There are correlations between ADC, K, Ve, and fibrosis content of PC. Fibroblast activation protein staining score of PC is negatively correlated to ADC and K. Apparent diffusion coefficient, K, and Ve may be feasible to predict prognosis of PC.

MERGER SIGNATURES IN THE DYNAMICS OF STAR-FORMING GAS

International Nuclear Information System (INIS)

Hung, Chao-Ling; Sanders, D. B.; Hayward, Christopher C.; Smith, Howard A.; Ashby, Matthew L. N.; Martínez-Galarza, Juan R.; Zezas, Andreas; Lanz, Lauranne

2016-01-01

The recent advent of integral field spectrographs and millimeter interferometers has revealed the internal dynamics of many hundreds of star-forming galaxies. Spatially resolved kinematics have been used to determine the dynamical status of star-forming galaxies with ambiguous morphologies, and constrain the importance of galaxy interactions during the assembly of galaxies. However, measuring the importance of interactions or galaxy merger rates requires knowledge of the systematics in kinematic diagnostics and the visible time with merger indicators. We analyze the dynamics of star-forming gas in a set of binary merger hydrodynamic simulations with stellar mass ratios of 1:1 and 1:4. We find that the evolution of kinematic asymmetries traced by star-forming gas mirrors morphological asymmetries derived from mock optical images, in which both merger indicators show the largest deviation from isolated disks during strong interaction phases. Based on a series of simulations with various initial disk orientations, orbital parameters, gas fractions, and mass ratios, we find that the merger signatures are visible for ∼0.2–0.4 Gyr with kinematic merger indicators but can be approximately twice as long for equal-mass mergers of massive gas-rich disk galaxies designed to be analogs of z ∼ 2–3 submillimeter galaxies. Merger signatures are most apparent after the second passage and before the black holes coalescence, but in some cases they persist up to several hundred Myr after coalescence. About 20%–60% of the simulated galaxies are not identified as mergers during the strong interaction phase, implying that galaxies undergoing violent merging process do not necessarily exhibit highly asymmetric kinematics in their star-forming gas. The lack of identifiable merger signatures in this population can lead to an underestimation of merger abundances in star-forming galaxies, and including them in samples of star-forming disks may bias the measurements of disk

Apparent molar volumes and apparent molar heat capacities of aqueous magnesium nitrate, strontium nitrate, and manganese nitrate at temperatures from 278.15 K to 393.15 K and at the pressure 0.35 MPa

International Nuclear Information System (INIS)

Jones, J.S.; Ziemer, S.P.; Brown, B.R.; Woolley, E.M.

2007-01-01

Apparent molar volumes V φ and apparent molar heat capacities C p,φ were determined at the pressure 0.35 MPa for aqueous solutions of magnesium nitrate Mg(NO 3 ) 2 at molalities m = (0.02 to 1.0) mol . kg -1 , strontium nitrate Sr(NO 3 ) 2 at m = (0.05 to 3.0) mol . kg -1 , and manganese nitrate Mn(NO 3 ) 2 at m = (0.01 to 0.5) mol . kg -1 . Our V φ values were calculated from solution densities obtained at T = (278.15 to 368.15) K using a vibrating-tube densimeter, and our C p,φ values were calculated from solution heat capacities obtained at T = (278.15 to 393.15) K using a twin fixed-cell, differential, temperature-scanning calorimeter. Empirical functions of m and T were fitted to our results, and standard state partial molar volumes and heat capacities were obtained over the ranges of T investigated

Apparent losses due to domestic water meter under-registration in South Africa

OpenAIRE

Couvelis, FA; van Zyl, JE

2015-01-01

This study investigated the extent of apparent losses due to water meter under-registration in South Africa. This was done by first estimating the under-registration of new meters due to on-site leakage, and then the additional under-registration due to meter aging. The extent and flow distributions of on-site leakage were determined through field studies in Cape Town, Mangaung and Johannesburg, by measuring the flow through new water meters when no legitimate consumption occurred on the prop...

Absence of penicillin-binding protein 4 from an apparently normal strain of Bacillus subtilis.

OpenAIRE

Buchanan, C E

1987-01-01

The phenotype of a Bacillus subtilis 168 strain with no detectable penicillin-binding protein 4 was examined. Despite the fact that penicillin-binding protein 4 is one of the most penicillin-sensitive proteins in the species, its apparent loss had no obvious effect on the organism or its susceptibility to various beta-lactam antibiotics.

Destabilization of Oil-in-Water Emulsions Formed Using Highly Hydrolyzed Whey Proteins.

Science.gov (United States)

Agboola; Singh; Munro; Dalgleish; Singh

1998-01-19

Oil-in-water emulsions (4 wt % soy oil) were prepared with 0.5-5 wt % whey protein hydrolysate (WPH) (27% degree of hydrolysis), in a two-stage homogenizer using various first-stage pressures of 10.3, 20.6, and 34.3 MPa and a constant second-stage pressure of 3.4 MPa. Destabilization studies on the emulsions were carried out for up to 24 h, using both laser light scattering and confocal laser microscopy. It was found that emulsions formed with oiling off and coalescence at all homogenization pressures. Emulsions formed with 2, 3, and 4% WPH showed coalescence and creaming only, while slight flocculation but no creaming occurred in emulsions formed with 5% WPH. Furthermore, the apparent rate of coalescence increased with homogenization pressure but decreased with WPH concentration. In contrast, the surface concentration of WPH increased with the WPH concentration in the emulsions but decreased with homogenization pressure. Analysis of WPH by high-performance liquid chromatography showed an increase in the concentration of high molecular weight peptides at the droplet surface compared to the WPH solution. This was considered very important for the stability of these oil-in-water emulsions.

The Effect of Exogenous Protease in Broiler Diets on the Apparent Ileal Digestibility of Amino Acids and on Protease Activity in Jejunum

Directory of Open Access Journals (Sweden)

Vojtěch Rada

2016-01-01

Full Text Available The objective of this study was to evaluate the effect of a mono-component commercial serine protease supplement in broiler diets on apparent ileal amino acid digestibility and protease activity. A total of 150 male (28 d old ROSS 308 were randomly placed into 30 battery pens and divided into 5 treatment groups with 6 replicates each. The experiment was performed for 7 days. Five dietary treatments were used: 2 standard protein diets without (SP and with protease (SP + P formulated 20.7 % CP, 2 lower-protein diets (19.9 % CP without (LP and with protease (LP + P and one lower‑protein diet with protease and with doubled rapeseed meal (RSM content (SP-RSM + P compared with the other treatments. Lower-protein diets were formulated with a 4 % decrease in the relative CP value compared with the standard protein diet. Enzyme protease was added to the diets at a concentration of 200 ppm (15,000 PROT units per kg. The diets contained 0.3 % Cr2O3 to facilitate the estimation of apparent AA digestibility and overall apparent ileal crude protein digestibility. Mono-component protease had no effect on apparent ileal AA digestibility or jejunum protease activity if diets contained the same level of RSM. The supplement of exogenous protease did not affect (P > 0.05 the apparent ileal AA digestibility coefficients if a higher RSM level was used. The CP level influenced (P < 0.05 only the coefficients of the apparent ileal AA digestibility of Pro and Arg. The RSM level (P < 0.01 had significant effects on protease activity in the jejunum.

Gene interference regulates aquaporin-4 expression in swollen tissue of rats with cerebral ischemic edema: Correlation with variation in apparent diffusion coefficient.

Science.gov (United States)

Hu, Hui; Lu, Hong; He, Zhanping; Han, Xiangjun; Chen, Jing; Tu, Rong

2012-07-25

To investigate the effects of mRNA interference on aquaporin-4 expression in swollen tissue of rats with ischemic cerebral edema, and diagnose the significance of diffusion-weighted MRI, we injected 5 μL shRNA- aquaporin-4 (control group) or siRNA- aquaporin-4 solution (1:800) (RNA interference group) into the rat right basal ganglia immediately before occlusion of the middle cerebral artery. At 0.25 hours after occlusion of the middle cerebral artery, diffusion-weighted MRI displayed a high signal; within 2 hours, the relative apparent diffusion coefficient decreased markedly, aquaporin-4 expression increased rapidly, and intracellular edema was obviously aggravated; at 4 and 6 hours, the relative apparent diffusion coefficient slowly returned to control levels, aquaporin-4 expression slightly increased, and angioedema was observed. In the RNA interference group, during 0.25-6 hours after injection of siRNA- aquaporin-4 solution, the relative apparent diffusion coefficient slightly fluctuated and aquaporin-4 expression was upregulated; during 0.5-4 hours, the relative apparent diffusion coefficient was significantly higher, while aquaporin-4 expression was significantly lower when compared with the control group, and intracellular edema was markedly reduced; at 0.25 and 6 hours, the relative apparent diffusion coefficient and aquaporin-4 expression were similar when compared with the control group; obvious angioedema remained at 6 hours. Pearson's correlation test results showed that aquaporin-4 expression was negatively correlated with the apparent diffusion coefficient (r = -0.806, P coefficient. Aquaporin-4 gene interference can effectively inhibit the upregulation of aquaporin-4 expression during the stage of intracellular edema with time-effectiveness. Moreover, diffusion-weighted MRI can accurately detect intracellular edema.

Apparent molar volumes and apparent molar heat capacities of Pr(NO{sub 3}){sub 3}(aq), Gd(NO{sub 3}){sub 3}(aq), Ho(NO{sub 3}){sub 3}(aq), and Y(NO{sub 3}){sub 3}(aq) at T (288.15, 298.15, 313.15, and 328.15) K and p = 0.1 MPa

Energy Technology Data Exchange (ETDEWEB)

Hakin, Andrew W. [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada)]. E-mail: hakin@uleth.ca; Liu Jinlian [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada); Erickson, Kristy [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada); Munoz, Julie-Vanessa [Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, Alberta, T1K 3M4 (Canada); Rard, Joseph A. [Energy and Environment Directorate, Lawrence Livermore National Laboratory, University of California, Livermore, CA 94550 (United States)

2005-02-01

Relative densities and relative massic heat capacities have been measured for acidified solutions of Y(NO{sub 3}){sub 3}(aq), Pr(NO{sub 3}){sub 3}(aq), and Gd(NO{sub 3}){sub 3}(aq) at T = (288.15, 298.15, 313.15, and 328.15) K and p = 0.1 MPa. In addition, relative densities and massic heat capacities have been measured at the same temperatures and pressure for Y(NO{sub 3}){sub 3}(aq) and Ho(NO{sub 3}){sub 3}(aq) solutions without excess acid (n.b. measurements at T = 328.15 K for Ho(NO{sub 3}){sub 3}(aq) were not performed due to the limited volume of solution available). Apparent molar volumes and apparent molar heat capacities for the aqueous salt solutions have been calculated from the experimental apparent molar properties of the acidified solutions using Young's rule, whereas the apparent molar properties of the solutions without excess acid were calculated directly from the measured densities and massic heat capacities. The two sets of data for the Y(NO{sub 3}){sub 3}(aq) systems provide a check of the internal consistency of the Young's rule approach we have utilised. The concentration dependences of the apparent molar volumes and heat capacities of the aqueous salt solutions have been modelled at each investigated temperature using the Pitzer ion interaction equations to yield apparent molar properties at infinite dilution. Complex formation within the aqueous rare earth nitrate systems is discussed qualitatively by probing the concentration dependence of apparent molar volumes and heat capacities. In spite of the complex formation in the aqueous rare earth nitrate systems, there is a high degree of self-consistency between the apparent molar volumes and heat capacities at infinite dilution reported in this manuscript and those previously reported for aqueous rare earth perchlorates.

Mean-coordination number dependence of the fragility in Ge-Se-In glass-forming liquids

International Nuclear Information System (INIS)

Saffarini, G.; Saiter, A.; Garda, M.R.; Saiter, J.M.

2007-01-01

Differential scanning calorimetry measurements have been performed on elemental Se as well as on Ge x Se 94- x In 6 (x=4, 8, and 11 at%) and on Ge y Se 88- y In 12 (y=5, 7, and 9 at%) chalcogenide glasses. From the cooling rate dependence of the fictive temperature, the apparent activation energies, Δh*, and the fragility indices, m, as defined in the strong-fragile glass-forming liquid concept, are determined. It is found that, in Ge-Se-In system, there is an evolution from strong (m=67) to fragile (m=116) glass-forming liquids. The dependence of 'm' on the mean-coordination number, Z, is also obtained. This dependence is rationalized by assuming that, in this glassy alloy system, there is a tendency for the formation of In 2 Se 3 clusters

Structural basis of thermal stability of the tungsten cofactor synthesis protein MoaB from Pyrococcus furiosus.

Directory of Open Access Journals (Sweden)

Nastassia Havarushka

Full Text Available Molybdenum and tungsten cofactors share a similar pterin-based scaffold, which hosts an ene-dithiolate function being essential for the coordination of either molybdenum or tungsten. The biosynthesis of both cofactors involves a multistep pathway, which ends with the activation of the metal binding pterin (MPT by adenylylation before the respective metal is incorporated. In the hyperthermophilic organism Pyrococcus furiosus, the hexameric protein MoaB (PfuMoaB has been shown to catalyse MPT-adenylylation. Here we determined the crystal structure of PfuMoaB at 2.5 Å resolution and identified key residues of α3-helix mediating hexamer formation. Given that PfuMoaB homologues from mesophilic organisms form trimers, we investigated the impact on PfuMoaB hexamerization on thermal stability and activity. Using structure-guided mutagenesis, we successfully disrupted the hexamer interface in PfuMoaB. The resulting PfuMoaB-H3 variant formed monomers, dimers and trimers as determined by size exclusion chromatography. Circular dichroism spectroscopy as well as chemical cross-linking coupled to mass spectrometry confirmed a wild-type-like fold of the protomers as well as inter-subunits contacts. The melting temperature of PfuMoaB-H3 was found to be reduced by more than 15 °C as determined by differential scanning calorimetry, thus demonstrating hexamerization as key determinant for PfuMoaB thermal stability. Remarkably, while a loss of activity at temperatures higher than 50 °C was observed in the PfuMoaB-H3 variant, at lower temperatures, we determined a significantly increased catalytic activity. The latter suggests a gain in conformational flexibility caused by the disruption of the hexamerization interface.

Apparent enrichment of organically bound tritium in rivers explained by the heritage of our past.

Science.gov (United States)

Eyrolle-Boyer, Frédérique; Boyer, Patrick; Claval, David; Charmasson, Sabine; Cossonnet, Catherine

2014-10-01

The global inventory of naturally produced tritium (3H) is estimated at 2.65 kg, whereas more than 600 kg have been released during atmospheric nuclear tests (NCRP, 1979; UNSCEAR, 2000) constituting the main source of artificial tritium throughout the Anthropocene. The behaviour of this radioactive isotope in the environment has been widely studied since the 1950s, both through laboratory experiments and, more recently, through field observations (e.g., Cline, 1953; Kirchmann et al., 1979; Daillant et al., 2004; McCubbin et al., 2001; Kim et al., 2012). In its "free" forms, [i.e. 3H gas or 3H hydride (HT); methyl 3H gas (CH3T); tritiated H2O or 3H-oxide (HTO); and Tissue Free Water 3H (TFWT)], tritium closely follows the water cycle. However, 3H bound with organic compounds, mainly during the basic stages of photosynthesis or through weak hydrogen links, is less exchangeable with water, which explains its persistence in the carbon cycle as re underlined recently by Baglan et al. (2013), Jean-Batiste and Fourré (2013), Kim et al. (2013a,b). In this paper, we demonstrate that terrestrial biomass pools, historically contaminated by global atmospheric fallout from nuclear testing, have constituted a significant delayed source of organically bound tritium (OBT) for aquatic systems, resulting in an apparent enrichment of OBT as compared to HTO. This finding helps to explain concentration factors (tritium concentration in biota/concentration in water) greater than 1 observed in areas that are not directly affected by industrial radioactive wastes, and thus sheds light on the controversies regarding tritium 'bioaccumulation'. Such apparent enrichment of OBT is expected to be more pronounced in the Northern Hemisphere where fallout was most significant, depending on the nature and biodegradability of terrestrial biomass at the regional scale. We further believe that OBT transfers from the continent to oceans have been sufficient to affect tritium concentrations in

Apparent foraging success reflects habitat quality in an irruptive species, the Black-backed Woodpecker

Science.gov (United States)

Christopher T. Rota; Mark A. Rumble; Chad P. Lehman; Dylan C. Kesler; Joshua J. Millspaugh

2015-01-01

Dramatic fluctuations in food resources are a key feature of many habitats, and many species have evolved a movement strategy to exploit food resources that are unpredictable in space and time. The availability of food resources may be a particularly strong determinant of habitat quality for irruptive bird species. We studied the apparent foraging success of Black-...

Prenatal diagnosis of familial transmission of 17q12 microduplication associated with no apparent phenotypic abnormality

Directory of Open Access Journals (Sweden)

Chih-Ping Chen

2016-12-01

Conclusion: The 17q12 microduplication may present with variable phenotypes including no apparent phenotypic abnormality in familial cases. However, neuropsychiatry assessment and monitoring should be warranted in childhood and through adulthood under such a circumstance.

A marine microbial consortium apparently mediating anaerobic oxidation of methane

DEFF Research Database (Denmark)

Boetius, A.; Ravenschlag, K.; Schubert, CJ

2000-01-01

microorganisms mediating this reaction have not yet been isolated, and the pathway of anaerobic oxidation of methane is insufficiently understood. Recent data suggest that certain archaea reverse the process of methanogenesis by interaction with sulphate-reducing bacteria(5-7). Here we provide microscopic...... cells and are surrounded by sulphate-reducing bacteria. These aggregates were abundant in gas-hydrate-rich sediments with extremely high rates of methane-based sulphate reduction, and apparently mediate anaerobic oxidation of methane.......A large fraction of globally produced methane is converted to CO2 by anaerobic oxidation in marine sediments(1). Strong geochemical evidence for net methane consumption in anoxic sediments is based on methane profiles(2), radiotracer experiments(3) and stable carbon isotope data(4). But the elusive...

Apparent Surface Free Energy of Polymer/Paper Composite Material Treated by Air Plasma

Directory of Open Access Journals (Sweden)

Konrad Terpiłowski

2017-01-01

Full Text Available Surface plasma treatment consists in changes of surface properties without changing internal properties. In this paper composite polymer/paper material is used for production of packaging in cosmetic industry. There are problems with bonding this material at the time of packaging production due to its properties. Composite surface was treated by air plasma for 1, 10, 20, and 30 s. The advancing and receding contact angles of water, formamide, and diiodomethane were measured using both treated and untreated samples. Apparent surface free energy was estimated using the hysteresis (CAH and Van Oss, Good, Chaudhury approaches (LWAB. Surface roughness was investigated using optical profilometry and identification of after plasma treatment emerging chemical groups was made by means of the XPS (X-ray photoelectron spectroscopy technique. After plasma treatment the values of contact angles decreased which is particularly evident for polar liquids. Apparent surface free energy increased compared to that of untreated samples. Changes of energy value are due to the electron-donor parameter of energy. This parameter increases as a result of adding polar groups at the time of surface plasma activation. Changes of surface properties are combination of increase of polar chemical functional groups, increase on the surface, and surface roughness increase.

Must analysis of meaning follow analysis of form? A time course analysis.

Science.gov (United States)

Feldman, Laurie B; Milin, Petar; Cho, Kit W; Moscoso Del Prado Martín, Fermín; O'Connor, Patrick A

2015-01-01

Many models of word recognition assume that processing proceeds sequentially from analysis of form to analysis of meaning. In the context of morphological processing, this implies that morphemes are processed as units of form prior to any influence of their meanings. Some interpret the apparent absence of differences in recognition latencies to targets (SNEAK) in form and semantically similar (sneaky-SNEAK) and in form similar and semantically dissimilar (sneaker-SNEAK) prime contexts at a stimulus onset asynchrony (SOA) of 48 ms as consistent with this claim. To determine the time course over which degree of semantic similarity between morphologically structured primes and their targets influences recognition in the forward masked priming variant of the lexical decision paradigm, we compared facilitation for the same targets after semantically similar and dissimilar primes across a range of SOAs (34-100 ms). The effect of shared semantics on recognition latency increased linearly with SOA when long SOAs were intermixed (Experiments 1A and 1B) and latencies were significantly faster after semantically similar than dissimilar primes at homogeneous SOAs of 48 ms (Experiment 2) and 34 ms (Experiment 3). Results limit the scope of form-then-semantics models of recognition and demonstrate that semantics influences even the very early stages of recognition. Finally, once general performance across trials has been accounted for, we fail to provide evidence for individual differences in morphological processing that can be linked to measures of reading proficiency.

Lean body mass, interleukin 18, and metabolic syndrome in apparently healthy Chinese.

Directory of Open Access Journals (Sweden)

Liang Sun

Full Text Available OBJECTIVE: We aimed to investigate how lean body mass is related to circulating Interleukin 18 (IL-18 and its association with metabolic syndrome (MetS among apparently healthy Chinese. METHODS: A population-based sample of 1059 Chinese men and women aged 35-54 years was used to measure plasma IL-18, glucose, insulin, lipid profile, inflammatory markers and high-molecular-weight (HMW-adiponectin. Fat mass index (FMI and lean mass index (LMI were measured by dual-energy X-ray absorptiometry. MetS was defined by the updated National Cholesterol Education Program Adult Treatment Panel III criteria for Asian-Americans. RESULTS: Circulating IL-18 was positively correlated with LMI after adjustment for FMI (correlation coefficient = 0.11, P<0.001. The association with the MetS (odds ratio 3.43, 95% confidence interval 2.01-5.85 was substantially higher in the highest than the lowest quartile of IL-18 after multiple adjustments including body mass index. In the stratified multivariable regression analyses, the positive association between IL-18 and MetS was independent of tertiles of FMI, inflammatory markers and HMW-adiponectin, but significantly interacted with tertile of LMI (P for interaction = 0.010. CONCLUSION: Elevated plasma IL-18 was associated with higher MetS prevalence in apparently healthy Chinese, independent of traditional risk factors, FMI, inflammatory markers and HMW-adiponectin. More studies are needed to clarify the role of lean mass in IL-18 secretion and its associated cardio-metabolic disorders.

Influence of processing conditions on apparent viscosity and system parameters during extrusion of distiller's dried grains-based snacks.

Science.gov (United States)

Singha, Poonam; Muthukumarappan, Kasiviswanathan; Krishnan, Padmanaban

2018-01-01

A combination of different levels of distillers dried grains processed for food application (FDDG), garbanzo flour and corn grits were chosen as a source of high-protein and high-fiber extruded snacks. A four-factor central composite rotatable design was adopted to study the effect of FDDG level, moisture content of blends, extrusion temperature, and screw speed on the apparent viscosity, mass flow rate or MFR, torque, and specific mechanical energy or SME during the extrusion process. With increase in the extrusion temperature from 100 to 140°C, apparent viscosity, specific mechanical energy, and torque value decreased. Increase in FDDG level resulted in increase in apparent viscosity, SME and torque. FDDG had no significant effect (p > .5) on mass flow rate. SME also increased with increase in the screw speed which could be due to the higher shear rates at higher screw speeds. Screw speed and moisture content had significant negative effect ( p  extruder and the system parameters were affected by the processing conditions. This study will be useful for control of extrusion process of blends containing these ingredients for the development of high-protein high-fiber extruded snacks.

Comparison of three inert markers in measuring apparent nutrient digestibility of juvenile abalone under different culture condition and temperature regimes

Science.gov (United States)

Nur, K. U.; Adams, L.; Stone, D.; Savva, N.; Adams, M.

2018-03-01

A comparative research using three inert markers, chromic oxide, yttrium and ytterbium to measure the apparent nutrient digestibility of experimental feed in juvenile Hybrid abalone (Haliotis rubra X H. laevigata) and Greenlip abalone (H.laevigata) revealed that apparent digestibility of crude protein (ADCP) measured using yttrium and ytterbium in hybrid abalone were significantly different across the treatments. Protein digestibility measured in experimental tanks was higher than those measured in indoor and outdoor commercial tanks, regardless of inert marker used. Chromic oxide led to overestimated ADCP compared to when measured using yttrium and ytterbium. There were no significant interactions between temperature and inert markers when measuring ADCP and apparent digestibility of gross energy (ADGE). However, there was a significant difference of ADCP amongst inert markers when measured in greenlip abalone cultured at two temperatures. While measurements of ADge calculated using three inert markers shared the same value.

Program Cost Accounting Manual. Form J-380/Form J-580, 1989-90.

Science.gov (United States)

California State Dept. of Education, Sacramento. Office of Financial Management Practices and Standards.

In response to criticism by legislators, the business community, and other publics for an apparent lack of sound financial management, the California State Department of Education, together with representatives from the field and from state control agencies, began to develop a new program cost accounting system in 1984. After pilot testing, the…

Investigation of the intermediate- and high-density forms of amorphous ice by molecular dynamics calculations and diffraction experiments

International Nuclear Information System (INIS)

Tse, John S.; Klug, Dennis D.; Guthrie, Malcolm; Benmore, Chris J.; Urquidi, Jacob; Tulk, Chris A.

2005-01-01

The lack of an 'isosbestic' point in the oxygen-oxygen atom radial distribution functions (RDFs) for the HDA→LDA ice transformation at ambient pressure derived from molecular dynamics (MD) calculations show unequivocally that intermediate phases are not equilibrium mixtures of these two amorphous forms. This is supported by x-ray structure factor data, where it is found that linear combinations of the starting and end amorphous forms do not describe intermediate forms of amorphous ice formed during the transformation. This reflects the fact that the x-ray data are heavily weighted to O-O correlations and therefore sensitive to the basic structural changes that occur during the relaxation process. The ice Ih→HDA transformation is also reexamined using MD to identify its thermodynamic nature. This apparently first-order transition induced by a mechanical instability is investigated by compression followed by decompression to negative pressures. In this study we demonstrated that the full van der Waals loop for this transition can be identified

Collective dynamics of glass-forming polymers at intermediate length scales

International Nuclear Information System (INIS)

Colmenero, J.; Alvarez, F.; Arbe, A.

2015-01-01

Deep understanding of the complex dynamics taking place in glass-forming systems could potentially be gained by exploiting the information provided by the collective response monitored by coherent neutron scattering. We have revisited the question of the characterization of the collective response of polyisobutylene at intermediate length scales observed by neutron spin echo (NSE) experiments. The model, generalized for sub-linear diffusion - as it is the case of glass-forming polymers - has been successfully applied by using the information on the total self-motions available from MD-simulations properly validated by direct comparison with experimental results. From the fits of the coherent NSE data, the collective time at Q → 0 has been extracted that agrees very well with compiled results from different experimental techniques directly accessing such relaxation time. We show that a unique temperature dependence governs both, the Q → 0 and Q → ∞ asymptotic characteristic times. The generalized model also gives account for the modulation of the apparent activation energy of the collective times with the static structure factor. It mainly results from changes of the short-range order at inter-molecular length scales

Accurate potentiometric determination of lipid membrane-water partition coefficients and apparent dissociation constants of ionizable drugs: electrostatic corrections.

Science.gov (United States)

Elsayed, Mustafa M A; Vierl, Ulrich; Cevc, Gregor

2009-06-01

Potentiometric lipid membrane-water partition coefficient studies neglect electrostatic interactions to date; this leads to incorrect results. We herein show how to account properly for such interactions in potentiometric data analysis. We conducted potentiometric titration experiments to determine lipid membrane-water partition coefficients of four illustrative drugs, bupivacaine, diclofenac, ketoprofen and terbinafine. We then analyzed the results conventionally and with an improved analytical approach that considers Coulombic electrostatic interactions. The new analytical approach delivers robust partition coefficient values. In contrast, the conventional data analysis yields apparent partition coefficients of the ionized drug forms that depend on experimental conditions (mainly the lipid-drug ratio and the bulk ionic strength). This is due to changing electrostatic effects originating either from bound drug and/or lipid charges. A membrane comprising 10 mol-% mono-charged molecules in a 150 mM (monovalent) electrolyte solution yields results that differ by a factor of 4 from uncharged membranes results. Allowance for the Coulombic electrostatic interactions is a prerequisite for accurate and reliable determination of lipid membrane-water partition coefficients of ionizable drugs from potentiometric titration data. The same conclusion applies to all analytical methods involving drug binding to a surface.

The incidence of apparent congenital urogenital anomalies in North Indian newborns: A study of 20,432 pregnancies

Directory of Open Access Journals (Sweden)

A. Bhat

2016-09-01

Conclusions: The incidence of apparent congenital urogenital anomalies was 3.91%. Infertility treatment, parity >2 and a maternal age >30 years were independently associated with an increased risk of congenital urogenital anomalies.

Apparent luminosity function of galaxies to the twenty-first magnitude

International Nuclear Information System (INIS)

Brown, G.S.

1979-01-01

Galaxy counts to limiting magnitudes B=17.7 to 21.0 in 13 selected areas in the north galactic polar cap are presented. The photographs were taken with a reducing camera at the Cassegrain focus of the 91 cm and 205 cm reflectors of McDonald Observatory. Both galaxy and star images were counted and recorded. On each plate a few stars and galaxies were marked as representative of the plate limit. Selected brighter galaxies and stars were measured photoelectrically to fix the zero points. The B magnitude limits of each plate for stars and galaxies are obtained by a combination of photoelectric and photographic photometry. The resulting apparent luminosity functions of galaxies and stars are compared with earlier data. Sources of error in the counts are discussed in detail

Owner assessment of pruritus and gastrointestinal signs in apparently healthy dogs with no history of cutaneous or noncutaneous disease.

Science.gov (United States)

Stetina, Kacie M; Marks, Stanley L; Griffin, Craig E

2015-08-01

Determining the cause of pruritus relies on establishing the pattern of abnormal pruritus. The presence of gastrointestinal (GI) disease has also been helpful in determining the cause of pruritus. No study has systematically evaluated typical GI signs and pruritic behaviours in apparently healthy dogs. To evaluate owners' perceptions of pruritus and GI signs in apparently healthy dogs, and determine if age, breed, activity, diet or supplements affected these signs. Three hundred and fourteen apparently healthy dogs ≥ 12 months old with an unremarkable physical examination and no history of pruritus, otitis, skin/hair disease, metabolic or GI disease were enrolled. Thirty one veterinarians enrolled dogs after establishing their pruritus visual analog scale (PVAS) score and faecal consistency score (FCS); owners completed a comprehensive online survey regarding GI signs, possible pruritic behaviours, ear cleaning and sneezing. A PVAS score of ≤ 1.9 was recorded in 87.6% of dogs and the FCS was 2-3 in 94.9% of dogs. PVAS was positively correlated with paw licking/chewing, facial/muzzle rubbing, head shaking and sneezing. Scooting was positively correlated with sneezing. Over 96% of dogs had 1-3 bowel movements (BM) per day. Age was positively correlated with facial/muzzle rubbing, sneezing, coprophagia and borborygmi. The number of walks/day was positively correlated with paw licking/chewing, head shaking, sneezing, number of BM/day, coprophagia, belching, flatulence and borborygmi. A standard method of asking relevant questions was developed and the frequency of GI signs and many behaviours that may indicate pruritus in apparently healthy dogs was established. © 2015 ESVD and ACVD.

Apparent diffusion coefficients of breast tumors. Clinical application

International Nuclear Information System (INIS)

Hatakenaka, Masamitsu; Soeda, Hiroyasu; Yabuuchi, Hidetake; Matsuo, Yoshio; Kamitani, Takeshi; Oda, Yoshinao; Tsuneyoshi, Masazumi; Honda, Hiroshi

2008-01-01

The purpose of this study was to evaluate the usefulness of apparent diffusion coefficient (ADC) for the differential diagnosis of breast tumors and to determine the relation between ADC and tumor cellularity. One hundred and thirty-six female patients (age range, 17-83 years; average age, 51.7 years) with 140 histologically proven breast tumors underwent diffusion-weighted magnetic resonance (MR) imaging (DWI) using the spin-echo echo-planar technique, and the ADCs of the tumors were calculated using 3 different b values, 0, 500, and 1000 s/mm 2 . The diagnoses consisted of fibroadenoma (FA, n=16), invasive ductal carcinoma, not otherwise specified (IDC, n=117), medullary carcinoma (ME, n=3) and mucinous carcinoma (MU, n=4). Tumor cellularity was calculated from surgical specimens. The ADCs of breast tumors and cellularity were compared between different histological types by analysis of variance and Scheffe's post hoc test. The correlation between tumor cellularity and ADC was analyzed by Pearson correlation test. Significant differences were observed in ADCs between FA and all types of cancers (P 2 =0.451). The ADC may potentially help in differentiating benign and malignant breast tumors. Tumor ADC correlates inversely with tumor cellularity. (author)

Densities and apparent molar volumes for aqueous solutions of HNO3-UO2(NO3)2 at 298.15 K

International Nuclear Information System (INIS)

Yang-Xin Yu; Tie-Zhu Bao; Guang-Hua Gao; Yi-Gui Li

1999-01-01

In order to obtain the exact information of atomic number density in the ternary system of HNO 3 -UO 2 (NO 3 ) 2 -H 2 O, the densities were measured with an Anton-Paar DMA60/602 digital density meter thermostated at 298.15±0.01 K. The apparent molal volumes for the systems were calculated from the experimental data. The present measured apparent molar volumes have been fitted to the Pitzer ion-interaction model, which provides an adequate representation of the experimental data for mixed aqueous electrolyte solutions up to 6.2 mol/kg ionic strength. This fit yields θ V , and Ψ V , which are the first derivatives with respect to pressure of the mixing interaction parameters for the excess free energy. With the mixing parameters θ V , and ψ V , the densities and apparent molar volumes of the ternary system studied in this work can be calculated with good accuracy, as shown by the standard deviations. (author)

The effect of cure conditions on the stability of cement waste forms after immersion in water

International Nuclear Information System (INIS)

Siskind, B.; Adams, J.W.; Clinton, J.H.; Piciulo, P.L.; McDaniel, K.

1988-01-01

We investigated the effects of curing conditions on the stability of cement-solidified ion-exchange resins after immersion in water. The test specimens consisted of partially depleted mixed-bed bead resins solidified in one of three vendor-supplied Portland I cement formulations, in a reference cement formulation, or in a gypsum-based binder formulation. We cured samples prepared using each formulation in sealed containers for periods of 7, 14, or 28 days as well as in air or with an accelerated heat cure prior to 90-day immersion in water. Two cement formulations exhibited apparent Portland-cement-like behavior, i.e., compressive strength increased or stabilized with increasing cure time. Two cement formulations exhibited behavior apparently unlike that of Portland cement, i.e., compressive strength decreased with increasing cure time. Such non-Portland-cement-like behavior is correlated with higher waste loadings. The gypsum-based formulation exhibited approximately constant compressive strength with cure time. Accelerated heat cures may not give compressive strengths representative of real-time cures. Some physical deterioration (cracking, spalling) of the waste form occurs during immersion

The effect of cure conditions on the stability of cement waste forms after immersion in water

International Nuclear Information System (INIS)

Siskind, B.; Adams, J.W.; Clinton, J.H.; Piciulo, P.L.

1988-01-01

The authors investigated the effects of curing conditions on the stability of cement-solidified ion-exchange resins after immersion in water. The test specimens consisted of partially depleted mixed-bed bead resins solidified in one of three vendor-supplied Portland I cement formulations, in a reference cement formulation, or in a gypsum-based binder formulation. They cured samples prepared using each formulation in sealed containers for periods of 7, 14, or 28 days as well as in air or with an accelerated heat cure prior to 90-day immersion in water. Two cement formulations exhibited apparent Portland-cement-like behavior, i.e., compressive strength increased or stabilized with increasing cure time. Two cement formulations exhibited behavior apparently unlike that of Portland cement, i.e. compressive strength decreased with increasing cure time. Such non-Portland-cement-like behavior is correlated with higher waste loadings. The gypsum-based formulation exhibited approximately constant compressive strength with cure time. Accelerated heat cures may not give compressive strengths representative of real-time cures. Some physical deterioration (cracking, spalling) of the waste form occurs during immersion

Apparent molal volumes of symmetrical and asymmetrical isomers of tetrabutylammonium bromide in water at several temperatures

International Nuclear Information System (INIS)

Moreno, Nicolás; Malagón, Andrés; Buchner, Richard; Vargas, Edgar F.

2014-01-01

Highlights: • Apparent molal volumes of five isomers of Bu 4 NBr in water have been measured. • The structural effect of branched and linear chains is discussed. • The structural contributions to the ionic volume were calculated. -- Abstract: Apparent molal volumes of a series of differently substituted quaternary ammonium bromides, namely tetra-iso-butyl-, tetra-sec-butyl-, tetra-n-butyl-, di-n-butyl-di-sec-butyl- and di-n-butyl-di-iso-butylammonium bromide have been determined as a function of molal concentration at (298.15, 303.15 and 308.15) K. Partial molar volumes at infinite dilution and ionic molar volumes of these quaternary ammonium cations were determined. Structural volume contributions to the ionic molar volume were also calculated. The symmetric and asymmetric quaternary ammonium cations are “structure making” ions. The contribution of the branched butyl chains predominates over the linear butyl chains in the asymmetric cations

Thermodynamics of proton dissociation from aqueous bicarbonate: apparent molar volumes and apparent molar heat capacities of potassium carbonate and potassium bicarbonate at T=(278.15 to 393.15) K and at the pressure 0.35 MPa

International Nuclear Information System (INIS)

Sorenson, E.C.; Woolley, E.M.

2004-01-01

We have determined the apparent molar volumes V phi and apparent molar heat capacities C p,phi of aqueous potassium carbonate and potassium bicarbonate solutions in the ranges (0.014≤m/(mol · kg -1 )≤0.51) and (278.15≤T/K≤393.15) at the pressure p=0.35 MPa. Corrections for speciation due to hydrolysis and disproportionation in solution were applied using Young's rule, and semi-empirical equations representing (V phi ,m,T) and (C p,phi ,m,T) for the species {2K + , CO 3 2- (aq)} and {K + , HCO 3 - (aq)} were fitted to the experimental results. We have used these equations to estimate the change in volume Δ r V m , change in heat capacity Δ r C p,m , enthalpy change Δ r H m , entropy change Δ r S m , and equilibrium molality quotient pQ for the second proton dissociation reaction from aqueous carbonic acid

Apparent molar volumes and apparent molar heat capacities of dilute aqueous solutions of ethanol, 1-propanol, and 2-propanol at temperatures from 278.15 K to 393.15 K and at the pressure 0.35 MPa

International Nuclear Information System (INIS)

Origlia-Luster, M.L.; Woolley, E.M.

2003-01-01

Apparent molar volumes V phi and apparent molar heat capacities C p,phi have been determined for dilute aqueous solutions of ethanol, 1-propanol, and 2-propanol at temperatures from 278.15 K to 393.15 K and at the pressure 0.35 MPa. The molalities investigated ranged from 0.05 mol·kg -1 to 1.0 mol·kg -1 . We used a vibrating tube densimeter (DMA 512P, Anton PAAR, Austria) to determine the densities and volumetric properties. Heat capacities were obtained using a twin fixed-cell, power-compensation, differential-output, temperature-scanning calorimeter (NanoDSC 6100, Calorimetry Sciences Corporation, American Fork, UT, USA). The results were fit by regression to equations that describe the surfaces (V phi ,T,m) and (C p,phi ,T,m). Infinite dilution partial molar volumes V 2 0 and heat capacities C 0 p,2 were obtained over the range of temperatures by extrapolation of these surfaces to m=0 mol·kg -1

Correlation between 3 T apparent diffusion coefficient values and grading of invasive breast carcinoma

Energy Technology Data Exchange (ETDEWEB)

Cipolla, Valentina, E-mail: valentina.cipolla@yahoo.it [Department of Radiological Sciences, University of Rome “Sapienza”, Viale del Policlinico 155, 00161 Rome (Italy); Santucci, Domiziana; Guerrieri, Daniele; Drudi, Francesco Maria [Department of Radiological Sciences, University of Rome “Sapienza”, Viale del Policlinico 155, 00161 Rome (Italy); Meggiorini, Maria Letizia [Department of Gynaecological Sciences, University of Rome “Sapienza”, Viale del Policlinico 155, 00161 Rome (Italy); Felice, Carlo de [Department of Radiological Sciences, University of Rome “Sapienza”, Viale del Policlinico 155, 00161 Rome (Italy)

2014-12-15

Highlights: • Apparent diffusion coefficient is a quantitative parameter which reflects molecular water movement. • Grading is an independent prognostic factor which correlates with other histopathological features. • Apparent diffusion coefficient values were significantly different between G1 and G3 classes. - Abstract: Purpose: The aim of this study was to evaluate whether the apparent diffusion coefficient (ADC) provided by 3.0 T (3 T) magnetic resonance diffusion-weighted imaging (DWI) varied according to the grading of invasive breast carcinoma. Materials and methods: A total of 92 patients with 96 invasive breast cancer lesions were enrolled; all had undergone 3 T magnetic resonance imaging (MRI) for local staging. All lesions were confirmed by histological analysis, and tumor grade was established according to the Nottingham Grading System (NGS). MRI included both dynamic contrast-enhanced and DWI sequences, and ADC value was calculated for each lesion. ADC values were compared with NGS classification using the Mann–Whitney U and the Kruskal–Wallis H tests. Grading was considered as a comprehensive prognostic factor, and Rho Spearman test was performed to determine correlation between grading and tumor size, hormonal receptor status, HER2 expression and Ki67 index. Pearson's Chi square test was carried out to compare grading with the other prognostic factors. Results: ADC values were significantly higher in G1 than in G3 tumors. No significant difference was observed when G1 and G3 were compared with G2. Tumor size, hormonal receptor status, HER2 expression and Ki67 index correlated significantly with grading but there was a significant difference only between G1 and G3 related to the ER and PR status, HER2 expression and Ki67 index. There was no statistically significant difference in lesion size between the two groups. Conclusion: ADC values obtained on 3 T DWI correlated with low-grade (G1) and high-grade (G3) invasive breast carcinoma. 3

Snoring, inflammatory markers, adipokines and metabolic syndrome in apparently healthy Chinese.

Directory of Open Access Journals (Sweden)

Liang Sun

Full Text Available OBJECTIVE: Chronic low-grade inflammation and adipokines dysregulation are linked to mechanisms underscoring the pathogenesis of obesity-related metabolic disorders. Little is known about roles of these cytokines on the association between snoring and metabolic syndrome (MetS. We aimed to investigate whether a cluster of cytokines are related to snoring frequency and its association with MetS in apparently healthy Chinese. METHODS: Current analyses used a population-based sample including 1059 Shanghai residents aged 35-54 years. Self-reported snoring frequency was classified as never, occasionally and regularly. Fasting plasma glucose, lipid profile, insulin, C-reactive protein, interleukin-6, interleukin-18, lipopolysaccharide binding protein, high-molecular-weight adiponectin and leptin were measured. MetS was defined by the updated National Cholesterol Education Program Adult Treatment Panel III criteria for Asian-Americans. RESULTS: Overweight/obese subjects had significantly higher prevalence of regular snorers than their normal-weight counterparts (34.8% vs. 11.5%, P<0.001. Regular snoring was associated with unfavorable profile of inflammatory markers and adipokines. However, those associations were abolished after adjustment for body mass index (BMI or waist circumference. The MetS risk (multivariate-adjusted odds ratio 5.41, 95% confidence interval 3.72-7.88 was substantially higher in regular snorers compared with non-snorers. Controlling for BMI remarkably attenuated the association (2.03, 1.26-3.26, while adjusting for inflammatory markers and adipokines showed little effects. CONCLUSION: Frequent snoring was associated with an elevated MetS risk independent of lifestyle factors, adiposity, inflammatory markers and adipokines in apparently healthy Chinese. Whether snoring pattern is an economic and no-invasive indicator for screening high-risk persons needs to be addressed prospectively.

Extended maximum likelihood analysis of apparent flattenings of S0 and spiral galaxies

International Nuclear Information System (INIS)

Okamura, Sadanori; Takase, Bunshiro; Hamabe, Masaru; Nakada, Yoshikazu; Kodaira, Keiichi.

1981-01-01

Apparent flattenings of S0 and spiral galaxies compiled by Sandage et al. (1970) and van den Bergh (1977), and those listed in the Second Reference Catalogue (RC2) are analyzed by means of the extended maximum likelihood method which was recently developed in the information theory for statistical model identification. Emphasis is put on the possible difference in the distribution of intrinsic flattenings between S0's and spirals as a group, and on the apparent disagreements present in the previous results. The present analysis shows that (1) One cannot conclude on the basis of the data in the Reference Catalogue of Bright Galaxies (RCBG) that the distribution of intrinsic flattenings of spirals is almost identical to that of S0's; spirals have wider dispersion than S0's, and there are more round systems in spirals than in S0's. (2) The distribution of intrinsic flattenings of S0's and spirals derived from the data in RC2 again indicates a significant difference from each other. (3) The distribution of intrinsic flattenings of S0's exhibits different characteristics depending upon the surface-brightness level; the distribution with one component is obtained from the data at RCBG level (--23.5 mag arcsec -2 ) and that with two components at RC2 level (25 mag arcsec -2 ). (author)

Apparent molar volumes and apparent molar heat capacities of aqueous tetrahydrofuran, dimethyl sulfoxide, 1,4-dioxane, and 1,2-dimethoxyethane at temperatures from 278.15 K to 393.15 K and at the pressure 0.35 MPa

International Nuclear Information System (INIS)

Swenson, D.M.; Blodgett, M.B.; Ziemer, S.P.; Woolley, E.M.

2008-01-01

We determined apparent molar volumes V φ at 278.15 ≤ (T/K) ≤ 368.15 and apparent molar heat capacities C p,φ at 278.15 ≤ (T/K) ≤ 393.15 at p = 0.35 MPa for aqueous solutions of tetrahydrofuran at m from (0.016 to 2.5) mol . kg -1 , dimethyl sulfoxide at m from (0.02 to 3.0) mol . kg -1 , 1,4-dioxane at m from (0.015 to 2.0) mol . kg -1 , and 1,2-dimethoxyethane at m from (0.01 to 2.0) mol . kg -1 . Values of V φ were determined from densities measured with a vibrating-tube densimeter, and values of C p,φ were determined with a twin fixed-cell, differential, temperature-scanning calorimeter. Empirical functions of m and T for each compound were fitted to our V φ and C p,φ results

Effects of Foveal Ablation on Emmetropization and Form-Deprivation Myopia

Science.gov (United States)

Smith, Earl L.; Ramamirtham, Ramkumar; Qiao-Grider, Ying; Hung, Li-Fang; Huang, Juan; Kee, Chea-su; Coats, David; Paysse, Evelyn

2009-01-01

Purpose Because of the prominence of central vision in primates, it has generally been assumed that signals from the fovea dominate refractive development. To test this assumption, the authors determined whether an intact fovea was essential for either normal emmetropization or the vision-induced myopic errors produced by form deprivation. Methods In 13 rhesus monkeys at 3 weeks of age, the fovea and most of the perifovea in one eye were ablated by laser photocoagulation. Five of these animals were subsequently allowed unrestricted vision. For the other eight monkeys with foveal ablations, a diffuser lens was secured in front of the treated eyes to produce form deprivation. Refractive development was assessed along the pupillary axis by retinoscopy, keratometry, and A-scan ultrasonography. Control data were obtained from 21 normal monkeys and three infants reared with plano lenses in front of both eyes. Results Foveal ablations had no apparent effect on emmetropization. Refractive errors for both eyes of the treated infants allowed unrestricted vision were within the control range throughout the observation period, and there were no systematic interocular differences in refractive error or axial length. In addition, foveal ablation did not prevent form deprivation myopia; six of the eight infants that experienced monocular form deprivation developed myopic axial anisometropias outside the control range. Conclusions Visual signals from the fovea are not essential for normal refractive development or the vision-induced alterations in ocular growth produced by form deprivation. Conversely, the peripheral retina, in isolation, can regulate emmetropizing responses and produce anomalous refractive errors in response to abnormal visual experience. These results indicate that peripheral vision should be considered when assessing the effects of visual experience on refractive development. PMID:17724167

Dietary factors associated with plasma high molecular weight and total adiponectin levels in apparently healthy women

NARCIS (Netherlands)

Yannakoulia, Mary; Yiannakouris, Nikos; Melistas, Labros; Fappa, Evaggelia; Vidra, Nikoletta; Kontogianni, Meropi D; Mantzoros, Christos S

2008-01-01

OBJECTIVE: Our aim was to investigate associations between dietary factors and high molecular weight (HMW) as well as total adiponectin in a sample of apparently healthy adult Mediterranean women. DESIGN AND METHODS: Two hundred and twenty women were enrolled in this study. Anthropometric and body

Linseed dietary fibers reduce apparent digestibility of energy and fat and weight gain in growing rats

DEFF Research Database (Denmark)

Kristensen, M.; Knudsen, K. E. B.; Jørgensen, H.

2013-01-01

Dietary fibers (DF) may affect energy balance, an effect often ascribed to the viscous nature of some water soluble DF, which affect luminal viscosity and thus multiple physiological processes. We have tested the hypothesis that viscous linseed DF reduce apparent nutrient digestibility, and limit...

Apparently noninvariant terms of nonlinear sigma models in lattice perturbation theory

International Nuclear Information System (INIS)

Harada, Koji; Hattori, Nozomu; Kubo, Hirofumi; Yamamoto, Yuki

2009-01-01

Apparently noninvariant terms (ANTs) that appear in loop diagrams for nonlinear sigma models are revisited in lattice perturbation theory. The calculations have been done mostly with dimensional regularization so far. In order to establish that the existence of ANTs is independent of the regularization scheme, and of the potential ambiguities in the definition of the Jacobian of the change of integration variables from group elements to 'pion' fields, we employ lattice regularization, in which everything (including the Jacobian) is well defined. We show explicitly that lattice perturbation theory produces ANTs in the four-point functions of the pion fields at one-loop and the Jacobian does not play an important role in generating ANTs.

Apparent diffusion coefficient of the renal tissue. The effect of diuretic

Energy Technology Data Exchange (ETDEWEB)

Yamamoto, Jin; Munechika, Hirotsugu [Showa Univ., Tokyo (Japan). School of Medicine

1998-12-01

Apparent diffusion coefficient (ADC) of the renal tissue was studied at diffusion-weighted images of the kidney which were obtained from spin-echo type sequence before and after furosemide (100 mg) injection in twelve healthy volunteers. ADC (mm{sup 2}/sec) of the renal cortex and medulla before furosemide injection was 2.08{+-}0.52 and 1.96{+-}0.52, respectively. No appreciable ADC difference was seen between the cortex and the medulla of the kidney. After furosemide injection, ADC of the renal cortex and medulla became 2.09{+-}0.42 and 1.78{+-}0.38, respectively. It was found that furosemide produced no significant effect on ADC of the renal tissue. (author)

VLBA Changes Picture of Famous Star-Forming Region

Science.gov (United States)

2007-10-01

Using the supersharp radio "vision" of the National Science Foundation's Very Long Baseline Array (VLBA), astronomers have made the most precise measurement ever of the distance to a famous star-forming region. The measurement -- to the heavily studied Orion Nebula -- changes scientists' understanding of the characteristics of the young stars in the region. Parallax Diagram Trigonometric Parallax method determines distance to star by measuring its slight shift in apparent position as seen from opposite ends of Earth's orbit. CREDIT: Bill Saxton, NRAO/AUI/NSF Star Track Apparent track of star GMR A in the Orion Nebula Cluster, showing shift caused by Earth's orbital motion and star's movement in space. CREDIT: Sandstrom et al., NRAO/AUI/NSF Click on Images for Larger Files "This measurement is four times more precise than previous distance estimates. Because our measurement reduces the distance to this region, it tells us that the stars there are less bright than thought before, and changes the estimates of their ages," said Geoff Bower, an astronomer at the University of California at Berkeley. Bower, along with Karin Sandstrom, J.E.G. Peek, Alberto Bolatto and Richard Plambeck, all of Berkeley, published their findings in the October 10 edition of the Astrophysical Journal. The scientists determined the distance to a star called GMR A, one of a cluster of stars in the Orion Nebula, by measuring the slight shift in the star's apparent position in the sky caused by the Earth's motion around the Sun. Observing the star when the Earth is on opposite sides of its annual orbit allows astronomers to measure the angle of this small shift and thus provides a direct trigonometric calculation of its distance. "By using this technique, called parallax, we get a direct measurement that does not depend on various assumptions that are required to use less-direct methods," Bower said. "Only a telescope with the remarkable ability to see fine detail that is provided by the VLBA is

Intake and total apparent digestibility in lambs fed six maize varieties in the Brazilian Semiarid

Directory of Open Access Journals (Sweden)

Rafael Dantas dos Santos

2011-12-01

Full Text Available The objective of this study was to evaluate the daily intake and total apparent digestibility of dry matter, organic matter, crude protein, gross energy, ether extract, neutral detergent fiber, acid detergent fiber, total and non-fibrous carbohydrates, total digestible nutrients, energy intake and nitrogen balance of silages of six maize varieties with early or super early cycles recommended to Northeast Brazil. Twenty-four male castrated lambs were lodged in metabolic cages. A completely randomized design with six treatments and four replications was used, with means compared by Tukey test at 5%. There were no differences among varieties for any of the evaluated variables regarding intake and apparent digestibility. Concerning the intake of digestible energy, metabolizable energy and the ratio content of digestible and metabolizable energy, significant differences were observed between varieties and BRS Assum Preto showed highest values of metabolizable energy (2.650,8 kcal/day. All of the treatments presented positive nitrogen balance and did not differ among themselves. The varieties asessed can be an additional option to the semiarid regions in Brazil.

Apparent increase in the thickness of superconducting particles at low temperatures measured by electron holography

International Nuclear Information System (INIS)

Hirsch, J.E.

2013-01-01

We predict that superconducting particles will show an apparent increase in thickness at low temperatures when measured by electron holography. This will result not from a real thickness increase, rather from an increase in the mean inner potential sensed by the electron wave traveling through the particle, originating in expansion of the electronic wavefunction of the superconducting electrons and resulting negative charge expulsion from the interior to the surface of the superconductor, giving rise to an increase in the phase shift of the electron wavefront going through the sample relative to the wavefront going through vacuum. The temperature dependence of the observed phase shifts will yield valuable new information on the physics of the superconducting state of metals. - Highlights: • A new property of superconducting particles is predicted. • Electron holography will show an apparent increase in thickness at low temperatures. • This will result from a predicted increase in the mean inner potential. • This will originate in expulsion of electrons from the interior to the surface. • This is not predicted by the conventional BCS theory of superconductivity

Apparent distribution coefficients of transuranium elements in UK coastal waters

International Nuclear Information System (INIS)

Kershaw, P.J.; Pentreath, R.J.; Harvey, B.R.; Lovett, M.B.; Boggis, S.J.

1986-01-01

The authorized inputs of low-level radioactive waste into the Irish Sea from the British Nuclear Fuels plc reprocessing plant at Sellafield may be used to advantage to study the distribution and behaviour of artificial radionuclides in the marine environment. Apparent distribution coefficients (Ksub(d)) for the transuranium elements Np, Pu, Am and Cm have been determined by the analysis of environmental samples collected from UK coastal waters. The sampling methodology for obtaining suspended sediment-seawater Ksub(d)s by filtration is described and critically evaluated. Artefacts may be introduced in the sample collection stage. Ksub(d) values have also been determined for seabed sediment-interstitial waters and the precautions taken to preserve in-situ chemical conditions are described. Variations in Ksub(d) values are discussed in relation to distance from Sellafield, suspended load, redox conditions and oxidation state changes. (author)

[The potential of general magnetic therapy for the rehabilitation of the patients presenting with hemorrhagic forms of erysipelas].

Science.gov (United States)

Kuzovleva, E V

2014-01-01

The objective of the present study was to evaluate the possibility and effectiveness of the application of general magnetic therapy for the combined treatment and rehabilitation of the patients presenting with hemorrhagic forms of erysipelas. A total of 102 patients were examined and treated; they were divided into two (control and study) groups matched for age and the main clinical manifestations of the disease. All the patients were given basal therapy, those in the study group were additionally treated using general magnetic therapy. It was shown that the inclusion of this procedure in the combined treatment of hemorrhagic forms of erysipelas promoted rapid and well-apparent elimination of the local inflammatory process, reduced oedema of the affected extremity, improved tissue trophicity, and stimulated microcirculation.

Dynamic Distribution of the Gut Microbiota and the Relationship with Apparent Crude Fiber Digestibility and Growth Stages in Pigs

Science.gov (United States)

Niu, Qing; Li, Pinghua; Hao, Shuaishuai; Zhang, Yeqiu; Kim, Sung Woo; Li, Huizhi; Ma, Xiang; Gao, Shuo; He, Lichun; Wu, WangJun; Huang, Xuegen; Hua, Jindi; Zhou, Bo; Huang, Ruihua

2015-01-01

The gut microbiota plays an important role in nutrient digestibility in animals. To examine changes in the pig gut microbiota across growth stages and its effects on nutrient digestion, the gut microbiota population in pigs at 28 days (before weaning), and 60, 90, and 150 days of age was assessed by 16S rDNA gene sequencing. The apparent digestibility of crude fiber (CF), neutral detergent fiber (NDF), acid detergent fiber (ADF), crude protein (CP) and ether extract (EE) was also assessed in these pigs. A total of 19,875 operational taxonomic units (OTUs) were identified from all samples. Both bacterial abundance and diversity increased with age. A total of 22 phyla and 249 genera were identified from all fecal samples; Firmicutes and Bacteroidetes were the most dominant phyla in all samples. With increasing age, the proportion of TM7 and Tenericutes increased, whereas the proportion of Lentisphaerae and Synergistetes decreased. The abundance of 36 genera varied with age, and the apparent digestibility of CF increased with age. Three phyla, Proteobacteria, Tenericutes and TM7, and 11 genera, including Anaeroplasma, Campylobacter, and Clostridium, were correlated with apparent CF digestibility. PMID:25898122

Regional Projections of Extreme Apparent Temperature Days in Africa and the Related Potential Risk to Human Health

CSIR Research Space (South Africa)

Garland, Rebecca M

2015-10-01

Full Text Available Regional climate modelling was used to produce high resolution climate projections for Africa, under a “business as usual scenario”, that were translated into potential health impacts utilizing a heat index that relates apparent temperature...

Oxygen exchange at gas/oxide interfaces: how the apparent activation energy of the surface exchange coefficient depends on the kinetic regime.

Science.gov (United States)

Fielitz, Peter; Borchardt, Günter

2016-08-10

In the dedicated literature the oxygen surface exchange coefficient KO and the equilibrium oxygen exchange rate [Fraktur R] are considered to be directly proportional to each other regardless of the experimental circumstances. Recent experimental observations, however, contradict the consequences of this assumption. Most surprising is the finding that the apparent activation energy of KO depends dramatically on the kinetic regime in which it has been determined, i.e. surface exchange controlled vs. mixed or diffusion controlled. This work demonstrates how the diffusion boundary condition at the gas/solid interface inevitably entails a correlation between the oxygen surface exchange coefficient KO and the oxygen self-diffusion coefficient DO in the bulk ("on top" of the correlation between KO and [Fraktur R] for the pure surface exchange regime). The model can thus quantitatively explain the range of apparent activation energies measured in the different regimes: in the surface exchange regime the apparent activation energy only contains the contribution of the equilibrium exchange rate, whereas in the mixed or in the diffusion controlled regime the contribution of the oxygen self-diffusivity has also to be taken into account, which may yield significantly higher apparent activation energies and simultaneously quantifies the correlation KO ∝ DO(1/2) observed for a large number of oxides in the mixed or diffusion controlled regime, respectively.

In vitro suppression of fungi caused by combinations of apparently non-antagonistic soil bacteria.

Science.gov (United States)

de Boer, Wietse; Wagenaar, Anne-Marieke; Klein Gunnewiek, Paulien J A; van Veen, Johannes A

2007-01-01

We hypothesized that apparently non-antagonistic soil bacteria may contribute to suppression of fungi during competitive interactions with other bacteria. Four soil bacteria (Brevundimonas sp., Luteibacter sp., Pedobacter sp. and Pseudomonas sp.) that exhibited little or no visible antifungal activity on different agar media were prescribed. Single and mixed strains of these species were tested for antagonism on a nutrient-poor agar medium against the plant pathogenic fungi Fusarium culmorum and Rhizoctonia solani and the saprotrophic fungus Trichoderma harzianum. Single bacterial strains caused little to moderate growth reduction of fungi (quantified as ergosterol), most probably due to nutrient withdrawal from the media. Growth reduction of fungi by the bacterial mixture was much stronger than that by the single strains. This appeared to be mostly due to competitive interactions between the Pseudomonas and Pedobacter strains. We argue that cohabitation of these strains triggered antibiotic production via interspecific interactions and that the growth reduction of fungi was a side-effect caused by the sensitivity of the fungi to bacterial secondary metabolites. Induction of gliding behavior in the Pedobacter strain by other strains was also observed. Our results indicate that apparently non-antagonistic soil bacteria may be important contributors to soil suppressiveness and fungistasis when in a community context.

Interpatient variation in normal peripheral zone apparent diffusion coefficient: effect on the prediction of prostate cancer aggressiveness

NARCIS (Netherlands)

Litjens, G.J.S.; Hambrock, T.; Hulsbergen-van de Kaa, C.A.; Barentsz, J.O.; Huisman, H.J.

2012-01-01

Purpose: To determine the interpatient variability of prostate peripheral zone (PZ) apparent diffusion coefficient (ADC) and its effect on the assessment of prostate cancer aggressiveness. Materials and Methods: The requirement for institutional review board approval was waived. Intra- and

An Inverse Relationship Links Temperature and Substrate Apparent Affinity in the Ion-Coupled Cotransporters rGAT1 and KAAT1

Directory of Open Access Journals (Sweden)

Antonio Peres

2012-11-01

Full Text Available The effects of temperature on the operation of two ion-coupled cotransporters of the SLC6A family, namely rat GAT1 (SLC6A1 and KAAT1 (SLC6A19 from Manduca sexta, have been studied by electrophysiological means in Xenopus laevis oocytes expressing these proteins. The maximal transport-associated current (Imax and the apparent substrate affinity (K05 were measured. In addition to the expected increase in transport rate (Q10 = 3–6, both transporters showed greater K05 values (i.e., a decrease in apparent affinity at higher temperatures. The transport efficiency, estimated as Imax/K05, increased at negative potentials in both transporters, but did not show statistically significant differences with temperature. The observation that the apparent substrate affinity is inversely related to the transport rate suggests a kinetic regulation of this parameter. Furthermore, the present results indicate that the affinities estimated at room temperature for mammalian cotransporters may not be simply extrapolated to their physiological operating conditions.

Crystal structure of secretory protein Hcp3 from Pseudomonas aeruginosa.

Science.gov (United States)

Osipiuk, Jerzy; Xu, Xiaohui; Cui, Hong; Savchenko, Alexei; Edwards, Aled; Joachimiak, Andrzej

2011-03-01

The Type VI secretion pathway transports proteins across the cell envelope of Gram-negative bacteria. Pseudomonas aeruginosa, an opportunistic Gram-negative bacterial pathogen infecting humans, uses the type VI secretion pathway to export specific effector proteins crucial for its pathogenesis. The HSI-I virulence locus encodes for several proteins that has been proposed to participate in protein transport including the Hcp1 protein, which forms hexameric rings that assemble into nanotubes in vitro. Two Hcp1 paralogues have been identified in the P. aeruginosa genome, Hsp2 and Hcp3. Here, we present the structure of the Hcp3 protein from P. aeruginosa. The overall structure of the monomer resembles Hcp1 despite the lack of amino-acid sequence similarity between the two proteins. The monomers assemble into hexamers similar to Hcp1. However, instead of forming nanotubes in head-to-tail mode like Hcp1, Hcp3 stacks its rings in head-to-head mode forming double-ring structures.

Anisotropy of the apparent frequency dependence of backscatter in formalin fixed human myocardium.

Science.gov (United States)

Hall, C S; Verdonk, E D; Wickline, S A; Perez, J E; Miller, J G

1997-01-01

Measurements of the frequency dependence of ultrasonic backscatter are presented for specific angles of insonification for regions of infarcted and noninfarcted human myocardium. A 5-MHz transducer was used to insonify cylindrical cores taken from 7 noninfarcted regions and 12 infarcted regions of the left ventricular free wall of 6 formalin-fixed human hearts explanted because of ischemic cardiomyopathy. The dependence of apparent (uncompensated for diffraction effects and attenuation) backscatter on frequency was approximated by a power-law dependence, magnitude of B(f)2 = afn. Under ideal conditions in a lossless medium, the effect of not compensating for the effects of diffraction and attenuation leads to the value of n to be 2.0 for Rayleigh scatterers while the frequency dependence of the fully compensated backscatter coefficient would be f4. The value of n was determined over the frequency range, 3-7 MHz. Both nonifarcted and infarcted myocardium exhibited anisotropy of the frequency dependence of backscatter, with maxima occurring at angles that were perpendicular to the predominant myofiber direction and minima when parallel to the fibers. Perpendicular insonification yielded results for n of 1.8 +/- 0.1 for noninfarcted myocardium and 1.2 +/- 0.1 for infarcted myocardium while parallel insonification yielded results of 0.4 +/- 0.1 for noninfarcted and 0.0 +/- 0.1 for infarcted myocardium. The functional form of the angle-dependent backscatter is similar for both noninfarcted and infarcted myocardium, although the frequency dependence is clearly different for both tissue states for all angles of insonification. The results of this study indicate that the anisotropy of the frequency dependence of backscatter may play a significant role in ultrasonic imaging and is an important consideration for ultrasonic tissue characterization in myocardium.

Improving compliance to meal-replacement food regimens. Forming implementation intentions (conscious IF-THEN plans) increases compliance.

Science.gov (United States)

Zandstra, E H; den Hoed, W; van der Meer, N; van der Maas, A

2010-12-01

Creating and changing habits around dieting behaviour can be a way to help consumers to consume more healthy products and to control their weight. Previous studies suggested that implementation intentions - deliberate plans on when, where and how - increase the likelihood that consumers perform the intended behaviour (Armitage, 2004; Gollwitzer & Sheeran, 2006; Jackson et al., 2005). This study investigated the effect of forming implementation intentions on compliance to a regimen based on a range of meal-replacement food products and snacks. Participants (n = 57) were allocated to one of two groups, either: (1) an implementation-intention group, who formed deliberate plans (implementation intentions) to consume the products - these implementation intentions were formed only once at the beginning of the study -, or (2) a control group who formed no implementation intentions. Participants were then instructed to follow a daily regimen, which included the consumption of foods from a range of meal-replacement products and snacks provided gratis for four weeks. Results showed that the implementation-intention group consumed significantly more meal-replacement food products per week (p intentions was apparent for 18 days. These findings indicate that forming implementation intentions may assist individuals in their compliance to a meal-replacement product regimen. Copyright © 2010 Elsevier Ltd. All rights reserved.

The effect of animal feed from irradiated palm oil sludge on antibody forming of mice

International Nuclear Information System (INIS)

Suharni Sadi; Umar, Hasibuan; Jenny, M.; Adria, P.M.; Murni Indrawatmi

1998-01-01

In this experiment, 3 kinds of animal feed were, e.q. control (commercial product), non irradiated and irradiated palm oil sludge by using 6 0Co source with a 4 kGy dose. BALB-C mice of 3 months old were used, each group contains 5 animals. Before conducting the experiment the animals were injected with antibiotic to free them from Enterobacteriaceae. The animals were observed every 2 weeks by weighting them, blood were analyzed and after 10 weeks their antibody were analyzed. Animal feed were in the form of pellets and each animal was feed 5 g of pellets. The results were as follows, antibody formed by C (control), N (non irradiated sludge) and, R (irradiated sludge) were 37; 36.5; and 36.2 mg/nl, respectively. Apparently pellets which were made of palm oil sludge and commercial product produced not significantly different level of antibody. (author)

A model for the Sun apparent movement from a geocentric perspective

Directory of Open Access Journals (Sweden)

Fernando Siqueira da Silva

2010-01-01

Full Text Available The present work has as main objective to build a model to identify the sun apparent movement (SAM as well as estimate the time interval in which it is above the horizon, to anywhere in the world and in any season. We begin with a brief reflection on the genesis of astronomy and some of its basic concepts, from which the model is built. The model basically consists of a transparent cylinder, in which are shown the paths of the SAM over the year. As applications of the model, are proposed some examples, such as the duration of "daylight" in different places of the globe. Making and using this model, besides the low cost and easy feasibility, provides a good understanding of the SAM.

A structural model of the genome packaging process in a membrane-containing double stranded DNA virus.

Directory of Open Access Journals (Sweden)

Chuan Hong

2014-12-01

Full Text Available Two crucial steps in the virus life cycle are genome encapsidation to form an infective virion and genome exit to infect the next host cell. In most icosahedral double-stranded (ds DNA viruses, the viral genome enters and exits the capsid through a unique vertex. Internal membrane-containing viruses possess additional complexity as the genome must be translocated through the viral membrane bilayer. Here, we report the structure of the genome packaging complex with a membrane conduit essential for viral genome encapsidation in the tailless icosahedral membrane-containing bacteriophage PRD1. We utilize single particle electron cryo-microscopy (cryo-EM and symmetry-free image reconstruction to determine structures of PRD1 virion, procapsid, and packaging deficient mutant particles. At the unique vertex of PRD1, the packaging complex replaces the regular 5-fold structure and crosses the lipid bilayer. These structures reveal that the packaging ATPase P9 and the packaging efficiency factor P6 form a dodecameric portal complex external to the membrane moiety, surrounded by ten major capsid protein P3 trimers. The viral transmembrane density at the special vertex is assigned to be a hexamer of heterodimer of proteins P20 and P22. The hexamer functions as a membrane conduit for the DNA and as a nucleating site for the unique vertex assembly. Our structures show a conformational alteration in the lipid membrane after the P9 and P6 are recruited to the virion. The P8-genome complex is then packaged into the procapsid through the unique vertex while the genome terminal protein P8 functions as a valve that closes the channel once the genome is inside. Comparing mature virion, procapsid, and mutant particle structures led us to propose an assembly pathway for the genome packaging apparatus in the PRD1 virion.

A structural model of the genome packaging process in a membrane-containing double stranded DNA virus.

Science.gov (United States)

Hong, Chuan; Oksanen, Hanna M; Liu, Xiangan; Jakana, Joanita; Bamford, Dennis H; Chiu, Wah

2014-12-01

Two crucial steps in the virus life cycle are genome encapsidation to form an infective virion and genome exit to infect the next host cell. In most icosahedral double-stranded (ds) DNA viruses, the viral genome enters and exits the capsid through a unique vertex. Internal membrane-containing viruses possess additional complexity as the genome must be translocated through the viral membrane bilayer. Here, we report the structure of the genome packaging complex with a membrane conduit essential for viral genome encapsidation in the tailless icosahedral membrane-containing bacteriophage PRD1. We utilize single particle electron cryo-microscopy (cryo-EM) and symmetry-free image reconstruction to determine structures of PRD1 virion, procapsid, and packaging deficient mutant particles. At the unique vertex of PRD1, the packaging complex replaces the regular 5-fold structure and crosses the lipid bilayer. These structures reveal that the packaging ATPase P9 and the packaging efficiency factor P6 form a dodecameric portal complex external to the membrane moiety, surrounded by ten major capsid protein P3 trimers. The viral transmembrane density at the special vertex is assigned to be a hexamer of heterodimer of proteins P20 and P22. The hexamer functions as a membrane conduit for the DNA and as a nucleating site for the unique vertex assembly. Our structures show a conformational alteration in the lipid membrane after the P9 and P6 are recruited to the virion. The P8-genome complex is then packaged into the procapsid through the unique vertex while the genome terminal protein P8 functions as a valve that closes the channel once the genome is inside. Comparing mature virion, procapsid, and mutant particle structures led us to propose an assembly pathway for the genome packaging apparatus in the PRD1 virion.

Partial and apparent molar volumes of aqueous solutions of the 1:1 type electrolytes

International Nuclear Information System (INIS)

Klugman, I.Yu.

2002-01-01

Formulas for calculating partial and apparent molar volumes of MX (M=Li-Cs; X = Cl-I) electrolyte aqueous solutions in a wide range of concentrations from 0 to 4 mol/kg with error not in excess of 0.05% are suggested. It is shown that the previously employed formulas for calculating partial molar volumes of electrolytes give false indications of mutual effect of ions and actually they are fit solely for very small concentrations [ru

The effect of measuring procedure on the apparent rheological properties of self-compacting concrete

DEFF Research Database (Denmark)

Geiker, Mette Rica; Bradl, M.; Thrane, L.N.

2002-01-01

Torque versus time during testing of the rheological properties of fresh concrete has been investigated. The testing was performed in a BML viscometer and on a self-compacting concrete (w/c = 0.45, 70% rapid hardening Portland cement, 3% silica fume, 27% fly ash, third generation superplasticizer......, lack of steady state may explain the apparent shear-thickening behaviour of self-compacting concrete reported elsewhere. (C) 2002 Elsevier Science Ltd. All rights reserved....

Spawning site fidelity and apparent annual survival of walleye (Sander vitreus) differ between a Lake Huron and Lake Erie tributary

Science.gov (United States)

Hayden, Todd A.; Binder, Thomas; Holbrook, Christopher; Vandergoot, Christopher; Fielder, David G.; Cooke, Steven J.; Dettmers, John M.; Krueger, Charles C.

2018-01-01

Fidelity to spawning habitats can maximise reproductive success of fish by synchronising movements to sites of previous recruitment. To determine the role of reproductive fidelity in structuring walleye Sander vitreus populations in the Laurentian Great Lakes, we used acoustic telemetry combined with Cormack–Jolly–Seber capture–recapture models to estimate spawning site fidelity and apparent annual survival for the Tittabawassee River in Lake Huron and Maumee River in Lake Erie. Walleye in spawning condition were tagged from the Tittabawassee River in Lake Huron and Maumee River in Lake Erie in 2011–2012. Site fidelity and apparent annual survival were estimated from return of individuals to the stream where tagged. Site fidelity estimates were higher in the Tittabawassee River (95%) than the Maumee River (70%) and were not related to sex or fish length at tagging. Apparent annual survival of walleye tagged in the Tittabawassee did not differ among spawning seasons but was higher for female than male walleye and decreased linearly as fish length increased. Apparent annual survival of walleye tagged in the Maumee River did not differ among spawning seasons but was higher for female walleye than male walleye and increased linearly as fish length increased. Greater fidelity of walleye tagged in the Tittabawassee River than walleye tagged in the Maumee River may be related to the close proximity to the Maumee River of other spawning aggregations and multiple spawning sites in Lake Erie. As spawning site fidelity increases, management actions to conserve population structure require an increasing focus on individual stocks.

Densified waste form and method for forming

Science.gov (United States)

Garino, Terry J.; Nenoff, Tina M.; Sava Gallis, Dorina Florentina

2015-08-25

Materials and methods of making densified waste forms for temperature sensitive waste material, such as nuclear waste, formed with low temperature processing using metallic powder that forms the matrix that encapsulates the temperature sensitive waste material. The densified waste form includes a temperature sensitive waste material in a physically densified matrix, the matrix is a compacted metallic powder. The method for forming the densified waste form includes mixing a metallic powder and a temperature sensitive waste material to form a waste form precursor. The waste form precursor is compacted with sufficient pressure to densify the waste precursor and encapsulate the temperature sensitive waste material in a physically densified matrix.

Densities and apparent molar volumes of HClO{sub 4}(aq) and Yb(ClO{sub 4}){sub 3}(aq) at elevated temperatures and pressures

Energy Technology Data Exchange (ETDEWEB)

Hakin, Andrew W. E-mail: hakin@uleth.ca; Lukacs, Michael J.; Jin Lianliu

2004-09-01

Relative densities have been measured for acidified aqueous solutions of ytterbium perchlorate {l_brace}Yb(ClO{sub 4}){sub 3}{r_brace} at approximately T=(348.15, 373.15, 398.15, and 423.15) K and p=(10.0, 20.0, and 30.0) MPa over the concentration range 0.01624{<=}m{sub 2}/(mol {center_dot} kg{sup -1}) {<=} 0.2531 using an optically coupled vibrating tube densimeter (OCVTD). Experimental apparent molar volumes have been calculated from the density measurements, and apparent molar volumes for the aqueous perchlorate salt have been calculated using Young's rule. The application of Young's rule requires apparent molar volumes for aqueous perchloric acid (HClO{sub 4}) solutions over extended temperature and pressure ranges. These values were calculated from densities for aqueous HClO{sub 4} solutions that were measured using the OCVTD at the same temperatures and pressures as those used to investigate the density surface of the acidified aqueous Yb(ClO{sub 4}){sub 3} solutions. The temperature, pressure, and composition surfaces of the apparent molar volumes for Yb(ClO{sub 4}){sub 3}(aq) and HClO{sub 4}(aq) have been modelled using Pitzer ion-interaction equations. Apparent molar volumes at infinite dilution obtained from these models have been compared to those which can be calculated using the semi-empirical Helgeson, Kirkham, and Flowers equations of state. Values for the apparent molar volume at infinite dilution of the ytterbium trivalent cation have also been calculated using simple additivity principles.

Evaluation of ADCP apparent bed load velocity in a large sand-bed river: Moving versus stationary boat conditions

Science.gov (United States)

Jamieson, E.C.; Rennie, C.D.; Jacobson, R.B.; Townsend, R.D.

2011-01-01

Detailed mapping of bathymetry and apparent bed load velocity using a boat-mounted acoustic Doppler current profiler (ADCP) was carried out along a 388-m section of the lower Missouri River near Columbia, Missouri. Sampling transects (moving boat) were completed at 5- and 20-m spacing along the study section. Stationary (fixed-boat) measurements were made by maintaining constant boat position over a target point where the position of the boat did not deviate more than 3 m in any direction. For each transect and stationary measurement, apparent bed load velocity (vb) was estimated using ADCP bottom tracking data and high precision real-time kinematic (RTK) global positioning system (GPS). The principal objectives of this research are to (1) determine whether boat motion introduces a bias in apparent bed load velocity measurements; and (2) evaluate the reliability of ADCP bed velocity measurements for a range of sediment transport environments. Results indicate that both high transport (vb>0.6 m/s) and moving-boat conditions (for both high and low transport environments) increase the relative variability in estimates of mean bed velocity. Despite this, the spatially dense single-transect measurements were capable of producing detailed bed velocity maps that correspond closely with the expected pattern of sediment transport over large dunes. ?? 2011 American Society of Civil Engineers.

Protruding Features of Viral Capsids Are Clustered on Icosahedral Great Circles.

Directory of Open Access Journals (Sweden)

David P Wilson

Full Text Available Spherical viruses are remarkably well characterized by the Triangulation (T number developed by Casper and Klug. The T-number specifies how many viral capsid proteins are required to cover the virus, as well as how they are further subdivided into pentamer and hexamer subunits. The T-number however does not constrain the orientations of these proteins within the subunits or dictate where the proteins should place their protruding features. These protrusions often take the form of loops, spires and helices, and are significant because they aid in stability of the capsid as well as recognition by the host organism. Until now there has be no overall understanding of the placement of protrusions for spherical viruses, other than they have icosahedral symmetry. We constructed a set of gauge points based upon the work affine extensions of Keef and Twarock, which have fixed relative angular locations with which to measure the locations of these features. This work adds a new element to our understanding of the geometric arrangement of spherical viral capsid proteins; chiefly that the locations of protruding features are not found stochastically distributed in an icosahedral manner across the viral surface, but instead these features are found only in specific locations along the 15 icosahedral great circles. We have found that this result holds true as the T number and viral capsids size increases, suggesting an underlying geometric constraint on their locations. This is in spite of the fact that the constraints on the pentamers and hexamer orientations change as a function of T-number, as you need to accommodate more hexamers in the same solid angle between pentamers. The existence of this angular constraint of viral capsids suggests that there is a fitness or energetic benefit to the virus placing its protrusions in this manner. This discovery may have profound impacts on identifying and eliminating viral pathogens, understanding evolutionary

Nondestructive assay of plutonium in empty stainless steel boxes by apparent mass method

International Nuclear Information System (INIS)

Agarwal, C.; Chaudhury, S.; Nathaniel, T.N.; Goswami, A.

2012-01-01

Apparent mass method (Venkataraman and Croft, Nucl Instrum Methods Phys Res A 505:527, 2003), initially standardized for the assay of Pu (Agarwal et al., J Nucl Mater 651:386, 2007) has been used to get Pu amount in empty stainless steel boxes generally used for storing and transferring plutonium oxide powders. The results have been compared with the neutron coincidence counting results and have been found to match well. The advantage of the method is that it can be used for any sample with nonstandard geometry and with uncertain source distribution. (author)

Apparent molar volumes and isentropic compressibilities of benzyltrialkylammonium chlorides in water at (293.15, 303.15, 313.15, 323.15, and 333.15) K

International Nuclear Information System (INIS)

Duman, Osman; Ayranci, Erol

2009-01-01

Densities and ultrasound speeds of benzyltrialkylammonium chlorides (BTAACls) were measured accurately in aqueous solutions at five temperatures (293.15, 303.15, 313.15, 323.15, and 333.15) K. The data were utilized in determining apparent molar volumes, V Φ , and apparent molar isentropic compressibilities, K SΦ . Infinite dilution values of these apparent molar quantities, V Φ 0 andK SΦ 0 , were determined by extrapolation procedures. Contribution of CH 2 groups, along the alkyl groups of BTAACls, to V Φ 0 andK SΦ 0 values were derived from plots of these quantities as a function of number of additional CH 2 groups in going from benzyltrimethylammonium chloride to benzyltributylammonium chloride. The temperature dependencies of V Φ 0 andK SΦ 0 values were examined on the basis of isobaric expansivity. Apparent molar isobaric expansivities at infinite dilution, E Φ 0 , were obtained from the slopes of V Φ 0 versus temperature data. Concentration dependencies of V Φ and K SΦ were examined. A fair correlation was observed between V Φ 0 andK SΦ 0 values of the three BTAACls.

Lava bubble-wall fragments formed by submarine hydrovolcanic explosions on Lo'ihi Seamount and Kilauea Volcano

Science.gov (United States)

Clague, D.A.; Davis, A.S.; Bischoff, J.L.; Dixon, J.E.; Geyer, R.

2000-01-01

Glassy bubble-wall fragments, morphologically similar to littoral limu o Pele, have been found in volcanic sands erupted on Lo'ihi Seamount and along the submarine east rift zone of Kilauea Volcano. The limu o Pele fragments are undegassed with respect to H2O and S and formed by mild steam explosions. Angular glass sand fragments apparently form at similar, and greater, depths by cooling-contraction granulation. The limu o Pele fragments from Lo'ihi Seamount are dominantly tholeiitic basalt containing 6.25-7.25% MgO. None of the limu o Pele samples from Lo'ihi Seamount contains less than 5.57% MgO, suggesting that higher viscosity magmas do not form lava bubbles. The dissolved CO2 and H2O contents of 7 of the limu o Pele fragments indicate eruption at 1200??300 m depth (120??30 bar). These pressures exceed that generally thought to limit steam explosions. We conclude that hydrovolcanic eruptions are possible, with appropriate pre-mixing conditions, at pressures as great as 120 bar.

POSSIBLE DETECTION OF APPARENT SUPERLUMINAL INWARD MOTION IN MARKARIAN 421 AFTER THE GIANT X-RAY FLARE IN 2010 FEBRUARY

Energy Technology Data Exchange (ETDEWEB)

Niinuma, K. [Graduate School of Science and Engineering, Yamaguchi University, Yamaguchi 753-8511 (Japan); Kino, M.; Oyama, T. [Mizusawa VLBI Observatory, National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Nagai, H. [ALMA-J Project, National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Isobe, N. [Institute of Space and Astronautics, Japan Aerospace Exploration Agency, Yoshinodai, Chuo, Sagamihara 252-5210 (Japan); Gabanyi, K. E. [Hungarian Academy of Sciences, Research Group for Physical Geodesy and Geodynamics, FOMI Satellite Geodetic Observatory Budapest, 1592 Budapest (Hungary); Hada, K. [INAF Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Koyama, S. [Department of Astronomy, University of Tokyo, Hongo, Bunkyo-ku, Tokyo 113-8654 (Japan); Asada, K. [Academia Sinica Institute of Astronomy and Astrophysics, Taipei 10617, Taiwan (China); Fujisawa, K., E-mail: niinuma@yamaguchi-u.ac.jp [Research Institute for Time Studies, Yamaguchi University, Yamaguchi 753-8511 (Japan)

2012-11-10

We report on the very long baseline interferometry (VLBI) follow-up observations using the Japanese VLBI Network array at 22 GHz for the largest X-ray flare of TeV blazar Mrk 421 that occurred in 2010 mid-February. The total of five epochs of observations were performed at intervals of about 20 days between 2010 March 7 and May 31. No newborn component associated with the flare was seen directly in the total intensity images obtained by our multi-epoch VLBI observations. However, one jet component located at {approx}1 mas northwest from the core was able to be identified, and its proper motion can be measured as -1.66 {+-} 0.46 mas yr{sup -1}, which corresponds to an apparent velocity of -3.48 {+-} 0.97c. Here, this negative velocity indicates that the jet component was apparently moving toward the core. As the most plausible explanation, we discuss that the apparent negative velocity was possibly caused by the ejection of a new component, which could not be resolved with our observations. In this case, the obtained Doppler factor of the new component is around 10-20, which is consistent with the ones typically estimated by model fittings of spectral energy distribution for this source.

Clinical chemistry reference values for 75-year-old apparently healthy persons.

Science.gov (United States)

Huber, Klaus Roland; Mostafaie, Nazanin; Stangl, Gerhard; Worofka, Brigitte; Kittl, Eva; Hofmann, Jörg; Hejtman, Milos; Michael, Rainer; Weissgram, Silvia; Leitha, Thomas; Jungwirth, Susanne; Fischer, Peter; Tragl, Karl-Heinz; Bauer, Kurt

2006-01-01

Clinical chemistry reference values for elderly persons are sparse and mostly intermixed with those for younger subjects. To understand the links between metabolism and aging, it is paramount to differentiate between "normal" physiological processes in apparently healthy elderly subjects and metabolic changes due to long-lasting diseases. The Vienna Transdanube Aging (VITA) study, which began in 2000 and is continuing, will allow us to do just that, because more than 600 male and female volunteers aged exactly 75 years (to exclude any influence of the "aging" factor in this cohort) are participating in this study. Extensive clinical, neurological, biochemical, psychological, genetic, and radiological analyses, with a special emphasis on consumption of medication and abuse of drugs, were performed on each of the probands. The multitude of data and questionnaires obtained made possible an a posteriori approach to select individuals fulfilling criteria for a reference sample group of apparently healthy 75-year-old subjects for our study. Specific analytes were quantified on automated clinical analyzers, while manual methods were used for hormonal analytes. All clinical chemistry analytes were evaluated using in-depth statistical analyses with SPSS for Windows. In all, reference intervals for 45 analytes could be established. These include routine parameters for the assessment of organ functions, as well as hormone concentrations and hematological appraisals. Because all patients were reevaluated after exactly 30 months in the course of this study, we had the opportunity to reassess their health status at the age of 77.5 years. This was very useful for validation of the first round data set. Data of the second round evaluation corroborate the reference limits of the baseline analysis and further confirm our inclusion and exclusion criteria. In summary, we have established a reliable set of reference data for hormonal, hematological, and clinical chemistry analytes for

Effects of forage family on apparent ruminal synthesis of B vitamins in lactating dairy cows.

Science.gov (United States)

Castagnino, D S; Seck, M; Beaudet, V; Kammes, K L; Linton, J A Voelker; Allen, M S; Gervais, R; Chouinard, P Y; Girard, C L

2016-03-01

Effects of forage family (legume vs. grass) on apparent ruminal synthesis (ARS) and postruminal supply of B vitamins were evaluated in 2 experiments. Diets containing either alfalfa (AL) or orchardgrass (OG) silages as the sole forage were offered to ruminally and duodenally cannulated lactating Holstein cows in crossover design experiments. Experiment 1 compared diets containing AL and OG [~23% forage neutral detergent fiber (NDF) and ~27% total NDF] offered to 8 cows in two 15-d treatment periods. Experiment 2 compared diets containing AL and OG (~25% forage NDF and ~30% total NDF) offered to 13 cows in two 18-d treatment periods. Thiamin, riboflavin, niacin, vitamin B6, folates, and vitamin B12 were analyzed in feeds and duodenal digesta. Apparent ruminal synthesis was calculated as the duodenal flow of each vitamin minus its intake. Forage family affected B vitamin intakes, duodenal flow, and ARS. In both experiments, AL diets increased vitamin B6 and decreased folate intakes. In experiment 1, riboflavin and niacin intakes were greater with the OG diet, whereas in experiment 2 thiamin intake was greater but riboflavin intake was smaller with the OG diet. In spite of the low contribution of either silage to the dietary folate content, folate intake was greater with OG diets than AL due to the difference in soybean meal contribution between diets. Niacin and folate ARS were not affected by the forage family. Duodenal microbial nitrogen flow was positively correlated with ARS of riboflavin, niacin, vitamin B6, folates, and vitamin B12, but tended to be negatively correlated with thiamin ARS. Apparent ruminal synthesis of folates and vitamin B12 appear to be related to microbial biomass activity. Changes in nutrient composition of the diets likely affected the microbial population in the rumen and their B vitamin metabolism. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

An investigation of the relationship between actual and apparent gasoline thickness in a uniform sand aquifer

International Nuclear Information System (INIS)

Ballestero, T.P.; Fiedler, F.R.; Kinner, N.E.

1994-01-01

A common effort involved in the remediation of contamination by petroleum hydrocarbons in porous media is the monitoring and volume estimation of the immiscible hydrocarbon fluid. The apparent free product thickness indicated by a standard monitoring well is typically much greater than the actual free product thickness in the surrounding soil. An equation to predict actual thickness was developed using heterogeneous fluid flow mechanics and hydrostatics. This equation is: t g =t(1-S g )-h a , where t g =actual formation free product thickness, t=apparent thickness, S g =specific gravity of petroleum hydrocarbon, and h a =distance between the groundwater table and the free product in the formation. The developed theory was compared to data collected from a physical model which simulated field conditions. The theory was used to estimate product thickness in the model, and then these estimates were statistically tested for accuracy. The theoretical slope was not statistically different from the regression slope at test levels of α=0.05 and α=0.01, while the theoretical intercept (h a ) was statistically different at α=0.05 and α=0.01. The discrepancy between the theoretical intercept and the regression intercept was probably due to either an incorrect assumption that h a =bar h c (bar h c =average wetting capillary rise), or an incorrect laboratory measurement of bar h c . The effects of water-table fluctuations were also studied. A rising water table caused a decrease in apparent thickness and an increase in actual thickness, and vice versa. Finally, the developed theoretical equation was compared to the results of previously published predictive methods and experiments. The comparison was made by calculating percent error and using a chi-square statistic. The developed theory was found to be the best predictor of actual product thickness for both laboratory data sets used

Characterization of chondroid matrix-forming sarcomas: gadolinium-enhanced and diffusion weighted MR imaging

International Nuclear Information System (INIS)

Cheng Kebin; Zhang Jing; Qu Hui; Zhang Wei; Liang Wei; Li Xiaosong; Cheng Xiaoguang; Gong Lihua

2010-01-01

Objective: To study the Gadolinium-enhanced MRI and diffusion weighted imaging (DWI) characteristics of the chondroid matrix-forming sarcomas. Methods: Contrast-enhanced MRI and DWI were performed in 14 cases of chondroid matrix-forming sarcomas (10 chondrosarcomas, 4 chondroblastic osteosarcomas) and 13 cases of other types of osteosarcomas. DWI was obtained with a single-shot echo-planar imaging (EPI) sequence using a 1.5 T MR imager with two different b values of 0 and 700 s/mm 2 . The apparent diffusion coefficient (ADC) values were obtained in GE Functiontool software. The contrast-enhancement pattern was evaluated and the ADC values of chondroid matrix-forming sarcomas was compared with that of other types of osteosareoma. Independent sample t-test was performed to evaluate the difference of ADC values between the group of chondroid matrix-forming sarcoma and the group of other types of osteosarcoma. In addition, nonparametric test was used to assess the difference of ADC values between the chondrosarcoma and the chondroblastic osteosarcoma. P value less than 0.05 was considered to represent a statistical significance. Results: For 14 cases of chondroid matrix-forming sarcomas, peripheral enhancement was found in all cases, septonodular enhancement was identified in 12 cases. While 13 cases of other types of osteosarcomas demonstrated heterogeneous enhancement. The mean ADC value of chondroid matrix-forming sarcomas [(2.56±0.35) x 10 -3 mm 2 /s] was significantly higher than that of other types of osteosarcoma [(1.16 ± 0.20) x 10 -3 mm 2 /s] (t=12.704, P<0.01). There was no significant difference in the ADC value between the chondrosarcoma and the chondroblastic osteosarcoma (Z=0.507, P=0.959). Conclusion: Contrast-enhanced MRI and DWI can improve differentiation between chondroid matrix-forming sarcomas and other types of osteosarcomas. (authors)

Predatory fishes affect trophic cascades and apparent competition in temperate reefs.

Science.gov (United States)

Frid, Alejandro; Marliave, Jeff

2010-08-23

We provide evidence for a trophic cascade involving apex predators and mesopredators of marine temperate reefs, lingcod and rockfish, respectively. We measured spatio-temporal variation in the relative abundance of lingcod, subadult rockfish and two shrimp groups eaten by rockfish (Pandalus sp. and three smaller-bodied genera aggregated). Lingcod had an indirect positive effect on shrimps, as mediated by the direct negative effects of lingcod on rockfish and of rockfish on shrimps. These top-down effects on shrimps, however, were stronger for Pandalus than for small-bodied shrimps. Further, abundances of Pandalus and small-bodied shrimps were negatively correlated and the latter had a stronger positive effect on rockfish, suggesting that rockfish mediated asymmetrical apparent competition between shrimps. Our results indicate mechanisms by which predatory fishes may influence the structure of marine communities.

Prediction of the association state of insulin using spectral parameters.

Science.gov (United States)

Uversky, Vladimir N; Garriques, Liza Nielsen; Millett, Ian S; Frokjaer, Sven; Brange, Jens; Doniach, Sebastian; Fink, Anthony L

2003-04-01

Human insulin exists in different association states, from monomer to hexamer, depending on the conditions. In the presence of zinc the "normal" state is a hexamer. The structural properties of 20 variants of human insulin were studied by near-UV circular dichroism, fluorescence spectroscopy, and small-angle X-ray scattering (SAXS). The mutants showed different degrees of association (monomer, dimers, tetramers, and hexamers) at neutral pH. A correlation was shown between the accessibility of tyrosines to acrylamide quenching and the degree of association of the insulin mutants. The near-UV CD spectra of the insulins were affected by protein association and by mutation-induced structural perturbations. However, the shape and intensity of difference CD spectra, obtained by subtraction of the spectra measured in 20% acetic acid (where all insulin species were monomeric) from the corresponding spectra measured at neutral pH, correlate well with the degree of insulin association. In fact, the near-UV CD difference spectra for monomeric, dimeric, tetrameric, and hexameric insulin are very distinctive, both in terms of intensity and shape. The results show that the spectral properties of the insulins reflect their state of association, and can be used to predict their oligomeric state. Copyright 2003 Wiley-Liss, Inc. and the American Pharmaceutical Association J Pharm Sci 92:847-858, 2003

Metabolic Syndrome in Apparently “Healthy” Ghanaian Adults: A Systematic Review and Meta-Analysis

Directory of Open Access Journals (Sweden)

Richard Ofori-Asenso

2017-01-01

Full Text Available Background. Metabolic syndrome (MetS is a major public health problem in Sub-Saharan Africa. We systematically reviewed the literature towards estimating the prevalence of MetS among apparently “healthy” Ghanaian adults. Methods. We searched PubMed, Web of Science, Scopus, Africa Journals Online, African Index Medicus, and Google scholar as well as the websites of the Ministry of Health and Ghana Health service through September 2016. Only studies conducted among apparently “healthy” (no established disease, e.g., diabetes and hypertension adults aged ≥ 18 years were considered. Only studies that utilised the National Cholesterol Education Program Adult Treatment Panel (NCEP-ATP, World Health Organization (WHO, or International Diabetes Federation (IDF classifications for MetS were included. Results. Data from nine studies involving 1,559 individuals were pooled. The prevalence of MetS based on NCEP-ATP, WHO, and IDF classifications was 12.4% (95% confidence interval [CI] = 8.3–17.4%, 6.0% (95% CI = 1.4–13.1%, and 21.2% (95% CI = 12.4–30.9, respectively. Prevalence of MetS was higher among women than men. Conclusion. Among a population of adult Ghanaians deemed “healthy,” there is a high prevalence of MetS. Preventive measures are required to address the risk components of MetS such as obesity and hypertension which are rapidly rising in Ghana.

Information loss problem and a ‘black hole’ model with a closed apparent horizon

International Nuclear Information System (INIS)

Frolov, Valeri P.

2014-01-01

In a classical description the spacetime curvature inside a black hole infinitely grows. In the domain where it reaches the Planckian value and exceeds it the Einstein equations should be modified. In the absence of reliable theory of quantum gravity it is instructive to consider simplified models. We assume that a spacetime curvature is limited by some value (of the order of the Planckian one). We use modified Vaidya metric, proposed by Hayward, to describe the black hole evaporation process. In such a spacetime the curvature near r=0 remains finite, it does not have an event horizon and its apparent horizon is closed. If the initial mass of such a ‘black hole’ is much larger than the Planckian one its properties (as seen by an external observer) are practically the same as properties of the ‘standard’ black hole with the event horizon. We study outgoing null rays in the vicinity of the outer apparent horizon and introduce a notion of a quasi-horizon. We demonstrate that particles, trapped inside a ‘black hole’ during the evaporation process, finally may return to external space after the evaporation is completed. We also demonstrate that such quanta would have very large blue-shift. The absence of the event horizon makes it possible restoration of the unitarity in evaporating black holes

Effect of increasing levels of apparent metabolizable energy on laying hens in barn system.

Science.gov (United States)

Kang, Hwan Ku; Park, Seong Bok; Jeon, Jin Joo; Kim, Hyun Soo; Park, Ki Tae; Kim, Sang Ho; Hong, Eui Chul; Kim, Chan Ho

2018-04-12

This experiment was to investigate the effect of increasing levels of apparent metabolizable energy (AMEn) on the laying performance, egg quality, blood parameter, blood biochemistry, intestinal morphology, and apparent total tract digestibility (ATTD) of energy and nutrients in diets fed to laying hens. A total of three-hundred twenty 33-week-old Hy-Line Brown laying hens (Gallus domesticus) were evenly assigned to four experimental diets of 2,750, 2,850, 2,950, and 3,050 kcal AMEn/kg in floor with deep litter of rice hulls. There were four replicates of each treatment, each consisting of 20 birds in a pen. AMEn intake was increased (linear, p Feed intake and feed conversion ratio were improved (linear, p hen-day egg production tended to be increased as increasing level of AMEn in diets increased. During the experiment, leukocyte concentration and blood biochemistry (total cholesterol, triglyceride, glucose, total protein, calcium, asparate aminotransferase (AST), and alanine transferase (ALT) were not influenced by increasing level of AMEn in diets. Gross energy and ether extract were increased (linear, p hens fed high AMEn diet (i.e., 3,050 kcal/kg in the current experiment) tended to overconsume energy with a positive effect on feed intake, feed conversion ratio, nutrient digestibility, and intestinal morphology but not in egg production and egg mass.

Explaining the apparent paradox of persistent selection for early flowering.

Science.gov (United States)

Austen, Emily J; Rowe, Locke; Stinchcombe, John R; Forrest, Jessica R K

2017-08-01

Decades of observation in natural plant populations have revealed pervasive phenotypic selection for early flowering onset. This consistent pattern seems at odds with life-history theory, which predicts stabilizing selection on age and size at reproduction. Why is selection for later flowering rare? Moreover, extensive evidence demonstrates that flowering time can and does evolve. What maintains ongoing directional selection for early flowering? Several non-mutually exclusive processes can help to reconcile the apparent paradox of selection for early flowering. We outline four: selection through other fitness components may counter observed fecundity selection for early flowering; asymmetry in the flowering-time-fitness function may make selection for later flowering hard to detect; flowering time and fitness may be condition-dependent; and selection on flowering duration is largely unaccounted for. In this Viewpoint, we develop these four mechanisms, and highlight areas where further study will improve our understanding of flowering-time evolution. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

Apparent mineralocorticoid excess: time of manifestation and complications despite treatment.

Science.gov (United States)

Knops, Noël B B; Monnens, Leo A; Lenders, Jacques W; Levtchenko, Elena N

2011-06-01

Here we describe the case of a patient followed from birth because of a positive family history for apparent mineralocorticoid excess (AME) in an older brother. The patient, a girl, had normal serum electrolyte and blood pressure measurements in the first months after birth. Not until the age of 11 months did she develop anorexia and failure to thrive in combination with hypertension, hypokalemia, and metabolic alkalosis, which are consistent with the diagnosis of AME. This diagnosis was confirmed by mutation analysis of the HSD11B2 gene (C1228T). Treatment with amiloride and furosemide electrolyte disturbances normalized her blood pressure. At the age of 19 years she unexpectedly suffered a stroke. Additional investigations revealed no accepted risk factor for stroke. We discuss the possible underlying mechanisms for the delayed manifestation of hypertension and electrolyte disturbances in AME, propose an additional explanation for the stroke in this patient, and advise treatment with a mineralocorticoid receptor antagonist to reduce stroke risk in patients with AME.

Study on the leach mechanism of 90-19/U glass form in underground water of disposal site

International Nuclear Information System (INIS)

Sheng Jiawei; Luo Shanggeng; Tang Baolong

1996-01-01

The leach behavior of 90-19/U glass form in underground water (UW) of disposal site and in the deionized water (DIW) is studied. The total mass losses of glass form and the normalized element mass losses of B, Li and Si in UW are presented and compared to DIW. It is found that the ions in UW affect the leach behavior of 90-19/U glass. At the beginning of the reaction the reaction rate of the glass is smaller in UW than in DIW due to the low glass dissolution affinity in UW which is defined as (1-c/K). The rate determining step of leach reaction of 90-19/U glass in UW during the entire reaction period is the ion-exchange reaction. The apparent activation energy of glass reaction in UW is 51.6 kJ/mol

Mass-action model analysis of the apparent molar volume and heat capacity of pluronics in water and liposome suspensions at 25 °C.

Science.gov (United States)

Quirion, François; Meilleur, Luc; Lévesque, Isabelle

2013-07-09

Pluronics are block copolymers composed of a central block of polypropylene oxide and two side chains of polyethylene oxide. They are used in water to generate aggregates and gels or added to phospholipid suspensions to prepare microparticles for drug delivery applications. The structure of these systems has been widely investigated. However, little is known about the mechanisms leading to these structures. This investigation compares the apparent molar volumes and heat capacities of Pluronics F38, F108, F127, P85, P104, and P103 at 25 °C in water and in the presence of lecithin liposomes. The changes in molar volumes, heat capacities, and enthalpies generated by a mass-action model are in good agreement with the loss of hydrophobic hydration of the polypropylene oxide central block of the Pluronics. However, the molecularity of the endothermic transitions is much smaller than the aggregation numbers reported in the literature for the same systems. It is suggested that Pluronics go through dehydration of their central block to form unimolecular or small entities having a hydrophobic polypropylene oxide core. In water, these entities would assemble athermally to form larger aggregates. In the presence of liposomes, they would be transferred into the hydrophobic lecithin bilayers of the liposomes. Light transmission experiments suggest that the liposome suspensions are significantly altered only when the added Pluronics are in the dehydrated state.

Apparent molar volumes and apparent molar heat capacities of aqueous adonitol, dulcitol, glycerol, meso-erythritol, myo-inositol, D-sorbitol, and xylitol at temperatures from (278.15 to 368.15) K and at the pressure 0.35 MPa

Energy Technology Data Exchange (ETDEWEB)

Blodgett, M.B. [Department of Chemistry and Biochemistry, Brigham Young University, Provo, UT, 84602-5700 (United States); Ziemer, S.P. [Department of Chemistry and Biochemistry, Brigham Young University, Provo, UT, 84602-5700 (United States); Brown, B.R. [Department of Chemistry and Biochemistry, Brigham Young University, Provo, UT, 84602-5700 (United States); Niederhauser, T.L. [Department of Chemistry and Biochemistry, Brigham Young University, Provo, UT, 84602-5700 (United States); Woolley, E.M. [Department of Chemistry and Biochemistry, Brigham Young University, Provo, UT, 84602-5700 (United States)]. E-mail: earl_woolley@byu.edu

2007-04-15

Apparent molar volumes V {sub {phi}} were determined for aqueous adonitol, dulcitol, glycerol, meso-erythritol, myo-inositol, D-sorbitol, and xylitol at temperatures from (278.15 to 368.15) K and at the pressure 0.35 MPa, and apparent molar heat capacities C {sub p,{phi}} of the same solutions were determined at temperatures from (278.15 to 363.15) K at the same pressure. Molalities m/(mol . kg{sup -1}) of the solutions were in the range (0.02 {<=} m {<=} 3.2) for adonitol, (0.02 {<=} m {<=} 0.15) for dulcitol, (0.02 {<=} m {<=} 5.0) for glycerol, (0.02 {<=} m {<=} 3.0) for meso-erythritol, (0.02 {<=} m {<=} 0.5) for myo-inositol, (0.02 {<=} m {<=} 2.0) for D-sorbitol, and (0.02 {<=} m {<=} 2.7) for xylitol. A vibrating tube densimeter was used to obtain solution densities and a fixed-cell temperature scanning calorimeter was used to obtain heat capacities. Values of V {sub {phi}} and C {sub p,{phi}} for these sugar alcohols are discussed relative to one another and compared to values from the literature, where available.

Apparent amitosis in the binucleate dinoflagellate Peridinium balticum.

Science.gov (United States)

Tippit, D H; Pickett-Heaps, J D

1976-07-01

Mitosis and cytokinesis in the free-living binucleate dinoflagellate Peridinium balticum are described, P. balticum contains 2 nuclei; one is a typical dinoflagellate nucleus and the other resembles the interphase nuclei of some eucaryotic cells and is here named the supernumerary nucleus (formerly called the eucaryotic nucleus). The dinoflagellate nucleus divides in the characteristic manner already described for certain other dinoflagellates. The supernumerary nucleus does not undergo normal mitosis; its chromatin does not condense, a spindle is not differentiated for its division, nor are any microtubules present inside the nucleus during any stage of its division. Instead the supernumerary nucleus divides by simple cleavage, which is concurrent with cytoplasmic cleavage. The nucleus cleaves first on its side facing the wall, but later it cleaves circumferentially as the cytoplasmic cleavage furrow draws closer. Invariably at late cytokinesis, a portion of the dividing nucleus passes through the only remaining uncleaved area of the cell. The final separation of the supernumerary nucleus is probably accomplished by the ingrowing furrow pinching the nucleus in two. There is no apparent precise segregation of genetic material during division, nor are there any structural changes inside the dividing nucleus which distinguish it from the interphase nucleus. Certain aspects of amitosis, and previously postulated theories concerning the endosymbiont origin of the second nucleus, are discussed.

Factors influencing zinc status of apparently healthy indians.

Science.gov (United States)

Agte, Vaishali V; Chiplonkar, Shashi A; Tarwadi, Kirtan V

2005-10-01

To identify dietary, environmental and socio-economic factors associated with mild zinc deficiency, three zinc status indices; erythrocyte membrane zinc (RBCMZn), plasma zinc and super oxide dismutase (SOD) were assessed in free living and apparently healthy Indian population. Dietary patterns of 232 men and 223 women (20-65 yr) from rural, industrial and urban regions of Western India were evaluated by food frequency questionnaire. RBCMZn was estimated using atomic absorption spectrometry, hemoglobin and serum ceruloplasmin by spectrophotometer. On a sub sample (48 men and 51 women) plasma zinc and SOD were also assessed. Mean RBCMZn was 0.5 +/- 0.1 micromols/g protein with 46% individuals showing zinc deficiency. Mean plasma zinc was 0.98 +/- 0.12 microg/mL with 25% men and 2.5% women having values below normal range. Mean SOD was 0.97 +/- 0.1 (u/mL cells). A significant positive correlation was observed between intakes of green leafy vegetables, other vegetables and milk products with RBCMZn status (p plasma zinc (p > 0.2). Cereal and legume intakes were negatively correlated with RBCMZn (p plasma zinc (p 0.2). Fruit and other vegetable intake were positively correlated with SOD (p Plasma zinc indicated positive association with zinc, thiamin and riboflavin intakes (p plasma zinc and SOD. Prominent determinants of zinc status were intakes of beta-carotene and zinc along with environmental conditions and family size.

Correlational study between sorption and goo apparent organoclays

International Nuclear Information System (INIS)

Silva, D.L.; Silva, M.R.O.; Ferreira, H.S.; Brasileiro, C.T.

2016-01-01

The sorption of surfactants in bentonite clay can occur through the mechanism of adsorption and absorption, this being a very supple phenomenon according clay and surfactant utilized. Thus the more surfactant sorbed at the organoclay it becomes, and can be used in various applications, including in oil drilling fluid. This study aimed to correlate the sorption of surfactants with the rheological properties of non-aqueous fluids (oil base). In organophilization process was used Bentongel clay which had its concentration varied from 3.16 to 7.16% by weight of clay. It was used to organophilization an ionic surfactant Praepagem WB with 75% of active matter, where its concentration ranged from 127-181 mEq. After organophilizated the clays were filtered, dried in an oven for 48 hours and passed in ABNT sieve No. 200, to be so characterized. Sorption was calculated from mathematical equations. Non-aqueous fluids were prepared according to standard Petrobras (EP-1EP-00023A) for rheological testing. Correlating the sorption of surfactant, and the rheological properties of non-aqueous fluid, obtained satisfactory results where observed through the scatter plots there is a strong correlation between the variables sorption and apparent viscosity, it should also be noted that the viscosity is a variable which increases with an increase in sorption, confirming that the surfactant concentration influences the viscosity. (author)

Colorimetric microdetermination of captopril in pure form and in pharmaceutical formulations

Science.gov (United States)

Shama, Sayed Ahmed; El-Sayed Amin, Alla; Omara, Hany

2006-11-01

A simple, rapid, accurate, precise and sensitive colorimetric method for the determination of captopril (CAP) in bulk sample and in dosage forms is described. The method is based on oxidation of the drug by potassium permanganate in acidic medium and determination of the unreacted oxidant by measuring the decrease in absorbance for five different dyes; methylene blue (MB); acid blue 74 (AB), acid red 73 (AR), amaranth dye (AM) and acid orange 7 (AO) at a suitable λmax (660, 610, 510, 520, and 485 nm), respectively. Regression analysis of Beer's plots showed good correlation in the concentration ranges (0.4 12.5, 0.3 10, 0.5 11, 0.4 8.3 and 0.5 9.3 μg ml-1), respectively. The apparent molar absorbtivity, Sandell sensitivity, detection and quantitation limits were calculated. For more accurate results, Ringbom optimum concentration ranges were 0.5 12, 0.5 9.6, 0.6 10.5, 0.5 8.0 and 0.7 9.0 μg ml-1, respectively. The validity of the proposed method was tested by analyzing in pure and dosage forms containing CAP whether alone or in combination with hydrochlorothiazide. Statistical analysis of the results reflects that the proposed procedures are precise, accurate and easily applicable for the determination of CAP in pure form and in pharmaceutical preparations. Also, the stability constant was determined and the free energy change was calculated potentiometrically.

Apparent Minimum Free Energy Requirements for Methanogenic Archaea and Sulfate-Reducing Bacteria in an Anoxic Marine Sediment

Science.gov (United States)

Hoehler, Tori M.; Alperin, Marc J.; Albert, Daniel B.; Martens, Christopher S.; DeVincenzi, Don (Technical Monitor)

2000-01-01

Among the most fundamental constraints governing the distribution of microorganisms in the environment is the availability of chemical energy at biologically useful levels. To assess the minimum free energy yield that can support microbial metabolism in situ, we examined the thermodynamics of H2-consuming processes in anoxic sediments from Cape Lookout Bight, NC, USA. Depth distributions of H2 partial pressure, along with a suite of relevant concentration data, were determined in sediment cores collected in November (at 14.5 C) and August (at 27 C) and used to calculate free energy yields for methanogenesis and sulfate reduction. At both times of year, and for both processes, free energy yields gradually decreased (became less negative) with depth before reaching an apparent asymptote. Sulfate reducing bacteria exhibited an asymptote of -19.1 +/- 1.7 kj(mol SO4(2-)(sup -1) while methanogenic archaea were apparently supported by energy yields as small as -10.6 +/- 0.7 kj(mol CH4)(sup -1).

Harmonic Maass forms and mock modular forms

CERN Document Server

Bringmann, Kathrin; Ono, Ken

2017-01-01

Modular forms and Jacobi forms play a central role in many areas of mathematics. Over the last 10-15 years, this theory has been extended to certain non-holomorphic functions, the so-called "harmonic Maass forms". The first glimpses of this theory appeared in Ramanujan's enigmatic last letter to G. H. Hardy written from his deathbed. Ramanujan discovered functions he called "mock theta functions" which over eighty years later were recognized as pieces of harmonic Maass forms. This book contains the essential features of the theory of harmonic Maass forms and mock modular forms, together with a wide variety of applications to algebraic number theory, combinatorics, elliptic curves, mathematical physics, quantum modular forms, and representation theory.

Digestibilidade aparente da farinha de aguapé em tilápias-do-nilo Apparent digestibility of water hyacinth meal by Nile tilapia

Directory of Open Access Journals (Sweden)

José Francisco Vicente Biudes

2009-11-01

Full Text Available Objetivou-se com este trabalho determinar e comparar as digestibilidades aparentes da matéria seca (MS, proteína bruta (PB, extrato etéreo (EE e energia bruta (EB e as disponibilidades aparentes de minerais das farinhas da biomassa emersa (lâmina foliar e pecíolo, submersa (raiz e rizoma e total do aguapé em tilápias-do-nilo (Oreochromis niloticus. Foram elaboradas quatro rações marcadas com 0,10% de óxido de crômio-III (uma ração-referência purificada e três contendo 30,0% de cada ingrediente. As tilápias-do-nilo (125,5 ± 10,5 g foram alimentadas até a saciedade e a coleta de fezes foi realizada pelo sistema Ghelph modificado. As digestibilidades aparentes da farinha da biomassa emersa (MS = 57,8; PB = 72,3; EE = 63,2 e EB = 62,0% foram maiores que as das farinhas da biomassa total (MS = 45,7; PB = 57,3; EE = 50,3 e EB = 42,3% e submersa (MS = 38,3; PB = 50,8; EE = 43,5 e EB = 32,0%. As disponibilidades aparentes de fósforo (P, cálcio (Ca, magnésio (Mg, manganês (Mn, cobre (Cu e zinco (Zn da farinha da biomassa emersa também foram maiores. A farinha de biomassa emersa do aguapé apresenta melhor digestibilidade e disponibilidade aparente dos nutrientes em comparação às farinhas da biomassa total e submersa.This study was carried out to determine and compare the apparent digestibility of dry matter (DM, crude protein (CP, crude fat (CF, gross energy (GE, and the apparent availability of minerals (P, Ca, Mg, Mn, Cu, and Zn of emergent (leaf and petiole, submerged (root and rhizome and total biomass meal of water hyacinth for Nile tilapia. Four diets were prepared, containing 0.10% chromic oxide-III, one being the reference diet (purified and the others containing 30% of each ingredient. The Nile tilapias (125.5 ± 10.5 g were fed until satiation and the feces were collected by the modified Guelph system. The apparent digestibility of emergent biomass meal (DM = 57.8, CP = 72.3, CF = 63.2, and GE = 62.0% was higher than

Systematic review on vitamin D level in apparently healthy Indian population and analysis of its associated factors

Directory of Open Access Journals (Sweden)

Sandhiya Selvarajan

2017-01-01

Full Text Available Background: Vitamin D which is involved in the maintenance of bone mineral homeostasis has been found to portray various pleiotropic effects. Although it has been widely accepted that serum 25-hydroxy Vitamin D level above 30 ng/ml is considered optimal for the biological actions of Vitamin D, there is a need to explore the levels of Vitamin D reported among Indians from various regions of the country. Hence, this systematic review aims to appraise the status of Vitamin D levels reported from apparently healthy Indians across various parts of India. Methodology: A comprehensive literature search was carried out to identify the range of Vitamin D levels among apparently healthy individuals from various parts of India, with the search term “Vitamin D and India” in the search portals of PubMed, Google Scholar, Indmed, and ScienceDirect. A total of 2998 articles were retrieved by the above search strategy, of which only forty studies fulfilled the criteria to be included in the systematic review. Studies done in various states were compiled under the respective zones based on the classification of Indian zones as specified in Zonal maps of India. Results: The level of Vitamin D from all the forty included studies ranged from 3.15 ± 1.4 to 52.9 ± 33.7 ng/ml. The effect size of Vitamin D level was higher in the South Zone compared to other zones. Conclusion: The present study shows that Vitamin D deficiency is prevalent among apparently healthy Indians living in different regions of India, irrespective of their exposure to sunlight.

The utility of serum CA-125 in predicting extra-uterine disease in apparent early-stage endometrial cancer.

Science.gov (United States)

Nicklin, James; Janda, Monika; Gebski, Val; Jobling, Thomas; Land, Russell; Manolitsas, Tom; McCartney, Anthony; Nascimento, Marcelo; Perrin, Lewis; Baker, Jannah F; Obermair, Andreas

2012-08-15

Surgical staging in early-stage uterine cancer is controversial. Preoperative serum CA-125 may be of clinical value in predicting the presence of extra-uterine disease in patients with apparent early-stage endometrial cancer. Between October 6, 2005, and June 17, 2010, 760 patients were enrolled in an international, multicentre, prospective randomized trial (LACE) comparing laparotomy with laparoscopy in the management of endometrial cancer apparently confined to the uterus. Of these, 657 patients with endometrial adenocarcinoma had a preoperative serum CA-125 value recorded. Multiple cross-validation analysis was undertaken to correlate preoperative serum CA-125 with stage of disease (Stage I vs. Stage II+) after surgery. Patients' median preoperative serum CA-125 was 14 U/ml. A cutoff point of 30 U/ml was associated with the smallest misclassification error, and using this cutoff, 98 patients (14.9%) had elevated CA-125 levels. Of those, 36 (36.7%) had evidence of extra-uterine disease. Of the 116 patients (17.7%) with evidence of extra-uterine disease, 31.0% had an elevated CA-125 level. On univariate and multivariable logistic regression analysis, only preoperative CA-125 level, but no other preoperative clinical characteristics were found to be associated with extra-uterine spread of disease. Utilizing a cutoff point of 30 U/ml achieved a sensitivity, specificity, positive predictive value and negative predictive value of 31.0, 88.5, 36.7 and 85.7%, respectively. Elevated CA-125 above 30 U/ml in patients with apparent early-stage disease is a risk factor for the presence of extra-uterine disease and may assist clinicians in the management of patients with clinical Stage I endometrial cancer. Copyright © 2011 UICC.

ABSORBANCE, ABSORPTION COEFFICIENT, AND APPARENT QUANTUM YIELD: A COMMENT ON AMBIGUITY IN THE USE OF THESE OPTICAL CONCEPTS

Science.gov (United States)

Several important optical terms such as "absorbance" and "absorption coefficient" are frequently used ambiguously in the current peer-reviewed literature. Since they are important terms that are required to derive other quantities such as the "apparent quantum yield" of photoprod...

Katanin spiral and ring structures shed light on power stroke for microtubule severing

Energy Technology Data Exchange (ETDEWEB)

Zehr, Elena; Szyk, Agnieszka; Piszczek, Grzegorz; Szczesna, Ewa; Zuo, Xiaobing; Roll-Mecak, Antonina

2017-08-07

Microtubule-severing enzymes katanin, spastin and fidgetin are AAA ATPases critical for the biogenesis and maintenance of complex microtubule arrays in axons, spindles and cilia. Because of a lack of 3D structures, their mechanism has remained poorly understood. We report the first X-ray structure of the monomeric AAA katanin module and cryo-EM reconstructions of the hexamer in two conformations. These reveal an unexpected asymmetric arrangement of the AAA domains mediated by structural elements unique to severing enzymes and critical for their function. Our reconstructions show that katanin cycles between open spiral and closed ring conformations, depending on the ATP occupancy of a gating protomer that tenses or relaxes inter-protomer interfaces. Cycling of the hexamer between these conformations would provide the power stroke for microtubule severing.

[MEASUREMENT OF HISTONES AND CIRCULATING EXTRACELLULAR NUCLEIC ACIDS IN PATIENTS' WITH COMPLICATED FORMS OF PEPTIC ULCER].

Science.gov (United States)

Yerznkyan, G; Kultanov, B; Shakeev, K; Tatina, Ye

2017-04-01

We studied 135 people (24 people, apparently healthy, 39 uncomplicated peptic ulcer disease, 42 people with complex forms peptic ulcer, 30 and after the treatment of complicated forms of peptic ulcer disease, both sexes (18-45 y.). In all patients, the diagnosis was confirmed fibrogastroduodenoscopy (EGD). Determination of histones and acid soluble fraction (ASF), RNA, DNA, in blood was performed by the method of L. Markusheva. Studies have led to the conclusion that the change in the blood concentration of extracellular nucleic acids in patients with uncomplicated disease and complex shapes can be caused by oxidative stress products and can be a signal for elimination of nucleic acids from cells. We have registered various dynamics of the studied parameters histones in the blood of patients with various forms of peptic ulcer disease, which reflects the degree of metabolic abnormalities that occur in the body, associated with changes in the structure of the nucleus. According to the results of our research in the study of the role of extracellular nucleic acids, histones to assess the extent of violations of metabolic processes at a peptic ulcer, complicated and uncomplicated form, the obtained results can be used as predictors of complications of a stomach ulcer.

Glucose intolerance among apparently healthy Hausa-Fulani ...

African Journals Online (AJOL)

Background: Glucose intolerance has been recently reclassified by the World Health Organization (WHO) incorporating a new class known as impaired fasting glycaemia. Previous studies in this environment looked as diabetes mellitus only but not the other forms of glucose intolerance. Objectives: To study the prevalence ...

A quantized mechanism for activation of pannexin channels

Science.gov (United States)

Chiu, Yu-Hsin; Jin, Xueyao; Medina, Christopher B.; Leonhardt, Susan A.; Kiessling, Volker; Bennett, Brad C.; Shu, Shaofang; Tamm, Lukas K.; Yeager, Mark; Ravichandran, Kodi S.; Bayliss, Douglas A.

2017-01-01

Pannexin 1 (PANX1) subunits form oligomeric plasma membrane channels that mediate nucleotide release for purinergic signalling, which is involved in diverse physiological processes such as apoptosis, inflammation, blood pressure regulation, and cancer progression and metastasis. Here we explore the mechanistic basis for PANX1 activation by using wild type and engineered concatemeric channels. We find that PANX1 activation involves sequential stepwise sojourns through multiple discrete open states, each with unique channel gating and conductance properties that reflect contributions of the individual subunits of the hexamer. Progressive PANX1 channel opening is directly linked to permeation of ions and large molecules (ATP and fluorescent dyes) and occurs during both irreversible (caspase cleavage-mediated) and reversible (α1 adrenoceptor-mediated) forms of channel activation. This unique, quantized activation process enables fine tuning of PANX1 channel activity and may be a generalized regulatory mechanism for other related multimeric channels. PMID:28134257

A second mutation associated with apparent [beta]-hexosaminidase A pseudodeficiency: Identification and frequency estimation

Energy Technology Data Exchange (ETDEWEB)

Cao, Z.; Chabot, T.; Triggs-Raine, B.L. (Univ. of Manitoba, Winnepeg (Canada)); Natowicz, M.R.; Prence, E.M. (Shriver Center for Mental Retardation, Waltham, MA (United States) Harvard Medical School, Boston, MA (United States)); Kaback, M.M.; Lim-Steele, S.T.; Brown, D. (Children' s Hospital, San Diego, CA (United States) Univ. of California, San Diego, CA (United States))

1993-12-01

Deficient activity of [beta]-hexosaminidase A (Hex A), resulting from mutations in the HEXA gene, typically causes Tay-Sachs disease. However, healthy individuals lacking Hex A activity against synthetic substrates (i.e., individuals who are pseudodeficient) have been described. Recently, an apparently benign C[sub 739]-to-T (Arg247Trp) mutation was found among individuals with Hex A levels indistinguishable from those of carriers of Tay-Sachs disease. This allele, when in compound heterozygosity with a second [open quotes]disease-causing[close quotes] allele, results in Hex A pseudodeficiency. The authors examined the HEXA gene of a healthy 42-year-old who was Hex A deficient but did not have the C[sub 739]-to-T mutation. The HEXA exons were PCR amplified, and the products were analyzed for mutations by using restriction-enzyme digestion or single-strand gel electrophoresis. A G[sub 805]-to-A (Gly269Ser) mutation associated with adult-onset G[sub m2] gangliosidosis was found on one chromosome. A new mutation, C[sub 745]-to-T (Arg 249Trp), was identified on the second chromosome. This mutation was detected in an additional 4/63 (6%) non-Jewish and 0/218 Ashkenazi Jewish enzyme-defined carriers. Although the Arg249Trp change may result in a late-onset form of G[sub M2] gangliosidosis, any phenotype must be very mild. This new mutation and the benign C[sub 739]-to-T mutation together account for [approximately]38% of non-Jewish enzyme-defined carriers. Because carriers of the C[sub 739]-to-T and C[sub 745]-to-T mutations cannot be differentiated from carriers of disease-causing alleles by using the classical biochemical screening approaches, DNA-based analyses for these mutations should be offered for non-Jewish enzyme-defined heterozygotes, before definitive counseling is provided. 46 refs., 5 figs., 2 tabs.

Chemical shift-dependent apparent scalar couplings: An alternative concept of chemical shift monitoring in multi-dimensional NMR experiments

International Nuclear Information System (INIS)

Kwiatkowski, Witek; Riek, Roland

2003-01-01

The paper presents an alternative technique for chemical shift monitoring in a multi-dimensional NMR experiment. The monitored chemical shift is coded in the line-shape of a cross-peak through an apparent residual scalar coupling active during an established evolution period or acquisition. The size of the apparent scalar coupling is manipulated with an off-resonance radio-frequency pulse in order to correlate the size of the coupling with the position of the additional chemical shift. The strength of this concept is that chemical shift information is added without an additional evolution period and accompanying polarization transfer periods. This concept was incorporated into the three-dimensional triple-resonance experiment HNCA, adding the information of 1 H α chemical shifts. The experiment is called HNCA coded HA, since the chemical shift of 1 H α is coded in the line-shape of the cross-peak along the 13 C α dimension

Apparent ileal amino acid digestibility and the nutritive value of the triticale cultivars Moreno and Ulrika for growing-finishing pigs

Directory of Open Access Journals (Sweden)

S. PERTTILÄ

2008-12-01

Full Text Available Both digestibility and performance experiments were carried out to evaluate the nutritive value of triticale for growing-finishing pigs.In experiment 1,the apparent ileal and faecal digestibility of nutrients in barley (Hordeum vulgare cv.Viiviand two triticale (Tritico secale cultivars, Moreno and Ulrika, were measured using six cannulated barrows with a body weight (BWof 82-107 kg.In experiment 2,132 pigs were used over 25-100 kg BW to study the effects of replacing barley in a barley-soyabean meal-based diet with graded amounts of triticale cv.Moreno (25,50,75,or 100% and cv.Ulrika (50 or 100%.The apparent ileal and faecal digestibilities of dry matter and organic matter were higher for both triticale cultivars than for barley (P 0.05.The apparent ileal digestibility of lysine averaged 65.6, 70.8, and 70.5% for barley and triticale cv.Moreno and Ulrika,respectively.The net energy content of triticales (11.5 MJ kg-1 DMwas 0.4 MJ kg -1 DM higher than that of barley.The replacement of barley with the triticale cultivars Moreno and Ulrika exerted a positive quadratic effect on daily weight gain and the feed conversion ratio of pigs from 50 to 100 kg and from 25 to 100 kg BW (P

Preparation of NaTaO3 by Spray Pyrolysis and Evaluation of Apparent Photocatalytic Activity for Hydrogen Production from Water

Directory of Open Access Journals (Sweden)

Hyun Woo Kang

2008-01-01

Full Text Available NaTaO3 photocatalyst was prepared by spray pyrolysis process and tested as photocatalyst for water splitting under UV light. Precursor solution was prepared from NaNO3 and Ta(OC2H55 in nitric acid solution and spray-pyrolyzed in air at between 973 and 1273 K. Considerable enhancement of photocatalytic activity was achieved by loading 0.05∼0.2 wt% of NiO on the surface of NaTaO3. The NiO loading was more effective on the NaTaO3 synthesized by spray pyrolysis in comparison with that synthesized by solid-state reaction. The quantum yield (QY of NiO/NaTaO3 photocatalyst was measured by chemical actinometry using potassium ferrioxalate and compared with the apparent photocatalytic activities (APA which would be more useful for the purpose of photocatalytic reactor design than the quantum yield. The apparent photocatalytic activity (APA was defined by the rate of hydrogen production divided by weight of catalyst, volume of reactant mixture, duration of irradiation, and power of UV lamp. The validity of the apparent photocatalytic activity (APA was discussed based on our results and reported activities of NaTaO3 photocatalyst loaded with or without NiO.

Congenital heart defects in newborns with apparently isolated single gastrointestinal malformation: A retrospective study.

Science.gov (United States)

Schierz, Ingrid Anne Mandy; Pinello, Giuseppa; Giuffrè, Mario; La Placa, Simona; Piro, Ettore; Corsello, Giovanni

2016-12-01

Congenital gastrointestinal system malformations/abdominal wall defects (GISM) may appear as isolated defects (single or complex), or in association with multiple malformations. The high incidence of association of GISM and congenital heart defects (CHD) in patients with syndromes and malformative sequences is known, but less expected is the association of apparently isolated single GISM and CHD. The aim of this study was to investigate the frequency of CHD in newborns with isolated GISM, and the possibility to modify the diagnostic-therapeutic approach just before the onset of cardiac symptoms or complications. Anamnestic, clinical, and imaging data of newborns requiring abdominal surgery for GISM, between 2009 and 2014, were compared with a control group of healthy newborns. Distribution of GISM and cardiovascular abnormalities were analyzed, and risk factors for adverse outcomes were identified. Seventy-one newborns with isolated GISM were included in this study. More frequent GISM were intestinal rotation and fixation disorders. CHD were observed in 15.5% of patients, augmenting their risk for morbidity. Risk factors for morbidity related to sepsis were identified in central venous catheter, intestinal stoma, and H2-inhibitor-drugs. Moreover, 28.2% of newborns presented only functional cardiac disorders but an unexpectedly higher mortality. The high incidence of congenital heart disease in infants with apparently isolated GISM confirms the need to perform an echocardiographic study before surgery to improve perioperative management and prevent complications such as sepsis and endocarditis. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

THE GOSPEL TEXT IN DOSTOYEVSKY'S WORKS IN THE LIGHT OF GENERAL FORM-PRODUCING PRINCIPLES

Directory of Open Access Journals (Sweden)

Sergey Viktorovich Syzranov

2014-11-01

Full Text Available The artistic functions of the Gospel text in Dostoyevsky’s Th e Double, Notes from the Underground and The Idiot" are examined in the light of Losev’s aesthetic theory. The focus is on the fact that the categories of Prime-image, Myth, Name take important place both in Losev’s aesthetics and Dostoyevsky’s poetics. Dynamics of the form-producing process is described by Losev as a dialectical way of the movement of Image towards Prime-image, its purpose is their complete equation. In Dostoyevsky’s works this dynamics is already apparent at onomapoetics: hero’s name actualizes dialectical relations between the character and its ideal prototype. These relations are materialized in diverse interactions of the artistic and the Gospel texts. Gospel text is actively involved in the process of formation; it carries interpenetration of architectonics and of composition aspects of artistic form, organizes artistic teleology of the writer’s works. Teleological direction of artistic myth created by Dostoyevsky embodies teleology of Absolute Myth of Sacred history.

Impact of Apparent Reactance Injected by TCSR on Distance Relay in Presence Phase to Earth Fault

Directory of Open Access Journals (Sweden)

Mohamed Zellagui

2013-01-01

Full Text Available This research paper presents the impact study of apparent reactance injected by series Flexible AC Transmission System (FACTS i.e. Thyristor Controlled Series Reactor (TCSR on the measured impedance of a 400 kV single electrical transmission line in the presence of phase to earth fault with fault resistance. The study deals with an electrical transmission line of Eastern Algerian transmission networks at Group Sonelgaz (Algerian Company of Electrical compensated by TCSR connected at midpoint of the transmission line. This compensator used to inject voltage and reactive power is controlled by TCSR. The simulations results investigate the three impacts of the apparent reactance injected by TCSR (XTCSR on transmission line protected by distance relay protection. The impacts concern the active and reactive power, the line impedance (reactance and resistance, and the short circuit parameters (symmetrical currents, line currents, symmetrical voltages and line voltages as well as the measured impedance by relay (resistance and reactance in the presence of earth fault These impacts are investigated in order to improve the performances of distance relay protection. More the impact of XTCSR by three TCSR for cases studies is presented.

Problems in maintenance of herd health associated with acid forming emissions

International Nuclear Information System (INIS)

Kostuch, M.

1992-01-01

The effects of sour gas plant emissions on dairy herds are described. A veterinarian establishing a practice in Rocky Mountain House, Alberta, found that dairy herds in that area suffered from a disproportionately higher occurrence of health problems than Minnesota herds with similar types of management. These problems are postulated to result from acid-forming emissions from two large sour gas plants in the area (the Ram River and Gulf Strachan plants). Health problems found in dairy cattle in the Rocky Mountain House area were: unthriftiness, increased susceptibility to infectious diseases, reproductive problems, and 'downer' animals (cows unable to stand up unassisted). Problems related to the reproductive organs were the most apparent. Clinical observations of problems in dairy herds are described. Since the levels of emissions from the plants have decreased, incidence of problems in dairy herds has also decreased. 1 ref., 2 figs

Spin trapping of radicals formed in gamma-irradiated methanol: effect of the irradiation temperature from 77K to 300K

International Nuclear Information System (INIS)

Schlick, S.; Kevan, L.

1976-01-01

The neutral radicals formed in gamma-irradiated methanol were studied by spin trapping with phenyl-t-butylnitrone (PBN) in an attempt to probe the primary neutral radicals formed. In the temperature range from approximately 157 K to 300 K both CH 2 OH and CH 3 O spin adducts are observed and their limiting ratio at high PBN concentrations is CH 2 OH/CH 3 O=1.5 over this temperature range. Below approximately 157 K this ratio increases exponentially with decreasing temperature with an apparent activation energy of 5.8 kJ/mole (1.4 kcal/mole); this is consistent with the finding that only CH 2 OH radicals are formed by gamma radiolysis at 77 K. Several possible models for the primary neutral radicals formed in gamma-irradiated methanol and their subsequent reactions as a function of irradiation temperature are discussed. It is suggested that the primary radical formation mechanisms are similar in the gas and liquid phases and become temperature dependent when molecular motion is arrested in the solid. (Auth.)

Preliminary estimates of residence times and apparent ages of ground water in the Chesapeake Bay watershed, and water-quality data from a survey of springs

Science.gov (United States)

Focazio, Michael J.; Plummer, Niel; Bohlke, John K.; Busenberg, Eurybiades; Bachman, L. Joseph; Powars, David S.

1998-01-01

Knowledge of the residence times of the ground-water systems in Chesapeake Bay watershed helps resource managers anticipate potential delays between implementation of land-management practices and any improve-ments in river and estuary water quality. This report presents preliminary estimates of ground-water residence times and apparent ages of water in the shallow aquifers of the Chesapeake Bay watershed. A simple reservoir model, published data, and analyses of spring water were used to estimate residence times and apparent ages of ground-water discharge. Ranges of aquifer hydraulic characteristics throughout the Bay watershed were derived from published literature and were used to estimate ground-water residence times on the basis of a simple reservoir model. Simple combinations of rock type and physiographic province were used to delineate hydrogeomorphic regions (HGMR?s) for the study area. The HGMR?s are used to facilitate organization and display of the data and analyses. Illustrations depicting the relation of aquifer characteristics and associated residence times as a continuum for each HGMR were developed. In this way, the natural variation of aquifer characteristics can be seen graphically by use of data from selected representative studies. Water samples collected in September and November 1996, from 46 springs throughout the watershed were analyzed for chlorofluorocarbons (CFC?s) to estimate the apparent age of ground water. For comparison purposes, apparent ages of water from springs were calculated assuming piston flow. Additi-onal data are given to estimate apparent ages assuming an exponential distribution of ages in spring discharge. Additionally, results from previous studies of CFC-dating of ground water from other springs and wells in the watershed were compiled. The CFC data, and the data on major ions, nutrients, and nitrogen isotopes in the water collected from the 46 springs are included in this report. The apparent ages of water

Apparent exchange rate for breast cancer characterization.

Science.gov (United States)

Lasič, Samo; Oredsson, Stina; Partridge, Savannah C; Saal, Lao H; Topgaard, Daniel; Nilsson, Markus; Bryskhe, Karin

2016-05-01

Although diffusion MRI has shown promise for the characterization of breast cancer, it has low specificity to malignant subtypes. Higher specificity might be achieved if the effects of cell morphology and molecular exchange across cell membranes could be disentangled. The quantification of exchange might thus allow the differentiation of different types of breast cancer cells. Based on differences in diffusion rates between the intra- and extracellular compartments, filter exchange spectroscopy/imaging (FEXSY/FEXI) provides non-invasive quantification of the apparent exchange rate (AXR) of water between the two compartments. To test the feasibility of FEXSY for the differentiation of different breast cancer cells, we performed experiments on several breast epithelial cell lines in vitro. Furthermore, we performed the first in vivo FEXI measurement of water exchange in human breast. In cell suspensions, pulsed gradient spin-echo experiments with large b values and variable pulse duration allow the characterization of the intracellular compartment, whereas FEXSY provides a quantification of AXR. These experiments are very sensitive to the physiological state of cells and can be used to establish reliable protocols for the culture and harvesting of cells. Our results suggest that different breast cancer subtypes can be distinguished on the basis of their AXR values in cell suspensions. Time-resolved measurements allow the monitoring of the physiological state of cells in suspensions over the time-scale of hours, and reveal an abrupt disintegration of the intracellular compartment. In vivo, exchange can be detected in a tumor, whereas, in normal tissue, the exchange rate is outside the range experimentally accessible for FEXI. At present, low signal-to-noise ratio and limited scan time allows the quantification of AXR only in a region of interest of relatively large tumors. © 2016 The Authors. NMR in Biomedicine published by John Wiley & Sons Ltd.

Determination of the apparent transfer coefficient for CO oxidation on Pt(poly), Pt(111), Pt(665) and Pt(332) using a potential modulation technique.

Science.gov (United States)

Wang, Han-Chun; Ernst, Siegfried; Baltruschat, Helmut

2010-03-07

The apparent transfer coefficient, which gives the magnitude of the potential dependence of the electrochemical reaction rates, is the key quantity for the elucidation of electrochemical reaction mechanisms. We introduce the application of an ac method to determine the apparent transfer coefficient alpha' for the oxidation of pre-adsorbed CO at polycrystalline and single-crystalline Pt electrodes in sulfuric acid. The method allows to record alpha' quasi continuously as a function of potential (and time) in cyclic voltammetry or at a fixed potential, with the reaction rate varying with time. At all surfaces (Pt(poly), Pt(111), Pt(665), and Pt(332)) we clearly observed a transition of the apparent transfer coefficient from values around 1.5 at low potentials to values around 0.5 at higher potentials. Changes of the apparent transfer coefficients for the CO oxidation with potential were observed previously, but only from around 0.7 to values as low as 0.2. In contrast, our experimental findings completely agree with the simulation by Koper et al., J. Chem. Phys., 1998, 109, 6051-6062. They can be understood in the framework of a Langmuir-Hinshelwood mechanism. The transition occurs when the sum of the rate constants for the forward reaction (first step: potential dependent OH adsorption, second step: potential dependent oxidation of CO(ad) with OH(ad)) exceeds the rate constant for the back-reaction of the first step. We expect that the ac method for the determination of the apparent transfer coefficient, which we used here, will be of great help also in many other cases, especially under steady conditions, where the major limitations of the method are avoided.

Apparent molar volumes and apparent molar heat capacities of aqueous adonitol, dulcitol, glycerol, meso-erythritol, myo-inositol, D-sorbitol, and xylitol at temperatures from (278.15 to 368.15) K and at the pressure 0.35 MPa

International Nuclear Information System (INIS)

Blodgett, M.B.; Ziemer, S.P.; Brown, B.R.; Niederhauser, T.L.; Woolley, E.M.

2007-01-01

Apparent molar volumes V φ were determined for aqueous adonitol, dulcitol, glycerol, meso-erythritol, myo-inositol, D-sorbitol, and xylitol at temperatures from (278.15 to 368.15) K and at the pressure 0.35 MPa, and apparent molar heat capacities C p,φ of the same solutions were determined at temperatures from (278.15 to 363.15) K at the same pressure. Molalities m/(mol . kg -1 ) of the solutions were in the range (0.02 ≤ m ≤ 3.2) for adonitol, (0.02 ≤ m ≤ 0.15) for dulcitol, (0.02 ≤ m ≤ 5.0) for glycerol, (0.02 ≤ m ≤ 3.0) for meso-erythritol, (0.02 ≤ m ≤ 0.5) for myo-inositol, (0.02 ≤ m ≤ 2.0) for D-sorbitol, and (0.02 ≤ m ≤ 2.7) for xylitol. A vibrating tube densimeter was used to obtain solution densities and a fixed-cell temperature scanning calorimeter was used to obtain heat capacities. Values of V φ and C p,φ for these sugar alcohols are discussed relative to one another and compared to values from the literature, where available

A Marker of Endotoxemia Is Associated With Obesity and Related Metabolic Disorders in Apparently Healthy Chinese

OpenAIRE

Sun, Liang; Yu, Zhijie; Ye, Xingwang; Zou, Shurong; Li, Huaixing; Yu, Danxia; Wu, Hongyu; Chen, Yan; Dore, Joel; Clément, Karine; Hu, Frank B.; Lin, Xu

2010-01-01

OBJECTIVE Elevated lipopolysaccharide-binding protein (LBP), a marker of subclinical endotoxemia, may be involved in the pathogenesis of obesity and metabolic risk. We aimed to investigate the association between plasma LBP and metabolic disorders in apparently healthy Chinese. RESEARCH DESIGN AND METHODS A population-based study including 559 overweight/obese (BMI ≥24.0 kg/m2) and 500 normal-weight (18.0 ≤ BMI

Diurnal productivity and apparent 14C-calcification in the staghorn coral, Acropora acuminata

International Nuclear Information System (INIS)

Barnes, D.J.; Crossland, C.J.

1978-01-01

The rate of 14 C-fixation by Acropora acuminata tissues showed a marked increase after dawn. However, maximum 14 C-fixation was not achieved until early afternoon. The apparent 14 C-incorporation rate into the skeleton of whole branches reached a peak around noon. However, the major period of 14 C-deposition occurred from noon to mid-afternoon. The broad peak of 14 C-incorporation into skeleton of whole branches reflects two rate maxima; a late-morning maximum of zooxanthellae-free terminal calices, probably related to translocation of fixed carbon from basal tissues; and an early afternoon maximum for the zooxanthellae-containing basal areas of branches. (author)

The Apparent Lack of Lorentz Invariance in Zero-Point Fields with Truncated Spectra

Directory of Open Access Journals (Sweden)

Daywitt W. C.

2009-01-01

Full Text Available The integrals that describe the expectation values of the zero-point quantum-field-theoretic vacuum state are semi-infinite, as are the integrals for the stochastic electrodynamic vacuum. The unbounded upper limit to these integrals leads in turn to infinite energy densities and renormalization masses. A number of models have been put forward to truncate the integrals so that these densities and masses are finite. Unfortunately the truncation apparently destroys the Lorentz invariance of the integrals. This note argues that the integrals are naturally truncated by the graininess of the negative-energy Planck vacuum state from which the zero-point vacuum arises, and are thus automatically Lorentz invariant.

Classic maximum entropy recovery of the average joint distribution of apparent FRET efficiency and fluorescence photons for single-molecule burst measurements.

Science.gov (United States)

DeVore, Matthew S; Gull, Stephen F; Johnson, Carey K

2012-04-05

We describe a method for analysis of single-molecule Förster resonance energy transfer (FRET) burst measurements using classic maximum entropy. Classic maximum entropy determines the Bayesian inference for the joint probability describing the total fluorescence photons and the apparent FRET efficiency. The method was tested with simulated data and then with DNA labeled with fluorescent dyes. The most probable joint distribution can be marginalized to obtain both the overall distribution of fluorescence photons and the apparent FRET efficiency distribution. This method proves to be ideal for determining the distance distribution of FRET-labeled biomolecules, and it successfully predicts the shape of the recovered distributions.

Field O stars: formed in situ or as runaways?

Science.gov (United States)

Gvaramadze, V. V.; Weidner, C.; Kroupa, P.; Pflamm-Altenburg, J.

2012-08-01

A significant fraction of massive stars in the Milky Way and other galaxies are located far from star clusters and star-forming regions. It is known that some of these stars are runaways, i.e. possess high space velocities (determined through the proper motion and/or radial velocity measurements), and therefore most likely were formed in embedded clusters and then ejected into the field because of dynamical few-body interactions or binary-supernova explosions. However, there exists a group of field O stars whose runaway status is difficult to prove via direct proper motion measurements (e.g. in the Magellanic Clouds) or whose (measured) low space velocities and/or young ages appear to be incompatible with their large separation from known star clusters. The existence of this group led some authors to believe that field O stars can form in situ. Since the question of whether or not O stars can form in isolation is of crucial importance for star formation theory, it is important to thoroughly test candidates of such stars in order to improve the theory. In this paper, we examine the runaway status of the best candidates for isolated formation of massive stars in the Milky Way and the Magellanic Clouds by searching for bow shocks around them, by using the new reduction of the Hipparcos data, and by searching for stellar systems from which they could originate within their lifetimes. We show that most of the known O stars thought to have formed in isolation are instead very likely runaways. We show also that the field must contain a population of O stars whose low space velocities and/or young ages are in apparent contradiction to the large separation of these stars from their parent clusters and/or the ages of these clusters. These stars (the descendants of runaway massive binaries) cannot be traced back to their parent clusters and therefore can be mistakenly considered as having formed in situ. We argue also that some field O stars could be detected in optical

Nephrotic Syndrome and Acute Renal Failure Apparently Induced by Sunitinib

Directory of Open Access Journals (Sweden)

Ying-Shou Chen

2009-10-01

Full Text Available We report a case of nephrotic syndrome and acute renal failure apparently induced by sunitinib. A 67-year-old man with a history of metastatic renal cell carcinoma presented with progressive kidney dysfunction with proteinuria, general edema, and body weight gain of 21 kg after undergoing 3 weeks of sunitinib therapy. The patient had taken no other over-the-counter medications, and all other possible causes of nephrotic syndrome were excluded. The Naranjo Adverse Drug Reaction Probability Scale score for this event was 6, indicating a high probability that the observed presentations were associated with use of the drug. However, despite the discontinuation of sunitinib, his condition deteriorated, and hemodialysis was initiated for respiratory distress. A renal biopsy was performed, which revealed ischemic acute tubular necrosis with minimal change nephropathy. In conclusion, nephrologists and oncologists should be aware that nephrotic syndrome with ischemic acute tubular necrosis is a possible adverse effect of sunitinib. For early diagnosis of this condition and to avoid renal damage, we recommend differential diagnosis of serum creatinine and proteinuria in patients undergoing sunitinib therapy.

The effect of actinides on the microstructural development in a metallic high-level nuclear waste form

Energy Technology Data Exchange (ETDEWEB)

Keiser, D. D., Jr.; Sinkler, W.; Abraham, D. P.; Richardson, J. W., Jr.; McDeavitt, S. M.

1999-10-25

Waste forms to contain material residual from an electrometallurgical treatment of spent nuclear fuel have been developed by Argonne National Laboratory. One of these waste forms contains waste stainless steel (SS), fission products that are noble to the process (e.g., Tc, Ru, Pd, Rh), Zr, and actinides. The baseline composition of this metallic waste form is SS-15wt.% Zr. The metallurgy of this baseline alloy has been well characterized. On the other hand, the effects of actinides on the alloy microstructure are not well understood. As a result, SS-Zr alloys with added U, Pu, and/or Np have been cast and then characterized, using scanning electron microscopy, transmission electron microscopy, and neutron diffraction, to investigate the microstructural development in SS-Zr alloys that contain actinides. Actinides were found to congregate non-uniformally in a Zr(Fe,Cr,Ni){sub 2+x} phase. Apparently, the actinides were contained in varying amounts in the different polytypes (C14, C15, and C36) of the Zr(Fe,Cr,Ni){sub 2+x} phase. Heat treatment of an actinide-containing SS-15 wt.% Zr alloy showed the observed microstructure to be stable.

Ultrasonic characterization of cancellous bone using apparent integrated backscatter

Energy Technology Data Exchange (ETDEWEB)

Hoffmeister, B K [Department of Physics, Rhodes College, 2000 North Parkway, Memphis, TN 38112 (United States); III, C I Jones [Department of Physics, Rhodes College, 2000 North Parkway, Memphis, TN 38112 (United States); Caldwell, G J [Department of Physics, Rhodes College, 2000 North Parkway, Memphis, TN 38112 (United States); Kaste, S C [Department of Diagnostic Imaging, St Jude Children' s Research Hospital, Memphis, TN 38105 (United States)

2006-06-07

Apparent integrated backscatter (AIB) is a measure of the frequency-averaged (integrated) backscattered power contained in some portion of a backscattered ultrasonic signal. AIB has been used extensively to study soft tissues, but its usefulness as a tissue characterization technique for cancellous bone has not been demonstrated. To address this, we performed measurements on 17 specimens of cancellous bone over two different frequency ranges using a 1 MHz and 5 MHz broadband ultrasonic transducer. Specimens were obtained from bovine tibiae and prepared in the shape of cubes (15 mm side length) with faces oriented along transverse (anterior, posterior, medial and lateral) and longitudinal (superior and inferior) principal anatomic directions. A mechanical scanning system was used to acquire multiple backscatter signals from each direction for each cube. AIB demonstrated highly significant linear correlations with bone mineral density (BMD) for both the transverse (R{sup 2} = 0.817) and longitudinal (R{sup 2} = 0.488) directions using the 5 MHz transducer. In contrast, the correlations with density were much weaker for the 1 MHz transducer (R{sup 2} = 0.007 transverse, R{sup 2} = 0.228 longitudinal). In all cases where a significant correlation was observed, AIB was found to decrease with increasing BMD.

Vitamin A equivalency and apparent absorption of ß-carotene in ileostomy subjects using a dual-isotope dilution technique

NARCIS (Netherlands)

Bouwman, C.A.; Naber, T.H.J.; Breemen, van R.B.; Zhu, D.; Dicke, H.; Siebelink, E.; Hulshof, P.J.M.; Russel, F.G.M.; Schaafsma, G.; West, C.E.

2010-01-01

The objective was to quantify the vitamin A equivalency of ß-carotene in two diets using a dual-isotope dilution technique and the apparent ß-carotene absorption as measured by the oral–faecal balance technique. Seventeen healthy adults with an ileostomy completed the 4-week diet-controlled,

Vitamin A equivalency and apparent absorption of beta-carotene in ileostomy subjects using a dual-isotope dilution technique.

NARCIS (Netherlands)

Loo-Bouwman, C.A. Van; Naber, T.H.; Breemen, R.B. van; Zhu, D.; Dicke, H.; Siebelink, E.; Hulshof, P.J.; Russel, F.G.M.; Schaafsma, G.; West, C.E.

2010-01-01

The objective was to quantify the vitamin A equivalency of beta-carotene in two diets using a dual-isotope dilution technique and the apparent beta-carotene absorption as measured by the oral-faecal balance technique. Seventeen healthy adults with an ileostomy completed the 4-week diet-controlled,

Bacterial actin MreB forms antiparallel double filaments.

Science.gov (United States)

van den Ent, Fusinita; Izoré, Thierry; Bharat, Tanmay Am; Johnson, Christopher M; Löwe, Jan

2014-05-02

Filaments of all actin-like proteins known to date are assembled from pairs of protofilaments that are arranged in a parallel fashion, generating polarity. In this study, we show that the prokaryotic actin homologue MreB forms pairs of protofilaments that adopt an antiparallel arrangement in vitro and in vivo. We provide an atomic view of antiparallel protofilaments of Caulobacter MreB as apparent from crystal structures. We show that a protofilament doublet is essential for MreB's function in cell shape maintenance and demonstrate by in vivo site-specific cross-linking the antiparallel orientation of MreB protofilaments in E. coli. 3D cryo-EM shows that pairs of protofilaments of Caulobacter MreB tightly bind to membranes. Crystal structures of different nucleotide and polymerisation states of Caulobacter MreB reveal conserved conformational changes accompanying antiparallel filament formation. Finally, the antimicrobial agents A22/MP265 are shown to bind close to the bound nucleotide of MreB, presumably preventing nucleotide hydrolysis and destabilising double protofilaments.DOI: http://dx.doi.org/10.7554/eLife.02634.001. Copyright © 2014, van den Ent et al.