23 CFR 771.125 - Final environmental impact statements.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Final environmental impact statements. 771.125 Section... ENVIRONMENT ENVIRONMENTAL IMPACT AND RELATED PROCEDURES § 771.125 Final environmental impact statements. (a)(1..., economic, or environmental impacts of the action may need to be more fully explored; (iii) the impacts of...
40 CFR 179.125 - Judicial review.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Judicial review. 179.125 Section 179... EVIDENTIARY PUBLIC HEARING Judicial Review § 179.125 Judicial review. (a) The Administrator's final decision... judicial review within the period ending on the 60th day after the date of the publication of the order...
Directory of Open Access Journals (Sweden)
Jae-Hoon Chang
Full Text Available BACKGROUND: Vitamin D(3, the most physiologically relevant form of vitamin D, is an essential organic compound that has been shown to have a crucial effect on the immune responses. Vitamin D(3 ameliorates the onset of the experimental autoimmune encephalomyelitis (EAE; however, the direct effect of vitamin D(3 on T cells is largely unknown. METHODOLOGY/PRINCIPAL FINDINGS: In an in vitro system using cells from mice, the active form of vitamin D(3 (1,25-dihydroxyvitamin D(3 suppresses both interleukin (IL-17-producing T cells (T(H17 and regulatory T cells (Treg differentiation via a vitamin D receptor signal. The ability of 1,25-dihydroxyvitamin D(3 (1,25(OH(2D(3 to reduce the amount of IL-2 regulates the generation of Treg cells, but not T(H17 cells. Under T(H17-polarizing conditions, 1,25(OH(2D(3 helps to increase the numbers of IL-10-producing T cells, but 1,25(OH(2D(3's negative regulation of T(H17 development is still defined in the IL-10(-/- T cells. Although the STAT1 signal reciprocally affects the secretion of IL-10 and IL-17, 1,25(OH(2D(3 inhibits IL-17 production in STAT1(-/- T cells. Most interestingly, 1,25(OH(2D(3 negatively regulates CCR6 expression which might be essential for T(H17 cells to enter the central nervous system and initiate EAE. CONCLUSIONS/SIGNIFICANCE: Our present results in an experimental murine model suggest that 1,25(OH(2D(3 can directly regulate T cell differentiation and could be applied in preventive and therapeutic strategies for T(H17-mediated autoimmune diseases.
Geoscience for society. 125th Anniversary volume
Energy Technology Data Exchange (ETDEWEB)
Nenonen, K.; Nurmi, P.A. (eds.)
2011-07-01
Our knowledge of Finnish geology and natural resources has considerably increased during the last few decades. Geological Survey of Finland - GTK has mapped the bedrock and Quaternary deposits, as well as mineral resources in great detail using modern geological, geochemical and geophysical techniques, so that Finland today has one of the best geological databases in the world. We have recently compiled countrywide datasets of seamless bedrock information at the scale of 1:200,000, and completed low-altitude airborne geophysical (200 m line spacing and 40 m terrain clearance), regional geochemical (80 000 samples), and reflection seismic surveys at the crustal scale and at high resolution on the main orepotential formations. Isotopic age determinations have been performed at GTK since the 1960s, and we now have accurate ages for about thousand samples, which is a key to studying the complex evolution of the Finnish Precambrian. GTK currently plays a vital role in providing geological expertise to the government, the business sector and the wider community. Specific responsibilities include the promotion and implementation of sustainable approaches to the supply and management of minerals, energy and construction materials, and to ensure environmental compliance through monitoring, assessment and remediation programmes. GTK also contributes to a wide range of international geoscience, mapping, mineral resources and environmental monitoring projects, and is active in developing multidisciplinary research programmes with universities, government agencies and stakeholders across related sectors. This 125th Anniversary Publication aims at elucidating, through a number of short articles, the current focus of research and development at GTK. In reaching the milestone of 125 years, we can state that our anniversary slogan, 'forever young', is justified by the vitality and increasing societal impact of the organization and our research focusing on sustainable
Geoscience for society. 125th Anniversary volume
Energy Technology Data Exchange (ETDEWEB)
Nenonen, K.; Nurmi, P A [eds.
2011-07-01
Our knowledge of Finnish geology and natural resources has considerably increased during the last few decades. Geological Survey of Finland - GTK has mapped the bedrock and Quaternary deposits, as well as mineral resources in great detail using modern geological, geochemical and geophysical techniques, so that Finland today has one of the best geological databases in the world. We have recently compiled countrywide datasets of seamless bedrock information at the scale of 1:200,000, and completed low-altitude airborne geophysical (200 m line spacing and 40 m terrain clearance), regional geochemical (80 000 samples), and reflection seismic surveys at the crustal scale and at high resolution on the main orepotential formations. Isotopic age determinations have been performed at GTK since the 1960s, and we now have accurate ages for about thousand samples, which is a key to studying the complex evolution of the Finnish Precambrian. GTK currently plays a vital role in providing geological expertise to the government, the business sector and the wider community. Specific responsibilities include the promotion and implementation of sustainable approaches to the supply and management of minerals, energy and construction materials, and to ensure environmental compliance through monitoring, assessment and remediation programmes. GTK also contributes to a wide range of international geoscience, mapping, mineral resources and environmental monitoring projects, and is active in developing multidisciplinary research programmes with universities, government agencies and stakeholders across related sectors. This 125th Anniversary Publication aims at elucidating, through a number of short articles, the current focus of research and development at GTK. In reaching the milestone of 125 years, we can state that our anniversary slogan, 'forever young', is justified by the vitality and increasing societal impact of the organization and our research focusing on sustainable development of
Stoll, Barbara J
2013-10-01
This year is the 125th anniversary of the American Pediatric Society (APS), a time to reflect on the past 125 years of child health and child health research, a time to consider the health of America's children in a social and global context, and a time to consider the future. This paper is a combination of pediatric and APS history and personal story.
Synthesis of (125) I-lamivudine and (125) I-lamivudine-ursodeoxycholic acid codrug.
Motaleb, M A; Abo-Kul, M; Ibrahim, Samy M; Saad, Shokry M; Arafat, Muhammad
2016-09-01
The preparation of (125) I-lamivudine ((125) I-3TC) and (125) I-lamivudine-ursodeoxycholic acid codrug ((125) I-3TC-UDCA), suitable for comparative biodistribution studies, is described. The synthesis of the unlabeled precursor 3TC-UDCA proceeds in an 11.6% yield, and the radiolabelling yields for (125) I-3TC and (125) I-3TC-UDCA were 89 and 92%, respectively. The final products are radiochemically pure (greater than 98%). Copyright © 2016 John Wiley & Sons, Ltd.
Brown, Gregory G; Anderson, Vicki; Bigler, Erin D; Chan, Agnes S; Fama, Rosemary; Grabowski, Thomas J; Zakzanis, Konstantine K
2017-11-01
The American Psychological Association (APA) celebrated its 125th anniversary in 2017. As part of this celebration, the APA journal Neuropsychology has published in its November 2017 issue 11 papers describing some of the advances in the field of neuropsychology over the past 25 years. The papers address three broad topics: assessment and intervention, brain imaging, and theory and methods. The papers describe the rise of new assessment and intervention technologies, the impact of evidence for neuroplasticity on neurorehabilitation. Examples of the use of mathematical models of cognition to investigate latent neurobehavioral processes, the development of the field of neuropsychology in select international countries, the increasing sophistication of brain imaging methods, the recent evidence for localizationist and connectionist accounts of neurobehavioral functioning, the advances in neurobehavioral genomics, and descriptions of newly developed statistical models of longitudinal change. Together the papers convey evidence of the vibrant growth in the field of neuropsychology over the quarter century since APA's 100th anniversary in 1992. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Standardization of 125 Sb in equilibrium non-equilibrium situations with 125m Te
International Nuclear Information System (INIS)
Rodriguez Barquero, L.; Jimenez de Mingo, A.; Grau Carles, A.
1997-10-01
We study the stability of ''125 Sb in the following scintillators: HiSafeIII''TM, Insta- Gel reg s ign Plus and '' Ultima-Gold'' TM. Since ''125 m Te requires more than one year to reach the secular equilibrium with ''125 Sb, we cannot be sure, for a given sample, whether equilibrium is reached or not. In this report we present a new procedure that permits one calibrate mixtures of ''125 Sb+''125 m Te out of the equilibrium. The steps required for the radiochemical separation of the components are indicated. Finally, we study the evolution of counting rate when column yields are less than 100%. (Author)
VandenBos, Gary R; Hogan, John D; Kazak, Anne E
2017-11-01
In 2017, the American Psychological Association (APA) celebrates the 125th anniversary of its founding. This special issue commemorates this milestone by providing long- and short-term views on the history of APA and its role in psychology in America. The opening paper presents an overview of initiatives and challenges facing the field of psychology and APA in five periods, each roughly 25 years in length. The remaining eight articles review specific issues and areas of activity over varying lengths of time in more recent years. Issues of policy involvement, relations with the media, and involvement with the courts are described, as well as developments related to social justice, education, science, practice, and publications. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
High level of CA 125 due to large endometrioma.
Phupong, Vorapong; Chen, Orawan; Ultchaswadi, Pornthip
2004-09-01
CA 125 is a tumor-associated antigen. Its high levels are usually associated with ovarian malignancies, whereas smaller increases in the levels were associated with benign gynecologic conditions. The authors report a high level of CA 125 in a case of large ovarian endometrioma. A 45-year-old nulliparous Thai woman, presented with an increase of her abdominal girth for 7 months. Transabdominal ultrasonogram demonstrated a large ovarian cyst and multiple small leiomyoma uteri, and serum CA 125 level was 1,006 U/ml. The preoperative diagnosis was ovarian cancer with leiomyoma uteri. Exploratory laparotomy was performed. There were a large right ovarian endometrioma, small left ovarian endometrioma and multiple small leiomyoma. Total abdominal hysterectomy and bilateral salpingo-oophorectomy was performed and histopathology confirmed the diagnosis of endometrioma and leiomyoma. The serum CA 125 level declined to non-detectable at the 4th week. She was well at discharge and throughout her 4th week follow-up period Although a very high level of CA 125 is associated with a malignant process, it can also be found in benign conditions such as a large endometrioma. The case emphasizes the association of high levels of CA 125 with benign gynecologic conditions.
DEFF Research Database (Denmark)
Poudrier, J; Owens, T
1995-01-01
that IL-5 (125 U/ml) synergizes with Th1 cells to induce B cell responses to IL-2, that are maintained following T-cell removal, e.g. autonomous. Th1 help in the absence of IL-5 resulted in weak or undetectable responses following T cell removal. The mechanism of IL-5 synergy involved persistence of IL-2R...... anti-Ig did not circumvent the need for IL-5 for autonomous IL-2 responses. Consistent with the above, interaction with an IL-5-producing Th2 clone induced strong autonomous B cell responses to IL-2. Qualitative differences of Th2 help over that of Th1 may thus be attributable to their differential...
Studies of the distribution of intrathecally injected 125I-tetanus antitoxin-F(ab')2
International Nuclear Information System (INIS)
Hanauske, A.R.
1981-01-01
Overall F(ab') 2 and antitetanus-f(ab') 2 - fragments were labelled with 125 I and injected i.th. into normal juvenile cats and adult rats. One group of rats was normal; in the other, unilateral local tetanus had been induced by injection of tetanus toxin into a M. gastrocnemius. The animals were sacrificed 24 h after the i.th. injection, and tissue samples were taken for histoautoradiography. 125 I-antitetanus-F(ab') 2 permeated into the extracellular space of the spinal cord, roots, and ganglia but not into the neuronal intracellular space. 125 I-overall-F(ab') showed identical permeation behaviour. 125 I-antitetanus-F(ab') 2 reacted with tetanus toxin issuing from the motoneurons after i.th. injection, forming an immunocomplex around the motorneurons. The immunocomplex was not formed around pseudo-unipolar ganglian cells in the spinal ganglia even though some of the ganglian cells contained tetanus toxin, and 125 I-antitetanus-F(ab') 2 was present in the extracellular space. As an explanation, it was suggested that tetanus toxin does not permeate into the extracellular space through the membrane of the pseudo-unipolar ganglian cells so that immune reactions will not occur. These findings help to explain the widely divergent results of tetanus therapy by means of i.th. injection of tetanus antitoxin. Recommendations for future therapy measures are derived from the findings. (orig./MG) [de
Alvarez-Díaz, Jorge Alberto
2008-01-01
Within the framework of the 125 anniversary of the birth of Franz Kafka we discuss his work as a patient affected by tuberculosis. This essay outlines a review of Kafka as a writer and explains the meaning of the term "Kafkaesque". We put forward a commentary on the ethics expressed in a short story entitled A country doctor. An interpretation of Kafka must involve the notion of responsibility, a theological concept that is then followed by the legal context. Finally, Kafka embraces an ethical approach expressed in his work.
Clinical evaluation of the Byk LIA-mat CA125 II assay: discussion of a reference value.
Bonfrer, J M; Korse, C M; Verstraeten, R A; van Kamp, G J; Hart, G A; Kenemans, P
1997-03-01
The Byk LIA-mat CA125 II assay was compared with the Centocor IRMA CA125 II. Serum samples studied (n = 1012) were obtained from 652 apparently healthy females, 61 pregnant women, and 299 patients with benign and malignant gynecological tumors. The CA125 II assay value at the 95th percentile of the total healthy group was 29 kU/L for the LIA-mat and 32 kU/L for the Centocor assay. For the LIA-mat assay the 95th percentile was 31 kU/L (Centocor 36 kU/L) for the group 55 years of age. By using ROC curves we found the optimal pretreatment Byk LIA-mat CA125 II value differentiating between benign and malignant ovarian tumors to be 95 kU/L. Pretreatment CA125 values > 1000 kU/L were detected in serum samples of patients with advanced epithelial ovarian cancer.
Energy Technology Data Exchange (ETDEWEB)
Mueller-Peddinghaus, R [Kali-Chemie Pharma G.m.b.H., Hannover (Germany, F.R.). Abt. fuer Experimentelle Pathologie; Meyer zu Schwabedissen, H [Medizinische Hochschule Hannover (Germany, F.R.). Abt. fuer Klinische Immunologie und Bluttransfusionswesen; Kalden, J R [Erlangen-Nuernberg Univ., Erlangen (Germany, F.R.). Inst. und Poliklinik fuer Klinische Immunologie; Trautwein, G; Ueberschaer, S [Tieraerztliche Hochschule Hannover (Germany, F.R.). Inst. fuer Pathologie
1980-01-01
Aleutian disease (AD) of mink most closely resembles systemic lupus erythematosus (SLE) in man; both are immune complex disease. In experimental AD serum immune complexes are determined by the /sup 125/J-C 1 q-binding test using human C 1 q. Mink (n = 12) infected intraperitoneally with Aleutian disease virus (ADV), grown in fetal mink kidney cells, developed during the course of infection a mean of /sup 125/I-C 1 q serum binding equivalent to 3.62 +- 1.68 mg./ml. aggr. HGG. (aggregated human immunoglobulin). Sera of mink (n = 8) which were infected with ADV grown in L-cells showed a less marked /sup 125/I-C 1 q binding with a mean equivalent to 2.52 +- 1.43 mg./ml. aggr. HGG. In contrast control animals (n = 8) treated with non-ADV-infected mink epidermal fibroblasts or Eagle's minimal essential medium substituted with fetal calf serum only bound /sup 125/I-C 1 q equivalent to 1.02 +- 0.99 mg./ml. aggr. HGG. In mink infected with ADV propagated in fetal mink kidney cells a constant increase in the /sup 125/I-C 1 q serum binding occurred from the 4th to the 7th and 13th week after ADV infection. Mink which were infected with ADV propagated in mouse L-cells exhibited a different pattern of the /sup 125/I-C 1 q serum binding capacity with a sharp increase from the 4th to the 7th week, followed by a decline towards the 13th week post infection. The serum /sup 125/I-C 1 q binding capacity of all experimental animal groups exhibited at different times of the experiment a significant correlation with the presence of hypergammaglobulinaemia and raised ADV-antibody titers. From the data obtained it appears that the /sup 125/I-C 1 q binding test, utilizing human C 1 q, is a suitable method for the detection of circulating serum immune complexes in mink during the course of ADV-infection.
Skates, Steven J.; Mai, Phuong; Horick, Nora K.; Piedmonte, Marion; Drescher, Charles W.; Isaacs, Claudine; Armstrong, Deborah K.; Buys, Saundra S.; Rodriguez, Gustavo C.; Horowitz, Ira R.; Berchuck, Andrew; Daly, Mary B.; Domchek, Susan; Cohn, David E.; Van Le, Linda; Schorge, John O.; Newland, William; Davidson, Susan A.; Barnes, Mack; Brewster, Wendy; Azodi, Masoud; Nerenstone, Stacy; Kauff, Noah D.; Fabian, Carol J.; Sluss, Patrick M.; Nayfield, Susan G.; Kasten, Carol H.; Finkelstein, Dianne M.; Greene, Mark H.; Lu, Karen
2011-01-01
Background Previous screening trials for early detection of ovarian cancer in postmenopausal women have used the standard CA125 cut-point of 35 U/mL, the 98th percentile in this population yielding a 2% false positive rate, while the same cut-point in trials of premenopausal women results in substantially higher false positive rates. We investigated demographic and clinical factors predicting CA125 distributions, including 98th percentiles, in a large population of high-risk women participating in two ovarian cancer screening studies with common eligibility criteria and screening protocols. Methods Baseline CA125 values and clinical and demographic data from 3,692 women participating in screening studies conducted by the NCI-sponsored Cancer Genetics Network and Gynecologic Oncology Group were combined for this pre-planned analysis. Due to the large effect of menopausal status on CA125 levels, statistical analyses were conducted separately in pre- and postmenopausal subjects to determine the impact of other baseline factors on predicted CA125 cut-points based on the 98th percentile. Results The primary clinical factor affecting CA125 cut-points was menopausal status, with premenopausal women having a significantly higher cut-point of 50 U/mL while in postmenopausal subjects the standard cut-point of 35 U/mL was recapitulated. In premenopausal women, current oral contraceptive (OC) users had a cut-point of 40 U/mL. Conclusions To achieve a 2% false positive rate in ovarian cancer screening trials and in high-risk women choosing to be screened, the cut-point for initial CA125 testing should be personalized primarily for menopausal status (~ 50 for premenopausal women, 40 for premenopausal on OC, 35 for postmenopausal women). PMID:21893500
[125th anniversary of the Serbian Medical Society].
Sulović, V; Pavlović, B
2002-01-01
Serbian Medical Society was founded on April 22, 1872. Foundation initiators were physicians of the following nationalities: 5 Serbs, 3 Czechs, 2 Poles, 3 Germans, 1 Slovak and 1 Greek. Josip Pancić was one of its founders as well, and the first president of the Serbian Academy of Sciences and Arts. Dr. Aćim Medović was elected its first President at the Inaugural Assembly, and Dr. Vladan Dordević its Secretary. Later, on October 17, 1874 Constitution of the Serbian Medical Society was passed and its was acknowledged by the Serbian Interior Minister. The first professional meeting was held on August 5, 1872, when they started the first medical journal named "Serbian Archives for All Physicians" ("Srpski arhiv za celokupno lekarstvo") that is being published regularly even today. At the proposal of SLD a Law on Medical Protection was passed (1881). This Law was translated into two European languages, German and French, and sent to be reconsidered by 400 towns throughout Europe. This Law included, beside the other things, the following: "...penny intended for health cannot be spent either by King, or by the Government or by any political party because it is intended for the health, tratement of the sick and doctors' salaries..." The first Congress of the Serbian physicians and scientists devoted to natural sciences was held in Belgrade from 5th to 7th of September, 1904, and it gahtered about 433 participants, among which over hundred were from abroad. In 1907 SLD organized in Belgrade "The First Scientific Conference of Yugoslav Doctors for Operating Surgery". Red Cross in Serbia was founded upon the initiative of SLD. The first initiative to establish the School of Medicine in Belgrade was given by SLD as well. Members of SLD proved their loyalty and devotion to their people, democracy and liberty during liberation wars in XIX and XX century by putting themselves in service of the sich and wrecked. Today, SLD realizes its professional activity through the work
125th Colloquium of the International Astronomical Union
Sorochenko, R
1990-01-01
Text no 1 Radio Recombination Lines (RRLs), discovered in the USSR in 1964, have become a powerful research tool for astronomers. Available throughout the radio spectrum, these lines carry information regarding the density, temperature, turbulence and velocity of thermal plasmas. Their very existance shows the presence of thermal gas. They also can carry information regarding magnetic fields if Zeeman splitting were to be detected. Containing the proceedings of an IAU Colloquium celebrating the 25th anniversary of their detection, this volume tells us what has happened since. It contains the story of the detection of RRLs and reviews of many areas of physics of the interstellargas from which stars form, HII regions excited by newly formed stars, planetary nebulae involving dying stars, and the structure of our Milky Way and other galaxies reflecting the large-scale morphology of the star formation process. In addition there is an article describing modern laboratory studies of Rydberg atoms to probe the basic...
Tumor therapy with 125I-octreotide and 125I-UdR
International Nuclear Information System (INIS)
Fan, W.; Zhu, R.; Yang, C.; Sun, J.J.; Xu, Y.J.; Zhang, Y.J.; Wu, M.J.; Wang, D.J.
2005-01-01
Purpose: To determine the tumor cell damage effect with Auger-electron emitter 125 I in different chemical states. Methods: (1) [Tyr 3 ] octreotide (TOC) and UdR are labeled with 125 I,respectively. (2) Receptor analysis of 125 I-TOC on small cell lung cancer (SCLC) NCI-H446 cell lines is performed comparing with normal lymph cells. NCI-H446 cells added various dose of 125 I-TOC are incubated for different time with 125 I-Nal and non-labeled TOC as control. The capacity of NCI-H446 cell lines bound and internalization of 125 I TOC are determined. The radiation damage of tumor cells is measured by MTF methods. (3) The killing effects of 125 I-UdR in human pancreatic cancer cell line Bax-Pc and Sca-BER bladder carcinoma cells are evaluated with the similar methods. I-UdR penetrating into the Sca-BER cell nucleus is observed with confocal microscope. The grow suppression and clonogenic formation of Sca-BER cells after incubation with 125 I-UdR are analyzed. Proliferation fraction and S phase cell fraction of Sca-BER cell added 125 I-UdR is measured with flow cytometric analysis. Results: (1) Kd=(0.56∼2.0) x 10 -11 mol/L and B max =(1.17∼2.0) x 10 5 cell site are obtained by receptor analysis of 125 I-TOC on NCI-H446 cells. Comparatively, the difference between total binding and non-specific binding is low and there is no saturation of specific binding for normal lymphocyte. About 50% of 125 I-TOC is internalized into the NCI-H446 cell nucleus at 24h after incubation. The damige of NCI-H446 cells by 125 I-TOC is clearly observed. (2) The penetration amount of 125 I-UdR into cell nucleus increases with the incubate time when the concentration of 125 I-UdR is in the range of 10∼500 kBq/mL and reaches the peak fraction of 94% at 36 h after incubation. The radioactivity of 125 I-UdR is then achieved equelibration and no more increased with time. The linear correlation with γ=0.867∼0.978 between the concentration of 125 I-UdR in cell nucleus and the incubation time
Effect of low dose radiation on Th1 and Th2 of thymocytes and splenocytes in mice
International Nuclear Information System (INIS)
Bai Ou; Liu Shuzheng; Mu Ying
1998-01-01
Objective: To elucidate the possible mechanism of activation of helper T cells after low dose radiation (LDR) exposure, the influence of whole-body irradiation (WBI) with 75 mGy X-rays on Th1 and Th2 was studied. Methods: Mice were irradiated at a dose rate of 12.5 mGy/min, and IFN-γ and IL-6 mRNA levels of the myocytes and splenocytes were analyzed by dot blot and Northern blot hybridization. Results: It was found that IFN-γ and IL-6 mRNA significantly increased after WBI with 75 mGy X-rays. Conclusion: The gene induction of cytokine profile after LDR indicates that activation of both Th1 and Th2 subtypes may be involved in the stimulation of immune functions by LDR
Smartphone-based immunosensor for CA125 detection.
Hosu, Oana; Ravalli, Andrea; Lo Piccolo, Giuseppe Mattia; Cristea, Cecilia; Sandulescu, Robert; Marrazza, Giovanna
2017-05-01
In this work, we report the design, the development and the characterization of the analytical performances of a colorimetric smartphone-based immunosensor for the detection of cancer antigen 125 (CA125). The immunosensor was based on a sandwich strategy in which the primary antibody was immobilized by spotting onto the 3D nitrocellulose membrane. The immunospots were subsequently incubated with CA125 solutions, followed by the affinity reaction with a secondary antibody labeled with gold nanoparticles (AuNPs). The antibody-AuNPs captured onto immunospots induced the silver deposition from a silver enhancer solution leading to the formation of gold-silver nanoparticles of different grey color spots depending on CA125 concentration. The 8 megapixels smartphone camera was integrated in a home-made dark box and used as transducer of color image acquisition and data handling. The pixel intensity of the captured images was determined by an image processing algorithm. The experimental parameters involved in each step of the immunosensor design were studied and optimized, obtaining a limit of detection of 30U/mL CA125. The selectivity of the immunoassay was proven against different concentration solutions of Vascular Endothelial Growth Factor (VEGF) antigen as an unspecific protein when a blank signal was obtained for all tested solutions. Finally, preliminary experiments in human serum samples spiked with CA125 protein were also performed. Therefore, the proposed system could represent a powerful point-of-care tool for the next generation technology for detecting and monitoring cancer biomarkers at early stages by taking advantage of nowadays gadgets with enhanced features such as smartphones. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Bian Wenchao; Qi Liangchen
2012-01-01
Objective: To observe the cell count changes of A549 cell line and human embryonic lung diploid cell line 2BS after irradiated by 125 I seeds with different doses, and to study the growth inhibition of 125 I on this two kinds of cell lines, and to determine its clinical safety dose in treatment of non-small cell lung. Methods: 125 I seeds with different doses (low dose: 0.2 mCi, mediate dose: 0.4 mCi, high dose: 0.8 mCi) were chosen and put into A549 cells and human embryonic lung diploid cell line 2BS in vitro, the cells on the 2nd, 4th, 6th and 8th days after irradiation were collected, the alive cells were counted by cells dyeing experiments, then the growth curves were drawn, and the IC 50 of the radioactive 125 I seeds to both two cell lines were calculated. Results: Compared with blank and control groups, the cell proliferation trend of A549 cells in low dose group was not significantly influenced (P>0.05), but the growth of A549 cells in mediate and high dose groups were inhibited in a time-dependent manner, there were significant differences (P<0.05), the most obvious change was on the 6th day. The IC 50 of the radioactive 125 I seeds to A549 cells was about .04 mCi. While the growth inhibition of 125 I 2BS had no statistically significant differences between various dose groups (P>0.05), and the IC 50 of the radioactive 125 I seeds to 2BS cell line was about 1.65 mCi. Conclusion: 0.4 mCi of radioactive 125 I seeds has already had the obvious damage effect on A549 cell, 0.8 mCi of radioactive 125 I seeds has the stronger effect. The IC 50 of the radioactive 125 I seeds to 2BS cells is about 1.65 mCi, so the clinical safety dosage is 0.4-0.8 mCi. (authors)
International Nuclear Information System (INIS)
Pickel, V.M.; Chan, J.; Milner, T.A.
1986-01-01
We examined whether autoradiographic localization of [ 125 I]-antirabbit immunoglobulin (IgG) was suitable for light and electron microscopic detection of a rabbit antiserum to the catecholamine-synthesizing enzyme, tyrosine hydroxylase (TH), and whether autoradiographic and peroxidase labeling could be combined for simultaneous immunocytochemical identification of TH and neuropeptides in brain. Adult rat brains were fixed by aortic arch perfusion with acrolein and paraformaldehyde. Vibratome sections of the fixed tissues were incubated with various dilutions of TH antiserum followed by [ 125 I]-secondary IgG. These sections were then directly processed for autoradiography or were incubated with rabbit antiserum to substance P (SP) or methionine [Met5]-enkephalin (ME). These latter sections were then processed by the peroxidase-antiperoxidase (PAP) or conjugated peroxidase methods followed by autoradiography. Exposure periods of 12-20 days for light microscopy or 90 days for electron microscopy yielded substantial accumulations of silver grains even at the highest (1:30,000) dilution of TH antiserum. At this dilution, immunoreactivity for TH was virtually nondetectable by PAP and conjugated peroxidase methods. The differential sensitivities of the autoradiographic versus peroxidase methods provided a means for separable identification of rabbit antiserum to TH and to SP or ME. Ultrastructural analysis of the catecholaminergic neurons in the medial nuclei of the solitary tract (NTS) showed selective cytoplasmic localization of silver grains for [ 125 I]-labeling of TH in perikarya, dendrites, and terminals. Within single thin sections prepared for dual labeling, the peroxidase marker for SP and for ME was differentially localized with respect to autoradiographic labeling of TH
Tax treatment of cafeteria plans. Internal Revenue Service (IRS), Treasury. Final regulations.
2000-03-23
This document contains final regulations relating to section 125 cafeteria plans. The final regulations clarify the circumstances under which a section 125 cafeteria plan election may be changed. The final regulations permit an employer to allow a section 125 cafeteria plan participant to revoke an existing election and make a new election during a period of coverage for accident or health coverage or group-term life insurance coverage.
International Nuclear Information System (INIS)
Ghosh, P.S.; Arya, A.; Dey, G.K.; Somayajulu, P.S.
2015-01-01
This paper calculates lattice thermal expansion (LTE) and thermal conductivity (TC) of Th 1-x Ce x O 2 (x=0.0, 0.0625 and 0.125) MOX using classical molecular dynamic simulations. The potential parameters of Coulomb-Buckingham function for Th-O, Ce-O and O-O were determined by fitting experimentally available LTE data for pure ThO 2 and CeO 2 . The calculated linear thermal expansion coefficients in the temperature range 300-1500K for ThO 2 , CeO 2 , Th 93.75 Ce 6.25 O 2 and Th 87.5 Ce 12.5 O 2 are 10.61, 13.08, 10.78 and 10.93x10 -6 K -1 , respectively. The MD calculated LTE values of ThO 2 and (Th,Ce)O 2 MOX are slightly higher than the experimentally determined values. The MD calculated TC values of ThO 2 and (Th,Ce)O 2 MOX in the high temperature range (600 to 1200 K) our results accords very well with the experimental measurements and at the low temperature range (300-500 K) our results are slightly different from some experimental results as the difference comes from our presumption that the dominant mechanism for phonon scattering is the Umklapp process. (author)
Detection Limits Of The 125I Air Sampler ''RIS125''
International Nuclear Information System (INIS)
Belaish, I.; Levinson, S.; German, U.; Kravchik, T.
1999-01-01
A system for 125 I monitoring in air (RIS-125) was designed and manufactured at NRCN. The main features of the system are described elsewhere. The system can monitor 125 I air contamination in gaseous and aerosol forms. An air monitoring system should have a fast response and the lowest available Minimum Detectable Activity (MDA). The present work presents the characteristic MDA values of the system
Academic stress-induced changes in Th1- and Th2-cytokine response
Directory of Open Access Journals (Sweden)
Areej M. Assaf
2017-12-01
Full Text Available Psychological stress stimulates physiological responses releasing catecholamines and corticoids, which act via corresponding receptors on immune cells, producing a shift in the cytokine balance. These responses are variable depending on the nature of stressors. The effect of the academic stress on the production of the Th1-cytokines (TNF-α, IFN-γ, IL-1β, IL-2, IL-6 and IL-8 and Th2-cytokines (IL-1ra, IL-4, IL-5 and IL-10 on 35 medical/health sciences students after completing their questionnaires was investigated. Blood samples were taken at three stages; baseline stage at the beginning, midterm and final academic examination stages. Plasma cortisol and cytokines were measured during the three stages. The last two stages were compared with the baseline non-stress period. Results of the stress induced during the final examination stage were the highest with a significant increase in cortisol release, IL-4, IL-5 and IL-1ra release with a shift in Th1:Th2 cytokines balance towards Th2. Whereby, the midterm stage did not show significant reduction in Th1-cytokines except for TNF-α, with an increase in IFN-γ level that was reduced in the third stage. Th2 cytokine, IL-1ra, had positive correlations with Th1 cytokines; IL-2 and IFN-γ in the second stage and IL-6 cytokine in the third stage. Cortisol was positively correlated with IL-8 in the last stage and heart rates had negative correlation with IL-10 in the first and last stages. Findings of this study indicate that exam stress down-regulates Th1 with a selective up-regulation of Th2-cytokines. In conclusion, Cortisol might have a role in suppressing the release of Th1- mediated cellular immune response which could increase the vulnerability among the students to infectious diseases.
Academic stress-induced changes in Th1- and Th2-cytokine response.
Assaf, Areej M; Al-Abbassi, Reem; Al-Binni, Maysaa
2017-12-01
Psychological stress stimulates physiological responses releasing catecholamines and corticoids, which act via corresponding receptors on immune cells, producing a shift in the cytokine balance. These responses are variable depending on the nature of stressors. The effect of the academic stress on the production of the Th1-cytokines (TNF-α, IFN-γ, IL-1β, IL-2, IL-6 and IL-8) and Th2-cytokines (IL-1ra, IL-4, IL-5 and IL-10) on 35 medical/health sciences students after completing their questionnaires was investigated. Blood samples were taken at three stages; baseline stage at the beginning, midterm and final academic examination stages. Plasma cortisol and cytokines were measured during the three stages. The last two stages were compared with the baseline non-stress period. Results of the stress induced during the final examination stage were the highest with a significant increase in cortisol release, IL-4, IL-5 and IL-1ra release with a shift in Th1:Th2 cytokines balance towards Th2. Whereby, the midterm stage did not show significant reduction in Th1-cytokines except for TNF-α, with an increase in IFN-γ level that was reduced in the third stage. Th2 cytokine, IL-1ra, had positive correlations with Th1 cytokines; IL-2 and IFN-γ in the second stage and IL-6 cytokine in the third stage. Cortisol was positively correlated with IL-8 in the last stage and heart rates had negative correlation with IL-10 in the first and last stages. Findings of this study indicate that exam stress down-regulates Th1 with a selective up-regulation of Th2-cytokines. In conclusion, Cortisol might have a role in suppressing the release of Th1- mediated cellular immune response which could increase the vulnerability among the students to infectious diseases.
APS: 125 Years of Progress of Physiology as a Scientific Discipline and a Profession
Carroll, Robert G.; Frank, Martin; Ra'anan, Alice; Matyas, Marsha L.
2013-01-01
The Experimental Biology 2012 meeting in San Diego, CA, included events to celebrate the 125th anniversary of the founding of the American Physiological Society (APS) and reflect on the recent accomplishments of the society. Most of the APS activities in the past quarter century were guided by a series of strategic plans. Membership in the APS…
77 FR 68136 - National Cancer Institute Amended; Notice of Meeting
2012-11-15
... Regency Bethesda Hotel, Old Georgetown Room, One Metro Center, Bethesda, MD 20814. The NCAB ad hoc... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health National Cancer Institute..., Building 31C, Wing C, Conference Room 10, 31 Center Drive, Bethesda, MD 20892 which was published in the...
R.I.S.-125 {sup 125}I air monitor system
Energy Technology Data Exchange (ETDEWEB)
Belaish, I; Levinson, S; German, U; Pelled, O; Laichter, Y; Wangrovitz, U; Tirosh, D; Barak, D [Israel Atomic Energy Commission, Beersheba (Israel). Nuclear Research Center-Negev
1996-12-01
We have developed at NRCN a prototype of a continuous K-Ray air monitoring (CAM) system called `R.1.S.-125` (Radioactive Isotope Sampler for {sup 125}I). The system. was checked according to ANSI N42.17B -1989 (authors).
Directory of Open Access Journals (Sweden)
Ivana Maria de Luna Ramos
2012-02-01
Full Text Available OBJECTIVE: To evaluate serum concentrations of CA-125 and soluble CD-23 and to correlate them with clinical symptoms, localization and stage of pelvic endometriosis and histological classification of the disease. METHODS: Blood samples were collected from 44 women with endometriosis and 58 without endometriosis, during the first three days (1st sample and during the 7th, 8th and 9th day (2nd sample of the menstrual cycle. Measurements of CA-125 and soluble CD-23 were performed by ELISA. Mann-Whitney U test was used for age, pain evaluations (visual analog scale and biomarkers concentrations. RESULTS: Serum levels of CA125 were higher in endometriosis patients when compared to the control group during both periods of the menstrual cycle evaluated in the study. This marker was also elevated in women with chronic pelvic pain, deep dyspareunia (2nd sample, dysmenorrhea (both samples and painful defecation during the menstrual flow (2nd sample. CA-125 concentration was higher in advanced stages of the disease in both samples and also in women with ovarian endometrioma. Concerning CD-23, no statistically significant differences were observed between groups. CONCLUSION: The concentrations of CA-125 were higher in patients with endometriosis than in patients without the disease. No significantly differences were observed for soluble CD-23 levels between groups.OBJETIVO: Avaliar as concentrações séricas de CA-125 e CD-23 solúvel e correlacioná-los com sintomas clínicos, localização e estádio da endometriose pélvica e classificação histológica da doença. MÉTODOS: Amostras de sangue foram coletadas de 44 mulheres com endometriose e 58 sem endometriose durante os primeiros três dias (1ª amostra e durante o sétimo, o oitavo e o nono dia (2ª amostra do ciclo menstrual. As dosagens de CA-125 e CD-23 solúvel foram realizadas por ELISA. O teste U de Mann-Whitney foi usado para idade, avaliação de dor (escala analógica visual e para a
Basdeo, Sharee A; Cluxton, Deborah; Sulaimani, Jamal; Moran, Barry; Canavan, Mary; Orr, Carl; Veale, Douglas J; Fearon, Ursula; Fletcher, Jean M
2017-03-15
Th17 cells are an important therapeutic target in autoimmunity. However, it is known that Th17 cells exhibit considerable plasticity, particularly at sites of autoimmune inflammation. Th17 cells can switch to become ex-Th17 cells that no longer produce IL-17 but produce IFN-γ. These ex-Th17 cells are also called nonclassical Th1 cells because of their ability to produce IFN-γ, similar to Th1 cells; however, it is unclear whether they resemble Th1 or Th17 cells in terms of their function and regulation, and whether they have a pathogenic role in autoimmunity. We compared the phenotypic and functional features of human Th17, Th1, and ex-Th17 cell populations. Our data showed that despite their loss of IL-17 expression, ex-Th17 cells were more polyfunctional in terms of cytokine production than either Th1 or bona fide Th17 cells, and produced increased amounts of proinflammatory cytokines. The proliferative brake on Th17 cells appeared to be lifted because ex-Th17 cells proliferated more than Th17 cells after stimulation. In contrast with Th1 and Th17 cells, ex-Th17 cells were highly resistant to suppression of proliferation and cytokines by regulatory T cells. Finally, we showed that ex-Th17 cells accumulated in the joints of rheumatoid arthritis patients. Taken together, these data indicate that human ex-Th17 cells are functionally distinct from Th1 and Th17 cells, and suggest that they may play a pathogenic role at sites of autoimmunity, such as the rheumatoid arthritis joint where they accumulate. These findings have implications for therapeutic strategies that target IL-17, because these may not inhibit pathogenic ex-Th17 cells. Copyright © 2017 by The American Association of Immunologists, Inc.
NYPA/TH!NK Clean Commute Program Final Report - Inception through December 2004
Energy Technology Data Exchange (ETDEWEB)
James Francfort; Don Karner
2005-11-01
The Clean Commute Program uses TH!NK city electric vehicles from Ford Motor Company’s electric vehicle group, TH!NK Mobility, to demonstrate the feasibility of using electric transportation in urban applications. Suburban New York City railroad commuters use the TH!NK city vehicles to commute from their private residences to railroad stations, where they catch commuter trains into New York City. Electric vehicle charging infrastructure for the TH!NK city vehicles is located at the commuters’ private residences as well as seven train stations. Ford leased at total of 97 TH!NK city electric vehicles to commuters from Westchester, Putnam, Rockland, Queens, Nassau, and Suffolk counties for $199 per month. First Clean Commute Program vehicle deliveries occurred late in 2001, with data collection commencing in February 2002. Through May, 2004, 24 of the lessees have returned their vehicles to Ford and no longer participate in the Clean Commute Program. Reasons given for leaving the Program include relocation out of the Program area, change in employment status, change in commuting status, and, in a few cases, dissatisfaction with the vehicle. Additionally, 13 vehicles were returned to Ford when the lease was completed. In August 2002, Ford announced that it was ceasing production of the TH!NK city and would not extend any TH!NK city leases. Mileage accumulation dropped in the last quarter of the program as vehicle leases were returned to Ford. The impact of the program overall was significant as participants in the Clean Commute Program drove their vehicles over 406,074 miles, avoiding the use of over 18,887 gallons of gasoline. During the active portion of the program, the TH!NK city vehicles were driven an average of between 180 and 230 miles per month. Over 95% of all trips taken with the TH!NK city vehicles replaced trips previously taken in gasoline vehicles. This report covers the period from Program inception through December 2004.
Metabolism in the isolated rat heart: comparison of 125I-BMIPP with 125I-IPPA
International Nuclear Information System (INIS)
Chen Shaoliang; Cheng Aiping; Xu Lanwen; Qiao Weiwei
2008-01-01
Objective: The fatty acid metabolism in myocardium is recently one of the most interesting subjects in nuclear cardiology. The purpose of this study was to clarify the metabolic fate of 125 I-labeled 15-(p-iodophenyl)-3-(R, S)-methyl-pentadecanoic acid ( 125 I-BMIPP) and 15-(p-[ 125 I] iodophenyl) pentadecanoic acid ( 125 I-IPPA) by means of isolated rat hearts. Methods: Ten isolated rat hearts were prepared and perfused with 125 I-BMIPP (5 rats) or 125 I-IPPA (5 rats) for 3 h following a basic perfusion of 30 min. After perfusion, the radioactivity in the recirculated buffer was measured. The metabolites in the buffer were then extracted and analyzed using high performance liquid chromatography (HPLC) and thin-layer chromatography (TLC). Results: At the beginning (5 rain) of 125 I-BMIPP perfusion, the main radioactive peak appeared on HPLC at 37 min, which remained after 3 h perfusion. Several small peaks eluting were found before the parent peak at 30, 26, 21, 16, 12 and 9 min, respectively. At the beginning (5 min) of 125 I-IPPA perfusion, the main peak appeared on HPLC at 33 min, which disappeared after 3 h. Conclusions: 125 I-BMIPP strongly inhibited beta-oxidation, therefore appeared suitable for myocardial metabolic imaging. 125 I-IPPA was metabolized rapidly. (authors)
Th1-Th17 Ratio as a New Insight in Rheumatoid Arthritis Disease.
Bazzazi, Hadi; Aghaei, Mehrdad; Memarian, Ali; Asgarian-Omran, Hossein; Behnampour, Nasser; Yazdani, Yaghoub
2018-02-01
The Th17, Th1 and dual Th17/Th1 cells are important players in rheumatoid arthritis (RA) disease. To assess their roles, the frequency and impact of these cells were investigated in patients with different disease activity. In 14 new cases and 41 established RA patients in comparison with 22 healthy controls, the percentages of Th17, Th1 and dual Th17/Th1 cells were determined by flow-cytometry and their correlations were investigated with disease activity score (DAS28). Moreover, serum levels of IL-6 and IL-17 as inducer and functional cytokines for Th17 were investigated. Finally, serum levels of anti citrullinated protein antibody (ACPA) and rheumatoid factor (RF) were assessed. Percentage of Th17 cells in RA patients were increased in comparison with healthy controls (pTh1 cells in RA patients were less than healthy group (pTh17/Th1 cell only in new cases of RA were more than healthy control groups (pTh1/Th17 ratio in RA patients is statistically different with healthy control group (pTh1/Th17 ratio in RA patient suggested a new paradigm in the field of autoimmune disease and indicated that imbalance or plasticity between these subsets can be important in progress, diagnosis and therapy of RA disease.
2012-09-17
... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines. The existing AD currently... TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but not limited to...
Synthesis and biologic studies of iodinated (125I/127I) ethidium
International Nuclear Information System (INIS)
Ho Nanhui; Tumeh, Paul C.; Kassis, Amin I.
2001-01-01
An iodinated ( 125 I/ 127 I) ethidium derivative (3,8-diamino-5-[6'-(p-iodobenzoylamino)-4'-azahexyl]-6 -phenylphenanthridinium chloride hydrochloride) was synthesized and characterized. The labeling yield of the 125 I-labeled derivative was 75% for carrier-free 125 I, with a radiochemical purity of 95%. The incubation of iodoethidium with calf thymus DNA resulted in a substantial enhancement of fluorescence yield, indicating the intercalation of this compound into DNA. In the presence of iodoethidium, the nuclei of methanol-treated mammalian cells fluoresced, while those of viable cells did not (since the plasma membrane is impermeable to iodoethidium). When viable cells were incubated with the reduced form of the derivative, 125 I/ 127 I-dihydroethidium traversed the plasma membrane, was oxidized in the cytoplasm, and intercalated into nuclear DNA. Finally, we tested the hypothesis that larger malignant solid tumors, containing a relatively greater percentage of degenerating permeable cells, can be targeted with 125 I-ethidium. In-vivo studies demonstrated a small but positive correlation (R = 0.72) between tumor volume and the uptake of the derivative. Because of the ubiquitous presence of abnormal permeable cells and necrosis in tumors, our results support the belief that radiolabeled DNA-intercalating or DNA-binding molecules may be of diagnostic and therapeutic value for a variety of solid tumors in humans
Cadmium-induced bone effect is not mediated via low serum 1,25-dihydroxy vitamin D
International Nuclear Information System (INIS)
Engstroem, Annette; Skerving, Staffan; Lidfeldt, Jonas; Burgaz, Ann; Lundh, Thomas; Samsioe, Goeran; Vahter, Marie; Akesson, Agneta
2009-01-01
Cadmium is a widespread environmental pollutant, which is associated with increased risk of osteoporosis. It has been proposed that cadmium's toxic effect on bone is exerted via impaired activation of vitamin D, secondary to the kidney effects. To test this, we assessed the association of cadmium-induced bone and kidney effects with serum 1,25-dihydroxyvitamin D (1,25(OH) 2 D); measured by enzyme immunoassay. For the assessment, we selected 85 postmenopausal women, based on low (0.14-0.39 μg/L) or high (0.66-2.1 μg/L) urinary cadmium, within a cross-sectional population-based women's health survey in Southern Sweden. We also measured 25-hydroxy vitamin D, cadmium in blood, bone mineral density and several markers of bone remodeling and kidney effects. Although there were clear differences in both kidney and bone effect markers between women with low and high cadmium exposure, the 1,25(OH) 2 D concentrations were not significantly different (median, 111 pmol/L (5-95th percentile, 67-170 pmol/L) in low- and 125 pmol/L (66-200 pmol/L) in high-cadmium groups; p=0.08). Also, there was no association between 1,25(OH) 2 D and markers of bone or kidney effects. It is concluded that the low levels of cadmium exposure present in the studied women, although high enough to be associated with lower bone mineral density and increased bone resorption, were not associated with lower serum concentrations of 1,25(OH) 2 D. Hence, decreased circulating levels of 1,25(OH) 2 D are unlikely to be the proposed link between cadmium-induced effects on kidney and bone
Laboratory of radioisotopes of IOCB ASCR - recent results of labeling by 3H and 125I
Czech Academy of Sciences Publication Activity Database
Elbert, Tomáš; Veselá, Iva
2009-01-01
Roč. 52, 7/8 (2009), s. 253-254 ISSN 0362-4803. [15th Workshop of the International Isotope Society - Central European Division: The synthesis and applications of isotopes and isotopically labelled compounds. 12.06.2009-13.06.2008, Bad Soden] Institutional research plan: CEZ:AV0Z40550506 Keywords : tritium * 125-I labeled peptides Subject RIV: CC - Organic Chemistry
2010-11-23
... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but..., Operation & Maintenance Manual OM- 01-02, Issue 3, Revision 13. (ii) For TAE 125-02-99 and TAE 125-02-114...
The preparation of 125I - gastrin I and 125 - minigastrin for medical diagnostics
International Nuclear Information System (INIS)
Byszewska-Szpocinska, E.; Markiewicz, A.
2002-01-01
Gastrin I G-17 and minigastrin G-13 were iodinated using direct methods with chloramin T and iodogen procedures and by indirect method with Bolton-Hunter reagent. 125 I - gastrin and 1 25 I - minigastrin were isolated from the iodination mixtures by gel filtration on Sephadex G-10 and Sephadex G-25 (PD-10 column) and by HPLC system (Lichrospher WP-300-RP-18 column). Radiochemical purity was shown by HPLC also. It was confirmed that iodogen procedure is the best for iodination of these peptides. 125 I - gastrin I obtained by this method with specific activity 80 μCi/nmol was homogeneous but iodination to higher specific activity (440μCi/nmol) caused appearance of two subfractions. 125 I - minigastrin with high and low specific activity were isolated by HPLC as the two forms (subfractions). It was shown that high performance liquid chromatography (HPLC) was the best method for isolation and purification of 125 I - gastrin I and 125 I - minigastrin. (author)
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.125 Section 284.125 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Transportation by Intrastate Pipelines § 284.125 [Reserved] ...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1220.125 Section 1220.125 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SOYBEAN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.125 Research. The term...
Etravirine: R165335, TMC 125, TMC-125, TMC125.
2006-01-01
Etravirine [TMC 125] is a next-generation non-nucleoside reverse transcriptase inhibitor (NNRTI) that is being developed by Tibotec (Tibotec-Virco Group; now Johnson & Johnson) for the treatment of HIV-1 infections. Etravirine is a highly flexible, di-aryl-pyrimidine (DAPY) compound. The flexibility enables favourable binding interactions with mutant HIV strains as well as wild-type virus. Etravirine has superseded dapivirine as Tibotec's lead NNRTI in clinical development worldwide. Tibotec merged with Virco to form Tibotec-Virco Group in March 2001. Subsequently, Tibotec-Virco Group was acquired by Johnson & Johnson on 18 April 2002. Etravirine was discovered by Tibotec in collaboration with the Janssen Research Foundation. However, the Janssen Research Foundation is no longer involved in the development of etravirine. Etravirine has received fast-track status from the US FDA for the treatment of HIV-1 infections. An expanded access programme for etravirine began in the US in September 2006. The programme made etravirine available to HIV-1 infected adults who have limited treatment options due to virological failure or intolerance to multiple antiretroviral regimens. The progamme will also be introduced in Canada and Europe. In November 2005, Tibotec initiated two randomised, placebo-controlled phase III trials of etravirine in treatment-experienced HIV-1 infected patients with NNRTI resistance and at least three primary protease mutations. The two trials will each enroll 600 patients and will be conducted in 18 countries. Darunavir will be used as the background protease inhibitor in the trials. This is the first time that two investigational antivirals have been evaluated in combination in heavily treatment-experienced patients. The trial design is supported by the FDA, the Committee for Medicinal Products for Human Use (CHMP) of the EMEA and the HIV patient community. Patient enrolment in the two phase III trials was completed in September 2006. A multicentre
2011-03-31
... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114.... Applicability (c) This AD applies to Thielert Aircraft Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE...) For TAE 125-02-99 and TAE 125-02-114 engines, Operation & Maintenance Manual OM-02-02, Version 2...
Switched Current Micropower 4th Order Lowpass / Highpass Filter
DEFF Research Database (Denmark)
Bogason, Gudmundur
1993-01-01
This paper describes a 4th order lowpass / highpass Butterworth filter implemented in switched current technique. The filter has been designed for low power operation. A prototype implementation has been made and it operates with supply voltages down to 2V and with a total supply current of 211Â......¿A at a sampling rate of 50kHz. The chip includes a clock-generator, three current-followers, sample-and-hold and two 4th order filters. The sampling frequency is restricted to approximately 50kHz and the ratio between sampling frequency and cutoff frequency is 12.5. The dynamic-range was found to be 49d...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Relationships. 1.25 Section 1.25 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF POWERS AND DUTIES Office of the Secretary § 1.25 Relationships. (a) Normal staff role. Normally, the functions of the Assistant Secretaries...
Nanometric MIL-125-NH₂ Metal-Organic Framework as a Potential Nerve Agent Antidote Carrier.
Vilela, Sérgio M F; Salcedo-Abraira, Pablo; Colinet, Isabelle; Salles, Fabrice; de Koning, Martijn C; Joosen, Marloes J A; Serre, Christian; Horcajada, Patricia
2017-10-12
The three-dimensional (3D) microporous titanium aminoterephthalate MIL-125-NH₂ (MIL: Material of Institut Lavoisier) was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h under atmospheric pressure) so that for the first time it could be considered for encapsulation and the release of drugs. The nerve agent antidote 2-[(hydroxyimino)methyl]-1-methyl-pyridinium chloride (2-PAM or pralidoxime) was effectively encapsulated into the pores of MIL-125-NH₂ as a result of the interactions between 2-PAM and the pore walls being mediated by π-stacking and hydrogen bonds, as deduced from infrared spectroscopy and Monte Carlo simulation studies. Finally, colloidal solutions of MIL-125-NH₂ nanoparticles exhibited remarkable stability in different organic media, aqueous solutions at different pH and under relevant physiological conditions over time (24 h). 2-PAM was rapidly released from the pores of MIL-125-NH₂ in vitro.
Liang, Taosha; Wang, Lei; Liu, Yang; Song, Xiu
2018-05-01
The microstructure and mechanical properties of the laser welded joint of DZ125L and IN718 nickel base superalloys were investigated. The results show that the fusion zone (FZ) mainly consists of fine dendrite structure with fine γ', Laves phases and MC carbides inhomogeneously distributed. The high welding temperature induces the partial dissolution of γ' in the heat-affected zone (HAZ) of DZ125L and liquation of grain boundaries in both of the HAZs. After post-weld heat treatment (PWHT), fine γ″ and γ' phases precipitate in the FZ, IN718 HAZ and IN718 base metal (BM), and fine γ' precipitate in the γ channel of the HAZ and BM of DZ125L. With tensile testing, the joints after PWHT show higher strengths than that of the weaker DZ125L alloy. Plastic deformation mainly concentrates in the weaker DZ125L and the joint finally fails in the DZ125L BM.
2011-02-23
... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-02-99 and TAE 125-02-114 Reciprocating... TAE 125-02-99 and TAE 125-02-114 reciprocating engines installed in, but not limited to, Cessna 172... occurs later. Repetitive Replacements of Timing Chains for All TAE 125-02-99 and TAE 125-02-114 Engines...
2011-10-18
... Engines GmbH (TAE) Models TAE 125-02-99 and TAE 125-01 Reciprocating Engines AGENCY: Federal Aviation... substance. But we have found it necessary to reduce the initial compliance time for TAE 125-02-99 engines... about 370 TAE 125-01 and TAE 125-02-99 reciprocating engines installed on products of U.S. registry. We...
Synthesis and biologic studies of iodinated ({sup 125}I/{sup 127}I) ethidium
Energy Technology Data Exchange (ETDEWEB)
Ho Nanhui; Tumeh, Paul C.; Kassis, Amin I. E-mail: amin_kassis@hms.harvard.edu
2001-11-01
An iodinated ({sup 125}I/{sup 127}I) ethidium derivative (3,8-diamino-5-[6'-(p-iodobenzoylamino)-4'-azahexyl]-6 -phenylphenanthridinium chloride hydrochloride) was synthesized and characterized. The labeling yield of the {sup 125}I-labeled derivative was 75% for carrier-free {sup 125}I, with a radiochemical purity of 95%. The incubation of iodoethidium with calf thymus DNA resulted in a substantial enhancement of fluorescence yield, indicating the intercalation of this compound into DNA. In the presence of iodoethidium, the nuclei of methanol-treated mammalian cells fluoresced, while those of viable cells did not (since the plasma membrane is impermeable to iodoethidium). When viable cells were incubated with the reduced form of the derivative, {sup 125}I/{sup 127}I-dihydroethidium traversed the plasma membrane, was oxidized in the cytoplasm, and intercalated into nuclear DNA. Finally, we tested the hypothesis that larger malignant solid tumors, containing a relatively greater percentage of degenerating permeable cells, can be targeted with {sup 125}I-ethidium. In-vivo studies demonstrated a small but positive correlation (R = 0.72) between tumor volume and the uptake of the derivative. Because of the ubiquitous presence of abnormal permeable cells and necrosis in tumors, our results support the belief that radiolabeled DNA-intercalating or DNA-binding molecules may be of diagnostic and therapeutic value for a variety of solid tumors in humans.
Grant Application Development, Submission, Review, & Award
This infographic shows the National Cancer Institute general timeline progression through Grant Application Development, Submission, Review, and Award Infographic. In the first month, Applicant prepares and submits Grant Application to Grants.gov in response to FOA. In month two, The Center for Scientific Review (CSR) assigns applications that fall under the category of R01s, etc. to a Scientific Review Group (SRG) or the CSR assigns applications that fall under the category of Program Projects and Center Grants to NCI Division of Extramural Activities (DEA). Months four through five: First-level review by Scientific Review Group (SRG) for Scientific Merit: SRG assigns Impact Scores. Month five Summary Sstatements are prepared and are available to NCI Program staff and applicants. Month six, second-level review by National Cancer Advisory board (NCAB) for NCI Funding determination begins. NCAB makes recommendation to NCI Director, NCI develops funding plan, Applications selected for Funding, “Paylists” forwarded to Office of Grant Administration (OGA). Month ten, Award Negotiations and Issuance: Award issued, Award received by Institution, and Investigator begins work. www.cancer.gov Icons made by Freepik from http://www.flaticon.com is licensed by CC BY3.0
Thyroid measurements of Iodine-125 workers
International Nuclear Information System (INIS)
Burns, P.A.; Peggie, J.R.
1979-02-01
The accumulation of 125 I in the thyroid presents real hazards to workers who use this radionuclide. Recent assessments of the maximum permissible thyroid burden for 125 I have tended to be lower than those previously adopted. Workers using 125 I may receive small doses to a film badge monitor from external radiation while accumulating significant doses to the thyroid from internal contamination. It is therefore necessary to perform some form of thyroid monitoring on such workers. In the past two years the Australian Radiation Laboratory has monitored 125 I workers from six different institutations in the Melbourne area to determine the activity of 125 I in their thyroids. Most of the levels monitored were less than one tenth of the most recently recommended thyroid burden of 400 nanocurie. The highest levels were measured in workers who actually perform iodinations. Workers who handle the iodinate generally had lower levels than those performing the iodinations. Only a very small number of the workers measured were below the detectable limit of the system indicating that even when low activities of 125 I are handled in relatively stable forms it is still possible to accumulate 125 I in the thyroid
14 CFR 125.145 - Firewall construction.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewall construction. 125.145 Section 125.145 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Requirements § 125.145 Firewall construction. Each firewall and shroud must— (a) Be so made that no hazardous...
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT
14 CFR 135.125 - Aircraft security.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft security. 135.125 Section 135.125....125 Aircraft security. Certificate holders conducting operators conducting operations under this part must comply with the applicable security requirements in 49 CFR chapter XII. [67 FR 8350, Feb. 22, 2002] ...
34 CFR 303.125 - Fiscal control.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Fiscal control. 303.125 Section 303.125 Education... DISABILITIES State Application for a Grant Statement of Assurances § 303.125 Fiscal control. The statement must provide assurance satisfactory to the Secretary that such fiscal control and fund accounting procedures...
Recovery of iodine as iodine-125 from biological materials prior to assay
International Nuclear Information System (INIS)
Jones, G.B.; Belling, G.B.; Buckley, R.A.
1979-01-01
In biological tissues iodine is usually present as iodoamino acids or iodoproteins. The organic material must be oxidised and the iodine converted into iodate prior to the final spectrophotometric determination. At parts per billion (10 9 ) levels, recoveries of added iodine are difficult to measure precisely as iodine can easily be lost from the sample and added inorganic iodine may not be recovered in the same proportions as the naturally occurring iodine. Iodine-125 provides a much more sensitive, specific and accurate means of testing the recovery of nanogram amounts of iodine from biological tissues and it can be incorporated into tissues in the naturally occurring compounds. Plants can be grown in a solution culture containing iodine-125 and animals can be injected with iodine-125 to provide tissues where naturally occurring iodine compounds are labelled with radioactive iodine. These tissues can be used to examine the recovery of iodine after oven drying, freeze drying, alkali ashing and acid digestion of the samples. Experimental details are given for spinach, tobacco, oats, cauliflower and thyroid. Results are given and discussed. (author)
2016-01-01
A subject of major importance in fundamental physics is the investigation of the origin of Electroweak Symmetry Breaking. The mechanism of mass generation through the spontaneous breaking of a gauge symmetry is called the Brout-Englert-Higgs mechanism and is associated with the appearance of a physical scalar boson. The discovery announced at CERN on 4th July 2012 by the ATLAS and CMS Collaborations of a boson at a mass close to 125 GeV/c2, compatible with this scalar boson of the Standard Model, the so-called Higgs boson, mainly in γγ, ZZ and WW decay modes, with compatible evidence also found at Fermilab in the bb mode, changed the landscape. This important discovery was acknowledged as decisive for the attribution of the 2013 Nobel Prize in Physics awarded jointly to François Englert and Peter Higgs . This 7th workshop of the "Higgs Hunting" series organized in Paris on August 31 - September 2, 2016 will discuss the developments of LHC run 2 analyses, detailed studies of the new boson and possible de...
Prognostic value of repeated serum CA 125 measurements in first trimester pregnancy.
Schmidt, T; Rein, D T; Foth, D; Eibach, H W; Kurbacher, C M; Mallmann, P; Römer, T
2001-08-01
To assess the diagnostic value of maternal CA 125 in patients with symptomatic first trimester pregnancy and to evaluate the prognostic significance of CA 125 versus beta-hCG in early pregnancies with intact fetal heartbeat, complicated by vaginal bleeding. Two prospective open-label studies with longitudinal follow-up in the second trial. Academic Department of Obstetrics and Gynecology, University of Cologne. Study 1: 168 patients presenting between gestational weeks 6 and 12 with: extrauterine pregnancy, 29; missed abortion, 50; incomplete spontaneous abortion, 38; imminent abortion, 33; and normal pregnancy (no history of endometriosis or ovarian mass), 18. Study 2: Fifty consecutive patients with vaginal bleeding during gestational weeks 6-12 all of whom having demostrable fetal heartbeat. Eighteen patients finally aborted whereas the remainder had normally continuing pregnancy until term. Study 1: Single serum determinations of CA 125 and beta-hCG were correlated with the different disorders observed. Study 2: Two sequential measurements of serum CA 125 and beta-hCG performed within a 5-7 days interval were related to the outcome of pregnancy as indicated by changes of the ultrasound presentation, miscarriage, future hospitalization, or delivery. Study 1: Patients with vaginal bleeding generally had higher median CA 125 values (38 IU/ml; range 1.3-540) compared to non-bleeding patients (17.8 IU/ml; range 1.0-157). No statistically significant differences in regard to median serum CA 125 levels between symptomatic and normal pregnancies occurred: normal pregnancy, 25.5 IU/ml (range 3.2-97); ectopic pregnancy, 26 IU/ml (range 1.3-157); missed abortion, 19.1IU/ml (range 1-242); threatened abortion, 48 IU/ml (range 5.2-540); spontaneous abortion, 40 IU/ml (range 5.4-442). Study 2: Initial CA 125 levels did not differ significantly between both groups of patients with 27/32 non-aborters and 13/18 aborters showing concentrations below 65 IU/ml. After 5-7 days, CA
The 13th Winter Conference on Medicinal and Bioorganic Chemistry.
Williams, Scott D
2017-04-06
The Medicinal and Bioorganic Chemistry Foundation (MBCF) hosted its 13 th biannual Winter Conference on Medicinal and Bioorganic Chemistry (WCMBC) this past January 22 nd -26 th in Steamboat Springs, Colorado (USA). The gathering this year kept true to the tradition of this conference series, with an impressive lineup of presenters from both academia and industry. With about 125 delegates, the conference took all the advantages of a mid-sized gathering: a sufficiently wide spectrum of scientists in attendance, yet an intimate atmosphere conducive to solid networking and frank, open discussions. This conference report summarizes the presentations that were given this year. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Goodnow, R.A. Jr.; Bukownik, R.; Nakanishi, K.; Usherwood, P.N.; Eldefrawi, A.T.; Anis, N.A.; Eldefrawi, M.E.
1991-01-01
125I2-iodinated philanthotoxin-343 (PhTX-343), [125I2]PhTX-343-arginine, and [125I2]PhTX-343-lysine were synthesized and evaluated as probes for glutamate receptors in rat brain synaptic membranes. It was found that these probes were not specific for the glutamate receptors but may be useful for investigating the polyamine binding site. Filtration assays with Whatman GF/B fiber glass filters were unsuitable because the iodinated PhTX-343 analogues exhibited high nonspecific binding to the filters, thus hindering detection of specific binding to membranes. When binding was measured by a centrifugal assay, [125I2]PhTX-343-lysine bound with low affinity (KD = 11.4 ± 2 microM) to a large number of sites (37.2 ± 9.1 nmol/mg of protein). The binding of [125I2]PhTX-343-lysine was sensitive only to the polyamines spermine and spermidine, which displaced [125I2]PhTX-343-lysine with Ki values of (3.77 ± 1.4) x 10(-5) M and (7.51 ± 0.77) x 10(-5) M, respectively. The binding was insensitive to glutamate receptor agonists and antagonists. Binding results with [125I2]PhTX-343-arginine were similar to those of [125I2]-PhTX-343-lysine. Considering the high number of toxin binding sites (10000-fold more than glutamate) in these membranes and the insensitivity of the binding to almost all drugs that bind to glutamate receptors, it is evident that most of the binding observed is not to glutamate receptors. On the other hand, PhTX analogues with photoaffinity labels may be useful in the isolation/purification of various glutamate and nicotinic acetylcholine receptors; they could also be useful in structural studies of receptors and their binding sites
14 CFR 125.355 - Airplane equipment.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane equipment. 125.355 Section 125.355...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Release Rules § 125.355 Airplane...
14 CFR 125.93 - Airplane limitations.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane limitations. 125.93 Section 125.93...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Airplane Requirements § 125.93 Airplane...
Nanometric MIL-125-NH2 Metal–Organic Framework as a Potential Nerve Agent Antidote Carrier
Directory of Open Access Journals (Sweden)
Sérgio M. F. Vilela
2017-10-01
Full Text Available The three-dimensional (3D microporous titanium aminoterephthalate MIL-125-NH2 (MIL: Material of Institut Lavoisier was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h under atmospheric pressure so that for the first time it could be considered for encapsulation and the release of drugs. The nerve agent antidote 2-[(hydroxyiminomethyl]-1-methyl-pyridinium chloride (2-PAM or pralidoxime was effectively encapsulated into the pores of MIL-125-NH2 as a result of the interactions between 2-PAM and the pore walls being mediated by π-stacking and hydrogen bonds, as deduced from infrared spectroscopy and Monte Carlo simulation studies. Finally, colloidal solutions of MIL-125-NH2 nanoparticles exhibited remarkable stability in different organic media, aqueous solutions at different pH and under relevant physiological conditions over time (24 h. 2-PAM was rapidly released from the pores of MIL-125-NH2 in vitro.
2010-02-23
... Engines GmbH (TAE) Models TAE 125-01 and TAE 125-02-99 Reciprocating Engines Installed in, But Not Limited...-99 engines, initial and repetitive replacements of the PPRV, and installation of a vibration isolator..., we estimate that this proposed AD would affect about 300 TAE 125-01 and TAE 125-02-99 reciprocating...
Directory of Open Access Journals (Sweden)
A. A. Kurteva
2016-08-01
Full Text Available Beta-decay of the nucleus 125I and spectroscopic characteristics of the daughter nucleus are described within the framework of the dynamic collective model. Quasiparticle and multiphonon states, as well as vacuum fluctuations of quasiparticles are taken into account. The comparison of the results of calculations with the available experimental data is performed.
Effect of HIP Combined with RHT Process on Creep Damage of DZ125 Superalloy
Directory of Open Access Journals (Sweden)
WANG Tian-you
2017-02-01
Full Text Available Four different processes of hot isostatic pressing (HIP combined with rejuvenation heat treatments (RHT were adopted to reveal the microstructural evolution of creep damaged DZ125 specimens, finally the mechanical properties were evaluated.The results show that both γ' precipitate degeneration and creep cavities for the creep damaged DZ125 superalloy are found after the pre-endurance damage test.However, the carbided compositions from MC type to M23C6 type or M6C type has not been observed for DZ125.In addition, it is found that the HIP temperature play a dominant role in the cavity healing process for the damaged specimens. The concentrically oriented γ' rafting structure and the incipient melting are observed at 1200℃ and 1250℃ respectively.Meanwhile, it is found that the appropriate HIP schedule adopted can effectively avoid the internal recrystallization for the directionally solidified nickel-based superalloy DZ125. The appropriate HIP schedule combined with RHT process can successfully restore the microstructure induced by creep damage and recover the degraded micro-hardness to the original one, in addition improve the creep rupture life.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewalls. 125.143 Section 125.143....143 Firewalls. Each engine, auxiliary power unit, fuel-burning heater, or other item of combusting... of firewalls or shrouds, or by other equivalent means. ...
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Aliens. 125.25 Section 125.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) WATERFRONT....25 Aliens. Alien registration records together with other papers and documents which indicated the...
Preparation of sup 125 I-creatine phosphokinase-MM
Energy Technology Data Exchange (ETDEWEB)
Jingxian, Su; Jingmin, Ma [Academia Sinica, Beijing, BJ (China). Inst. of Atomic Energy
1988-09-01
{sup 125}I-creatine phosphokinase-MM ({sup 125}I-CPK-MM) was prepared by {sup 125}I-labelled Bolton-Hunter reagent (HPNS). Iodinating conditions of HPNS and its conjugation to protein were studied. {sup 125}I-CPK-MM with immune activity was obtained and used to establish the {sup 125}I-CPK-MM radioimmunoassay method by the General Hospital of PLA. {sup 125}I-CPK-MM in PBS-G solution containing 0.015 mol/l ethyl mercaptan at 4-10 deg C can be used for one month.
2010-07-01
... environment means that territorial seas, the contiguous zone and the oceans. (c) Mixing zone means the zone... of the pollutants. (e) Unreasonable degradation of the marine environment means: (1) Significant... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 125.121 Section 125.121...
24 CFR 125.201 - Administrative Enforcement Initiative.
2010-04-01
... Initiative. 125.201 Section 125.201 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.201 Administrative Enforcement Initiative. The Administrative Enforcement Initiative provides funding to State and local fair housing agencies administering...
27 CFR 21.125 - Rubber hydrocarbon solvent.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Rubber hydrocarbon solvent. 21.125 Section 21.125 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU....125 Rubber hydrocarbon solvent. (a) Rubber hydrocarbon solvent is a petroleum derivative. (b...
Fragmentation of chromatin with 125I radioactive disintegrations
International Nuclear Information System (INIS)
Turner, G.N.; Nobis, P.; Dewey, W.C.
1976-01-01
The DNA in Chinese hamster cells was labeled first for 3 h with [ 3 H]TdR and then for 3 h with [ 125 I]UdR. Chromatin was extracted, frozen, and stored at -30 0 C until 1.0 x 10 17 and 1.25 x 10 17 disintegrations/g of labeled DNA occurred for 125 I and 3 H, respectively. Velocity sedimentation of chromatin (DNA with associated chromosomal proteins) in neutral sucrose gradients indicated that the localized energy from the 125 I disintegrations, which gave about 1 double-strand break/disintegration plus an additional 1.3 single strand breaks, selectively fragmented the [ 125 I] chromatin into pieces smaller than the [ 3 H] chromatin. In other words, 125 I disintegrations caused much more localized damage in the chromatin labeled with 125 I than in the chromatin labeled with 3 H, and fragments induced in DNA by 125 I disintegrations were not held together by the associated chromosomal proteins. Use of this 125 I technique for studying chromosomal proteins associated with different regions in the cellular DNA is discussed. For these studies, the number of disintegrations required for fragmenting DNA molecules of different sizes is illustrated
7 CFR 1221.125 - Books and records.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1221.125 Section 1221.125... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Reports, Books, and Records § 1221.125 Books and records. (a) Each first handler, producer, or importer subject to this subpart shall maintain...
23 CFR 635.125 - Termination of contract.
2010-04-01
... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.125 Termination of contract. (a) All contracts exceeding... 23 Highways 1 2010-04-01 2010-04-01 false Termination of contract. 635.125 Section 635.125... the termination will be effected and the basis for settlement. In addition, such contracts shall...
Synkavit and its direct labelling with iodine-125, as a potential anti-cancer drug
International Nuclear Information System (INIS)
Unak, T.; Unak, P.
1993-01-01
The compound known as ''synkavit'' is a diphosphate derivative of vitamin K 3 (menadion), which is capable of being selectively accumulated in certain tumour cells, and covalently bonded to DNA producing considerable DNA damage. On the other hand, iodine-125 nuclide incorporated into the nucleus of living cells causes extreme radiotoxic effects. Consequently, synkavit can be used as a specific carrier of iodine-125 into the nucleus of tumour cells. Thus, its iodo-derivatives have become interesting agents on the potential application of iodine-125 in cancer therapy. 6-Iodo-synkavit is a unique iodo-derivative described in the literature. In addition, its synthesis and radioiodination is still problematic, and consequently the results obtained using 6-iodo-synkavit labelled with iodine-125 remains in question. For this reason, the synthesis of 6-iodo-synkavit was examined in this study. It is finally determined that a mixture of different iodo-isomers of synkavit has been produced rather than its specific 6-iodo-isomer, when the synthetic sequence was begun with the direct sulfonation of 2-methyl-naphthalene. On the other hand, it is also determined that synkavit can directly be radioiodinated using different iodination techniques, and iodogen especially can be successfully used as an oxidative agent. (Author)
Mock iodine-125 radiation source
International Nuclear Information System (INIS)
Coffey, D.L.
1976-01-01
An intimate mixture of americium-241 and iodine-129 provides an energy spectrum that reliably simulates the spectrum of iodine-125 in a well-type detector. As such, it may be used as a long-lived standard to calibrate instruments such as well scintillation spectrometers in which measurements are to be made involving iodine-125
Tang, Dianping; Su, Biling; Tang, Juan; Ren, Jingjing; Chen, Guonan
2010-02-15
A novel nanoparticle-based electrochemical immunoassay of carbohydrate antigen 125 (CA125) as a model was designed to couple with a microfluidic strategy using anti-CA125-functionalized magnetic beads as immunosensing probes. To construct the immunoassay, thionine-horseradish peroxidase conjugation (TH-HRP) was initially doped into nanosilica particles using the reverse micelle method, and then HRP-labeled anti-CA125 antibodies (HRP-anti-CA125) were bound onto the surface of the synthesized nanoparticles, which were used as recognition elements. Different from conventional nanoparticle-based electrochemical immunoassays, the recognition elements of the immunoassay simultaneously contained electron mediator and enzyme labels and simplified the electrochemical measurement process. The sandwich-type immunoassay format was used for the online formation of the immunocomplex in an incubation cell and captured in the detection cell with an external magnet. The electrochemical signals derived from the carried HRP toward the reduction of H(2)O(2) using the doped thionine as electron mediator. Under optimal conditions, the electrochemical immunoassay exhibited a wide working range from 0.1 to 450 U/mL with a detection limit of 0.1 U/mL CA125. The precision, reproducibility, and stability of the immunoassay were acceptable. The assay was evaluated for clinical serum samples, receiving in excellent accordance with results obtained from the standard enzyme-linked immunosorbent assay (ELISA) method. Concluding, the nanoparticle-based assay format provides a promising approach in clinical application and thus represents a versatile detection method.
Negative regulation of NOD1 mediated angiogenesis by PPARγ-regulated miR-125a
International Nuclear Information System (INIS)
Kang, Hyesoo; Park, Youngsook; Lee, Aram; Seo, Hyemin; Kim, Min Jung; Choi, Jihea; Jo, Ha-neul; Jeong, Ha-neul; Cho, Jin Gu; Chang, Woochul; Lee, Myeong-Sok; Jeon, Raok; Kim, Jongmin
2017-01-01
Infection with pathogens activates the endothelial cell and its sustained activation may result in impaired endothelial function. Endothelial dysfunction contributes to the pathologic angiogenesis that is characteristic of infection-induced inflammatory pathway activation. Nucleotide-binding oligomerization domain-containing protein 1 (NOD1) is a protein receptor which recognizes bacterial molecules and stimulates an immune reaction in various cells; however, the underlying molecular mechanisms in the regulation of inflammation-triggered angiogenesis are not fully understood. Here we report that peroxisome proliferator-activated receptor gamma (PPARγ)-mediated miR-125a serves as an important regulator of NOD1 agonist-mediated angiogenesis in endothelial cells by directly targeting NOD1. Treatment of human umbilical vein endothelial cells with natural PPARγ ligand, 15-Deoxy-Delta12,14-prostaglandin J2, led to inhibition of NOD1 expression; contrarily, protein levels of NOD1 were significantly increased by PPARγ knockdown. We report that PPARγ regulation of NOD1 expression is a novel microRNA-mediated regulation in endothelial cells. MiR-125a expression was markedly decreased in human umbilical vein endothelial cells subjected to PPARγ knockdown while 15-Deoxy-Delta12,14-prostaglandin J2 treatment increased the level of miR-125a. In addition, NOD1 is closely regulated by miR-125a, which directly targets the 3′ untranslated region of NOD1. Moreover, both overexpression of miR-125a and PPARγ activation led to inhibition of NOD1 agonist-induced tube formation in endothelial cells. Finally, NOD1 agonist increased the formation of cranial and subintestinal vessel plexus in zebrafish, and this effect was abrogated by concurrent PPARγ activation. Overall, these findings identify a PPARγ-miR-125a-NOD1 signaling axis in endothelial cells that is critical in the regulation of inflammation-mediated angiogenesis. - Highlights: • Expression of NOD1 is regulated by
Energy Technology Data Exchange (ETDEWEB)
Chiang, John C. H. [University of California, Berkeley, CA (United States); Wehner, Michael F. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2012-10-29
This is the final scientific report for grant DOE-FG02-08ER64588, "The Interhemispheric Pattern in 20th Century and Future Abrupt Change in Regional Tropical Rainfall."The project investigates the role of the interhemispheric pattern in surface temperature – i.e. the contrast between the northern and southern temperature changes – in driving rapid changes to tropical rainfall changes over the 20th century and future climates. Previous observational and modeling studies have shown that the tropical rainband – the Intertropical Convergence Zone (ITCZ) over marine regions, and the summer monsoonal rainfall over land – are sensitive to the interhemispheric thermal contrast; but that the link between the two has not been applied to interpreting long-term tropical rainfall changes over the 20th century and future.The specific goals of the project were to i) develop dynamical mechanisms to explain the link between the interhemispheric pattern to abrupt changes of West African and Asian monsoonal rainfall; ii) Undertake a formal detection and attribution study on the interhemispheric pattern in 20th century climate; and iii) assess the likelihood of changes to this pattern in the future. In line with these goals, our project has produced the following significant results: 1.We have developed a case that suggests that the well-known abrupt weakening of the West African monsoon in the late 1960s was part of a wider co-ordinated weakening of the West African and Asian monsoons, and driven from an abrupt cooling in the high latitude North Atlantic sea surface temperature at the same time. Our modeling work suggests that the high-latitude North Atlantic cooling is effective in driving monsoonal weakening, through driving a cooling of the Northern hemisphere that is amplified by positive radiative feedbacks. 2.We have shown that anthropogenic sulfate aerosols may have partially contributed to driving a progressively southward displacement of the Atlantic Intertropical
Fu, Yi; Cao, Fuhua
2015-01-01
We investigated the functional roles of microRNA-125a-5p in regulating human prostate carcinoma. Quantitative reverse transcription-polymerase chain reaction (qRT-PCR) was conducted to evaluate the gene expression levels of miR-125a-5p in eight prostate cancer cell lines and nine biopsy specimens from patients with prostate cancer. miR-125a-5p was genetically knocked down in prostate cancer cell lines, DU145 and VCaP cells by lentiviral transduction. The effects of miR-125a-5p downregulation on prostate cancer cell proliferation and migration were evaluated by MTT assay and transwell assay, respectively. Direct regulation of miR-125a-5p on its downstream targets, NAIF1, and apoptotic gene caspase-3 were evaluated through dual-luciferase reporter assay, qRT-PCR, and Western blot, respectively. NAIF1 was then ectopically overexpressed in DU145 and VCaP cells to modulate prostate cancer cell proliferation and migration. Finally, the effects of miR-125a-5p downregulation or NAIF1 overexpression on the growth of in vivo prostate cancer xenograft were evaluated. miR-125a-5p was upregulated in prostate cancer cell lines and human prostate carcinomas. Lentivirus induced miR-125a-5p downregulation in DU145 and VCaP cells inhibited prostate cancer cell proliferation or migration. NAIF1 was the direct target of miR-125a-5p, as both gene and protein expression levels of NAIF1, as well as caspase-3 were upregulated by miR-125a-5p. Forced overexpression of NAIF1 had similar antitumor effects as miR-125a-5p downregulation on prostate cancer cell proliferation and migration. In vivo prostate xenograft assay confirmed the tumor-suppressive effect of miR-125a-5p downregulation or NAIF1 overexpression. miR-125a-5p regulates prostate cancer cell proliferation and migration through NAIF1.
Energy Technology Data Exchange (ETDEWEB)
Isturiz, J [Centre de Radiotherapie du Parc, Dijon (France)
2001-07-01
It tries on: physical presentation of the sources; radiation protection; mathematical model of I-125 source model 6711; data considered for the calculation program; experimental com probation of the dose distribution; exposure rate and apparent activity; techniques of the use given to the sources I-125; and the calculation planning systems. [Spanish] Trata sobre presentacion fisica de las fuentes, radioproteccion, modelo matematico de las fuentes I-125 modelo 6711, datos considerados en el programa de calculo, comprobacion experimental de la distribucion de dosis, tasa de exposicion y actividad aparente, tecnicas de utilizacion de las fuentes I-125; y los sistemas de planificacion del calculo de las dosis.
21 CFR 131.125 - Nonfat dry milk.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Nonfat dry milk. 131.125 Section 131.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.125 Nonfat dry milk. (a...
29 CFR 102.125 - Action on petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Action on petition. 102.125 Section 102.125 Labor....125 Action on petition. Upon the filing of such petition, the Board shall consider the same and may thereupon either grant or deny the petition in whole or in part, conduct an appropriate hearing thereon, or...
14 CFR 125.7 - Display of certificate.
2010-01-01
... OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT General § 125.7 Display of certificate. (a) The certificate holder must display a true copy of the certificate in each of its aircraft. (b... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Display of certificate. 125.7 Section 125.7...
14 CFR 125.127 - Location of fuel tanks.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Location of fuel tanks. 125.127 Section 125... Requirements § 125.127 Location of fuel tanks. (a) Fuel tanks must be located in accordance with § 125.153. (b... compartment may be used as the wall of an integral tank. (c) Fuel tanks must be isolated from personnel...
International Nuclear Information System (INIS)
Yamato, H.; Matsumoto, T.; Fukumoto, S.; Ikeda, K.; Ishizuka, S.; Ogata, E.
1989-01-01
Previous studies revealed that administration of 24,25-dihydroxyvitamin D3 [24,25-(OH)2D3] to calcium (Ca)-deficient rats causes a dose-dependent reduction in markedly elevated serum 1,25-(OH)2D3 level. Although the results suggested that the metabolism of 1,25-(OH)2D3 was accelerated by 24,25-(OH)2D3, those experiments could not define whether the enhanced metabolism of 1,25-(OH)2D3 played a role in the reduction in the serum 1,25-(OH)2D3 level. In the present study, in order to address this issue more specifically, serum 1,25-(OH)2D3 was maintained solely by exogenous administration through miniosmotic pumps of 1,25-(OH)2D3 into vitamin D-deficient rats. Thus, by measuring the serum 1,25-(OH)2D3 concentration, the effect of 24,25-(OH)2D3 on the MCR of 1,25-(OH)2D3 could be examined. Administration of 24,25-(OH)2D3 caused a dose-dependent enhancement in the MCR of 1,25-(OH)2D3, and 1 microgram/100 g rat.day 24,25-(OH)2D3, which elevated serum 24,25-(OH)2D3 to 8.6 +/- 1.3 ng/ml, significantly increased MCR and suppressed serum levels of 1,25-(OH)2D3. The effect of 24,25-(OH)2D3 on 1,25-(OH)2D3 metabolism developed with a rapid time course, and the recovery of iv injected [1 beta-3H]1,25-(OH)2D3 in blood was significantly reduced within 1 h. In addition, there was an increase in radioactivity in the water-soluble fraction of serum as well as in urine, suggesting that 1,25-(OH)2D3 is rapidly degraded to a water-soluble metabolite(s). Furthermore, the reduction in serum 1,25-(OH)2D3 was associated with a reduction in both serum and urinary Ca levels. Because the conversion of [3H]24,25-(OH)2D3 to [3H]1,24,25-(OH)2D3 or other metabolites was minimal in these rats, 24,25-(OH)2D3 appears to act without being converted into other metabolites. These results demonstrate that 24,25-(OH)2D3 rapidly stimulates the metabolism of 1,25-(OH)2D3 and reduces its serum level
Biglycan, a novel trigger of Th1 and Th17 cell recruitment into the kidney.
Nastase, Madalina-Viviana; Zeng-Brouwers, Jinyang; Beckmann, Janet; Tredup, Claudia; Christen, Urs; Radeke, Heinfried H; Wygrecka, Malgorzata; Schaefer, Liliana
2017-12-15
Th1 and Th17 cells, T helper (Th) subtypes, are key inducers of renal fibrosis. The molecular mechanisms of their recruitment into the kidney, however, are not well understood. Here, we show that biglycan, a proteoglycan of the extracellular matrix, acting in its soluble form as a danger signal, stimulates autonomously the production of Th1 and Th17 chemoattractants CXCL10 and CCL20 in macrophages. In the presence of IFNγ, biglycan synergistically stimulates CXCL9. In macrophages deficient for TLR2, TLR4, and their adaptor molecules MyD88 or TRIF, we identified highly selective mechanisms of biglycan-dependent Th1/17 chemoattraction. Thus, the expression of CXCL9 and CXCL10, common chemoattractants for CXCR3-positive Th1 and Th17 cells, is triggered in a biglycan-TLR4/TRIF-dependent manner. By contrast, biglycan induces CCL20 chemokine production, responsible for CCR6-positive Th17 cell recruitment, in a TLR2/4/MyD88-dependent manner. Importantly, at the onset of diabetes mellitus and lupus nephritis we provide evidence for biglycan-dependent recruitment of Th1 and Th17 cells, IFNγ and IL-17 production, and development of albuminuria in mice lacking or overexpressing soluble biglycan. Furthermore, by genetic ablation of Cxcl10 we showed in vivo involvement of this chemokine in biglycan-dependent recruitment of Th1 and Th17 cells into the kidney. Finally, a positive correlation of biglycan and CXCL10/CXCL9 levels was detected in plasma from patients with diabetic nephropathy and lupus nephritis. Taken together, we identified biglycan as a novel trigger of Th1 and Th17 cell recruitment into the kidney and we postulate that interfering with biglycan/TLR/TRIF/MyD88-signaling might provide novel therapeutic avenues for renal fibrosis. Copyright © 2017 International Society of Matrix Biology. Published by Elsevier B.V. All rights reserved.
Predictors of pretreatment CA125 at ovarian cancer diagnosis
DEFF Research Database (Denmark)
Babic, Ana; Cramer, Daniel W; Kelemen, Linda E
2017-01-01
PURPOSE: Cancer antigen 125 (CA125) is a glycoprotein expressed by epithelial cells of several normal tissue types and overexpressed by several epithelial cancers. Serum CA125 levels are mostly used as an aid in the diagnosis of ovarian cancer patients, to monitor response to treatment and detect...... in CA125 between studies and linear regression to estimate the association between epidemiologic factors and tumor characteristics and pretreatment CA125 levels. RESULTS: In age-adjusted models, older age, history of pregnancy, history of tubal ligation, family history of breast cancer, and family...... cancer recurrence. Besides tumor characteristics, CA125 levels are also influenced by several epidemiologic factors, such as age, parity, and oral contraceptive use. Identifying factors that influence CA125 levels in ovarian cancer patients could aid in the interpretation of CA125 values for individuals...
Dissolution behaviour of 238U, 234U and 230Th deposited on filters from personal dosemeters
International Nuclear Information System (INIS)
Beckova, V.; Malatova, I.
2008-01-01
Kinetics of dissolution of 238 U, 234 U and 230 Th dust deposited on filters from personal alpha dosemeters was studied by means of a 26-d in vitro dissolution test with a serum ultra-filtrate simulant. Dosemeters had been used by miners at the uranium mine 'Dolni Rozinka' at Rozna, Czech Republic. The sampling flow-rate as declared by the producer is 4 l h -1 and the sampling period is typically 1 month. Studied filters contained 125 ± 6 mBq 238 U in equilibrium with 234 U and 230 Th; no 232 Th series nuclides were found. Half-time of rapid dissolution of 1.4 d for 238 U and 234 U and slow dissolution half-times of 173 and 116 d were found for 238 U and 234 U, respectively. No detectable dissolution of 230 Th was found. (authors)
African Journals Online (AJOL)
Boaz
Hospital Management Board. Only individuals who ... version 17 for Windows. Descriptive .... consider when making management decisions .... Pearson K, Peprah EK, Pereira CC, Perico N, .... and Opportunistic Infections; February 16th. -19th ...
9 CFR 3.125 - Facilities, general.
2010-01-01
... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Facilities, general. 3.125 Section 3.125 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...
44 CFR 19.125 - Effect of other requirements.
2010-10-01
... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.125 Effect of other requirements. (a... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Effect of other requirements. 19.125 Section 19.125 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...
Synthesis of I-125 labeled photoaffinity rapamycin analogs
International Nuclear Information System (INIS)
Shu, A.Y.L.; Yamashita, D.S.; Holt, D.A.; Heys, J.R.
1996-01-01
Two no-carrier-added 125 I-labelled photoaffinity rapamycin analogs were prepared: 7-demethoxy-7-(4-azido-3- 125 I-benzyloxy) rapamycin and its C 28 -C 29 seco analog. The key reactions of the synthesis were substitution of the C 7 methoxyl of rapamycin with 4-azido-3-tributylstannylbenzyloxy group, exchange of tributyltin with 125 I using Na 125 I and Chloramine-T, and a ZnCl 2 mediated retro-Aldol cleavage of the C 28 -C 29 bond of rapamycin. (author)
24 CFR 572.125 - Replacement reserves.
2010-04-01
...) Homeownership Program Requirements-Implementation Grants § 572.125 Replacement reserves. (a) Purpose. A single replacement reserve may be established for the homeownership program only if HUD determines it is necessary to... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Replacement reserves. 572.125...
46 CFR 201.125 - Attendance and mileage fees.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Attendance and mileage fees. 201.125 Section 201.125 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Subpoenas (Rule 12) § 201.125 Attendance and mileage fees. Persons attending...
24 CFR 125.501 - Fair Housing Organizations Initiative.
2010-04-01
... Initiative. 125.501 Section 125.501 Housing and Urban Development Regulations Relating to Housing and Urban... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.501 Fair Housing Organizations Initiative. (a) The Fair Housing Organizations Initiative of the FHIP provides funding to develop or expand the ability of...
24 CFR 245.125 - Tenant organizers.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Tenant organizers. 245.125 Section... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.125 Tenant organizers. (a) A tenant organizer is a tenant or non-tenant who assists tenants in establishing and operating a tenant organization...
Cancer antigen-125 and risk of atrial fibrillation
DEFF Research Database (Denmark)
Cheung, Angel; Gong, Mengqi; Bellanti, Roberto
2018-01-01
Background: Cancer antigen-125 (Ca-125) is traditionally recognised as a tumour marker and its role in cardiovascular diseases has been studied only in recent years. Whether Ca-125 is elevated in patients with atrial fibrillation (AF) and its levels predict the risk of AF remains controversial. T...
40 CFR 40.125-1 - Limitations on duration.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Limitations on duration. 40.125-1 Section 40.125-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE RESEARCH AND DEMONSTRATION GRANTS § 40.125-1 Limitations on duration. (a) [Reserved] (b) No...
230Th-238U disequilibrium and the melting processes beneath ridge axes
International Nuclear Information System (INIS)
McKenzie, D.
1985-01-01
The activity ratio ( 230 Th/ 238 U) is calculated for a simple model of melting, for which the melt fraction in chemical and radioactive equilibrium with the solid residium remains constant as melting proceeds. The activity ratio in the melt is only significantly different from unity if the melting is slow compared with the half-life of 230 Th and if the melt fraction present at any time does not exceed a few percent. The observation that ( 230 Th/ 238 U) is about 1.25 for many ocean ridge basalts is therefore most easily explained if the melt fraction in the source region is less than 2% and if the melting occurs in a broad region more than 100 km wide beneath the ridge axis. These results are compatible with other geophysical observations. Measurements of ( 226 Ra/ 238 U) might provide useful constraints on the time required to reach chemical equilibrium between the melt and the matrix. (orig.)
Is tissue CA125 expression in epithelial ovarian adenocarcinoma heterogenic?
DEFF Research Database (Denmark)
Sparholt, Morten H; Høgdall, Claus K; Nedergaard, Lotte
2013-01-01
To evaluate if heterogeneity of tissue cancer antigen 125 (CA125) expression is present in epithelial serous adenocarcinomas. Furthermore, to investigate whether there is a correlation between levels of CA125 tissue expression, serum level of CA125, stage, and grade. A total of 10 patients...... diagnosed with serous ovarian adenocarcinomas were included. Preoperative blood samples were collected to determine serum CA125 levels. Tumor tissue from primary surgery was collected and processed for immunohistochemical analyses. CA125 was expressed in varying degrees in tumor tissues from all patients....... Mean tissue CA125 expression for each patient ranged from 36% to 98%. Intrapatient variations in tissue expression ranged from 10% to 90% point. No significant correlations between levels of CA125 tissue expression, serum level of CA125, stage, and grade were found. We found that the tissue expression...
Directory of Open Access Journals (Sweden)
Saghar Salehpour
2009-01-01
Full Text Available Background: Despite a high prevalence of endometriosis, there still exist many challenges indiagnosing the disease. This study aims to evaluate non-invasive and practical diagnostic methodsby measuring serum and peritoneal fluid CA 125 levels in patients with endometriosis. A secondaryaim is to determine the correlation between these markers with the stage of disease as well as therelationship of the two markers with each other.Materials and Methods: This is a cross-sectional study of 60 women who underwent laparoscopyfor benign conditions. Based on laparoscopic findings and biopsy results, patients were divided to twogroups; one group included patients with pelvic endometriosis (35 patients and the second enrolledpatients free from endometriosis (25 patients. Serum and peritoneal fluid specimens were provided at thetime of laparoscopy and CA125 levels were then assessed by electrochemiluminescence immunoassay.Results: Mean serum and peritoneal fluid CA125 levels were significantly higher in women withendometriosis as compared to the control group (26.42 ± 24.34 IU/ml versus 12.64 ± 6.87 IU/mlin serum and 2203.54 + 993.19 IU/ml versus 1583.42 ± 912.51 IU/ml in peritoneal fluid, p<0.05.CA 125 levels also varied proportionally with the stage of endometriosis; but showed a significantdifference only in higher stages of the disease, both in serum and peritoneal fluid. We calculatedthe cut-off value suggesting a diagnosis of pelvic endometriosis as 14.70 IU/ml for serum and1286.5 IU/ml for peritoneal fluid CA125. A linear correlation between CA 125 levels in serum andperitoneal fluid in patients with pelvic endometriosis has also been observed.Conclusion: Serum and peritoneal fluid CA 125 levels are simple and non-surgical tools fordiagnosing and staging pelvic endometriosis. These markers are of greater diagnostic value inhigher stages of the disease.
International Nuclear Information System (INIS)
Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J.M.; Grau Carles, A.
1994-01-01
A comparative study of performance of 19-iodocholesterol-''125I 3-acetate and sodium iodine samples labelled with ''125 I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I''-concentration of 0-90 ug and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol-''125I 3-acetate samples in Toluene-alcohol and 0.04% for Na''125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs
10 CFR 26.125 - Licensee testing facility personnel.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Licensee testing facility personnel. 26.125 Section 26.125 Energy NUCLEAR REGULATORY COMMISSION FITNESS FOR DUTY PROGRAMS Licensee Testing Facilities § 26.125... reports, if any; results of tests that establish employee competency for the position he or she holds...
46 CFR 28.125 - Stowage of survival craft.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Stowage of survival craft. 28.125 Section 28.125... FISHING INDUSTRY VESSELS Requirements for All Vessels § 28.125 Stowage of survival craft. (a) Each..., inflatable buoyant apparatus, and any auxiliary craft used in their place, must be kept readily accessible...
Isotopic labeling affects 1,25-dihydroxyvitamin D metabolism
International Nuclear Information System (INIS)
Halloran, B.P.; Bikle, D.D.; Castro, M.E.; Gee, E.
1989-01-01
Isotope substitution can change the biochemical properties of vitamin D. To determine the effect of substituting 3H for 1H on the metabolism of 1,25(OH)2D3, we measured the metabolic clearance rate and renal metabolism of unlabeled and 3H-labeled 1,25(OH)2D3. Substitution of 3H for 1H on carbons 26 and 27 [1,25(OH)2[26,27(n)-3H]D3] or on carbons 23 and 24 [1,25(OH)2[23,24(n)-3H]D3] reduced the in vivo metabolic clearance rate of 1,25(OH)2D3 by 36% and 37%, respectively, and reduced the in vitro renal catabolism of 1,25(OH)2D3 by 11% and 54%, respectively. Substitutions of 3H for 1H on carbons 23 and 24 as opposed to carbons 26 and 27 reduced conversion of [3H]1,25(OH)2D3 to [3H]1,24,25(OH)2D3 by 25% and to putative 24-oxo-1,23,25-dihydroxyvitamin D3 by 1600%. These results indicate that substitution of 3H for 1H on carbons 26 and 27 or on carbons 23 and 24 can reduce the metabolic clearance rate and in vitro metabolism of 1,25(OH)2D3 and quantitatively alter the pattern of metabolic products produced
9th International Robotic Sailing Conference
Cruz, Nuno
2017-01-01
This book contains selected papers that address a variety of topics related to the design, development and operation of unmanned and fully autonomous sailing boats. These papers were presented in the 9th International Robotic Sailing Conference, in association with the 9th World Robotic Sailing Championship that took place in Viana do Castelo, Portugal from the 5th to 10th of September 2016. The book is divided in three parts, each focusing on key aspects of robotic sailing. The first part addresses the design, construction and validation of autonomous sailboat platforms, including their rigs, appendages and control mechanisms. The second part is devoted to the development of sensors and algorithms to enhance the performance of robotic sailing boats, in terms of their speed, course control and manoeuvring ability. Finally, the papers in the last part are dedicated to the improvement of behaviours required for the accomplishment of complex autonomous missions. Robotic sailing is a relatively new multidisciplin...
Separation of Ra and Th from rock matrices for alpha-spectrometry
International Nuclear Information System (INIS)
Ditchburn, R.G.; Whitehead, N.E.
1995-01-01
Dating rocks using 226 Ra/ 230 Th isochrons demands radiochemical purification of radium and thorium. This paper presents an improved method. Rocks are solubilised by nitric/hydrofluoric digestion followed by dissolution of insoluble fluorides by boric/nitric acids, and Th is extracted by passing the 8M nitric solution through an anion column in nitrate form. The eluant contains Ra and Ba which are precipitated as sulphate and redissolved in alkaline EDTA. Complete separation of Ba and Ra from sulphate is on an AG 1 x 8 anion column in EDTA form, which was found better than the chloride form. The Ba+Ra is separated on an AG 50W x 8 cation column, and uses CDTA as an eluant for Ba. Careful pH control is essential. Ra elutes later with EDTA or 4M HCl and is precipitated with 125μg barium as sulphate to yield a source suitable for α-spectrometry, or further treated to electroplate the Ra. The yield tracers used are 228 Th and 224 Ra. Because the sample contains natural 224 Ra a correction must be applied, calculated from the amount of natural 232 Th in the Th spectrum. Th may be precipitated with 100 μg of ferric iron and gives a spectrometry-quality source, but further purification and electrodeposition was found to be preferable. Variations on the method for the case of analysis of calcium-rich fish otoliths are described. (author) 37 refs.; 3 figs
Dissolution behaviour of 238U, 234U and 230Th deposited on filters from personal dosemeters.
Becková, Vera; Malátová, Irena
2008-01-01
Kinetics of dissolution of (238)U, (234)U and (230)Th dust deposited on filters from personal alpha dosemeters was studied by means of a 26-d in vitro dissolution test with a serum ultrafiltrate simulant. Dosemeters had been used by miners at the uranium mine 'Dolní Rozínka' at Rozná, Czech Republic. The sampling flow-rate as declared by the producer is 4 l h(-1) and the sampling period is typically 1 month. Studied filters contained 125 +/- 6 mBq (238)U in equilibrium with (234)U and (230)Th; no (232)Th series nuclides were found. Half-time of rapid dissolution of 1.4 d for (238)U and (234)U and slow dissolution half-times of 173 and 116 d were found for (238)U and (234)U, respectively. No detectable dissolution of (230)Th was found.
49 CFR 192.125 - Design of copper pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Design of copper pipe. 192.125 Section 192.125... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.125 Design of copper pipe. (a) Copper... hard drawn. (b) Copper pipe used in service lines must have wall thickness not less than that indicated...
Airborne iodine-125 arising from surface contamination
International Nuclear Information System (INIS)
Kwok, C.S.; Hilditch, T.E.
1982-01-01
Measurements of airborne 125 I were made during the subdivision of 740 MBq stocks of 125 I iodide solution in a hospital dispensary. Within the fume cupboard the mean airborne 125 I concentration was 3.5 +- 2.9 kBqm -3 . No airborne concentration contamination was found outside the fume cupboard during these dispensing sessions. The airborne 125 I concentration arising from deliberate surface contamination (50 μl, 3.7-6.3 MBq) of the top of a lead pot was measured at a height simulating face level at an open work bench. There was a progressive fall in airborne concentration over seven days but even then the level was still significantly above background. Measurements made with the extraction system of the fume cupboard in operation were 2-3 times lower. (U.K.)
7 CFR 4279.125 - Interest rates.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Interest rates. 4279.125 Section 4279.125 Agriculture... Interest rates. The interest rate for the guaranteed loan will be negotiated between the lender and the applicant and may be either fixed or variable as long as it is a legal rate. Interest rates will not be more...
14 CFR 125.211 - Seat and safety belts.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Seat and safety belts. 125.211 Section 125... Requirements § 125.211 Seat and safety belts. (a) No person may operate an airplane unless there are available... the airplane who is at least 2 years old; and (2) An approved safety belt for separate use by each...
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 108, 109 and 167 (under construction)). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INB no. 75). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 158 and 159). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 139, 144 and 163 (under dismantling)). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 103, 104, 114 and 115). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
Directory of Open Access Journals (Sweden)
O. El-Ahmady
1993-01-01
Full Text Available Serum TPA and CA-125 were determined in 86 individuals (66 with breast cancer representing the different stages and grades of the disease and 20 normal healthy controls. TPA and CA-125 were estimated using the L1A reagents supplied by BYK Sangtec. TPA showed sensitivity rates of 31.8%, 42.4% and 51.5% while CA-125 showed sensitivities of 16.3%, 18.6% and 25.6% at specificity levels of 100%, 95% and 90% respectively. Combined determination of the two markers resulted in some improvement in sensitivity. For follow-up of breast cancer patients after surgery both markers were of value and showed near-identical patterns.
International Nuclear Information System (INIS)
Oesterud, B.; Rapaport, S.I.
Activation of Factor IX and Factor X was studied by adding 125 I-Factor IX or 125 I-Factor X to reaction mixtures and quantitating cleavage products by reduced sodium dodecylsulfate gel electrophoresis. Thrombin failed to activate Factors IX or X; Factor Xsub(a) produced insignificant amounts of cleavage products of both factors. In contrast, the reaction product of tissue factor and Factor VII cleaved large amounts of both Factor IX and Factor X in purified systems and in plasma. In incubation mixtures of plasma containing added 125 I-Factor IX or 125 I-Factor X, tissue factor and Ca 2+ ions, the percentage of total radioactivity in the heavy chain peak of 125 I-IXsub(a) and the heavy chain of 125 I-Xsub(a) increased at a similar rate. When the tissue factor was diluted, similar curves were obtained for percent cleavage of 125 I-Factor IX and percent cleavage of 125 I-Factor X plotted against tissue factor concentration. These findings support the hypothesis that activation of Factor IX by the tissue factor-Factor VII reaction product represents a physiologically significant step in normal haemostasis. (author)
deBruijn, HWA; vanderZee, AGJ; Aalders, JG
Although the nature of the cancer antigen 125 leaves many questions unanswered, the use of serum measurements as a means to assess the response to surgery and chemotherapy in ovarian cancer is now well documented. Good prognostic significance is attributed to a rapid decline in cancer antigen 125
1,25 dihydroxyvitamin D3 (1,25) regulation of c-myc mRNA in HL-60 leukemia cells
International Nuclear Information System (INIS)
Simpson, R.U.; Bresnick, E.H.; Begley, D.A.
1986-01-01
Recently, 1,25 was shown to induce differentiation and decrease c-myc levels in HL-60 cells. The authors have confirmed these observations by RNA dot blot analysis. Cells treated with 50 nM 1,25 for 4, 24 and 48 hr showed c-myc mRNA levels of 26, 17 and 15% of control respectively. β-Actin mRNA levels were not altered. To ascertain whether 1, 25 regulated c-myc transcriptionally, an HL-60 nuclear RNA runoff assay was developed. Assay of total nuclei transcriptional activity revealed that 50% of RNA elongation was α-amanitin (0.8 μg/ml) sensitive and was linear with nuclei concentration (0.1-1 x 10 7 nuclei). 1,25 (50 nM) treated (45-96 hr) cells had decreased (approx.40%) total transcription rate relative to control. Decreased total RNA synthesis occurred concomitant with NBT reducing activity. 32 P-RNA runoff transcripts from HL-60 nuclei were hybridized to excess (5 μg DNA was excess) Pst I linearized c-myc and β-actin clones (in pBR322) immobilized on nitrocellulose filter. 32 P-RNA input from 2 x 10 6 to 2 x 10 7 cpm yielded linear hybridization signal. Analysis of blot dot intensity revealed no difference in transcription of c-myc in nuclei from 1,25 dosed or control cells. (myc/actin ratios: 1,25 (50 nM, 72 hr) =1.1 +/- 0.3 and control (72 hr) = 1.0, N=3 or 2 or 3 dots ea). These preliminary data suggest 1,25 does not affect c-myc transcription in HL-60 nuclei and may regulate c-myc mRNA post-transcriptionally
Determination of radiochemical purity of 125I-TOC and 125I-F-PGA
International Nuclear Information System (INIS)
Yang Keya; Fan Wo; Zhang Youjiu; Xu Yujie; Zhu Ran; Hu Mingjiang
2006-01-01
To explore whether there is accordance among three determination methods of the radiochemical purity of [Tyr 3 ] octreotide (TOC) and folate-penicillin G amidase conjugate (F-PGA), which are both labeled with 125 I by Iodogen method, the RCP of the labelings are determined by high performance liquid chromatography (HPLC), paper chromatography and trichloroacetic acid (TCA) precipitation, in which four different concentrations of proteins are used to investigate the effect of them on the determination of RCP. It is shown that both HPLC and paper chromatography can separate the labelings from free iodine efficiently, though HPLC is the most precise and reliable method to determinate RCP of such labelings. In TCA precipitation, the RCP measured with 0.2%BSA is the lowest, but those with three other concentrations of the BSA are similar (P>0.05). When RCP 0.05), whereas higher than that with HPLC (P 10%, the RCP of 125 I-TOC obtained by TCA precipitation is a bit lower than those by two other methods (P 0.05), and there are no significant differences to determinate the RCP of 125 I-F-PGA (P>0.05). The three methods are correlated each other (r=0.0996-0.999, P<0.001). (authors)
16 CFR 1500.125 - Labeling requirements for accompanying literature.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Labeling requirements for accompanying literature. 1500.125 Section 1500.125 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION FEDERAL... REGULATIONS § 1500.125 Labeling requirements for accompanying literature. When any accompanying literature...
Lavocat, Fabien; Maggi, Laura; Annunziato, Francesco; Miossec, Pierre
2016-12-01
To compare the direct effect of cytokines on synoviocytes and endothelial cells to the effects of supernatants from Th1, Th17 and Th1/17 clones and the direct cell-cell interactions with the same clones. Th17 and Th1/17 clones were obtained from the CD161+CCR6+ fraction and Th1 clones from the CD161-CCR6- fraction of human CD4+ T-cells. Endothelial cells or synoviocytes were cultured in the presence of either isolated pro-inflammatory cytokines (IL-17 and/or TNF-α) or supernatants from the T-cell clones or co-cultured with T-cell clones themselves. IL-6 and IL-8 expression and production were analyzed. IL-17 and TNF-α induced IL-6 and IL-8 expression, although IL-17 alone had a limited effect on endothelial cells compared to synoviocytes. Supernatants from activated T-helper clones also induced IL-6 and IL-8 expression but with discrepancies between endothelial cells and synoviocytes. Endothelial cells were mostly activated by Th1 clone supernatants whereas synoviocytes were activated by all T-cell subtypes. Finally, cell-cell contact experiments showed a great heterogeneity among cell clones, even from the same lineage. IL-6 expression was mostly induced by contact with Th1 clones both in endothelial and mesenchymal cells whereas IL-8 expression was induced by all T-cell clones whatever their phenotype. We showed that endothelial cells were much more sensitive to Th1 activation whereas synoviocytes were activated by all T-helper lineages. This work highlights the heterogeneity of interactions between T-cells and stromal cells through soluble factors or direct cell contact. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Ward, W.F.; Moss, A.L.
1985-01-01
To further evaluate the role of the lysosomal system in insulin degradation, the authors have compared the effects of inhibitors of lysosomal function on the degradation of 125 I-insulin with 125 I-asialofetuin, a lysosomally targeted molecule, by the intact, perfused rat liver and the isolated rat hepatocyte. The inhibitors employed were chloroquine ( 125 microM), NH 4 Cl (10 mM), and leupeptin (50 micrograms/ml). In the intact, perfused liver the observed inhibition of 125 I-asialofetuin degradation at 30 min was as follows: chloroquine, 38%; NH 4 Cl, 32%; and leupeptin, 86%. Chloroquine also inhibited 125 I-insulin degradation in the intact, perfused liver (29%), but NH 4 Cl and leupeptin had no effect. Using the isolated hepatocyte, the observed values for inhibition of 125I-asialofetuin at 60 min were: chloroquine, 85%; NH 4 Cl, 76%; and leupeptin, 81%. Chloroquine produced a 28% inhibition of 125I-insulin degradation, while NH 4 Cl and leupeptin had no effect. Chloroquine and NH 4 Cl decreased cell-associated radioactivity when isolated hepatocytes were incubated with 125I-asialofetuin (leupeptin had no effect), whereas chloroquine caused a 107% increase in cell-associated radioactivity when 125I-insulin was added to the incubation media (NH 4 Cl and leupeptin had no effect). These results indicate that the effects of chloroquine on insulin degradation are an extralysosomal action and that lysosomes appear not to be involved in the physiologic degradation of the insulin molecule
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 111 and 112). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
Directory of Open Access Journals (Sweden)
Gjertsen Bjørn
2010-07-01
Full Text Available Abstract Background Several observations suggest that immunological events early after chemotherapy, possibly during the period of severe treatment-induced cytopenia, are important for antileukemic immune reactivity in acute myeloid leukemia (AML. We therefore investigated the frequencies of various T cell subsets (TC1, TH1, TH17 and CD25+ FoxP3+ TREG cells in AML patients with untreated disease and following intensive chemotherapy. Results Relative levels of circulating TC1 and TH1 cells were decreased in patients with severe chemotherapy-induced cytopenia, whereas TH17 levels did not differ from healthy controls. Increased levels of regulatory CD25+ FoxP3+ T cells were detected in AML patients with untreated disease, during chemotherapy-induced cytopenia and during regeneration after treatment. TH17 and TH1 levels were significantly higher in healthy males than females, but this gender difference was not detected during chemotherapy-induced cytopenia. Finally, exogenous IL17-A usually had no or only minor effects on proliferation of primary human AML cells. Conclusions We conclude that the effect of intensive AML chemotherapy differ between circulating T cell subsets, relative frequencies of TH17 cells are not affected by chemotherapy and this subset may affect AML cells indirectly through their immunoregulatory effects but probably not through direct effects of IL17-A.
47 CFR 69.125 - Dedicated signalling transport.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Dedicated signalling transport. 69.125 Section... (CONTINUED) ACCESS CHARGES Computation of Charges § 69.125 Dedicated signalling transport. (a) Dedicated signalling transport shall consist of two elements, a signalling link charge and a signalling transfer point...
Measurement of circulating 1,25-dihydroxyvitamin D employing radioimmunoassay
International Nuclear Information System (INIS)
Yamamoto, Itsuo; Hamazu, Hisatoshi; Kigami, Yuusuke; Morita, Rikushi
1997-01-01
Measurement of serum 1,25-dihydroxyvitamin D levels is important for diagnosis of various calcium metabolism disorders. Conventional assays for 1,25-dihydroxyvitamin D employed specific 1,25-dihydroxyvitamin D receptor as binding site for the ligand and thus, biologically active 1,25-dihydroxyvitamin D ligand, which is labeled with 3 H, was required. Usage of 3 H made assays cumbersome works. A new assay which uses specific antibody as the binding site and the radioligand labeled with 125 I is now available as a commercial kit. Using these kits, we first studied basically the reproducibility, recovery, cross-reactivity and comparison with conventional assays. All of those results were satisfactory. Secondly, we measured clinically in 111 healthy adults and in patients with various disorders such as renal failure, primary hyperparathyroidism, hypoparathyroidism and sarcoidosis. This newly available kit for measurement of circulating 1,25-dihydroxyvitamin D is proved to be useful in clinical evaluation of calcium metabolic disorders. (author)
41 CFR 101-4.125 - Effect of other requirements.
2010-07-01
... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 101-4.125 Effect of... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Effect of other requirements. 101-4.125 Section 101-4.125 Public Contracts and Property Management Federal Property Management...
Characterization of Binding Epitopes of CA125 Monoclonal Antibodies
DEFF Research Database (Denmark)
Marcos-Silva, Lara; Narimatsu, Yoshiki; Halim, Adnan
2014-01-01
The most used cancer serum biomarker is the CA125 immunoassay for ovarian cancer that detects the mucin glycoprotein MUC16. Several monoclonal antibodies (mAbs) including OC125 and M11 are used in CA125 assays. However, despite considerable efforts, our knowledge of the molecular characteristics...
International Nuclear Information System (INIS)
Yang Jingxiu; Shi Shaohong; Wang Yuping
2005-01-01
Objective: To explore the diagnostic values of changes of serum EMAb and CA125 levels in patients with endometriosis. Methods: Serum EMAb levels were measured with ELISA and CA125 levels with RIA in 54 patients with endometriosis and 35 controls. Results: Positive rate of serum EMAb was significantly higher in the patients with endometriosis than those in controls (P≤0.01). Serum CA125 levels were also significantly higher than those in controls (P<0.01). Conclusion: Combined detection of serum EMAb positive rate and CA125 levels was of diagnostic value in patients with endometriosis. (authors)
The effect of size-segregated ambient particulate matter on Th1/Th2-like immune responses in mice.
Directory of Open Access Journals (Sweden)
Kuo-Liang Huang
Full Text Available Particulate matter (PM has been associated with increased pulmonary and cardiovascular mortality and morbidity. Additionally, PM is known to exacerbate asthma. However, whether ambient PM exposure contributes to the onset of asthma, especially in non-atopic children and adults, is less conclusive. The current study aimed to evaluate the effects of size-fractioned PM on lung immune responses in healthy BALB/c mice.We collected PM10, PM2.5, PM1 and PM0.1 samples from October 2012 to August 2013 in the Taipei Basin. These PM samples were representative of urban traffic pollution. The samples were extracted and sonicated in phosphate-buffered saline (PBS. Female BALB/c mice were exposed to the samples via intratracheal instillation at three different doses: 1.75 mg/kg (35 μg/per mouse, 5 mg/kg (100 μg/per mouse, and 12.5 mg/kg (250 μg/per mouse. The mice were exposed on days 0 and 7, and PBS alone was used as a control. Following the exposures, the expression profiles of inflammatory cells and cytokines in bronchoalveolar lavage fluid (BALF were assessed. Exposure to PM10 resulted in inflammatory responses, including the recruitment of neutrophils and the induction of T helper 1 (Th1 cell-related cytokine release, such as TNF-α and IFN-γ. Furthermore, an allergic immune response, including the recruitment of eosinophils and the up-regulation of T helper 2 (Th2 cell-related cytokine release, such as IL-5 and IL-13, was also observed in the BALF of mice exposed to PM10.Our study showed that exposure to PM alone caused mixed Th1/Th2 inflammatory responses in healthy mice. These findings support the hypothesis that PM may contribute to the onset of asthma.
21 CFR 175.125 - Pressure-sensitive adhesives.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Pressure-sensitive adhesives. 175.125 Section 175...) FOOD FOR HUMAN CONSUMPTION (CONTINUED) INDIRECT FOOD ADDITIVES: ADHESIVES AND COMPONENTS OF COATINGS Substances for Use Only as Components of Adhesives § 175.125 Pressure-sensitive adhesives. Pressure-sensitive...
24 CFR 125.401 - Private Enforcement Initiative.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Private Enforcement Initiative. 125... FAIR HOUSING FAIR HOUSING INITIATIVES PROGRAM § 125.401 Private Enforcement Initiative. (a) The Private Enforcement Initiative provides funding on a single-year or multi-year basis, to investigate violations and...
Iodine-125 seeds for cancer treatment
Energy Technology Data Exchange (ETDEWEB)
Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Feher, Anselmo; Moura, Joao A.; Moura, Eduardo S.; Nagatomi, Helio R.; Manzoli, Jose E.; Souza, Carla D., E-mail: elisaros@ipen.b, E-mail: czeituni@pobox.co, E-mail: afeher@ipen.b, E-mail: jmoura31@yahoo.com.b, E-mail: esmoura@ipen.b, E-mail: hrnagato@ipen.b, E-mail: jemanzoli@ipen.b, E-mail: cdsouza@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Karam, Dib, E-mail: dib.karan@usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Escola de Artes, Ciencias e Humanidades
2009-07-01
In Brazil, cancer has become one of the major public health problems. An estimate by the Health Ministry showed that 466,430 people had the disease in the country in 2008. The prostate cancer is the second largest death cause among men. The National Institute of Cancer estimated the occurrence of 50,000 new cases for 2009. Some of these patients are treated with Brachytherapy, using Iodine-125 seeds. By this technique, small seeds with Iodine-125, a radioactive material, are implanted in the prostate. The advantages of radioactive seed implants are the preservation of healthy tissues and organs near the prostate, besides the low rate of impotence and urinary incontinence. The Energy and Nuclear Research Institute - IPEN, which belongs to the Nuclear Energy National Commission - CNEN, established a program for the development of the technique and production of Iodine-125 seeds in Brazil. The estimate for the 125-Iodine seeds demand is of 8,000 seeds/month and the laboratory to be implanted will need this production capacity. The purpose of this paper is to explain the project status and show some data about the seeds used in the country. The project will be divided in two phases: technological development of a prototype and a laboratory implementation for the seeds production. (author)
Les tuberculomes intracraniens: à propos de 125 cas
Moufid, Faycal; Oulali, Noureddine; El Fatemi, Nizare; Gana, Rachid; Maaqili, Rachid; Bellakhdar, Fouad
2012-01-01
Les tuberculomes intracrâniens représentent l'une des localisations les plus graves de la tuberculose, leur incidence varie en fonction du contexte représentant 0,2% des processus intracrâniens dans les pays occidentaux et 5 à 10% des masses intracrâniennes dans les pays en voie de développement. Nous rapportons une étude rétrospective de 125 cas. L'hypertension intracrânienne (45%) et le déficit neurologique (36%) sont les signes cliniques les plus fréquents. La lésion était localisée dans 60% des cas en sus-tentoriel et dans 40% des cas en sous-tentoriel. L'approche thérapeutique a consisté en un abord direct du tuberculome dans 67 cas (53%), une biopsie stéréotaxique dans 32 cas (25%), le traitement médical en première intention sans confirmation histologique dans 26 cas (20%). Avant 1993 notre service ne disposait pas de cadre de stéréotaxie, notre attitude thérapeutique consistait soit en un abord direct de la lésion dans 70% des cas, soit un traitement antituberculeux en première intention sans confirmation histologique (30%). Cette attitude était corrélée à une mortalité et morbidité non négligeables respectivement 3% et 10%. Après 1993; le taux d'abords direct a chuté a 38%, avec 47% de biopsies stéréotaxiques et seulement 13% des patients traités par antibacillaires sans preuve histologique. Ceci s'est accompagné d'une réduction significative de mortalité a 1,4% (p = 0,0003) et de morbidité a 2% (p = 0,0027). PMID:22937196
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 84 and 85). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 127 and 128). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
International Nuclear Information System (INIS)
Beaujouan, J.C.; Torrens, Y.; Herbet, A.; Daguet, M.C.; Glowinski, J.; Prochiantz, A.
1982-01-01
Binding characteristics of 125 I-labeled Bolton-Hunter substance P ([ 125 I]BHSP), a radioactive analogue of substance P, were studied with mesencephalic primary cultures prepared from embryonic mouse brain. Nonspecific binding represented no more than 20% of the total binding observed on the cells. In contrast, significant specific binding--saturable, reversible, and temperature-dependent--was demonstrated. Scatchard analysis of concentration-dependent binding saturation indicates a single population of noninteracting sites with a high affinity (Kd . 169 pM). Substance P and different substance P analogues were tested for their competitive potencies with regard to [ 125 I]BHSP binding. BHSP itself, substance P, (Tyr8)-substance P, and (nor-Leu11)-substance P strongly inhibited the binding. Good inhibition was also obtained with physalaemin and eledoisin, two peptides structurally related to substance P. When substance P C-terminal fragments were tested for their ability to compete with [ 125 I]BHSP binding, a good relationship was found between competitive activity and peptide length. Regional distribution of [ 125 I]BHSP binding sites was found using primary cultures obtained from different regions of embryonic mouse brain. Mesencephalic, hypothalamic, and striatal cultures had the highest [ 125 I]BHSP binding capacities, whereas cortical, hippocampal, and cerebellar cells shared only little binding activity. Finally, when mesencephalic cells were grown under conditions impairing glial development, [ 125 I]BHSP binding was not affected, demonstrating that binding sites are located on neuronal cells
The contamination on farm products from 125I
International Nuclear Information System (INIS)
Zhao Wenhu; Xu Shiming; Hou Lanxin
1990-02-01
The 125 I contamination on 15 farm products have been investigated. The effects of 12 farm crops (wheat, bean, eggplants and other vegetables) contaminated by 125 I during the growing stage on their fruits and seeds have been studied. The results show that the 125 I radioactive substance is mainly concentrated on the fruit surface, and the radioactivity rapidly decreased towards its kernel. The fruits and seeds would not be contaminated when plants were contaminated in the seedling stage
32 CFR 701.125 - Computer matching program.
2010-07-01
... counterintelligence matches done in the course of performing a background check for security clearances of Federal... 32 National Defense 5 2010-07-01 2010-07-01 false Computer matching program. 701.125 Section 701... OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.125 Computer matching program...
14 CFR 125.265 - Flight engineer requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer requirements. 125.265... Requirements § 125.265 Flight engineer requirements. (a) No person may operate an airplane for which a flight engineer is required by the type certification requirements without a flight crewmember holding a current...
31 CFR 1.25 - Accounting of disclosures.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Accounting of disclosures. 1.25... Privacy Act § 1.25 Accounting of disclosures. (a) Accounting of certain disclosures. Each component, with respect to each system of records under its control, shall: (1) Keep an accurate accounting of: (i) The...
14 CFR 125.75 - Airplane flight manual.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 125.75 Section 125... OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6... Airplane flight manual. (a) Each certificate holder shall keep a current approved Airplane Flight Manual or...
21 CFR 14.125 - Procedures of TEPRSSC.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Procedures of TEPRSSC. 14.125 Section 14.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PUBLIC HEARING...) The agenda and other material to be considered at any meeting will be sent to members whenever...
High resolution photofission measurements in 238U and 232Th. Final report
International Nuclear Information System (INIS)
Lancman, H.
1985-12-01
A novel technique for measuring the photofission cross section with very high photon energy resolution has been developed. The photons are obtained from selected resonances in the (p,γ) reaction on various light nuclei. The photon energy resolution approaches 200 eV in favorable cases. The photon energy spread at each (p,γ) resonance is approx.20 keV on the average. Measurements of the photo-fission cross sections of 232 Th and 238 U have been carried out in the energy range from 5.8 to 12 MeV. Intermediate structure has been found in both nuclei at excitation energies around 6 MeV. Various properties of this structure, such as average areas of resonances, their spacing, width, and the underlying bakground, as well as the experimental fission probability averaged over the intermediate structure have been found to agree with theoretical predictions based on a double-humped fission barrier. In the case of 232 Th, the feature of this barrier, a rather high first hump and a deep secondary well, are quite different from those predicted by current theoretial barrier calculations. 13 refs., 4 figs., 3 tabs
Energy Technology Data Exchange (ETDEWEB)
Guenther, Ilonka; Hall, Haakan; Halldin, Christer; Swahn, Carl-Gunnar; Farde, Lars; Sedvall, Goeran
1997-10-01
The binding of the three dopamine transporter radioligands ([{sup 125}I]{beta}-CIT, [{sup 125}I]{beta}-CIT-FE, and [{sup 125}I]{beta}-CIT-FP) was studied using whole-hemisphere autoradiography on postmortem human brains. The autoradiograms revealed an intense and homogeneous labeling of the nucleus caudatus and putamen but also to varying extent to serotonergic and noradrenergic transporters of neocortex and thalamus. The order of specificity estimated (striatum over neocortex ratios) was {beta}-CIT-FP > {beta}-CIT-FE >> {beta}-CIT, suggesting that {beta}-CIT-FE and {beta}-CIT-FP should be preferred for in vivo studies of the dopamine transporter in the human brain.
19 CFR 125.2 - Supervision of cartage and lighterage.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Supervision of cartage and lighterage. 125.2 Section 125.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARTAGE AND LIGHTERAGE OF MERCHANDISE General Provisions § 125.2 Supervision of cartage and lighterage. All licensed vehicles or...
Cell cycle related /sup 125/IUDR-induced-division delay
International Nuclear Information System (INIS)
Scheniderman, M.H.; Hofer, K.G.
1987-01-01
A series of experiments were run to determine if /sup 125/I-decays, in /sup 125/IUdR labeled DNA, specifically accumulated at 1, 3, 5, 7 and 9 hours after plating labeled mitotic cells caused a change in the rate or time of cell entry into mitosis. To accomplish this, a pool of labeled mitotic cells was selected in mitosis and plated in replicate flasks. /sup 125/I decays were accumulated in groups of cells by cooling (4 0 C) for 2 hours starting at the designated times. After rewarding, colcemid was added to arrest cells in mitosis. The rate of cell progression into mitosis for each cell cycle time of accumulation was determined by scoring the mitotic index of cells sampled as a function of time after addition of the colcemid. The results are summarized: (1) Decays from /sup 125/I in /sup 125/I(UdR) labeled DNA reduced the rate of cell progression into mitosis and delayed the time of initiation of mitosis. (2) The reduced rate of progression and the delayed time of initiation of mitosis were independent of the cell cycle time that /sup 125/I-decays were accumulated. (3) The reduced rate of progression after cell cycle accumulation of /sup 125/I decay was statistically indistinguishable from the corresponding controls. (4) The delayed initiation of mitosis after specific cell cycle accumulation of /sup 125/I- decays was greater than the corresponding control. The relationship of these data to DNA and non-DNA division delay target(s) is emphasized
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the facilities (INBs no. 78, 89 (NPPs in operation), 465 (NPP under deconstruction), 102 (fuel storage facility), and 173 (radioactive waste conditioning and storage facility under construction)). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
Podoplanin is a negative regulator of Th17 inflammation.
Nylander, Alyssa N; Ponath, Gerald D; Axisa, Pierre-Paul; Mubarak, Mayyan; Tomayko, Mary; Kuchroo, Vijay K; Pitt, David; Hafler, David A
2017-09-07
Recent data indicate that there are different subpopulations of Th17 cells that can express a regulatory as opposed to an inflammatory gene signature. The transmembrane glycoprotein PDPN is critical in the development of multiple organs including the lymphatic system and has been described on T cells in mouse models of autoimmune Th17 inflammation. Here, we demonstrate that unlike in mice, PDPN+ T cells induced under classic Th17-polarizing conditions express transcription factors associated with Th17 cells but do not produce IL-17. Moreover, these cells express a transcriptional profile enriched for immunosuppressive and regulatory pathways and express a distinct cytokine profile compared with potentially pathogenic PDPN- Th17 cells. Ligation of PDPN by its ligand CLEC-2 ameliorates the Th17 inflammatory response. IL-17 secretion is restored with shRNA gene silencing of PDPN. Furthermore, PDPN expression is reduced via an Sgk1-mediated pathway under proinflammatory, high sodium chloride conditions. Finally, CD3+PDPN+ T cells are devoid of IL-17 in skin biopsies from patients with candidiasis, a prototypical Th17-driven skin disease. Thus, our data support the hypothesis that PDPN may serve as a marker of a nonpathogenic Th17 cell subset and may also functionally regulate pathogenic Th17 inflammation.
Preclinical pharmacological study on 125 I-IPPA
International Nuclear Information System (INIS)
Wu Chunying; Ji Shuren; Fang Ping; Zhou Xiang; He Yongjun; Cao Guoxian
1999-01-01
Myocardial uptake of 125 I-IPPA in rats showed a peak of 4.4% of injected dose per gram. The half elimination time of myocardium was 3.8 min and the maximal uptake of thyroid is only 0.005%ID/organ at 120 min. The initial half time of 2.7 min in rabbits was obtained from the elimination curve of radioactivity in blood. In vitro binding test for 125 I-IPPA to HSA showed rather constant level of activation during tow hours. The second peak of extraction was observed in major organs of rats, in rabbits' elimination of radioactivity and in binding test for 125 I-IPPA to albumin in vivo. Toxicity trial was up to standard. The tolerance of a mouse to IPPA was 560 times as high as that of a person to IPPA. It demonstrated that 125 I-IPPA could be quickly extracted by myocardium, and its catabolite were excreted in the urine with almost no iodine loss. All the results were found to agree with the expectations based on the principal metabolic path of phenyl fatty acid
Synthesis of radioiodinated N-succinimidyl 3-[125I] iodobenzoate
International Nuclear Information System (INIS)
Li Junling; Wang Lihua; Zhang Lan; Tian Haibin; Wang Yongxian
2003-01-01
N-Succinimidyl 3-(tri-n-butylstannyl) benzoate (ATE) was radioiodinated using Iodogen as oxidant and useful conjugate S 125 IB of labeling proteins was obtained. ATE and Iodogen affecting labeling proteins were successfully isolated from S 125 IB by Sep-Pak silica. The labeling efficiency was more than 93%. Several factors affecting labeling such as labeling time, the amount of Iodogen and the mole ratio of ATE to Na 125 I, were studied. The better labeling conditions were obtained as follows: mole ratio of ATE to Na 125 I=6:1, Iodogen=7 μg, labeling time=5 min in room temperature
International Nuclear Information System (INIS)
Zhai Hongyan; Fa Yihua; Su Chenghai; Yang Jicheng; Sheng Weihua; Xie Yufeng
2009-01-01
This work is to investigate the combined tumor-suppression effect of Adenovirus-mediated human ING4 (Ad-hING4) and 125 I seed on human pancreatic cancer xenograft and the possible mechanisms. Ad-hING4 recombinant adenovirus vector was transected into QBI-293A cells and high titre adenovirus was obtained. Subcutaneous tumor models were established with 25 nude mice with human pancreatic cancer cell line PANC-1. They were randomly divided into 5 groups: PBS control group, Ad carrier group, 125 I seed brachytherapy group, Ad-hING4 gene treatment group, combined 125 I seed and Ad-hING4 group. The tumor volumes were measured every 5 days after treatment, and were sacrificed on the 20th day. The tumors were measured and weighed to determine the ratio of tumor-suppression and Jin-Shi q value. Morphological changes of tumor cells,the tissue injury and apoptotic index AI were examined on pathological sections. MVD, Survivin and Caspase3 were tested in immunohistochemistry. The results show that the tumor-suppressive ratio of the 125 I seed group, Ad-hING4 group, combined treatment group were,respectively, 34.19%(P 0.05). It can be concluded that 125 I seed and Ad-hING4 inhibit the growth of PANC-1 pancreatic cancer on nude mice significantly. These indicate a synergy of the combined treatments in tumor-suppression and Ad-hING4 is a promising novel radiosensitizer. The mechanisms of tumor-suppressive may be multi-pathways such as down-regulation the expression of Survivin and up-regulation the expression of Caspase3 to induce apoptosis and inhibit angiogenesis. (authors)
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 119 and 120). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
26 CFR 1.25A-4 - Lifetime Learning Credit.
2010-04-01
... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Lifetime Learning Credit. 1.25A-4 Section 1.25A-4... Rates During A Taxable Year § 1.25A-4 Lifetime Learning Credit. (a) Amount of the credit—(1) Taxable years beginning before January 1, 2003. Subject to the phaseout of the education tax credit described in...
Special Issue the 12th International Conference on Substorms
Shiokawa, Kazuo; Fok, Mei-Ching; Fujimoto, Masaki
2016-01-01
The 12th International Conference on Substorms (ICS-12) was held at the Ise-Shima Royal Hotel in Shima, Japan, on November 10-14, 2014. There were 125 attendees including 68 from foreign countries. The ICS has been held every 2 years since 1992 to discuss substorms, which are fundamental global-scale disturbances in the Earth's magnetosphere. The year 2014 marked the 50th anniversary of the first publication about substorms (Akasofu 1964). The conference included three tutorial lecturers (Profs. S.-I. Akasofu, V. Angelopoulous, and D. Baker), as well as many international scientists, to discuss substorm processes in the tail, their Interactions with the inner magnetosphere and the ionosphere, substorm currents and their dynamics and energetics, the role of MagnetoHydroDynamics (MHD) and kinetic instabilities, storm-substorm relationships, ULFELFVLF waves, and non-Earth substorm-like features. Prof. Akasofu also gave an evening talk about the history of auroral research since the nineteenth century with photographs that inspired and intrigued the young scientists and students in attendance.
MiR-125a TNF receptor-associated factor 6 to inhibit osteoclastogenesis
International Nuclear Information System (INIS)
Guo, Li-Juan; Liao, Lan; Yang, Li; Li, Yu; Jiang, Tie-Jian
2014-01-01
MicroRNAs (miRNAs) play important roles in osteoclastogenesis and bone resorption. In the present study, we found that miR-125a was dramatically down-regulated during macrophage colony stimulating factor (M-CSF) and receptor activator of nuclear factor-κB ligand (RANKL) induced osteoclastogenesis of circulating CD14+ peripheral blood mononuclear cells (PBMCs). Overexpression of miR-125a in CD14+ PBMCs inhibited osteoclastogenesis, while inhibition of miR-125a promoted osteoclastogenesis. TNF receptor-associated factor 6 (TRAF6), a transduction factor for RANKL/RANK/NFATc1 signal, was confirmed to be a target of miR-125a. EMSA and ChIP assays confirmed that NFATc1 bound to the promoter of the miR-125a. Overexpression of NFATc1 inhibited miR-125a transcription, and block of NFATc1 expression attenuated RANKL-regulated miR-125a transcription. Here, we reported that miR-125a played a biological function in osteoclastogenesis through a novel TRAF6/ NFATc1/miR-125a regulatory feedback loop. It suggests that regulation of miR-125a expression may be a potential strategy for ameliorating metabolic disease. - Highlights: • MiR-125a was significantly down-regulated in osteoclastogenesis of CD14+ PBMCs. • MiR-125a inhibited osteoclast differentiation by targeting TRAF6. • NFATc1 inhibited miR-125a transciption by binding to the promoter of miR-125a. • TRAF6/NFATc1 and miR-125a form a regulatory feedback loop in osteoclastogenesis
ENVIRONMENTAL RESEARCH BRIEF: THERMOPHYSICAL PROPERTIES OF HFE-125
Thermophysical properties of HFE-125 (pentafluorodimethylether) suggest that it could serve as an alternative non-ozone depleting refrigerant for certain low temperature applications. This Brief presents the thermophysical properties of HFE-125 (Tables 1-4) which have been obtai...
Energy Technology Data Exchange (ETDEWEB)
Ignjatović, Nenad [Centre for Fine Particles Processing and Nanotechnologies, Institute of Technical Sciences of the Serbian Academy of Science and Arts, Knez Mihailova 35/4, 11000 Belgrade (Serbia); Vranješ Djurić, Sanja [Laboratory for Radioisotopes, Vinča Institute of Nuclear Sciences, University of Belgrade, PO Box 522, 11001 Belgrade (Serbia); Mitić, Žarko [Faculty of Medicine, Department of Pharmacy, University of Niš, Bulevar dr Zorana Đinđića 81, 18000 Niš (Serbia); Janković, Drina [Laboratory for Radioisotopes, Vinča Institute of Nuclear Sciences, University of Belgrade, PO Box 522, 11001 Belgrade (Serbia); Uskoković, Dragan, E-mail: dragan.uskokovic@itn.sanu.ac.rs [Centre for Fine Particles Processing and Nanotechnologies, Institute of Technical Sciences of the Serbian Academy of Science and Arts, Knez Mihailova 35/4, 11000 Belgrade (Serbia)
2014-10-01
In this study, we have investigated the synthesis of nanoparticles of hydroxyapatite (HAp) and hydroxyapatite coated with chitosan (HAp/Ch) and the chitosan-poly-D,L-lactide-co-glycolide polymer blend (HAp/Ch-PLGA) as an organ-targeting system. We have examined and defined the final destination, as well as the dynamics and the pathways of the synthesized particles following intravenous administration in vivo. The XRD, ZP, FT-IR and SEM analyses have confirmed that the hydroxyapatite nanoparticles with d{sub 50} = 72 nm are coated with polymers. Radioactive 125-Iodine ({sup 125}I), a low energy gamma emitter, was used to develop a novel in situ method for the radiolabeling of particles and investigation of their biodistribution. {sup 125}I-labeled particles exhibited high stability in saline and serum over the second day, which justified their use in the following in vivo studies. The biodistribution of {sup 125}I-labeled particles after intravenous injection in rats differed significantly: HAp particles mostly targeted the liver, HAp/Ch the spleen and the liver, while HAp/Ch-PLGA targeted the lungs. Twenty-four hours post injection, HAp particles were excreted completely, while both {sup 125}I-HAp/Ch and {sup 125}I-HAp/Ch-PLGA were retained in the body for a prolonged period of time with more than 20% of radioactivity still found in different organs. - Highlights: • An organ-targeting carrier based on nano-hydroxyapatite • In situ labeling • Biodistribution of {sup 125}I-labeled HAp particles.
Criteria for safe working with iodine-125
International Nuclear Information System (INIS)
Linsley, G.S.
1977-01-01
Radio-immunoassay and other saturation assay tests involving the use of iodine-125 are finding wide application for the determination of hormone concentrations in biological fluids. In such tests, iodinations involving concentrations of a milli-curie per micro-litre are common. Iodine-125 presents a problem from the monitoring standpoint because of its low energy photon emission (27 and 35 keV). Iodine is preferentially taken up by the thyroid gland and work involving moderate amounts of radio-iodine may give rise to a significant hazard in an accident situation. The general precautions which should be taken in work with unsealed radioactive substances are briefly summarized, working limits for iodine-125 are identified, and methods of personal protection and monitoring in an emergency situation described. (author)
The 11th quality control survey for radioisotopes in vitro tests in Japan, 1989
Energy Technology Data Exchange (ETDEWEB)
1990-10-01
This report presents the results of the 11th quality control nationwide survey. Of 730 facilities performing radioisotopes in vitro tests in November 1989, 422 facilities (60.5%) participated in the present survey. The following 23 items were examined: adrenocorticotropic hormone (ACTH), albumin, carbohydrate antigen 125 (CA 125), carbohydrate antigen 19-9 (CA 19-9), carcinoembryonic antigen (CEA), calcitonin, cortisol, estradiol, ferritin, free thyroxine (FT{sub 4}), follicle stimulating hormone (FSH), gastrine, cholylglycine, glucagon, insulin, anti-DNA antibody, luteinizing hormone (LH), neuron specific enolase (NSE), parathyroid hormone (PTH), squamous cell carcinoma associated antigen (SCC), thyroxine (T{sub 4}), thyroxine binding globulin (TBG), and antithyroid stimulating hormone (TSH) receptor antibody. 'Within kit variation' between facilities showed large coefficient of variation for ACTH, CA125, CEA, estradiol, ferritin, FSH, glucagon, anti-DNA antibody, LH, PTH, and TSH receptor antibody. Both 'within kit variation' and 'between kit variation' showed small coefficient of variation for cortisol, free T{sub 4}, NSE, SCC, T{sub 4}, and TBG. The present survey was characterized by using immunoradiometric assay (IRMA) and non-isotope techniques, as well as radioimmunoassay. Kits for IRMA greatly varied from facility to facility. (N.K.).
Francesco Sansovino’s anthology of novella and its reception in 16th- and 17th- century Spain
Directory of Open Access Journals (Sweden)
Diana Berruezo Sánchez
2017-12-01
Full Text Available This article delves into Francesco Sansovino’s successful anthology of novelle and its complex circulation and reception in Spain. Firstly, it outlines the anthology’s corrections, insertions, and deletions from its publication in 1561 to its latest edition in 1610. Secondly, it explains the misinterpretation from which the anthologist is deemed as the author of the short stories. As argued here, the fact that the letter addressed to the readers was not included in the latest editions triggered the misunderstanding about the authorship of the short stories. Finally, it offers significant data that proves the circulation of the anthology in Spain in the 16th and 17th Centuries.
40 CFR 7.125 - Coordination with other agencies.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Coordination with other agencies. 7.125 Section 7.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL NONDISCRIMINATION IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL ASSISTANCE FROM THE ENVIRONMENTAL PROTECTION AGENCY Agency...
International Nuclear Information System (INIS)
Janowsky, A.; Ebert, M.H.; De Paulis, T.; Vanderbilt Univ., Nashville, TN; Kessler, R.M.; Vanderbilt Univ., Nashville, TN; Clanton, J.A.; Smith, H.E.
1988-01-01
Substituted benzamides are currently among the most selective antagonists at dopamine D-2 receptors, and high affinity ligands have been developed by substituting halogens into the aromatic ring of the benzamides. The authors report the high affinity, stereoselective, reversible, and sodium dependent binding of a new iodine-substituted benzamide, called [ 125 I]iodopride, to a membrane preparation from rat corpus striatum. 5 refs.; 1 figure
International Nuclear Information System (INIS)
Quirion, R.; Rowe, W.; Kar, S.; Dore, S.
1997-01-01
The insulin-like growth factors (IGF-I and IGF-II) and insulin are localized within distinct brain regions and their respective functions are mediated by specific membrane receptors. High densities of binding sites for these growth factors are discretely and differentially distributed throughout the brain, with prominent levels localized to the hippocampal formation. IGFs and insulin, in addition to their growth promoting actions, are considered to play important roles in the development and maintenance of normal cell functions throughout life. We compared the anatomical distribution and levels of IGF and insulin receptors in young (five month) and aged (25 month) memory-impaired and memory-unimpaired male Long-Evans rats as determined in the Morris water maze task in order to determine if alterations in IGF and insulin activity may be related to the emergence of cognitive deficits in the aged memory-impaired rat. In the hippocampus, [ 125 I]IGF-I receptors are concentrated primarily in the dentate gyrus (DG) and the CA3 sub-field while high amounts of [ 125 I]IGF-II binding sites are localized to the pyramidal cell layer, and the granular cell layer of the DG. [ 125 I]insulin binding sites are mostly found in the molecular layer of the DG and the CA1 sub-field. No significant differences were found in [ 125 I]IGF-I, [ 125 I]IGF-II or [ 125 I]insulin binding levels in any regions or laminae of the hippocampus of young vs aged rats, and deficits in cognitive performance did not relate to altered levels of these receptors in aged memory-impaired vs aged memory-unimpaired rats. Other regions, including various cortical areas, were also examined and failed to reveal any significant differences between the three groups studied.It thus appears that IGF-I, IGF-II and insulin receptor sites are not markedly altered during the normal ageing process in the Long-Evans rat, in spite of significant learning deficits in a sub-group (memory-impaired) of aged animals. Hence
α -decay chains of superheavy nuclei with Z =125
Santhosh, K. P.; Nithya, C.
2018-04-01
The decay properties of the isotopes of Z =125 within the range 303 ≤ A ≤ 339 are investigated. The calculation of proton separation energies reveals that isotopes 125-309303 may decay through proton emission. Four different mass tables are used to show the sensitivity of the mass models used to calculate the Q values as well as the α-decay half-lives. α -decay chains are predicted by comparing the α half-lives calculated within the Coulomb and proximity potential model for deformed nuclei (CPPMDN) [Nucl. Phys. A 850, 34 (2011), 10.1016/j.nuclphysa.2010.12.002] with the spontaneous fission half-lives using the shell-effect-dependent formula [Phys. Rev. C 94, 054621 (2016), 10.1103/PhysRevC.94.054621]. It is seen that isotopes 125,311310 show 6α chains. 5α chains can be seen from isotopes 125-318312. Isotopes 125,320319 exhibit 2α chains and 323125 exhibits 1α chain. All the other isotopes, that is, 125 321 ,322 ,324 -339 may decay through spontaneous fission. The α half-lives using CPPMDN are compared with five other theoretical formalisms and are seen to be matching with each other. We hope that our studies will be helpful in designing future experiments to explore the island of stability.
14 CFR 125.203 - Communication and navigation equipment.
2010-01-01
... within the degree of accuracy required for ATC; (ii) One marker beacon receiver providing visual and... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Communication and navigation equipment. 125... Equipment Requirements § 125.203 Communication and navigation equipment. (a) Communication equipment—general...
Cheng, Jie; Li, Fengsheng; Cui, Jiuwei; Guo, Weiying; Li, Cai; Li, Wei; Wang, Guixia; Xing, Xiao; Gao, Ying; Ge, Yuanyuan; Wang, Guanjun; Cai, Lu
2014-05-08
We reported the attenuation of diabetes-induced renal dysfunction by exposure to multiple low-dose radiation (LDR) at 25 mGy every other day by suppressing renal oxidative damage. We here explored the optimal conditions of LDR to protect the kidney from diabetes. Male C57BL/6J mice with type 1 diabetes were induced with multiple injections of low-dose streptozotocin. Diabetic mice received whole body X-irradiation at a dose of 12.5, 25 or 50 mGy every other day for either 4 or 8 weeks. Age-matched normal mice were similarly irradiated at the dose of 25 mGy for 4 or 8 weeks. The renal function and histopathological changes were examined at the 4th and 8th weeks of the study. Diabetes induced renal dysfunction is shown by the decreased creatinine and increased microalbumin in the urine. Renal oxidative damage, detected by protein nitration and lipid oxidation, and remodeling, reflected by increased expression of connective tissue growth factor, collagen IV and fibronectin, were significantly increased in diabetic mice. All these renal pathological and function changes in diabetic mice were significantly attenuated by exposure to LDR at all regimens, among which, however, exposure to LDR at 12.5 mGy for 8 weeks provided the best protective effect on the kidney of diabetic mice. Our results suggest that whole-body LDR at 12.5 mGy every other day for 8 weeks is the optimal condition of LDR to protect the kidney from diabetes. Copyright © 2014 Elsevier Inc. All rights reserved.
Delayed Activation Kinetics of Th2- and Th17 Cells Compared to Th1 Cells.
Duechting, Andrea; Przybyla, Anna; Kuerten, Stefanie; Lehmann, Paul V
2017-09-12
During immune responses, different classes of T cells arise: Th1, Th2, and Th17. Mobilizing the right class plays a critical role in successful host defense and therefore defining the ratios of Th1/Th2/Th17 cells within the antigen-specific T cell repertoire is critical for immune monitoring purposes. Antigen-specific Th1, Th2, and Th17 cells can be detected by challenging peripheral blood mononuclear cells (PBMC) with antigen, and establishing the numbers of T cells producing the respective lead cytokine, IFN-γ and IL-2 for Th1 cells, IL-4 and IL-5 for Th2, and IL-17 for Th-17 cells, respectively. Traditionally, these cytokines are measured within 6 h in flow cytometry. We show here that 6 h of stimulation is sufficient to detect peptide-induced production of IFN-γ, but 24 h are required to reveal the full frequency of protein antigen-specific Th1 cells. Also the detection of IL-2 producing Th1 cells requires 24 h stimulation cultures. Measurements of IL-4 producing Th2 cells requires 48-h cultures and 96 h are required for frequency measurements of IL-5 and IL-17 secreting T cells. Therefore, accounting for the differential secretion kinetics of these cytokines is critical for the accurate determination of the frequencies and ratios of antigen-specific Th1, Th2, and Th17 cells.
In Vivo Thyroid 125I Monitoring with Radioluminography
International Nuclear Information System (INIS)
Nishizawa, K.; Saze, T.; Yamashita, H.; Etoh, M.
1999-01-01
The counting features of an in vivo thyroid monitoring system with an imaging plate (IP) were investigated by using an anthropomorphic thyroid-neck phantom. The realistic thyroid phantoms loaded with 125 I solution were embedded in a neck phantom. The IP was fixed on the neck phantom and exposed to 125 I photons emitted from the thyroid phantom by changing the pre-thyroid tissue thickness at the front of the thyroid. A clear thyroid image was obtained at short tissue thicknesses. A region of interest (ROI) was set so that the ROI contained the thyroid image. The count within the ROI was regarded as the number of 125 I photons detected by the IP. The IP counting efficiency was about 0.6% at maximum. Monitoring with IP has the advantage of allowing the worker to move freely during the monitoring period by wearing the IP on his neck. Radioluminography with IP has shown itself to be useful when monitoring thyroid 125 I. (author)
Chen, Xuemei; Wang, Junfu; Wang, Rui; Su, Qinghong; Luan, Junwen; Huang, Haiyan; Zhou, Peng; Liu, Jinsheng; Xu, Xiaoqun
2016-02-01
Th0 cells differentiate into Th1 or Th2 depending on multiple transcription factors acting on specific time points to regulate gene expression. Th17 cells, a subset of IL-17-producing T cells distinct from Th1 or Th2 cells, have been described as key players in inflammation and autoimmune diseases as well as cancer development. In the present study, 53 patients with hypopharyngeal cancer were included. The expression levels of Th1-, Th2- and Th17-associated cytokines in hypopharyngeal cancer tissues and pericarcinoma tissues were detected. The relationship between Th1, Th2, or Th17 infiltration and metastasis was studied. Our results showed that the mRNA and protein expressions of Th1 cytokines were lower, while the expressions of Th2 and Th17 cytokines were higher in tumor tissues, and the intensity of expression was strengthened with clinical stage increasing. Cancer tissues had higher level expressions of Th2 and Th17 cytokines than that of pericarcinoma tissues. From the above data, we speculated that high expressions of Th2- and Th17-associated cytokines in hypopharyngeal carcinoma may contribute to cancer development and metastasis.
International Nuclear Information System (INIS)
Lin Zhengyu; Lin Jun; Lin Cong; Li Yinguan; Chen Shaoming; Hu Jianping; Hu Rui; Chen Jin
2012-01-01
Purpose: To evaluate the feasibility and therapeutic efficacy of 1.5 T conventional MR-guided percutaneous interstitial implantation of I-125 radioactive seeds in patients with hepatocellular carcinoma (HCC). Materials and methods: The institutional ethics committee approved this study. After imformed consent was obtained, twenty-three patients suffering from a total of 65 HCC lesions were treated with I-125 seed permanent interstitial implantation under the guidance of a 1.5 T conventional magnetic resonance imaging (MRI) system. The FSE T2WI, T1 FSPGR, FIESTA 2D, 3D Dyn T1WI sequences were used to guide an 18G MR-compatible needle inserted into the lesions to introduce the I-125 seeds. The response evaluation criteria in solid tumors (RECIST) were used to evaluate the curative effect. Results: The needle and I-125 seed were seen clearly on MRI images. The final dose delivered to total decay was 173.46 ± 32.44 Gy (range, 110–270 Gy) as calculated by postoperative TPS. The complete response (CR) was seen in 22 lesions (33.8%), partial response (PR) in 24 lesions (36.9%), stable disease (SD) in 9 lesions (13.8%), and progressive disease (PD) in 10 lesions (15.4%). The post-operative alpha-fetoprotein (AFP) was decreased (t = 3.117, P = 0.005 < 0.05). Two patients were observed a small area of subcapsular bleeding that did not lead to any symptoms or clinical sequelae. Conclusion: MR-guided I-125 implantation for HCC is technically feasible and effective.
International Nuclear Information System (INIS)
Haryuni, R.D.; Bahtiar, A.; Soenarjo, S.; Harahap, Y.; Mutalib, A.; Ramli, M.; Hermanto, S.; Ardiyatno, C.N.; Susilo, V.Y.; Haffid, D.
2014-01-01
Nimotuzumab is an anticancer agent which belongs to the inhibitor group of Epidermal Growth Factor Receptor (EGFR). This monoclonal antibody has a relatively high molecular weight which slows penetration on tumor cells, making it less attractive in imaging kinetics and potentially elicits antibodies responses. Therefore, in this study nimotuzumab was fragmented to form a bivalent antibody [F(ab’) 2 ] and then labeled with 125 I to form 125 I-F(ab’) 2 -nimotuzumab which can be used further as a precursor for preparing 125 I-F(ab’) 2 -nimotuzumab-NLS (NLS = nuclear localization sequence) radiopharmaceutical for radioimmunotherapy. The aims of this study was to obtain characteristics of 125 I-F(ab’) 2 -nimotuzumab by comparing with the 125 I labeled-intact nimotuzumab ( 125 I-nimotuzumab). This study was initiated by purifying nimotuzumab by mean of dialysis. The purified nimotuzumab was then fragmented by using pepsin. The F(ab') 2 -nimotuzumab formed was then purified from its by-products which formed in fragmentation process by using a PD-10 column (consisted Sephadex G25). The intact nimotuzumab and its F(ab’)2 fragment were then labeled with the 125 I to form 125 I-nimotuzumab and 125 I-F(ab’) 2 -nimotuzumab. The radiochemical purity are 98.27 % and 93.24 %, respectively. Stability test results show that, both 125 I-nimotuzumab and 125 I-F(ab’) 2 -nimotuzumab are more stable at 4 °C than at room temperature storage and 37 °C. (author)
Study on labelling conditions of 125I-synkavit by the iodogen method
International Nuclear Information System (INIS)
Oezdemir, D.; Uenak, P.
1994-01-01
Labeling conditions of synkavit (2-methyl-1,4-naphtoquinol disodium phosphate) with iodine-125 have been studied. Labeling temperature, reaction time, successive using of iodogen coated tubes, iodogen amount and synkavit concentrations have been determined to get optimum conditions for maximum labeling. Final results showed that when the labeling temperature, reaction time, synkavit concentration and iodogen amount were, at room temperature, 15 min (in the case of successive using of three iodogen coated tubes), 2 mg ml -1 and 5 mg, respectively; labeling yield was 90% and specific activities of the order of 555 GBq mmol -1 (15 Ci mmol -1 have been obtained. (author) 14 refs.; 4 figs
49 CFR 37.125 - ADA paratransit eligibility: Process.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Process. 37.125... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.125 ADA... § 37.121 of this part shall establish a process for determining ADA paratransit eligibility. (a) The...
14 CFR 125.363 - Flight release over water.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight release over water. 125.363 Section 125.363 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Flight release over water. (a) No person may release an airplane for a flight that involves extended...
DNA strand breakage by 125I-decay in oligoDNA
International Nuclear Information System (INIS)
Lobachevsky, P.; Martin, R.F.
1996-01-01
Full text: A double-stranded oligodeoxynucleotide containing 125 I-dC in a defined location, with 5'- or 3'- 32 P-end-labelling of either strand, was used to investigate DNA strand breakage resulting from 125 I decay. Samples of the 32 P-end-labelled and 125 I-dC containing oligoDNA were incubated in 20 mM phosphate buffer (PB), or PB + 2 M dimethylsulphoxide (DMSO) at 4 deg during 18-20 days. The 32 P-end-labelled DNA fragments produced by 125 I decays were separated on denaturing polyacrylamide gels, and the 3P activity in each fragment was determined by scintillation counting after elution from the gel. The fragment size distribution was then converted to a distribution of single stranded break probabilities at each nucleotide position. The results indicate that each 125 I decay event produces at least one break in the 125 I-dC containing strand, and causes breakage of the opposite strand in 75-80% of events. Thus, the double stranded break is produced by 125 I decay with probability ∼0.8. Most of single stranded breaks (around 90%) occurred within 5-6 nucleotides of the 125 I-dC, however DNA breaks were detected up to 18-20 nucleotides from the decay site. The average numbers of single stranded breaks per decay are 3.7 (PB) and 3.3 (PB+DMSO) in 125 I-dC containing strand, and 1.5 (PB) and 1.3 (PB+DMSO) in the opposite strand. Deconvolution of strand break probabilities as a function of separation from the 125 I, in terms of both distance (to target deoxyribosyl carbon atoms, in B-DNA) and nucleotide number, show that the latter is an important parameter for the shorter-range damage. This could indicate a role for attenuation/dissipation of damage through the stacked bases. In summary, the results represent a much more extensive set of data than available from earlier experiments on DNA breakage from l25 I-decay, and may provide new mechanistic insights
40 CFR 125.99 - What are approved design and construction technologies?
2010-07-01
... construction technologies? 125.99 Section 125.99 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...) of the Act § 125.99 What are approved design and construction technologies? (a) The following....99 was suspended. ...
International Nuclear Information System (INIS)
2016-01-01
This safety report was established in accordance with articles L. 125-15 and L. 125-16 of the French environmental code. It presents, first, the NPPs (INBs no. 136 and 140). Then, the nuclear safety and radiation protection measures taken regarding the facilities are reviewed: nuclear safety definition, radiation protection of intervening parties, safety and radiation protection improvement paths, crisis management, external and internal controls, technical situation of facilities, administrative procedures in progress. The incidents and accidents which occurred in 2015, if any, are reported as well as the radioactive and non-radioactive effluents discharge in the environment. Finally, the radioactive materials and wastes generated by the facility are presented (type of waste, quantities, conditioning process). The document concludes with a presentation of the actions of communication and public information made by the direction of the facility. A glossary and the list of recommendations from the Committees for health, safety and working conditions are given in appendix
Electrical conduction in (Na0⋅ 125Bi0⋅ 125 Ba0⋅ 65Ca0⋅)(Nd0 ...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science; Volume 29; Issue 1. Electrical conduction in (Na0.125Bi0.125Ba0.65Ca0.1)(Nd0.065Ti0.87Nb0.065)O3 ceramic. Syed Mahboob G Prasad G S Kumar. Ceramics and Glasses Volume 29 Issue 1 February 2006 pp 35-41 ...
Serum CA125 predicts extrauterine disease and survival in uterine carcinosarcoma
Huang, Gloria S.; Chiu, Lydia G.; Gebb, Juliana S.; Gunter, Marc J.; Sukumvanich, Paniti; Goldberg, Gary L.; Einstein, Mark H.
2009-01-01
Objective The purpose of this study was to determine the clinical utility of CA125 measurement in patients with uterine carcinosarcoma (CS). Methods Ninety-five consecutive patients treated for CS at a single institution were identified. All 54 patients who underwent preoperative CA125 measurement were included in the study. Data were abstracted from the medical records. Tests of association between preoperative CA125 and previously identified clinicopathologic prognostic factors were performed using Fisher’s exact test and Pearson chi-square test. To evaluate relationship of CA125 elevation and survival, a Cox proportional hazard model was used for multivariate analysis, incorporating all of prognostic factors identified by univariate analysis. Results Preoperative CA125 was significantly associated with the presence of extrauterine disease (P<0.001), deep myometrial invasion (P<0.001), and serous histology of the epithelial component (P=0.005). Using univariate survival analysis, stage (HR=1.808, P=0.004), postoperative CA125 level (HR=9.855, P<0.001), and estrogen receptor positivity (HR=0.314, P=0.029) were significantly associated with survival. In the multivariate model, only postoperative CA125 level remained significantly associated with poor survival (HR=5.725, P=0.009). Conclusion Preoperative CA125 elevation is a marker of extrauterine disease and deep myometrial invasion in patients with uterine CS. Postoperative CA125 elevation is an independent prognostic factor for poor survival. These findings indicate that CA125 may be a clinically useful serum marker in the management of patients with CS. PMID:17935762
Directory of Open Access Journals (Sweden)
Stephanie M Coomes
2015-07-01
Full Text Available Parasitic helminths establish chronic infections in mammalian hosts. Helminth/Plasmodium co-infections occur frequently in endemic areas. However, it is unclear whether Plasmodium infections compromise anti-helminth immunity, contributing to the chronicity of infection. Immunity to Plasmodium or helminths requires divergent CD4+ T cell-driven responses, dominated by IFNγ or IL-4, respectively. Recent literature has indicated that Th cells, including Th2 cells, have phenotypic plasticity with the ability to produce non-lineage associated cytokines. Whether such plasticity occurs during co-infection is unclear. In this study, we observed reduced anti-helminth Th2 cell responses and compromised anti-helminth immunity during Heligmosomoides polygyrus and Plasmodium chabaudi co-infection. Using newly established triple cytokine reporter mice (Il4gfpIfngyfpIl17aFP635, we demonstrated that Il4gfp+ Th2 cells purified from in vitro cultures or isolated ex vivo from helminth-infected mice up-regulated IFNγ following adoptive transfer into Rag1-/- mice infected with P. chabaudi. Functionally, Th2 cells that up-regulated IFNγ were transcriptionally re-wired and protected recipient mice from high parasitemia. Mechanistically, TCR stimulation and responsiveness to IL-12 and IFNγ, but not type I IFN, was required for optimal IFNγ production by Th2 cells. Finally, blockade of IL-12 and IFNγ during co-infection partially preserved anti-helminth Th2 responses. In summary, this study demonstrates that Th2 cells retain substantial plasticity with the ability to produce IFNγ during Plasmodium infection. Consequently, co-infection with Plasmodium spp. may contribute to the chronicity of helminth infection by reducing anti-helminth Th2 cells and converting them into IFNγ-secreting cells.
International Nuclear Information System (INIS)
Upadhyay, Santosh Kumar; Verone, Alissa; Shoemaker, Suzanne; Qin, Maochun; Liu, Song; Campbell, Moray; Hershberger, Pamela A.
2013-01-01
1,25-dihydroxyvitamin D 3 (1,25(OH) 2 D 3 ) exerts anti-proliferative activity by binding to the vitamin D receptor (VDR) and regulating gene expression. We previously reported that non-small cell lung cancer (NSCLC) cells which harbor epidermal growth factor receptor (EGFR) mutations display elevated VDR expression (VDR high ) and are vitamin D-sensitive. Conversely, those with K-ras mutations are VDR low and vitamin D-refractory. Because EGFR mutations are found predominately in NSCLC cells with an epithelial phenotype and K-ras mutations are more common in cells with a mesenchymal phenotype, we investigated the relationship between vitamin D signaling capacity and the epithelial mesenchymal transition (EMT). Using NSCLC cell lines and publically available lung cancer cell line microarray data, we identified a relationship between VDR expression, 1,25(OH) 2 D 3 sensitivity, and EMT phenotype. Further, we discovered that 1,25(OH) 2 D 3 induces E-cadherin and decreases EMT-related molecules SNAIL, ZEB1, and vimentin in NSCLC cells. 1,25(OH) 2 D 3 -mediated changes in gene expression are associated with a significant decrease in cell migration and maintenance of epithelial morphology. These data indicate that 1,25(OH) 2 D 3 opposes EMT in NSCLC cells. Because EMT is associated with increased migration, invasion, and chemoresistance, our data imply that 1,25(OH) 2 D 3 may prevent lung cancer progression in a molecularly defined subset of NSCLC patients
77 FR 37326 - Safety Zone; Grand Hotel 125th Anniversary Fireworks Celebration, Mackinaw Island, MI
2012-06-21
... National Technology Transfer and Advancement Act (NTTAA) (15 U.S.C. 272 note) directs agencies to use... Rulemaking A. Regulatory History and Information The Coast Guard is issuing this temporary final rule without.... Assistance for Small Entities Under section 213(a) of the Small Business Regulatory Enforcement Fairness Act...
Wang, Si-Ming; Cai, Huai-Qiu; Dong, Xiao-Qiu; Fan, Qiu-Lan; Wang, Lu-Lu; Shao, Xiao-Hui; Zhang, Li-Wei
2015-01-01
This study was to investigate the correlation between ovarian chocolate cysts and serum carbohydrate antigen (CA)-125 levels and to demonstrate the effect of ultrasound-guided interventional sclerotherapy (UGIS) on serum CA-125 levels. Based on the serum CA-125 level, as determined by chemiluminescence detection prior to UGIS, 105 patients with ovarian chocolate cysts were divided into the normal group (CA-125 ≤ 35 U/mL, 45 patients) and the abnormal group (35 U/mL history, child-bearing history, abortion history and surgical history. The ultrasonography characteristics were cyst diameter, cyst wall thickness and the side on which the cyst occurred. The correlations between serum CA-125 levels pretreatment and the clinical indicators and ultrasonography characteristics was analyzed. The serum CA-125 levels pretreatment, 3 months post-treatment and 6 months post-treatment were compared. The pretreatment serum CA-125 levels of the 105 patients positively correlated with disease duration (r = 0.3932, P = 0.0040), dysmenorrhea history (r = 0.2351, P = 0.0111), cyst diameter (r = 0.3415, P chocolate cysts. © 2014 The Authors. Journal of Obstetrics and Gynaecology Research © 2014 Japan Society of Obstetrics and Gynecology.
14 CFR 125.206 - Pitot heat indication systems.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pitot heat indication systems. 125.206... Equipment Requirements § 125.206 Pitot heat indication systems. (a) Except as provided in paragraph (b) of... flight instrument pitot heating system unless the airplane is equipped with an operable pitot heat...
Use of (3H) and (125I) tracers in steroid radioimmunoassays
International Nuclear Information System (INIS)
Jeffcoate, S.L.
1975-01-01
The comparative use of 3 H and 125 I tracers in steroid radioimmunoassays will be discussed around the following points: - 3 H. Advantages: they can be purchased commercially and have a long shelf-life. Disadvantages: they may have reduced affinity for antibodies due to ''isotope effects''; the counting of β-emitters is more expensive and difficult; 3 H tracers are not available for all steroids. - 125 I. Advantages: gamma-counting is cheaper, simpler and more precise; 125 I tracers may have higher affinity for antibodies than unlabelled steroids; 125 I can be used to label any steroid. Disadvantages: 125 I tracers have a limited shelf-life (n.b. six months for 125 I histamine tracers). The high affinity of some tracers will be a big disadvantage if the unlabelled steroid cannot compete effectively
125I-β-CIT biodistribution study in animals
International Nuclear Information System (INIS)
Hu Ping
2000-01-01
The purpose is to study the preparation and biodistribution in animal of dopamine transporter imaging agent 125 I-β-CIT. β-CIT was 125 I radioiodinated with Iodogen method, the dynamic distribution of 125 I-β-CIT in brain and critical organs were studied with SD rat (autoradiography) and NIH mice respectively. The radiolabelling yield of 125 I-β-CIT was 84%, the radiochemical purity was better than 98%. Blood clearance could be explained by two-compartment model with a duration of 12h, (α = 3.87, T 1/2α = 0.179, β = 0.162, T 1/2β = 4.276) and three-compartment model in 24 h, (Pi = 5.28, T 1/2Pi = 0.131, α = 0.403, T 1/2α = 1.719, β 0.040, T 1/2β = 17.298). The maxim uptake rate of brain (9.1% +- 1.0%) was reaches at 1h, while at 24h, the target/noise ratio was higher . Critical organs liver, lung, spleen and kidney had high uptake rate [(9.88 +- 1.43) - (16.29 +- 1.72)], except liver, other organs showed quick clearance (T 1/2 125 I-β-CIT has a high striatum uptake and good stability in vivo, can provide good SPECT images, the best acquisition time of SPECT may be about 20h after i.v
Eμ/miR-125b transgenic mice develop lethal B-cell malignancies.
Enomoto, Y; Kitaura, J; Hatakeyama, K; Watanuki, J; Akasaka, T; Kato, N; Shimanuki, M; Nishimura, K; Takahashi, M; Taniwaki, M; Haferlach, C; Siebert, R; Dyer, M J S; Asou, N; Aburatani, H; Nakakuma, H; Kitamura, T; Sonoki, T
2011-12-01
MicroRNA-125b-1 (miR-125b-1) is a target of a chromosomal translocation t(11;14)(q24;q32) recurrently found in human B-cell precursor acute lymphoblastic leukemia (BCP-ALL). This translocation results in overexpression of miR-125b controlled by immunoglobulin heavy chain gene (IGH) regulatory elements. In addition, we found that six out of twenty-one BCP-ALL patients without t(11;14)(q24;q32) showed overexpression of miR-125b. Interestingly, four out of nine patients with BCR/ABL-positive BCP-ALL and one patient with B-cell lymphoid crisis that had progressed from chronic myelogenous leukemia overexpressed miR-125b. To examine the role of the deregulated expression of miR-125b in the development of B-cell tumor in vivo, we generated transgenic mice mimicking the t(11;14)(q24;q32) (Eμ/miR-125b-TG mice). Eμ/miR-125b-TG mice overexpressed miR-125b driven by IGH enhancer and promoter and developed IgM-negative or IgM-positive lethal B-cell malignancies with clonal proliferation. B cells obtained from the Eμ/miR-125b-TG mice were resistant to apoptosis induced by serum starvation. We identified Trp53inp1, a pro-apoptotic gene induced by cell stress, as a novel target gene of miR-125b in hematopoietic cells in vitro and in vivo. Our results provide direct evidence that miR-125b has important roles in the tumorigenesis of precursor B cells.
Directory of Open Access Journals (Sweden)
R.D. Haryuni
2014-04-01
Full Text Available Nimotuzumab is an anticancer agent which belongs to the inhibitor group of Epidermal Growth Factor Receptor (EGFR. This monoclonal antibody has a relatively high molecular weight which makes slow penetration on tumor cell, as concequence, it is less attractive in imaging kinetics, and potentially elicits antibodies respons. Therefore in this study nimotuzumab was fragmented to form bivalent antibody [F(ab’2] and then labeled with 125I to form 125I-F(ab’2-nimotuzumab which can be used further as a precursor for preparing 125I-F(ab’2-nimotuzumab-NLS (NLS = nuclear localizing sequences radiopharmaceutical for radioimmunotherapy. The aims of this study were to obtain characteristics of 125I-F(ab’2-nimotuzumab by comparing with the 125I labeled-intact nimotuzumab (125I-nimotuzumab. This study was initiated by purifying nimotuzumab by mean of dialysis. The purified nimotuzumab was then fragmented by using pepsin. The F(ab'2-nimotuzumab formed was then purified from its by-products which formed in fragmentation process by using a PD-10 column (consisted Sephadex G25. The intact nimotuzumab and its F(ab’2 fragment were then labeled with the 125I to form 125I-nimotuzumab and 125I-F(ab’2-nimotuzumab. The radiochemical purity are 98.27 % and 93.24 % ,respectively. Stability test results show that, both of 125I-nimotuzumab and 125I-F(ab’2-nimotuzumab more stable at 4 °C than at room temperature storage and 37 °C
Preparation of 125I-labeled monoclonal antibody of bladder neoplasm using lactoperoxidase
International Nuclear Information System (INIS)
Li Huaifen; Niu Huisheng; Yuan Mingyue; Huang Yongzhi
1994-01-01
125 I-labelled monoclonal antibody of bladder neoplasm ( 125 I-L 4 B 4 ) is prepared using lactoperoxidase. The in-vivo radioactive distribution of 125 I-L 4 B 4 in bare mice shows that 125 I-L 4 B 4 concentrates in the tumour
Computerized dosimetry of I-125 sources model 6711
International Nuclear Information System (INIS)
Isturiz, J.
2001-01-01
It tries on: physical presentation of the sources; radiation protection; mathematical model of I-125 source model 6711; data considered for the calculation program; experimental com probation of the dose distribution; exposure rate and apparent activity; techniques of the use given to the sources I-125; and the calculation planning systems [es
14 CFR 125.311 - Flight crewmembers at controls.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight crewmembers at controls. 125.311... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Operations § 125.311 Flight crewmembers at controls. (a) Except as provided in paragraph (b) of this section, each...
Recovery of antimony-125 from tin-124 irradiated by neutrons
International Nuclear Information System (INIS)
Baluev, A.V.; Mityakhina, V.S.; Krasnikov, L.V.; Galkin, B.Ya.; Besnosyuk, V.I.
2003-01-01
Separation of 125 Sb from tin using highly basic, medium-basic, and weakly basic ion-exchangers was studied. The best results were obtained for AN-31 weakly basic anion exchanger. The yield of 125 Sb was 95 -98 % of the initial activity, the yield of tin, 98 ± 0.5% of the initial amount. The separation coefficient is 10 6 -10 7 for one cycle. A procedure based on ion exchange was developed. Extraction procedures of separation of 125 Sb from tin were studied. Isoamyl alcohol, ethyl acetate, and di-n-butyl ether were used as extracting agents. The most efficient extracting agent is di-n-butyl ether. Carrier-free radiochemically pure sample of 125 Sb was produced. More than 20 mCi of the target product was recovered. The extraction recovery procedure of 125 Sb has been developed. (author)
First symposium seed implant 125I and high rate of prostate
International Nuclear Information System (INIS)
2012-01-01
The First symposium seed implant 125 I and high rate of prostate, was organized by the Marie Curie Foundation, between the 12 to april 2012, in the Cordoba city of Argentina. In this event were presented several documents in different topics: patients selection for impacts of 125 I seeds; high doses radiation in radiotherapy; brachytherapy for prostate cancer; prostate implant technique with 125 I seeds; implant dosimetric aspects; radioprotection of 125 I seeds.
14 CFR 125.177 - Control of engine rotation.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Control of engine rotation. 125.177 Section... Requirements § 125.177 Control of engine rotation. (a) Except as provided in paragraph (b) of this section, each airplane must have a means of individually stopping and restarting the rotation of any engine in...
Quality asurance of iodinated (125 I) human fibrinogen
International Nuclear Information System (INIS)
Vines, E.J.
1980-05-01
The radiopharmaceutical iodinated ( 125 I) human fibrinogen is currently used for the detection of deep vein thrombosis in the legs, a fairly common post-surgical complication. A comprehensive quality assurance programme for ( 125 I) - human fibrinogen has been determined for routine use at the Australian Radiation Laboratory, with adaptions necessary for hospital quality control testing
50 CFR 12.5 - Seizure by other agencies.
2010-10-01
... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Seizure by other agencies. 12.5 Section 12... SEIZURE AND FORFEITURE PROCEDURES General Provisions § 12.5 Seizure by other agencies. Any authorized... the laws listed in § 12.2 will, if so requested, deliver such seizure to the appropriate Special Agent...
Effect of fentanyl on 125I-β-CIT uptake in mice brain
International Nuclear Information System (INIS)
Liu Xingdang; Lin Xiangtong
2003-01-01
Objective: To investigate the effect of fentanyl on 125 I-2β-carbomethoxy-3β-(4-iodophenyl) tropane ( 125 I-β-CIT) uptake in mice brain. Methods: 1) KM mice groups of five were given different doses of fentanyl, and 10 min or 1 h later were given a dose of 125 I-β-CIT. 2)Two groups of animals were killed at 2 h after injection of 125 I-β-CIT. 3)One group of animals were killed at 1 h after injection of 125 I-β-CIT. Results: 1)In the striatum, frontal cortex, hippocampus, brain stem, cerebellum and whole brain, a dose-dependent increase in uptake (%ID/g or %ID) of 125 I-β-CIT was detected at the fentanyl doses ranging from 125 to 300 μg/kg, and the uptakes of hippocampus and cerebellum were higher than that of the controls. There was a great difference in the value of %ID/g or %ID between the group treated with 250 μg/kg fentanyl and the control group; while at the doses from 12.5 to 100 μg/kg, a dose-dependent decrease in uptake in the same regions was observed and all the uptake levels were lower (hippocampus: except 62.5 and 12.5 μg/kg groups; brain stem: except 62.5 μg/kg group) than that of the controls. 2)The uptakes of 125 I-β-CIT in the striatum, frontal cortex, hippocampus, brain stem, cerebellum and whole brain in the groups injected with 125 I-β-CIT 10 min after fentanyl treatment were higher than that in the groups injected with 125 I-β-CIT 1 h after fentanyl treatment. 3)The binding of 125 I-β-CIT in the striatum, frontal cortex, hippocampus, brain stem, cerebellum and whole brain in the groups killed at 1 h after injection of 125 I-β-CIT was higher than that in the control group, but without significant difference. Conclusion: Fentanyl may have different effects on 125 I-β-CIT at various time points and doses
Application of 125I in micropipettor check
International Nuclear Information System (INIS)
Qian Xiaoyu; Gao Yunchao; Yang Yadong; Lu Hankui
2006-01-01
Gravimetric test is one of authoritative methods for the measurement and validation of the accuracy and precision of micropipettors. The feasibility of radioactive measurement in the check of micropipettors is studied. There are no significant difference in radioactive count rates of 125 I aspirated between 2 qualified micropipettors, but significant difference are recorded between qualified and unqualified micropipettors. So 125 I radiometry agrees with gravimetric tests, and can be used as a laboratory constant test of micropipettors. (authors)
International Nuclear Information System (INIS)
Sawant, R.M.; Ramakumar, K.L.; Sharma, R.S.
2003-01-01
Protonation constants of hydroquinone and stability constants of thorium hydroquinone complexes were determined in 1 M NaClO 4 medium at 25 ± 0.5 degC, by varying concentration of thorium, using pH titration technique. Protonation constants of hydroquinone (β 1H = [HQ]/[H][Q] and β 2H = [H 2 Q]/[H] 2 [Q]) were found to be β 1H = 11.404 ± 0.014 and β 2H = 21.402 ± 0.012. The analysis of titration data of thorium-hydroquinone system appears to indicate the formation of species Th(H 2 Q) 3 (OH) and Th(H 2 O) 4 (OH). Equilibrium constants obtained for these species are -log β 13-I = 48.51 ± 0.67 and -log β 14-1 64.86 ± 1.25 respectively which are not reported in the literature. (author)
Preparation and dosimetry of reactor-produced Xe-125 for ventilation scintigraphy
International Nuclear Information System (INIS)
Junker, D.; Cordes, H.
1978-01-01
Xe-125 is produced in the reactor by the (n, γ)-reaction from Xe-124. The natural abundance of Xe-124, however, is only 0,1 percent. As the costs for Xe-124 enriched Xenon are considerable, natural Xenon is activated in the epithermal energy region. In contrast to the other stable isotopes of Xenon, Xe-124 shows a large resonance cross section in this energy region. The main activation product is Xe-125. In addition, a few nuclides (e.g. Xe-125m, Xe-127m, Xe-137) are produced, which due to their short half lives give no contribution to radiation dose. Radiocontaminants originating from parent-daughter decay (e.g. Cs-135 and Cs-137) are separated by filtration of the gas. I-125 produced by the decay of Xe-125 is removed by filtering of the gas before administration to the patient. Typical yields of a sample capsule are 20 to 30 mCi Xe-125 after irradiation of 4 hours in an epithermal flux of approximately 2.10 -11 s -1 cm -2 . The residual contaminants contributing to the radiation dose are Xe-135 and Xe-129m. Depending on the irradiation time they amount to a few percent of the total activity. Using Xe-125 for lung ventilation studies results in considerable reduction of radiation dose as compared to Xe-133. An additional advantage is the better tissue penetration of Xe-125 (γ-energies at 188 keV (55%) and 243 keV (29%)) permitting the reduction of the dose for a study. The daughter nuclide I-125 generated during the study causes only a few mrem of radiation dose if the thyroid is blocked. Altogether Xe-125 as compared to Xe-133 offers more suitable γ-energies for lung ventilation studies and in addition a reduced radiation dose to the patient. (author)
Preparation and evaluation of serotonin labelled with 125I
International Nuclear Information System (INIS)
Sivaprasad, N.; Geetha, R.; Ghodke, A.S.; Karmalkar, C.P.; Pilkhwal, N.S.; Sarnaik, J.S.; Borkute, S.D.; Nadkarni, G.D.
1999-01-01
Radiolabelled serotonin is an important tool for studying serotonin receptors and estimating serotonin levels in plants and animals. In this paper we report the synthesis of serotonin - 125 I. Tyrosine Methyl Ester (TME) was first labelled with 125 I using chloramine-T method. 125 I-TME was then conjugated with serotonin using carbodimide. The labelled conjugate was purified using gel filtration. Yield and radiochemical purity were estimated using electrophoresis and ITLC in different solvent systems. The binding of the purified tracer to serotonin receptors and serotonin antibodies was studied. (author)
Evolution of Th and U whole-rock contents in the Ilimaussaq intrusion
International Nuclear Information System (INIS)
Bailey, J.C.; Rose-Hansen, J.; Soerensen, H.
1981-01-01
Thorium and uranium values of a large collction of representative samples taken from all rock types of the Ilimaussaq alkaline intrusion, South Greenland, are presented. The values are largely obtained by laboratory gamma-ray spectrometric (GRS) analysis. The results are discussed in relation to current knowledge and ideas on the petrologic evolution of the Ilimaussaq intrusion. It is concluded that (1) Rocks from the Ilimaussaq alkaline intrusion evolve to extremely high Th and U contents; (2) The evolution is characterised by appearance of low-Th/U cumulates due to the appearance of low-Th/U eudialyte as a liquidus phase; (3) Fractionation of the observed cumulus assemblages fails to explain all features of the Th-U evolution; (4) Losses of mobile fluids, rich in Th/U, occur in the final stages. (BP)
Melancholia before the 20th century: Fear and Sorrow or Partial Insanity?
Directory of Open Access Journals (Sweden)
Diogo eTelles-Correia
2015-02-01
Full Text Available Throughout the history of Psychopathology, several meanings have been assigned to the term melancholia. The main ones were related to affective (fear and sadness and thought disorders (a type of mental disorder characterised mainly by the presence of abnormal believes. At the time of Hippocrates melancholia was regarded mainly in its affective component. Since that time, and until the 18th century, authors and opinions have been divided, with both aspects (affective and thought disorders, being valued. Finally, in the 18th-19th centuries, with Pinel at its peak, melancholia becomes exclusively a synonym of thought disorders (abnormal believes: delusions/overvalued ideas.At the turn of the 19th to the 20th century, the affective component returns as the main aspect characterising melancholia.
Iodine-125 toxicity as a function of intranuclear radionuclide distribution
International Nuclear Information System (INIS)
Yasui, L.S.; Hofer, K.G.
1984-01-01
Chinese hamster ovary (CHO) cells were synchronized in the G/sub 1/ phase of the cell cycle by isoleucine deprivation and then subjected to 8 hr. labeling with /sup 125/I-iododeoxyuridine (/sup 125/IUdR) either in the presence or absence of aphidicolin. Cells labeled in the presence of aphidicolin showed a D/sub 0/ of 30 decays/cell as compared to a D/sub 0/ of 90-100 decays for control cells. Presumably, aphidicolin had shifted /sup 125/IUdR incorporation into a sensitive sub-fraction of the nuclear genome. However, no aphidicolin effect was seen in identical studies on asynchronous cell populations, i.e., both control and aphidicolin treated cells showed a D/sub 0/ of 90-100 decays/cell. An attempt was made to correlate /sup 125/I toxicity with intranuclear /sup 125/I distribution. Electron-microsopic autoradiography and Chi=squared analysis revealed that in all experimental groups grain density was highest in the heterochromatin region of the nucleus. However, isoleucine deprivation lead to a dramatic decrease in the nuclear area occupied by heterochromatin (19.5% in control cells, 0.7% in synchronized cells), resulting in a corresponding increase in area and grain density for the euchromatin containing portion of the nucleus. These observations suggest that any shift in intranuclear distribution of /sup 125/I causes a dramatic change in the toxic effects of intranuclear /sup 125/I decays
Synthesis of 125 I - Salicyl Hydroxamic Acid for Urinary Bladder Imaging
International Nuclear Information System (INIS)
Ibrahim, I.T.; Abou EL Zahab, M.; Hamed, M.
2015-01-01
Salicylhydroxamic acid is a salicylate derivative. Radiolabeling of Salicyl hydroxamic acid ( SHA ) with iodine-125 may have considerable interest for imaging of urinary bladder. This study is aimed to optimize the radiolabeling yield of Salicyl hydroxamic with radio iodine (125-123) using chloramine - T (CAT) as an oxidizing agent with respect to factors that affect the reaction conditions such as SHA amount, CAT amount, reaction time and ph of the reaction mixture. In - vitro stability of the radiolabeled complex was checked and it was found to be stable for up to 24 h. 125 I-SHA was injected via intravenous administration routes into normal male Sprague – Dawley rats. Bio - distribution studies have revealed that 125 I-SHA was excreted in urine with extent that it could give a clear image for urinary bladder especially if the bladder it tightly closed. The amount of 125 I - Salicyl hydroxamic excreted was increased in case of giving potassium bicarbonate to rat before injection of 125 I-SHA. The result of biodistribution study of 125 I - SHA in experimental animal suggest ed the possibility of using 123 I-SHA to image the urinary bladder
PPARγ inhibits ovarian cancer cells proliferation through upregulation of miR-125b
Energy Technology Data Exchange (ETDEWEB)
Luo, Shuang, E-mail: luoshuangsch@163.com [Department of Obstetrics and Gynecology, Suining Central Hospital, Suining (China); Wang, Jidong [Department of Gynecology and Obsterics, Jinan Central Hospital, Jinan (China); Ma, Ying [Department of Otorhinolaryngolgy, Suining Central Hospital, Suining (China); Yao, Zhenwei [Department of Gynecology and Obstetrics, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Pan, Hongjuan [Department of Gynecology and Obsterics, Zhongshan Hospital, Wuhan (China)
2015-06-26
miR-125b has essential roles in coordinating tumor proliferation, angiogenesis, invasiveness, metastasis and chemotherapy recurrence. In ovarian cancer miR-125b has been shown to be downregulated and acts as a tumor suppressor by targeting proto-oncogene BCL3. PPARγ, a multiple functional transcription factor, has been reported to have anti-tumor effects through inhibition of proliferation and induction of differentiation and apoptosis by targeting the tumor related genes. However, it is unclear whether miR-125b is regulated by PPARγ in ovarian cancer. In this study, we demonstrated that the miR-125b downregulated in ovarian cancer tissues and cell lines. Ligands-activated PPARγ suppressed proliferation of ovarian cancer cells and this PPARγ-induced growth inhibition is mediated by the upregulation of miR-125b. PPARγ promoted the expression of miR-125b by directly binding to the responsive element in miR-125b gene promoter region. Thus, our results suggest that PPARγ can induce growth suppression of ovarian cancer by upregulating miR-125b which inhibition of proto-oncogene BCL3. These findings will extend our understanding of the function of PPARγ in tumorigenesis and miR-125b may be a therapeutic intervention of ovarian cancer. - Highlights: • miR-125b is down-regulated in ovarian cancer tissues and cells. • PPARγ upregulates miR-125b and downregulates its target gene BCL3 expression. • Silence of miR-125b attenuates PPARγ-mediated growth suppression of ovarian cancer cells. • PPARγ promotes the transcription of miR-125b via binding to PPARE in miR-125b gene promoter region.
Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles as a janus electrode material for Li-ion batteries
Karegeya, Claude; Mahmoud, Abdelfattah; Hatert, Frédéric; Vertruyen, Bénédicte; Cloots, Rudi; Lippens, Pierre-Emmanuel; Boschini, Frédéric
2018-06-01
A solvothermal method was used to prepare Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles, a new promising electrode material for lithium-ion batteries. The composition and the crystal structure were determined by 57Fe Mössbauer spectroscopy and powder X-ray diffraction Rietveld refinements and confirmed by magnetic measurements. The structural formula □0.75Na1.25Ni1.25Fe1.75(PO4)3 was obtained showing a significant amount of Na vacancies, which enhances Li diffusion. Na1.25Ni1.25Fe1.75(PO4)3 was used as negative and positive electrode material and shows excellent electrochemical performances. As negative electrode in the voltage range 0.03-3.5 V vs. Li+/Li, the first discharge at current density of 40 mA g-1 delivers a specific capacity of 1186 mAh g-1, which is almost three times its theoretical capacity (428 mAh g-1). Then, reversible capacity of 550 mAh g-1 was obtained at 50 mA g-1 with high rate capability (150 mAh g-1 at 500 mA g-1) and capacity retention of 350 cycles. As positive electrode material, specific capacities of about 145 and 99 mAh g-1 were delivered at current densities of 5 and 50 mA g-1, respectively, in the voltage range of 1.5-4.5 V vs. Li+/Li. In addition, we show that the use of solvothermal synthesis contributes to the synthesis of small sized particles leading to good electrochemical performances.
International Nuclear Information System (INIS)
Miyake, Yasuo; Sugimura, Yukio; Yasujima, Tadahide.
1978-01-01
The concentration of thorium isotopes and the activity ratios of 230 Th/ 232 Th and 228 Th/ 232 Th in 500 l sea water samples collected in the Pacific Ocean were determined. Thorium isotopes were analyzed by alpha-ray spectrometry after separating them from other elements with an anion exchange resin. The average content of thorium ( 232 Th) of 0.9 ng l -1 was obtained in the open Pacific water. The average contents of 230 Th and 228 Th were 2.1 x 10 -2 pgl -1 and 1.2 agl -1 respectively. It was found that the ratios of 230 Th/ 232 Th and 228 Th/ 232 Th ranged respectively from 1.0 to 29, and from 0.4 to as high as 128. (author)
Th1/Th2 cytokine expression in diabetic retinopathy.
Cao, Y L; Zhang, F Q; Hao, F Q
2016-07-15
Diabetic retinopathy (DR), an important complication of diabetes mellitus (DM), is not well understood. T helper cell balance (Th1/Th2) is involved in various autoimmune diseases; however, its role in DR is not understood. This study explores changes in Th1 and Th2 cytokine expression during DR. Blood samples were collected from 25 healthy volunteers (normal control group), 35 patients with type 2 DM (T2DM group) without DR, and 30 cases of T2DM patients with DR (DR group). Real-time PCR was used to measure mRNA expression of IL-2 and TNF-α, secreted from Th1 cells, and of IL-4 and IL-10, secreted from Th2 cells. We used ELISA to detect cytokine expression in serum to analyze the correlation between Th1 and Th2 cytokines. IL-2 and TNF-αmRNA and protein expression levels in the T2DM and DR groups were significantly higher than in the normal control group (P 0.05). IL-2 and TNF-αwere negatively correlated with IL-4 and IL-10 in the DR group, respectively. We found that Th1 cytokine secretion was higher and Th2 cytokines secretion was lower during DR, leading to a Th1/ Th2 imbalance, suggesting that Th1/Th2 imbalance is a side effect for DR occurrence and development.
Metabolism of (125I)tyramine cellobiose-labeled low density lipoproteins in squirrel monkeys
International Nuclear Information System (INIS)
Portman, O.W.; Alexander, Manfred
1985-01-01
Low density lipoproteins labeled with ( 125 I)tyramine cellobiose (( 125 I)TC-LDL) were removed from the circulation of squirrel monkeys at a similar but slightly slower rate than LDLs labeled with 125 I, ( 125 I)hydroxypenyl propionic acid, or ( 3 H)leucine. After the simultaneous injection of (( 125 I)TC-LDL) and ( 131 I)LDL labeled with 131 ICI, the 125 I was also removed at a slightly slower rate than 131 I. Most of the radioactivity was retained in tissues and not excreted during the 24 h after injection of ( 125 I)TC-LDL. This finding supports the claim of Pittman et al. (18) that ( 125 I)TC-LDL can be used to determine the irreversible uptake of LDL by different tissues. The liver cleared more LDL than any other organ, but the adrenals and ovaries were more active per gram. Trichloroacetic acid (TCA) precipitated more than 80% of the radioactivity in the tissues that had low 125 I uptake, but only about 50% of the 125 I in more active tissues (liver, adrenals, ovaries and spleen). Only a small percentage of 125 I in urine and bile was TCA-precipitable. In the dual label experiment with ( 125 I)TC-LDL and ( 131 I)LDL there was a selective retention of 125 I in samples from liver, spleen, adrenals, and perhaps testes, and an almost complete selectivity for 125 I in bile and feces. The aortic intima plus inner media (AIM) cleared much less LDL than other tissues, but the uptake by the entire AIM was proportional to the cholesterol concentration and weight of the total AIM. There was, however, no correlation between either of the latter two measurements and the uptake of LDL per pram of AIM. (author)
International Nuclear Information System (INIS)
Chen Shihong; Yuan Ruo; Chai Yaqin; Min Ligen; Li Wenjuan; Xu Yang
2009-01-01
A new strategy for constructing a sensitive mediator-type electrochemical immunosensor for the detection of carcinoma antigen-125 (CA125) was developed. In this strategy, mediator tris(2,2'-bipyridyl)cobalt(III) (Co(bpy) 3 3+ ) was incoporated into the multiwall carbon nanotubes-Nafion (MWNTs-Nafion) composite film via a simple ion-exchange route. Then, gold colloidal nanoparticles (nano-Au) were attached onto Co(bpy) 3 3+ /MWNTs-Nafion film through electrostatic interaction between negatively charged nano-Au and positively charged Co(bpy) 3 3+ . Finally, CA125 monoclonal antibody (anti-CA125), used as a model antibody, was assembled onto the surface of nano-Au to achieve an immunosensor for the determination of CA125 antigen. X-ray photoelectron spectroscopy (XPS), atomic force microscopy (AFM), electrochemical impedance spectroscopy (EIS) and cyclic voltammetry (CV) were used to characterize the assembly process of the modified electrode. The resulting immunosensor showed a high sensitivity, wide dynamic range consisting of two linear parts from 1.0 to 30 U mL -1 and 30 to 150 U mL -1 with a low detection limit of 0.36 U mL -1 at 3 times the background noise. Moreover, it displayed good reproducibility and stability, and would be potentially attractive for clinical immunoassay of CA125. The integration of mediator Co(bpy) 3 3+ and MWNTs-Nafion composite would offer potential promise for the fabrication of biosensors and biocatalysts.
International Nuclear Information System (INIS)
Korinthenberg, Rudolf; Neuburger, Daniela; Trippel, Michael; Ostertag, Christoph; Nikkhah, Guido
2011-01-01
Purpose: To retrospectively review the results of temporary I-125 brachytherapy in 94 children and adolescents with low-grade glioma. Methods and Materials: Treatment was performed in progressive tumors roughly spherical in shape with a diameter of up to 5 cm, including 79 astrocytomas, 5 oligodendrogliomas, 4 oligoastrocytomas, 1 ependymoma, and 5 other tumors. Location was suprasellar/chiasmal in 44, thalamic/basal ganglia in 18, hemispheric in 15, midbrain/pineal region in 13, and lower brainstem in 3. Initially, 8% of patients were free of symptoms, 47% were symptomatic but not disabled, and 30% were slightly, 6% moderately, and 3% severely disabled. Results: 5- and 10-year survival was 97% and 92%. The response to I-125 brachytherapy over the long term was estimated after a median observation period of 38.4 (range, 6.4-171.0) months. At that time, 4 patients were in complete, 27 in partial, and 18 in objective remission; 15 showed stable and 30 progressive tumors. Treatment results did not correlate with age, sex, histology, tumor size, location, or demarcation of the tumor. Secondary treatment became necessary in 36 patients, including 19 who underwent repeated I-125 brachytherapy. At final follow-up, the number of symptom-free patients had risen to 21%. Thirty-eight percent showed symptoms without functional impairment, 19% were slightly and 11% moderately disabled, and only 4% were severely disabled. Conclusions: Response rates similar to those of conventional radiotherapy or chemotherapy can be anticipated with I-125 brachytherapy in tumors of the appropriate size and shape. We believe it to be a useful contribution to the treatment of low-grade gliomas in children.
A Clinical Study on 125IT3 Resin Uptake Rate and Serum Thyroxin(T4) in Hyperthyroidism
International Nuclear Information System (INIS)
MooN, Ern Soo; Park, Yoh Han; Cho, Chang Ho; Park, In Soo; Lee, Chong Suk; Lee, Hak Choong
1978-01-01
Hyperthyroidism may be defined as those clinical conditions which result from an increase in the circulating levels of one or both thyroid hormones. Hyperthyroidism in broad sense could be classified with toxic diffuse goiter, toxic adenomatous goiter, and toxic multinodular goiter on the basis of the circulating thyroid hormone levels. For this study, the subject included 94 cases with hyperthyroidism were presented in 77 with toxic diffuse goiter, 8 with toxic adenomatous goiter, and 9 with toxic multinodular goiter on the levels of 125 IT 3 resin uptake rate and serum thyroxine (T 4 ). The observed results were as follows: 1) In the cases of hyperthyroidism including toxic diffuse goiter, toxic adenomatous goiter, and toxic multinodular goiter, 20.21% of the patients were male and 79.79% female. The majority of the patients were in 2nd to 4th decades of their lives. 2) There were objective signs clearly manifested in hyperthyroidism including toxic diffuse goiter and toxic adenomatous goiter which were rare in the multinodular goiter. The clinical signs in toxic diffuse and toxic adenomatous goiter included wide pulse pressure, tachycardia, systolic murmur, exophthalmos, tremor and warm skin etc. 3) The most frequent complaints of the patients with hyperthyroidism were palpitation, weight loss, increased appetite, perspiration, heat intolerance, nervousness, exertional dyspnea, and menstrual disturbance etc. There was no clear difference in the incidence of symptoms between toxic diffuse goiter and toxic adenomatous goiter, but there was clear difference between toxic multinodular goiter. 4) Considering of results of 125 IT 3 resin uptake rate and serum T 4 level in toxic diffuse goiter, toxic adenomatous goiter and toxic multinodular goiter, 125 IT 3 resin uptake rate was 49.15±9.94% (mean) and serum T 4 21.29±7.04 ug/dl (mean) in toxic diffuse goiter. In toxic multinodular goiter, 125 I T 3 resin uptake rate was 32.47±6.74% (mean) and serum T 4 level 11.03
Hou, Bin; Ma, Xiaohua; Yang, Ling; Zhu, Jiejie; Zhu, Qing; Chen, Lixiang; Mi, Minhan; Zhang, Hengshuang; Zhang, Meng; Zhang, Peng; Zhou, Xiaowei; Hao, Yue
2017-07-01
In this paper, a normally-off AlGaN/GaN high-electron-mobility transistors (HEMT) fabricated using inductively coupled plasma (ICP) CF4 plasma recessing and an implantation technique is reported. A gate-to-channel distance of ˜10 nm and an equivalent negative fluorine sheet charge density of -1.21 × 1013 cm-2 extracted using a simple threshold voltage (V th) analytical model result in a high V th of 1.5 V, a peak transconductance of 356 mS/mm, and a subthreshold slope of 133 mV/decade. A small degradation of channel mobility leads to a high RF performance with f T/f max of 41/125 GHz, resulting in a record high f T × L g product of 10.66 GHz·µm among Schottky barrier AlGaN/GaN normally-off HEMTs with V th exceeding 1 V, to the best of our knowledge.
Christensen, T B; Marqversen, J; Engbaek, F; Berger, P; Bacher, T; Maase, H von der
1999-01-01
We have recently introduced 125I-hCG as an elimination marker in patients with human chorionic gonadotrophin (hCG) producing testicular cancer. 125I-hCG is a well-known reagent in clinical biochemistry and is used extensively in hCG assays. Previous studies have shown that the iodination process leaves the hCG molecule mainly intact. The iodination, purification and stability of 125I-hCG tracer are described. The aim of the present study was to determine whether or not 125I is associated with...
Autoradiography for iodine-125 seeds
International Nuclear Information System (INIS)
Alberti, W.; Divoux, S.; Pothmann, B.; Tabor, P.; Hermann, K.P.; Harder, D.
1993-01-01
To study the interior design of model 6702 and 6711 iodine-125 seeds, contact autoradiographs were performed using mammography film. Improved resolution was obtained using a pin-hole camera with a hole of 0.1 mm x 0.1 mm. With these techniques, qualitative determination of the relative activity distribution within each seed was possible. The number of the activated resin spheres and the positions of the centers of these spheres can be exactly determined. A model calculation shows that variations in the arrangement of the activated spheres within a seed have a moderate influence on the dose distribution at source distances below 10 mm. Knowing the exact source configuration may be useful when comparing dose calculations with measured data for model 6702 125 I seeds which are currently employed in ophthalmic plaque and implant therapy of other tumors. 16 refs., 5 figs., 2 tabs
Dosimetric study in iodine-125 seeds for brachytherapy application
International Nuclear Information System (INIS)
Zeituni, Carlos Alberto
2008-01-01
The demand for iodine-125 seeds for use in brachytherapy treatments has experienced an increase along recent years in Brazil and all over the world. All iodine-125 seed must have its operational parameters measured and/or calculated every time changes in the production process are carried out. A complete dosimetric measurement is very expensive, and it is recommended that this procedure must be repeated at least once a year. Thus, this work developed a methodology for the entire dosimetric process. This methodology is based on the scarce information available in the literature, once almost all the methodology used in large industrial laboratories is commercial secret. The proposed methodology was tested using seeds of Amersham-Oncura-Ge Healthcare, which is the largest seed manufactory in the world. In this new methodology, an automatic reader was employed in order to reduce the time required in the selection process of the TLD-100 dosimeters used and a postprocessing of the obtained spectra was carried out. A total of 142 dosimeters were used and only 29 have been selected using the new methodology. Measurements were performed using slabs of Solid Water RW1 to simulate measuring in the 'water', using three different experimental apparatus and each measurement was repeated at least three times. The TLD-100 calibration was performed using a Dermopan II - Siemens. The measured values showed a good agreement with the ones available in the literature. Finally, these measured values were compared with calculated ones obtained by a semiempirical simulation program, showing a good agreement and, therefore, demonstrating the validity of the proposed methodology regarding dosimetric calculations. (author)
Celebrating 65th Anniversary of the Transistor
Directory of Open Access Journals (Sweden)
Goce L. Arsov
2013-12-01
Full Text Available The paper is dedicated to the 65th anniversary of the invention of the revolutionary electronic component that actually changed our way of life—the transistor. It recounts the key historical moments leading up to the invention of the first semiconductor active component in 1947. The meaning of the blend “transistor” is explained using the memorandum issued by Bell Telephone Laboratories. Certain problems appeared in the engineering phase of the transistor development and the new components obtained as a result of this research are reviewed. The impact of this invention on the development of power electronics is being emphasized. Finally, the possibility that the most important invention of the 20th century has been conceived not once but twice is discussed.
International Nuclear Information System (INIS)
Owens, Jonathan; Tebbutt, Andrew A.; McGregor, Ailsa L.; Kodama, K.; Magar, Sharad S.; Perlman, Michael E.; Robins, David J.; Durant, Graham J.; McCulloch, James
2000-01-01
N-(1-Naphthyl)-N'-(3-[ 125 I]-iodophenyl)-N'-methylguanidine ([ 125 I]-CNS 1261) was synthesized as a potential radioligand to image N-methyl-D-aspartate (NMDA) receptor activation. [ 125 I]-CNS 1261 was prepared by radioiodination of N-(1-naphthyl)-N'-(3-tributylstannylphenyl)-N'-methylguanidine using Na 125 I and peracetic acid. [ 125 I]-CNS 1261 uptake in vivo reflected NMDA receptor distribution in normal rat brain, whereas in ischemic rat brain, uptake was markedly increased in areas of NMDA receptor activation. Radiolabeled CNS 1261 appears to be a good candidate for further development as a single photon emission computed tomography tracer in the investigation of NMDA receptor activation in cerebral ischemia
Formation and early hydration characteristics of C2.75B1.25A3$ in binary system of C2.75B1.25A3$-C2S
Directory of Open Access Journals (Sweden)
Wang, Shoude
2016-09-01
Full Text Available C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2O3• SO3 is one of the important minerals and it govern-directly the early-strength of belite-barium calcium sulphoaluminate cement. In this paper a binary system C2.75B1.25A3$-C2S is selected to investigate the formation of C2.75B1.25A3$. In the range of 1100 °C–1200 °C, the earlier formed C2S hinders the formation of C2.75B1.25A3$. On the contrary, when the temperature is in the range of 1200 °C–1350 °C, the initially formed C2S could provide a surface for the nucleation of C2.75B1.25A3$ and cut down the potential barrier (?Gk* for the heterogeneous nucleation of C2.75B1.25A3$, which contributes to its formation. Moreover, at 1350 °C, the large amount of previously formed C2S benefits the extent of formation of C2.75B1.25A3$. The possible reason was that it could prevent sulfur evaporation. In early hydration age, AFm and AFt originating from C2.75B1.25A3$ hydration are found within 2 h and 12 h under 95% RH at 1 °C, respectively, whereas C2S is unhydrated at this moment.En el cemento de sulfoaluminato de calcio y bario, el C2.75B1.25A3$ (2.75CaO•1.25BaO• 3Al2 O3• SO3 es una de las principales fases, y regula directamente la resistencia inicial del cemento. En este trabajo, se ha seleccionado el sistema binario C2.75B1.25A3$-C2S para investigar la formación de C2.75B1.25A3$. En el rango de 1100 °C-1200 °C, el C2S formado anteriormente impide la formación de C2.75B1.25A3$, mientras que cuando la temperatura está entre 1200 °C-1350 °C, el C2S proporcionaría una superficie de nucleación de C2.75B1.25A3$ reduciendo la barrera de potencial (?Gk* para la nucleación heterogénea de C2.75B1.25A3$, lo que contribuye a su formación. Además, a 1350 °C, la gran cantidad de C2S formado beneficia la formación de C2.75B1.25A3$, ya que podía prevenir la evaporación del azufre. En las primeras etapas de la hidratación (entre 2 y 12h y 95% HR a 1 ºC se pueden encontrar AFM y AFt
Concentration of 232Th, 230Th and 228Th in various tissues of Japanese subjects
International Nuclear Information System (INIS)
Takizawa, Y.; Qingmei, H.; Hisamatsu, S.; Abe, T.
1997-01-01
The concentration of 232 Th, 230 Th and 228 Th in various human tissues of Japanese subjects obtained at autopsies are reported. The tissue samples were weighed, spiked with 234 Th tracer and ashed by acid. The solution was dried on a hot-plate. Separation of thorium radionuclides was accomplished through cation-exchange resin chromatography and electrodeposition. The concentrations of thorium isotopes were measured by α-spectrometry. Thorium-232 and 230 Th concentrations were found to be highest in lung, followed by bone. The maximum concentration of 228 Th was in bone. The lowest concentrations of thorium isotopes were in muscle. (author)
m-[125I]iodoaniline: a useful reagent for radiolabeling biotin
International Nuclear Information System (INIS)
Khawli, L.A.; Kassis, A.I.
1992-01-01
Biotinyl-m-[ 125 I]iodoanilide (BIA) was synthesized by coupling biotin to m-[ 125 I]iodoaniline via a mixed anhydride reaction. m-[ 125 I]Iodoaniline was produced from the tin precursor, which was prepared using a palladium catalyzed reaction of hexabutylditin with m-bromoaniline. The radioiodinated BIA derivative is characterized by a stable amide and/or intact ureido group on the biotin molecule, it may thus be a useful carrier for targeting radionuclides to avidin-conjugated antibodies previously localized on tumors. (author)
Method of separating (125I)-L-thyroxine from mixture obtained by radioiodination
International Nuclear Information System (INIS)
Mucha, J.; Talan, P.; Dobias, M.
1982-01-01
( 125 I)-L-thyroxine is separated by gel filtration on a column from the mixture of ( 125 I)-L-thyroxine, ( 125 I)-L-3,5,3'-triiodothyronine and ( 125 I) - . The column is packed with a non-polar gel such as polydextran with particle size 25 to 100 μm. The mixture 1,2-propanediol/distilled water/concentrated (26%) aqueous ammonia solution, or 1,2-propanediol/concentrated (26%) aqueous ammonia solution is used as eluent. The concentration of the eluate containing ( 125 I)-L-thyroxine is adjusted with distilled water such as to establish a 50 vol.% concentration of 1,2-propanediol. (E.S.)
(B1-/sup 125/I-desaminotyrosine)-insulin - A novel homogeneous insulin tracer
Energy Technology Data Exchange (ETDEWEB)
Bahrami, S; Zahn, H; Brandenburg, D [Deutsches Wollforschungsinstitut, Aachen (Germany F.R.); Machulla, H -J; Dutschka, K [Institut fuer Medizinische Strahlenphysik und Strahlenbiologie des Universitaetsklinikum, Essen (Germany F.R.)
1980-10-28
(B1-/sup 125/I-desaminotyrosine)-insulin (/sup 125/I-MII) was prepared with high specific activities (420 Ci/mmole) by exchanging B1-phenylalanine for /sup 125/I-p-hydroxyphenyl-propionic acid N-hydroxysuccinimide ester (Bolton-Hunter reagent). Overall radiochemical yields were about 8%. Analytical quality control and purification were performed by means of radio high pressure liquid chromatography. The radiochemical purity of /sup 125/I-MII was >99%, and the immunoprecipitability was 97%.
Serum level of tumor marker CA-125 in ovarian pathology
International Nuclear Information System (INIS)
Bagni, B.; Feggi, L.M.; Prandini, N.; Pasini, S.; Mollica, G.
1987-01-01
The tumor marker CA-125 is an embrional glycoprotein detectable in tissues derived from celomatic epitelium. Serum Ca-125 was determined by RIA in 66 patients with various ovarian pathologies (16 malignant at stage III-IV and 50 benign). Six patients with ovarian carcinoma were monitored during the first week after surgery and chemiotherapy for a total of 150 days of treatment. It has been observed that CA-125 serum level is consistently above the normal range (>35 U/ml) in all malignant diseases. In benign pathology, levels above the normal were found to be represented almost exclusively by ovarian endometriosis. Furthermore, the results demonstrate that chemiotherapy alone is capable of lowering CA-125 serum levels. This tumor marker may be of great advantage in diagnosis and follow-up of ovarian malignancy
14 CFR 125.507 - Fuel tank system inspection program.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fuel tank system inspection program. 125... Airworthiness and Safety Improvements § 125.507 Fuel tank system inspection program. (a) Except as provided in... fuel tank is installed under a field approval, before June 16, 2008, the certificate holder must submit...
12 CFR 221.125 - Credit to brokers and dealers.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Credit to brokers and dealers. 221.125 Section... SYSTEM CREDIT BY BANKS AND PERSONS OTHER THAN BROKERS OR DEALERS FOR THE PURPOSE OF PURCHASING OR CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.125 Credit to brokers and dealers. (a) The...
Immunoreactivity of 125I-papain labelled by different methods
International Nuclear Information System (INIS)
Rauch, P.; Fukal, L.; Kas, J.; Tykva, R.
1984-01-01
Three different methods of papain iodination (with chloramine-T, lactoperoxidase and conjugation with Bolton-Hunter reagent) have been compared. The highest yield of 125 I-papain could be obtained using lactoperoxidase which enabled to achieve the highest immunoreactivity. 125 I-papain, labelled this way, is suitable for the radioimmunoassay of papain. (author)
Energy Technology Data Exchange (ETDEWEB)
Singh, K; Sahota, H S
1983-01-01
The 2.7 yr beta decay of /sup 125/Sb yields /sup 125/Te has been studied using Ge(Li), Si(Li) and Ge detectors and the directional correlation technique New lines at 58, 111, 642, 693 and 729 keV have been detected and fitted in the decay scheme in the already existing levels, besides the one suggested at 729 keV. The intensities of 20, 109, 111, 116, 172, 178 and 198 keV transitions have been measured more precisely than before. The ..gamma..-..gamma.. directional correlation measurements in the 208-463, 204-176 and 321-176 keV cascades have enabled to assign a uniquue spin 7/2/sup -/ to the 525 keV level. The multipole mixing ratios for the 204, 208 and 321 keV transitions have been found as M1 + (14.75 +- 3.55)%E2, M1 + (4.5 +- 2.0)%E2 and E1 + (2.70 +- 0.75)%M2, respectively.
Distinct DC subsets regulate adaptive Th1 and 2 responses during Trichuris muris infection
DEFF Research Database (Denmark)
Demiri, M.; Müller-Luda, K.; Agace, William Winston
2017-01-01
a high-dose infection and displayed impaired Th2 responses. Conversely, mice lacking IRF8-dependent cDC cleared a low-dose infection and displayed an impaired Th1 response while increased production of Th2 cytokines. Finally, mice lacking both IRF4- and IRF8-dependent cDC were able to generate a Th2...... response and clear a low-dose infection. Collectively, these results suggest that IRF4- and IRF8-dependent cDC act antagonistically during T. muris infection, and demonstrate that intestinal Th2 responses can be generated towards T. muris in the absence of IRF4-dependent cDC.......Low- and high-dose infections with the murine large intestinal nematode Trichuris muris are associated with induction of adaptive Th1 and Th2 responses, respectively, in mesenteric lymph nodes (MLN). Classical dendritic cells (cDC) accumulate in the large intestinal mucosa and MLN upon T. muris...
Inhibition effects of 125I-triplex forming oligonucleotide to hepatoma cells
International Nuclear Information System (INIS)
Lv Zhongwei; Hou Min; Cai Haidong; Yuan Xueyu; Yang Yuehua; Yuan Shidong; He Junmin
2007-01-01
Objective: Triplex forming oligonucleotide (TFO) has been reported as a new antigene strategy. The purpose of this study was to observe the inhibition effects of 125 I-TFO on hepatoma cells and to investigate the possibility of using 125 I-TFO as an antigene radiotherapy technique for hepatocellular carcinoma (HCC) related to HBV. Methods: TFO complementary to the initiator of S gene of HBV was synthesized and labeled with 125 I. HepG2.2.15 cells, in which HBV genome was integrated, were incubated with 125 I-TFO, TFO and 125 I respectively. After incubation, hepatitis B e antigen (HBeAg) and hepatitis B surface antigen (HBsAg) of each group were assayed with ELISA and the survival rate of cells in each group was determined with 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenylte-trazolium bromide (MTT) reduction assay. Results: 125 I-TFO showed a high stability with a radiolabeling rate of >93%. The radiochemical purity of labeled compound was 90.8%, 81.1% and 73.2% respectively after 12, 48 and 72 h at 37 degree C. The peak inhibition effect of 125 I-TFO on synthesizing HBsAg and HBeAg by HepG2.2.15 cells were found at 48 h after transfection, with significantly the highest inhibition rate of 45.2% for HBsAg and 74.5% for HBeAg expression among the three groups(P 125 I-TFO may inhibit the antigen expression of HBV and the growth of hepatocarcinoma cells, thus it may provide a new approach to develop gene-based radiotherapeutic pharmaceuticals for anti-HBV and HCC. (authors)
International Nuclear Information System (INIS)
Barnes, H.L.; Wilkin, R.T.
1995-08-01
This Final Report includes a summary and discussion of results obtained under this project on the solubilities in subcritical aqueous solutions of Mont St. Hilaire analcime, Wikieup analcime, and Castle Creek Na-clinoptilolite. Also included here are the methods and results of hydrothermal flow-through experiments designed to measure the rates of Na-clinoptilolite dissolution and precipitation at 125 degree C. In this report, high-temperature solubility measurements made in our lab are integrated and discussed along with the low-temperature measurements made at Yale University. The final report prepared by the group at Yale University (Lasaga et al.) includes a synthesis of dissolution rate measurements made between 25 degree and 125 degree C on the Na-clinoptilolite
Energy Technology Data Exchange (ETDEWEB)
Kishizawa, G.; Sato, H.; Watanabe, K.
1999-05-01
R-32/125 (difluoromethane/pentafluoroethane) and R-125/143a (pentafluoroethane/1,1,1-trifluoroethane) binary systems are promising alternative refrigerants to replace conventional refrigerants, i.e., R-22 and R-502. The saturated vapor- and liquid-density data in the critical region of these mixtures were measured using the visual observation of the miniscus disappearance in an optical cell. For the R-32/125 system, 35 saturation density data were measured at three compositions, 10, 35, and 50 mass % R-32. Nineteen saturation density data were also measured for R-125/143a (50/50 mass %). The critical temperatures and densities for these binary refrigerants were determined by taking into consideration the level and location of the meniscus disappearance as well as the intensity of the critical opalescence. Correlations to represent the critical loci of these binary refrigerants for an entire range of compositions have been developed. The experimental uncertainties of the saturation density data are estimated to be within 9 mK in temperature and 0.5 to 5.0 kg{center{underscore}dot}m{sup {minus}3} in density. The uncertainties of the critical temperature and density are estimated to be within 12 to 14 mK and 4 to 8 kg{center{underscore}dot}m{sup {minus}3}, respectively.
Preparation of {sup 125}I-labeled monoclonal antibody of bladder neoplasm using lactoperoxidase
Energy Technology Data Exchange (ETDEWEB)
Huaifen, Li; Huisheng, Niu; Mingyue, Yuan; Yongzhi, Huang [Chinese Acaolemy of Medical Sciences, Tianjin (China). Inst. of Radiation Medicine
1994-11-01
{sup 125}I-labelled monoclonal antibody of bladder neoplasm ({sup 125}I-L{sub 4}B{sub 4}) is prepared using lactoperoxidase. The in-vivo radioactive distribution of {sup 125}I-L{sub 4}B{sub 4} in bare mice shows that {sup 125}I-L{sub 4}B{sub 4} concentrates in the tumour.
Auger-electron cascades, charge potential and microdosimetry of iodine-125
Energy Technology Data Exchange (ETDEWEB)
Booz, J.; Pomplun, E.; Olko, P.; Paretzke, H.G.
1987-06-01
This paper is a contribution to the microdosimetry of I-125. It shows microdosimetric spectra of individual and average disintegrations of I-125 for various target sizes and gives evidence for the relative contributions of energy-depositon events of low and high LET. It further presents information on the relative efficiencies of Auger-electrons and multiple charges in terms of local energy deposition, e.g. to model targets of DNA, and discusses their radiobiological implications, e.g. the microdosimetric understanding of the different efficiencies of specific and random incorporations of I-125. When I-125 is specifically incorporated into DNA, most of the energy deposition events are very large, e.g. above 40 keV/..mu..m for a simulated target volume of 20 nm diameter, regardless of the number and energy of Auger electrons emitted. Therefore it is not necessary, for the discussion of the radiobiological implications, to distinguish between different classes of disintegrations. For unspecific, homogeneous incorporation of I-125 somewhere into tissue, about 20% of the dose to critical targets of 25 nm diameter is made up by disintegrations that happen to occur within these targets. When assuming that other critical targets and target structures can be neglected, this part of the dose will be equally effective as in the case of specific incorporation of I-125 into such target models. In addition, there are the normal, low-LET radiation effects from the other, 80% large fraction of the dose. With this information, for the biological systems and end points for which a short section of the elemental chromatine fiber can be taken as the relevant critical target, it is shown that the expected D/sub 37/ value for homogeneous unspecific incorporation of I-125 can be estimated when the D/sub 37/ for specific incorporation in DNA is known.
Iodine-125 Chitosan-Vitamin C complex. Preparation, characterization and application
Energy Technology Data Exchange (ETDEWEB)
Elbarbary, Ahmed M. [National Center for Radiation Research and Technology, Cairo (Egypt). Polymer Chemistry Dept.; Shafik, H.M.; Ebeid, N.H.; Ayoub, S.M. [Atomic Energy Authority, Cairo (Egypt). Hot Lab. Center; Othman, Sameh H. [Atomic Energy Authority, Cairo (Egypt). Nuclear Research Center
2015-07-01
In heterogeneous conditions, water soluble Chitosan-Vitamin C Complex (CSVC) is successfully synthesized via the ionic interaction between γ-degraded CS and VC. Chitosan (CS) of low molecular weight (MW) is prepared using γ-irradiation method. The coupling of CS and vitamin C (VC) is carried out by the chemical treatment of VC with the γ-degraded CS. The formation of CSVC complex instead of physical mixture is confirmed by FT-IR and UV spectrometry. Characterization by transmission electron microscope (TEM) and dynamic light scattering (DLS) shows the formation of a nanostructure in 40 nm range. The preparation of labeled CSVC was performed using chloramines-T oxidation method. The labeling feasibility of CSVC nanostructure by Iodine-125 ({sup 125}I) is investigated. The optimized conditions of labeling are thought to be 50 μg of oxidizing agent, pH 3, and one minute reaction time. The Biodistribution activity of {sup 125}I radiolabeled CSVC nanostructure ({sup 125}I-CSVC) is examined on a group of different ascites tumor bearing mice. Calculation of the biodistribution percentages shows that the tumor, liver, and kidney are the targeting organs of {sup 125}I-CSVC nanostructure.
Iodine-125 Chitosan-Vitamin C complex. Preparation, characterization and application
International Nuclear Information System (INIS)
Elbarbary, Ahmed M.; Shafik, H.M.; Ebeid, N.H.; Ayoub, S.M.; Othman, Sameh H.
2015-01-01
In heterogeneous conditions, water soluble Chitosan-Vitamin C Complex (CSVC) is successfully synthesized via the ionic interaction between γ-degraded CS and VC. Chitosan (CS) of low molecular weight (MW) is prepared using γ-irradiation method. The coupling of CS and vitamin C (VC) is carried out by the chemical treatment of VC with the γ-degraded CS. The formation of CSVC complex instead of physical mixture is confirmed by FT-IR and UV spectrometry. Characterization by transmission electron microscope (TEM) and dynamic light scattering (DLS) shows the formation of a nanostructure in 40 nm range. The preparation of labeled CSVC was performed using chloramines-T oxidation method. The labeling feasibility of CSVC nanostructure by Iodine-125 ( 125 I) is investigated. The optimized conditions of labeling are thought to be 50 μg of oxidizing agent, pH 3, and one minute reaction time. The Biodistribution activity of 125 I radiolabeled CSVC nanostructure ( 125 I-CSVC) is examined on a group of different ascites tumor bearing mice. Calculation of the biodistribution percentages shows that the tumor, liver, and kidney are the targeting organs of 125 I-CSVC nanostructure.
The Th17 Lineage: From Barrier Surfaces Homeostasis to Autoimmunity, Cancer, and HIV-1 Pathogenesis.
Wacleche, Vanessa Sue; Landay, Alan; Routy, Jean-Pierre; Ancuta, Petronela
2017-10-19
The T helper 17 (Th17) cells represent a subset of CD4+ T-cells with unique effector functions, developmental plasticity, and stem-cell features. Th17 cells bridge innate and adaptive immunity against fungal and bacterial infections at skin and mucosal barrier surfaces. Although Th17 cells have been extensively studied in the context of autoimmunity, their role in various other pathologies is underexplored and remains an area of open investigation. This review summarizes the history of Th17 cell discovery and the current knowledge relative to the beneficial role of Th17 cells in maintaining mucosal immunity homeostasis. We further discuss the concept of Th17 pathogenicity in the context of autoimmunity, cancer, and HIV infection, and we review the most recent discoveries on molecular mechanisms regulating HIV replication/persistence in pathogenic Th17 cells. Finally, we stress the need for novel fundamental research discovery-based Th17-specific therapeutic interventions to treat pathogenic conditions associated with Th17 abnormalities, including HIV infection.
Application of 125I seed permanent plantation in osseous metastases
International Nuclear Information System (INIS)
Zhang Fujun; Wu Peihong; Lu Mingjian; Li Kui; Zhang Liang; Huang Jinhua; Fan Weijun; Zhao Ming; Gu Yangkui; Liu Jian; Wang Junjie
2007-01-01
Objective: To evaluate the value of 125 I permanent plantation in treating osseous metastases. Methods: Twenty-two patients with osseous metastases were accepted radioactive seeds 125 I permanent plantation. The curative effect was appraised according to the degree of ostalgia relieving and the changing of the radiology imaging in patients. Results: Accepted radioactive seeds 125 I permanent plantation, relief of pain was obtained and the effective rate is 91% (20/22). However none of the patients showed severe side-effect. Among 32 lesions in 22 cases followed-up by CT in 2 months, 4 obtained CR, 18 obtained PR, 10 NC and 0 PD. The responsive rate was 68.7%. Conclusion: 125 I permanent plantation procedure can be a safe and effective method in treating osseous metastases and obtaining good clinical effects with minimal damage and few complications. (authors)
Variation in 125I-Insulin absorption and blood glucose concentration
International Nuclear Information System (INIS)
Lauritzen, T.; Faber, O.K.; Binder, C.
1979-01-01
The absorption of monocomponent porcine 125 I-insulin Monotard and Isophane was studied in six insulin dependent diabetic patients over a period of 12 days. The absorption of insulin was measured as the disappearance of radioactivity from sites of injection. The daily 125 I-insulin doses ranged from 20 to 48 IU between patients. The insulin absorbed varied considerably within and between patients. The range of individual daily absorbed insulin varied from 19 to 104 per cent of the 125 I-insulin dose. A significant correlation (p [de
miR-125/Pokemon auto-circuit contributes to the progression of hepatocellular carcinoma.
Kong, Jing; Liu, Xiaoping; Li, Xiangqian; Wu, Jinsheng; Wu, Ning; Chen, Jun; Fang, Fang
2016-01-01
Hepatocellular carcinoma (HCC) is a type of human malignant tumor occurring in hepatic tissues with high mortality. Patients benefit little from current therapeutic modalities, at least partially due to the lack of complete elucidation of molecular network regulating HCC. miR-125 and Pokemon are well-recognized tumor suppressor and oncogenes for HCC, respectively. However, the underlying mechanism by which the two genes exert their functions and the relationship between miR-125 and Pokemon is still unexplored yet. In this study, we found that there is an inverse association between miR-125 and Pokemon expression levels in HCC specimen and cell lines. Online database mining indicated that there are three putative mRNA recognition elements (MREs) of miR-125 within 3' untranslated region (3'UTR) of Pokemon. MREs of miR-125 confer the expression of luciferase with a miR-125-dependent fashion. The alteration in miR-125 abundance regulates the expression of Pokemon at both protein and mRNA levels. Overexpression of Pokemon is able to abrogate the inhibitory effect of miR-125 on HCC progression. Further study showed that Pokemon inhibits the expression of miR-125 by binding of recognition sites within its promoter. In conclusion, we found that there is an auto-regulatory circuit consisting of miR-125 and Pokemon, which promotes the progression of HCC and may be a promising therapeutic target in clinical HCC treatment.
32 CFR 935.125 - Citation in place of arrest.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Citation in place of arrest. 935.125 Section 935... INSULAR REGULATIONS WAKE ISLAND CODE Peace Officers § 935.125 Citation in place of arrest. In any case in which a peace officer may make an arrest without a warrant, he may issue and serve a citation if he...
Enzymatic labelling of. gamma. -globulin and insulin with iodine-125
Energy Technology Data Exchange (ETDEWEB)
Lucka, B; Russin, K [Institute of Nuclear Physics, Krakow (Poland)
1979-01-01
The parameters of enzymatic labelling of proteins with iodine 125 were examined. The manner and sequence of reagent addition, the effects of reagent concentration, reaction time and total Na/sup 125/I activity on the labelling yield were determined.
Preparation of 125I FSH hormone
International Nuclear Information System (INIS)
Castro de Sabbatini, D.; Nieto de Nunez, G.; Mitta, A.E.A.
1976-01-01
Labelling of human FSH of pituitary origin with 125 I and its purification are described. Suitable parameters are selected for the use of radioimmunologic technique for FSH dosage in human serum. (author) [es
Directory of Open Access Journals (Sweden)
Sardinata
2013-04-01
Full Text Available Caudal blockage is the most frequently used regional anestesia technique in pediatric surgery. Various local anesthetic agents have been frequently used in this technique. Bupivacaine is one of the most used local anesthetics due to its long duration of action. Dexmedetomidin is an α2agonist that is used as adjuvant in lengthening bupivacaine duration when it is administered via caudal blockage. In increasing its effectiveness, the combination of bupivacaine with dexmedetomidin in low concentrationd and low dose can be given. This study was performed to assess the postoperative analgesia duration using caudal blockage between the combined 0.125% bupivacaine-1µg/Kg BW dexmedetomidin and 0.125% bupivacaine solely in pediatric patients having hypospadic surgery. The study was applied to 30 pediatric patients with ASA I and II physical status, and aged 1-6 years that received hypospadic surgery with general anesthesia, to whom caudal blockage applied postoperatively. The patients were divided into two groups. One group (BD group was treated using the combined 0.125% bupivacaine-1 µg/Kg BW dexmedetomidin (0.5 cc/kg BW, the other group (B group was treated with 0.125% bupivacaine (0.5 cc/kb BW as control group. Postoperative analgesia duration was recorded. The data of the study results were assessed using Mann-Whitney test. Postoperative analgesia duration of BD group (863.0 [36.34] minutes was very significantly (p<0.001 longer than that in B group (378.08 [37.87] minutes. The conclusion of this study indicated that the use of combined 0.125% bupivacaine-1 µg/Kg BW dexmedetomidin for caudal blockage as analgetic agent after hypospadic surgery resulted longer analgesia duration than that of 0.125% bupivacaine solely
MicroRNA miR-125b induces senescence in human melanoma cells.
Glud, Martin; Manfé, Valentina; Biskup, Edyta; Holst, Line; Dirksen, Anne Marie Ahlburg; Hastrup, Nina; Nielsen, Finn C; Drzewiecki, Krzysztof T; Gniadecki, Robert
2011-06-01
MicroRNAs (miRNAs) are small noncoding RNA molecules involved in gene regulation. Aberrant expression of miRNA has been associated with the development or progression of several diseases, including cancer. In a previous study, we found that the expression of miRNA-125b (miR-125b) was two-fold lower in malignant melanoma producing lymph node micrometastases than in nonmetastasizing tumors. To get further insight into the functional role of miR-125b, we assessed whether its overexpression or silencing affects apoptosis, proliferation, or senescence in melanoma cell lines. We showed that overexpression of miR-125b induced typical senescent cell morphology, including increased cytoplasmatic/nucleus ratio and intensive cytoplasmatic β-galactosidase expression. In contrast, inhibition of miR-125b resulted in 30-35% decreased levels of spontaneous apoptosis. We propose that downregulation of miR-125b in an early cutaneous malignant melanoma can contribute to the increased metastatic capability of this tumor.
Cytotoxicity of an 125I-labelled DNA ligand
International Nuclear Information System (INIS)
Karagiannis, T.C.; Lobachevsky, P.N.; Martin, R.F.
2000-01-01
The subcellular distribution and cytotoxicity of a DNA-binding ligand [ 125 I]-Hoechst 33258 following incubation of K562 cells with the drug was investigated. The ability of a radical scavenger, dimethyl sulphoxide, to protect cells from the 125 I-decay induced cell death was also studied. Three different concentrations and specific activities of the drug were used to provide different ligand : DNA binding ratios. The results demonstrated a trend toward improved delivery of the ligand to the nucleus and to chromatin at higher ligand concentrations, with concomitant increased sensitivity to 125 I-decay induced cytotoxicity and decreased protection by dimethyl sulphoxide. This correlation of radiobiological parameters with subcellular drug distribution is consistent with the classical dogma that attributes cytotoxicity to DNA double-stranded breakage in the vicinity of the site of decay, where the high LET nature of the damage confers minimal sensitivity to radical scavenging
Directory of Open Access Journals (Sweden)
Hartiningsih .
2013-07-01
Full Text Available The objective of this research was to study the correlation of panhisterectomy and supplement 1.25-dihydroxyvitamin D3 on urolithiasis risk in Wistar rats. Twenty female Wistar rats at 8 weeks of age, weredivided into four groups (control fed standard diet, control fed standard diet+1,25-dihydroxyvitamin D3 supplement, panhisterectomy fed standard diet and panhisterectomy fed standard diet +1,25-dihydroxyvitamin D3 supplement. Eleven weeks after treatment, each of rats was placed into individualmetabolic cage for balance study for a week. From day 4 to 11 of the balance study, every morning theremaining food, feces, and urine were collected and recorded for calcium (Ca analysis. At the end ofbalance study, blood samples were taken from canthus retroorbitalis medialis for estrogen analysis. Theresults showed urinary and fecal Ca excretions were not significantly different compared to the controlgroup. Calcium consumption was significantly higher (P<0.05 in panhisterectomized rats compared withthose in control rats. While, estrogen in panhisterectomized group was not significantly different to thosein control rats. Calcium urinary and Ca consumption in rats consuming 1,25-dihydroxyvitamin D3 supplement were significantly higher (P<0.05 compared with those in without 1,25-dihydroxyvitamin D3 supplementation, but Ca excretion in feses was not significantly different. Estrogen in rats consuming1.25-dihydroxyvitamin D3 supplement was significantly lower (P<0.05 compared with the rats that without1,25-dihydroxyvitamin D3 supplemention. It can be concluded that panhisterectomy does not seem to affecturolithiasis risk, while 1,25-dihydroxyvitamin D3 supplement may affect urolithiasis risk. There is likelyno association between panhisterectomy and 1.25-dihydroxyvitamin D3 supplementation on urolithiasisrisk in Wistar rats.
36th International Pyrotechnics Seminar 2009 in Rotterdam - Editorial
Klerk, W.P.C. de; Lingen, J.L. van
2010-01-01
From August 23 to 28, 2009, TNO Defence, Security and Safety organized the 36th IPS Congress in De Doelen in Rotterdam. The program consisted of 4 days of scientific presentations, a tour of the ports of Rotterdam and a final tour at TNO Defence, Security and Safety in Rijswijk and Ypenburg. The
238U-230Th dating of chevkinite in high-silica rhyolites from La Primavera and Yellowstone calderas
Vazquez, Jorge A.; Velasco, Noel O.; Schmitt, Axel K.; Bleick, Heather A.; Stelten, Mark E.
2014-01-01
Application of 238U-230Th disequilibrium dating of accessory minerals with contrasting stabilities and compositions can provide a unique perspective on magmatic evolution by placing the thermochemical evolution of magma within the framework of absolute time. Chevkinite, a Th-rich accessory mineral that occurs in peralkaline and metaluminous rhyolites, may be particularly useful as a chronometer of crystallization and differentiation because its composition may reflect the chemical changes of its host melt. Ion microprobe 128U-230Th dating of single chevkinite microphenocrysts from pre- and post-caldera La Primavera, Mexico, rhyolites yields model crystallization ages that are within 10's of k.y. of their corresponding K-Ar ages of ca. 125 ka to 85 ka, while chevkinite microphenocrysts from a post-caldera Yellowstone, USA, rhyolite yield a range of ages from ca. 110 ka to 250 ka, which is indistinguishable from the age distribution of coexisting zircon. Internal chevkinite-zircon isochrons from La Primavera yield Pleistocene ages with ~5% precision due to the nearly two order difference in Th/U between both minerals. Coupling chevkinite 238U-230Th ages and compositional analyses reveals a secular trend of Th/U and rare earth elements recorded in Yellowstone rhyolite, likely reflecting progressive compositional evolution of host magma. The relatively short timescale between chevkinite-zircon crystallization and eruption suggests that crystal-poor rhyolites at La Primavera were erupted shortly after differentiation and/or reheating. These results indicate that 238U-230Th dating of chevkinite via ion microprobe analysis may be used to date crystallization and chemical evolution of silicic magmas.
NH125 kills methicillin-resistant Staphylococcus aureus persisters by lipid bilayer disruption.
Kim, Wooseong; Fricke, Nico; Conery, Annie L; Fuchs, Beth Burgwyn; Rajamuthiah, Rajmohan; Jayamani, Elamparithi; Vlahovska, Petia M; Ausubel, Frederick M; Mylonakis, Eleftherios
2016-01-01
NH125, a known WalK inhibitor kills MRSA persisters. However, its precise mode of action is still unknown. The mode of action of NH125 was investigated by comparing its spectrum of antimicrobial activity and its effects on membrane permeability and giant unilamellar vesicles (GUVs) with walrycin B, a WalR inhibitor and benzyldimethylhexadecylammonium chloride (16-BAC), a cationic surfactant. NH125 killed persister cells of a variety of Staphylococcus aureus strains. Similar to 16-BAC, NH125 killed MRSA persisters by inducing rapid membrane permeabilization and caused the rupture of GUVs, whereas walrycin B did not kill MRSA persisters or induce membrane permeabilization and did not affect GUVs. NH125 kills MRSA persisters by interacting with and disrupting membranes in a detergent-like manner.
Study on agroecology contamination from 125I gas and control measures in a simulated ecosystem
International Nuclear Information System (INIS)
Zhao Wenhu; Li Chuanzhao; Xu Shiming; Hou Lanxin; Shang Zhaorong; Li Xia
1995-09-01
The study was made in an air-tight space in which a simulated agricultural ecosystem was contaminated from 125 I gas. The contents of the study were summarized as follows: The space and time distribution of 125 I gas, contamination of foliage of the plants, accumulation and transfer of 125 I fallen on the soil and entered into the plants from the roots of crops and vegetables, the time distribution of 125 I in crops in water contaminated from 125 I fallout, distribution, accumulation and transfer of 125 I in chickens and rabbits which inhaled 125 I gas or fed the fodder contaminated from 125 I. The control measures of contamination in agroenvironment from 125 I were discussed. (7 refs., 20 figs., 29 tabs.)
Energy Technology Data Exchange (ETDEWEB)
Upadhyay, Santosh Kumar; Verone, Alissa; Shoemaker, Suzanne [Department of Pharmacology and Therapeutics, Roswell Park Cancer Institute, Elm and Carlton Streets, Buffalo, NY 14263 (United States); Qin, Maochun; Liu, Song [Department of Biostatistics and Bioinformatics, Roswell Park Cancer Institute, Elm and Carlton Streets, Buffalo, NY 14263 (United States); Campbell, Moray; Hershberger, Pamela A., E-mail: pamela.hershberger@roswellpark.org [Department of Pharmacology and Therapeutics, Roswell Park Cancer Institute, Elm and Carlton Streets, Buffalo, NY 14263 (United States)
2013-11-08
1,25-dihydroxyvitamin D{sub 3} (1,25(OH){sub 2}D{sub 3}) exerts anti-proliferative activity by binding to the vitamin D receptor (VDR) and regulating gene expression. We previously reported that non-small cell lung cancer (NSCLC) cells which harbor epidermal growth factor receptor (EGFR) mutations display elevated VDR expression (VDR{sup high}) and are vitamin D-sensitive. Conversely, those with K-ras mutations are VDR{sup low} and vitamin D-refractory. Because EGFR mutations are found predominately in NSCLC cells with an epithelial phenotype and K-ras mutations are more common in cells with a mesenchymal phenotype, we investigated the relationship between vitamin D signaling capacity and the epithelial mesenchymal transition (EMT). Using NSCLC cell lines and publically available lung cancer cell line microarray data, we identified a relationship between VDR expression, 1,25(OH){sub 2}D{sub 3} sensitivity, and EMT phenotype. Further, we discovered that 1,25(OH){sub 2}D{sub 3} induces E-cadherin and decreases EMT-related molecules SNAIL, ZEB1, and vimentin in NSCLC cells. 1,25(OH){sub 2}D{sub 3}-mediated changes in gene expression are associated with a significant decrease in cell migration and maintenance of epithelial morphology. These data indicate that 1,25(OH){sub 2}D{sub 3} opposes EMT in NSCLC cells. Because EMT is associated with increased migration, invasion, and chemoresistance, our data imply that 1,25(OH){sub 2}D{sub 3} may prevent lung cancer progression in a molecularly defined subset of NSCLC patients.
Comparative study on biodistribution of domestic and imported 125I-β-CIT
International Nuclear Information System (INIS)
Liu Xingdang; Lin Xiangtong; Fang Ping; Chen Zhengping; Zhou Xiang; Wang Bocheng; Zhang Manda
2003-01-01
Objective: To characterize the kinetics and biodistribution of a domestically synthesized 125 I-2β-carbomethoxy-3β-4-iodopheny1tropane (β-CIT ) and to compare it with that of 125 I-β-CIT imported from RBI company. Methods: 1)The biodistribution of domestic and RBI company produced 125 I-β-CIT in KM mice. Twenty groups of mice (group of 5) were injected into the tail vein with either one of 125 I-β-CIT products. Each group of both products was killed at 5,15,30 and 45 min, and 1, 2, 4, 6, 8 and 24 h. 2)Autoradiography was performed on the brain of SD rats at 2 h after injection. Results: Domestic 125 I-β-CIT was primarily uptaked in the striatum, also in areas rich in 5-HTT such as the brain stem, frontal cortex, parietal cortex, temporal cortex, occipital cortex and hippocampus. Striatal uptake peaked at 2 h postinjection of 125 I-β-CIT. The ratio of specific to nonspecific binding in striatum peaked at 6 h. The highest radioactivity was in the lungs and the less radioactivity was in the liver, kidney, spleen and intestine. Autoradiography confirmed that 125 I-β-CIT primarily bound to striatum and lower room temperature significantly reduced the binding of the agent. Conclusion: The domestic 125 I-β-CIT binds primarily to dopamine transporters in the striatum in mice and rats and the maximum uptake is in the lungs
International Nuclear Information System (INIS)
Lin Yansong; Fang Ping; Ding Shiyu; Chen Zhengping; Zhou Xiang; Hu Mingyang; Wang Bocheng; Zhang Manda; Wang Shizhen
2001-01-01
Objective: To explore the variation of cerebral dopamine (DA) transmitting system in morphine dependent (MD) rats using dopamine transporter (DAT) and D 2 receptors imaging agent. Methods: MD model rats were established by using a two-compartment (C1 and C2-morphine conditioned compartment) apparatus for assessing morphine conditioned place preferences in rats. 125 I-2β-carbomethoxy-3β-(4-iodophenyl) tropane ( 125 I-β-CIT) and 125 I-3-iodo-2-hydroxy-6-methoxy-N[(1-ethyl-2-pyrrolidinyl) methyl] benzamide ( 125 I-IBZM) cerebral DAT and D 2 receptor autoradiography and biodistribution study were used to evaluate the variation of DAT and D 2 receptors in morphine dependent rats. Results: The mean time of MD rats entering from C1 to C2 was (0.84 +- 0.50) min after 6 days' conditioned place preference training, shorter than that of the control group [(2.40 +- 1.10) min, P 125 I-β-CIT uptake ratio of striatum (ST)/cerebellum (CB) and nucleus acumens (NAC)/CB in MD group were 4.76 +- 0.92 and 2.72 +- 0.96, significantly lower than that of control group (5.92 +- 0.67 and 4.16 +- 0.56, P 125 I-IBZM uptake ratio in MD group were 4.11 +- 0.56 and 2.64 +- 0.25, lower than that in control group (5.43 +- 0.74 and 3.49 +- 0.65, P 125 I-β-CIT, 125 I-IBZM biodistribution study also showed that the DAT and D 2 binding sites were reduced in ST of MD group by (21.68 +- 11.11)% and (18.69 +- 9.97)% comparing to the controls, respectively. Conclusions: The DAT and D 2 receptors in both ST and NAC were all involved and reduced to some extent in morphine dependent model rats, the DAT and D 2 receptor imaging agent could reflect the variation of DAT and D 2 receptors, this would afford the theoretical basis for D 2 receptors and DAT imaging in study on preventing drug addiction and on its abstinence
(125I)Iodoazidococaine, a photoaffinity label for the haloperidol-sensitive sigma receptor
International Nuclear Information System (INIS)
Kahoun, J.R.; Ruoho, A.E.
1992-01-01
A carrier-free radioiodinated cocaine photoaffinity label, (-)-3-( 125 I)iodo-4-azidococaine [( 125 I)IACoc], has been synthesized and used as a probe for cocaine-binding proteins. Photoaffinity labeling with 0.5 nM ( 125 I)IACoc resulted in selective derivatization of a 26-kDa polypeptide with the pharmacology of a sigma receptor in membranes derived from whole rat brain, rat liver, and human placenta. ( 125 I)IACoc labeling of the 26-kDa polypeptide was also inhibited by 10 μM imipramine, amitriptyline, fluoxetine, benztropine, and tetrabenazine. The size of the ( 125 I)I-ACoc-labeled proteins is consistent with the size of proteins photolabeled in guinea pig brain and liver membranes by using the sigma photolabel azido-[ 3 H]DTG. Kinetic analysis of ( 125 I)IACoc binding to rat liver microsomes revealed two sites with K d values of 19 and 126 pM, respectively. The presence or absence of proteolytic inhibitors during membrane preparation did not alter the size of the photolabeled sigma receptor, indicating that the 26-kDa polypeptide was not derived from a larger protein. In summary, ( 125 I)IACoc is a potent and highly specific photoaffinity label for the haloperidol-sensitive sigma receptor and will be useful for its biochemical and molecular characterization
Iodine-125-labelled tamoxifen is differentially cytoxic to cells containing oestrogen receptors
International Nuclear Information System (INIS)
Bloomer, W.D.; McLaughlin, W.H.; Weichselbaum, R.R.
1980-01-01
Tamoxifen, a non-steroidal anti-oestrogen competes with 17 - oestradiol for oestrogen receptor protein and is translocated to the nucleus. Carrier-free 125 I-TAM was tested for cytotoxicity in oestrogen receptor rich (human breast cancer MCF-7) and poor (V-79 Chinese hamster) cells. 125 I-TAM was differentially cytotoxic to MCF-7 cells. The D 37 values for MCF-7 and V-79 cells were 0.5 and 1.5 pCi/cell respectively. No radiotoxicity was observed with Na 125 I at doses equal to 125 I-TAM; iodide was effectively excluded from both cell lines and remained in the extracellular space. Also, nonradioactive 127 I-TAM and TAM were both non-toxic when tested at levels comparable to 125 I-TAM. It is suggested that the marked cytotoxicity in MCF-7 cells results from close approximation of 125 I with the genetic apparatus as a result of direct charging of specific nuclear receptors and/or translocation of 125 I-TAM receptor complexes from the cytoplasm to the nucleus, and that the minimal toxicity in V-79 cells reflects transmitted cytoplasmic radiation effects, limited direct nuclear charging and/or limited nuclear translocation resulting from the relative paucity of oestrogen in the cells. (U.K.)
Ross, Pádraig J.; Allen, Aideen C.; Walsh, Kevin; Misiak, Alicja; Lavelle, Ed C.; McLoughlin, Rachel M.; Mills, Kingston H. G.
2013-01-01
Whooping cough caused by Bordetella pertussis is a re-emerging infectious disease despite the introduction of safer acellular pertussis vaccines (Pa). One explanation for this is that Pa are less protective than the more reactogenic whole cell pertussis vaccines (Pw) that they replaced. Although Pa induce potent antibody responses, and protection has been found to be associated with high concentrations of circulating IgG against vaccine antigens, it has not been firmly established that host protection induced with this vaccine is mediated solely by humoral immunity. The aim of this study was to examine the relative contribution of Th1 and Th17 cells in host immunity to infection with B. pertussis and in immunity induced by immunization with Pw and Pa and to use this information to help rationally design a more effective Pa. Our findings demonstrate that Th1 and Th17 both function in protective immunity induced by infection with B. pertussis or immunization with Pw. In contrast, a current licensed Pa, administered with alum as the adjuvant, induced Th2 and Th17 cells, but weak Th1 responses. We found that IL-1 signalling played a central role in protective immunity induced with alum-adsorbed Pa and this was associated with the induction of Th17 cells. Pa generated strong antibody and Th2 responses, but was fully protective in IL-4-defective mice, suggesting that Th2 cells were dispensable. In contrast, Pa failed to confer protective immunity in IL-17A-defective mice. Bacterial clearance mediated by Pa-induced Th17 cells was associated with cell recruitment to the lungs after challenge. Finally, protective immunity induced by an experimental Pa could be enhanced by substituting alum with a TLR agonist that induces Th1 cells. Our findings demonstrate that alum promotes protective immunity through IL-1β-induced IL-17A production, but also reveal that optimum protection against B. pertussis requires induction of Th1, but not Th2 cells. PMID:23592988
40 CFR 52.125 - Control strategy and regulations: Sulfur oxides.
2010-07-01
... to existing fuel burning equipment producing electrical energy will provide for the attainment and...: Sulfur oxides. 52.125 Section 52.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... since the control strategy does not analyze the impact of smelter fugitive emissions on ambient air...
Acute exposure to Iodine-125: a case study
Energy Technology Data Exchange (ETDEWEB)
Kol, R; Canfi, A; Dukhan, N; Pelled, O; Brikner, D; Laichter, Y; Gold, B [Israel Atomic Energy Commission, Beersheba (Israel). Nuclear Research Center-Negev
1996-12-01
Radioiodines I-125 and I-131 are extremely volatile even in the form of the relatively stable Iodine anion. This property renders frequent airborne contamination and sometimes accidental inhalation of the radioiodine by personnel heavily involved with it`s handling. In order to detect radioiodine contamination as early as possible, the laboratory and its surroundings are constantly air monitored, surfaces are monitored according to a predetermined regime and personnel is being checked upon completion of a job or upon leaving the laboratory. Follow-up, routine or in special occasions, is performed by health-physics personnel who reports to the radiation medicine department. We report here the measures and means used to monitor a case of an accidental inhalation of I-125 due to an externally contaminated NaI[I-125] commercial package. The monitoring of the contamination is described, the dose to the thyroid and the Committed Effective Dose Equivalent (CEDE) are reported, and the medical evaluation is presented (authors).
Gidwani, Kamlesh; Huhtinen, Kaisa; Kekki, Henna; van Vliet, Sandra; Hynninen, Johanna; Koivuviita, Niina; Perheentupa, Antti; Poutanen, Matti; Auranen, Annika; Grenman, Seija; Lamminmäki, Urpo; Carpen, Olli; van Kooyk, Yvette; Pettersson, Kim
2016-10-01
Measurement of serum cancer antigen 125 (CA125) is the standard approach for epithelial ovarian cancer (EOC) diagnostics and follow-up. However, the clinical specificity is not optimal because increased values are also detected in healthy controls and in benign diseases. CA125 is known to be differentially glycosylated in EOC, potentially offering a way to construct CA125 assays with improved cancer specificity. Our goal was to identify carbohydrate-reactive lectins for discriminating between CA125 originating from EOC and noncancerous sources. CA125 from the OVCAR-3 cancer cell line, placental homogenate, and ascites fluid from patients with cirrhosis were captured on anti-CA125 antibody immobilized on microtitration wells. A panel of lectins, each coated onto fluorescent europium-chelate-doped 97-nm nanoparticles (Eu(+3)-NPs), was tested for detection of the immobilized CA125. Serum samples from high-grade serous EOC or patients with endometriosis and healthy controls were analyzed. By using macrophage galactose-type lectin (MGL)-coated Eu(+3)-NPs, an analytically sensitive CA125 assay (CA125(MGL)) was achieved that specifically recognized the CA125 isoform produced by EOC, whereas the recognition of CA125 from nonmalignant conditions was reduced. Serum CA125(MGL) measurement better discriminated patients with EOC from endometriosis compared to conventional immunoassay. The discrimination was particularly improved for marginally increased CA125 values and for earlier detection of EOC progression. The new CA125(MGL) assay concept could help reduce the false-positive rates of conventional CA125 immunoassays. The improved analytical specificity of this test approach is dependent on a discriminating lectin immobilized in large numbers on Eu(+3)-NPs, providing both an avidity effect and signal amplification. © 2016 American Association for Clinical Chemistry.
A study of thyroid contaminations with 125I and of their blocking
International Nuclear Information System (INIS)
Ribela, Maria Teresa de Carvalho Pinto
1996-01-01
) and urine radioactivity 4 to 6 hours (U-4, U-5, U-6) after contamination (r = 0.974 with a level of significance p T-48 = 0.790 X U-4 + 2.973. An analogous study, carried out in humans to which was administered, presented a similar correlation and level of significance : Y T-24 = 1.162 X U-4 + 3.263 (r = 0.9265; p 125 I or 131 I, showing a good agreement between measured and extrapolated thyroid uptake, with a mean difference of less than 10%. Three different blocking agents were tested : potassium iodide and perchlorate and tapazol. The first two compounds presented a blocking action of about 90% while the third of 24% only. Potassium iodide was chosen due to its limited side effects and a final study, carried out with different doses, indicated that 25 mg of KI should be the ideal amount to be administered to the dog. This corresponds to an extrapolated amount of approximately 100 mg for a 70 kg human, the same being recommended by various authors. (author)
IL-4 enhances IL-10 production in Th1 cells: implications for Th1 and Th2 regulation.
Mitchell, Ruth E; Hassan, Masriana; Burton, Bronwen R; Britton, Graham; Hill, Elaine V; Verhagen, Johan; Wraith, David C
2017-09-12
IL-10 is an immunomodulatory cytokine with a critical role in limiting inflammation in immune-mediated pathologies. The mechanisms leading to IL-10 expression by CD4 + T cells are being elucidated, with several cytokines implicated. We explored the effect of IL-4 on the natural phenomenon of IL-10 production by a chronically stimulated antigen-specific population of differentiated Th1 cells. In vitro, IL-4 blockade inhibited while addition of exogenous IL-4 to Th1 cultures enhanced IL-10 production. In the in vivo setting of peptide immunotherapy leading to a chronically stimulated Th1 phenotype, lack of IL-4Rα inhibited the induction of IL-10. Exploring the interplay of Th1 and Th2 cells through co-culture, Th2-derived IL-4 promoted IL-10 expression by Th1 cultures, reducing their pathogenicity in vivo. Co-culture led to upregulated c-Maf expression with no decrease in the proportion of T-bet + cells in these cultures. Addition of IL-4 also reduced the encephalitogenic capacity of Th1 cultures. These data demonstrate that IL-4 contributes to IL-10 production and that Th2 cells modulate Th1 cultures towards a self-regulatory phenotype, contributing to the cross-regulation of Th1 and Th2 cells. These findings are important in the context of Th1 driven diseases since they reveal how the Th1 phenotype and function can be modulated by IL-4.
Energy Technology Data Exchange (ETDEWEB)
Linsalata, P
1988-07-01
This report consists of three parts. Part 1 discusses a field study conducted in an area of enhanced, natural radioactivity to assess the soil to edible vegetable concentration ratios (CR = concentration in dry vegetable/concentration in dry soil) of Th-232, Th-230, Ra-226, Ra-228, and the light rare earth elements (REE's), La, Ce, and Nd. Twenty-eight soil, and approximately 42 vegetable samples consisting of relatively equal numbers of seven varieties, were obtained from 11 farms on the Pocos de Caldas Plateau in the state of Minas Gerais, Brazil. This region is the site of a major natural analogue study to assess the mobilization and retardation processes affecting thorium and the REE's at the Morro do Ferro ore body, and uranium series radionuclides at the Osamu Utsumi open pit uranium mine. Thorium (IV) serves as a chemical analogue for quadrivalent plutonium, the light REE's (III) as chemical analogues for trivalent americium and curium, and uranium (VI) as an analogue for transuranics with stable oxidation states above IV, e.g., Pu(VI). Part 2 includes our final measurement results for naturally occurring light rare earth elements (REE's include La, Ce, Nd, and SM), U-series and Th-series radionuclides in adult farm animal tissues, feeds and soils. Our findings on soil-to-tissue concentration ratios (CR's) and the comparative behavior of these elements in farm animals raised under natural conditions by local farmers are presented. Part 3 summarizes our findings to date on the distribution and mobilization of Th-232, light rare earth elements (LREE), U-238 and Ra-228 in the MF basin. Estimates of first order, present day, mobilization rate constants resulting from ground water solubilization and seepage/stream transport are calculated using revised inventory estimates for the occurrence of these elements in the ore body and annual flux estimates for the transport of these elements away from the ore body. 151 refs., 20 figs., 40 tabs.
Experimental study on the killing effects of 125IUdR to human glioma cells in vitro
International Nuclear Information System (INIS)
Li Jinquan; Bao Yaodong; Zhou Dai; Cui Gang; Wang Bocheng; Jiang Yimin; Wang Haiqiu; Wu Yiwei
2001-01-01
The 125 IUdR-uptake profile and the cytocidal effects of 125 IUdR on human cerebral glioma (SHG44) cells were estimated after incubation with 125 IUdR. The killing effects of 125 IUdR comparing with Na 125 I on SHG44 were estimated by colony forming method. The results showed that the amounts of 125 IUdR uptake by SHG44 were growing with the rate of dose of 125 IUdR in the medium, relation factor r = 0.9917. Also the concentration of 125 IUdR uptake by SHG44 was time-dependent, relation factor r = 0.9859. As the concentration in SHG44 growing, the inhibition effects became stronger, relation factor r = - 0.9736. The LD 50 was 8.7 +- 0.12 kBq/ml. The concentration of radioactivity ingestion was significantly stronger in 125 IUdR group than that in Na 125 I group. The surviving fraction was significantly different between in the 125 IUdR group and in Na 125 I group at the concentration point 9.0 kBq/ml. 125 IUdR may be incorporated in SHG44 cell, and the concentration of 125 IUdR ingestion by SHG44 was influenced with the dose in the medium and the culturing time. The prohibitive effects of 125 IUdR on SHG44 cell were obvious. The prohibition effects were significantly stronger in 125 IUdR group than that in Na 125 I group. 125 IUdR may be a kind of potential drug in the therapy of human cerebral glioma
Permanent interstitial implantation of 125Iodine seed for thoracic malignant tumors
International Nuclear Information System (INIS)
Xu Zhongheng; Qian Yongyue; Wu Jinchang; Liu Zengli
2002-01-01
Objective: To observe effect of 125 Iodine sed on interstitial brachytherapy of patient with thoracic malignant tumor. Methods: 125 Iodine seed were inserted into the target tissue and permanent left there for brachytherapy in 6 cases of thoracic malignant tumors, which including lung cancer, Pancoast's tumour, mediastinal malignant schwannoma. Results: All cases were rehabilitated shortly after operation. The implanted lesions remained controlled now and in dead patients. No radiation-related and 125 Iodine seed-related complications occurred. Conclusion: Brachytherapy by implantation of 125 Iodine seeds of remained tumor tissue in patients with thoracic malignant tumor after operation has a satisfactory outcome. This therapy can control local recurrent of thoracic malignant tumor. But the results in long term should be studied further
Development of thyroid monitoring system for the measurement of 125I
International Nuclear Information System (INIS)
Sankhla, Rajesh; Singh, I.S.; Rao, D.D.; Pradeepkumar, K.S.
2015-01-01
Iodine-125 has gained wide acceptance in medical science for diagnosis and therapeutic applications. A considerable number of radiation workers of BARC and BRIT are involved in the production of 125 I and preparation of radio immunoassay (RIA) kits to meet medical requirement of the country. A state of the art Thyroid Monitoring System incorporated with 51 mm diameter x 3 mm thick NaI(Tl) detector is developed for in-vivo monitoring of 125 I in radiation workers handling this radioisotope. The developed system also has provision to accommodate variable body sizes (child to adult). This paper presents the different aspects of the system and its calibration using IAEA neck phantom for estimation of thyroidal content of 125 I. (author)
Determination of 232Th, 230Th and 228Th in liquid effluents from uranium mining
International Nuclear Information System (INIS)
Godoy, Jose Marcus de Oliveira
1979-10-01
A liquid scintillator αlpha spectrometer was built for the determination of Th- 228 , Th- 230 and Th- 232 in liquid effluents from Uranium mines and mills. The resolution of the αlpha spectrometer was found to be 200-300 KeV, when the scintillator was 8% T0P0, 0,77% scintimix-4 (91% PP0 and 9% Dimetil-P0P0P) and 10% of naphthalene in toluene. Aliquat-336 in xylene (30% v/v) was used to separate the thorium isotopes from other interfering radionuclides (U- 238 , U- 234 , Ra- 226 , Po- 210 ). Under the extraction experimental conditions, the detection limits were 1,2 pCi/1 for Th- 232 , 1,2 pCi/1 for Th- 230 and 0,9 pCi/1 for Th- 228 , for 1000 minutes of counting time. (author)
Çakirer, H. Serdar
2014-01-01
The aim of the present study is to compare the values in the songs of 5th, 6th, 7th and 8th grade primary education music classes students? workbooks according to the value categorizations proposed by Rockeach and Akbas and which values among the categories mentioned are taught to the students in the 5th, 6th, 7th and 8th grade primary education…
miR-125b induces cellular senescence in malignant melanoma
DEFF Research Database (Denmark)
Nyholm, Anne Marie; Lerche, Catharina M; Manfé, Valentina
2014-01-01
transfected melanoma cell line Mel-Juso and then investigated the effect of the presence of a stable overexpression of miR-125b on growth by western blotting, flow cytometry and β-galactosidase staining. The tumourogenicity of the transfected cells was tested using a murine model and the tumours were further...... examined with in-situ-hybridization. RESULTS: In primary human tumours and in lymph node metastases increased expression of miR-125b was found in single, large tumour cells with abundant cytoplasm. A stable overexpression of miR-125b in human melanoma cell line Mel-Juso resulted in a G0/G1 cell cycle block...... and emergence of large cells expressing senescence markers: senescence-associated beta-galactosidase, p21, p27 and p53. Mel-Juso cells overexpressing miR-125b were tumourigenic in mice, but the tumours exhibited higher level of cell senescence and decreased expression of proliferation markers, cyclin D1 and Ki...
Occupational exposure in prostate permanent implants with I-125 seeds
Energy Technology Data Exchange (ETDEWEB)
Fdez Garcia, J.; Luna, V.; Sancho, J. M. g.; Martinez, J.; Galiano, P. S.; Jimenez, I.; Prada, P.; Juan, G.; Vivanco, J.
2002-07-01
Prostate brachytherapy is one of the techniques increasing faster in the environment of the radiotherapy and will probably go on increasing in the future. There are two forms in their use; by means of remote afterloading high dose rate (HDR) with Ir-192 radioactive sources or by means of permanent implant by manual/automatic afterloading of low dose rate (LDR) with seeds of I-125 or Pd-103. Iodine-125 has a half life of 59.4 days and it decays by electron capture with emissions of characteristic photons and electrons. The electrons are absorbed by the titanium wall of the I-125 seed. The principal photon emissions are 27.4 and 31.4 keV X-rays and a 35.5 keV gamma ray. Besides 22.1 and 25.2 keV fluorescent X-rays are also emitted resulting from interactions of the iodine-125 photons with the silver rod. The resulting average photon energy is approximately 27.4 keV. (Author)
On the Th internal contamination of animals
International Nuclear Information System (INIS)
Ciubotariu, M.; Danis, A.; Dumitrescu, G.
2000-01-01
Fissionable elements (U,Th) internal contamination have been studied using the fission track method as analysis method of the U and/or Th contaminant elements and Wistar-London breed rats as experiment animals. In our previous studies on the Th internal contamination, we investigated the Th biodistribution and retention in all the vital organs of the contaminated rats. In this stage, we continued this study with the Th elimination investigation through urine and excrements. The identical aliquot parts of a solution calibrated in Th, corresponding to an Annual Limit Intake, three Wistar-London breed rats were contaminated. They were kept in normal life conditions and under permanent medical surveillance up to their sacrifice. The animals were sacrificed at different time intervals after their contamination: RAT 1 = 2 days, RAT 2 = 7 days and RAT 3 = 14 days, respectively. After the sacrifice, their vital organs were sampled, weighed, calcined, re-weighed and finally analysed by track detection using the fission track micro-mappings technique. The evacuations were sampled every 24 hours: urine, on the filter paper, and all excrements balls. The samples were weighed before and after calcination and analysed in the same way as the vital organs. The Th fission track micro-mappings technique was used in the following conditions: - mica-muscovite as track detector pre-etched for fossil tracks 18 h in HF-40 per cent at room temperature; - the neutron irradiations were performed in the nuclear reactor WWR-S Bucharest at the neutron fluences of 3·10 15 - 2·10 16 fast neutrons/cm 2 ; - the visualization of the Th induced fission tracks was obtained by chemical etching in HF-40 %, 3 h at room temperature; - the Th track micromappings obtained in track detectors were studied by optical microscopy using a stereo microscope WILD M7S for ensemble study (X6-X31) and a binocular Zeiss JENA microscope for qualitative and quantitative studies (X150). The investigation of the Th
Extremely Elevated CA 125 and CA 19-9 in Endometrioma; A Case Series
Directory of Open Access Journals (Sweden)
Vugar Bayramov
2010-03-01
Full Text Available Although endometriosis is a benign condition, increased levels of the tumor markers CA 125 and CA 19-9 may be seen. However, these tumor markers reach to very high levels, rarely. In this report, 4 patients between 20 and 43 year-old with extremely elevated CA 125, CA 19-9 and CA 15-3 levels are discussed. In endometriosis extremely increased tumor markers are determined in the case of ruptured endometrioma cyst. There are two mechanisms to clarify extremely elevated levels of CA 125 in endometriosis. First, the peritoneal irritation of CA 125 molecule after the rupture of endometioma cyst and CA 125 secretion from the periton. And the second is penetration of the CA 125 moecule easily to the circulation through the peritoneal endothelial surface after the cyst rupture. In conclusion, the diagnosis of ruptured endometrioma cyst should be kept in mind especially in young patients with extremely elevated serum CA 125 levels with regard to the history and ultrasonographical signs and invasive procedures should be avoided.
125I-iomazenil-benzodiazepine receptor binding during psychological stress in rats
International Nuclear Information System (INIS)
Fukumitsu, Nobuyoshi; Tsuchida, Daisuke; Ogi, Shigeyuki; Uchiyama, Mayuki; Mori, Yutaka
2002-01-01
We investigated the changes in 125 I-iomazenil ( 125 I-IMZ) benzodiazepine receptor (BZR) binding with psychological stress in a rat model. Six male Wistar rats were placed under psychological stress for 1 hour by using a communication box. No physical stress was not received. 1.85 MBq of 125 I-IMZ was injected into the lateral tail vein and the rat was killed 3 hours later. Twenty-micormeter-thick sections of the brain were collected and % injected dose per body weight (% ID/BW) of eleven regions (frontal, parietal, temporal, occipital cortices, caudate putamen, accumubens nuclei, globus pallidus, amygdala, thalamus, hippocampus and hypothalamus) were calculated by autoradiography. The %ID/BW of rats which were placed under psychological stress was compared with that of 6 control rats. The %ID/BW of rats which were placed under psychological stress diffusely tended to show a reduction in 125 I-IMZ-BZR binding. A significant decrease in BZR binding was observed in the hippocampus of the rats which were placed under psychological stress. 125 I-IMZ-BZR binding tended to decrease throughout the brain. (author)
Radioimmunoassay of salivary cyclosporine with use of 125I-labeled cyclosporine
International Nuclear Information System (INIS)
Coates, J.E.; Lam, S.F.; McGaw, W.T.
1988-01-01
We prepared 125 I-labeled cyclosporine ( 125 I-CS) by modifying the procedure of Mahoney and Orf and characterized it with regards to maximal immunoreactivity (greater than 90%), trichloroacetic acid precipitability (greater than 90%), and stability (90% immunoreactive after five half-lives of 125 I). For a particular preparation of 125 I-CS, we estimated its immunoreaction concentration (50 pmol/L) and the equilibrium constant for its reaction with Sandoz polyclonal antiserum (K = 3.9 X 10(9) L/mol). By substituting 125 I-CS as tracer in the Sandoz radioimmunoassay and by modifying other aspects of the assay, we developed a procedure that is sufficiently sensitive (0.34 micrograms/L) to allow measurement of trough (lowest inter-dose) cyclosporine concentrations in parotid saliva. Of 38 kidney-transplant patients, 35 had measurable concentrations in saliva (mean 8.3, SD 5.2 micrograms/L), and these correlated moderately with paired serum concentrations (r = 0.68, P less than 0.001). We believe that measurement of salivary cyclosporine may offer a simple way of estimating the free fraction of the drug in serum or plasma
CA-125 AUC as a predictor for epithelial ovarian cancer relapse.
Mano, António; Falcão, Amílcar; Godinho, Isabel; Santos, Jorge; Leitão, Fátima; de Oliveira, Carlos; Caramona, Margarida
2008-01-01
The aim of the present work was to evaluate the usefulness of CA-125 normalized in time area under the curve (CA-125 AUC) to signalise epithelial ovarian cancer relapse. Data from a hundred and eleven patients were submitted to two different approaches based on CA-125 AUC increase values to predict patient relapse. In Criterion A total CA-125 AUC normalized in time value (AUC(i)) was compared with the immediately previous one (AUC(i-1)) using the formulae AUC(i) > or = F * AUC(i-1) (several F values were tested) to find the appropriate close related increment associated to patient relapse. In Criterion B total CA-125 AUC normalised in time was calculated and several cut-off values were correlated with patient relapse prediction capacity. In Criterion A the best accuracy was achieved with a factor (F) of 1.25 (increment of 25% from the previous status), while in Criterion B the best accuracies were achieved with cut-offs of 25, 50, 75 and 100 IU/mL. The mean lead time to relapse achieved with Criterion A was 181 days, while with Criterion B they were, respectively, 131, 111, 63 and 11 days. Based on our results we believe that conjugation and sequential application of both criteria in patient relapse detection should be highly advisable. CA-125 AUC rapid burst in asymptomatic patients should be firstly evaluated using Criterion A with a high accuracy (0.85) and with a substantial mean lead time to relapse (181 days). If a negative answer was obtained then Criterion B should performed to confirm the absence of relapse.
Down-regulation of the Th1, Th17, and Th22 pathways due to anti-TNF-α treatment in psoriasis.
Luan, Li; Han, Shixin; Wang, Hua; Liu, Xiaoming
2015-12-01
Psoriasis is a T-cell-mediated chronic inflammatory dermatosis. Th1, Th17 and Th22 cells are suggested to contribute to the pathogenesis of psoriasis. To determine whether treatment with the anti-tumor-necrosis-factor antagonist, adalimumab, induces significant modulation of the Th1, Th17 and Th22 pathways, and correlates cellular activity with clinical response. This study included 21 patients with moderate-to-severe psoriasis who were treated with adalimumab, and 10 healthy control subjects. Blood samples were collected at baseline and at week 12. Flow cytometry was used to analyze the frequency of circulating Th1, Th17 and Th22 cells. Real-time polymerase chain reaction was used to analyze the expression of T-bet (Th1-related), retinoid-acid receptor-related orphan receptor gamma t (RORγt, Th17-related) and aryl hydrocarbon receptor (AHR, Th22-related). An enzyme-linked immunosorbent assay was used to analyze the serum levels of IFN-γ, IL-17, IL-22, IL-6 and tumor necrosis factor-α (TNF-α). At baseline, the frequencies of Th1, Th17 and Th22 cells were higher in psoriasis patients compared to the healthy controls. The expression of transcription factors T-bet, RORγt and AHR, and the serum levels of IFN-γ, IL-17, IL-22, IL-6 and TNF-α were higher in psoriasis patients compared to the healthy controls. After adalimumab therapy, there was a significant decline in the frequencies of Th1, Th17 and Th22 cells, and a concomitant decrease in the levels of their associated transcription factors and cytokines. The results suggest that the anti-tumor-necrosis-factor antagonist, adalimumab, disrupts the Th1, Th17 and Th22 pathways, resulting in clinical improvement of psoriasis. Copyright © 2015 Elsevier B.V. All rights reserved.
7 CFR 1260.125 - Industry information.
2010-01-01
... Promotion and Research Order Definitions § 1260.125 Industry information. Industry information means information and programs that will lead to the development of new markets, marketing strategies, increased... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING...
The Th17 Lineage: From Barrier Surfaces Homeostasis to Autoimmunity, Cancer, and HIV-1 Pathogenesis
Directory of Open Access Journals (Sweden)
Vanessa Sue Wacleche
2017-10-01
Full Text Available The T helper 17 (Th17 cells represent a subset of CD4+ T-cells with unique effector functions, developmental plasticity, and stem-cell features. Th17 cells bridge innate and adaptive immunity against fungal and bacterial infections at skin and mucosal barrier surfaces. Although Th17 cells have been extensively studied in the context of autoimmunity, their role in various other pathologies is underexplored and remains an area of open investigation. This review summarizes the history of Th17 cell discovery and the current knowledge relative to the beneficial role of Th17 cells in maintaining mucosal immunity homeostasis. We further discuss the concept of Th17 pathogenicity in the context of autoimmunity, cancer, and HIV infection, and we review the most recent discoveries on molecular mechanisms regulating HIV replication/persistence in pathogenic Th17 cells. Finally, we stress the need for novel fundamental research discovery-based Th17-specific therapeutic interventions to treat pathogenic conditions associated with Th17 abnormalities, including HIV infection.
Serum tumor marker CA 125 for monitoring ovarian cancer during follow-up
DEFF Research Database (Denmark)
Tuxen, Malgorzata K.; Sölétormos, G; Dombernowsky, P
2002-01-01
CA 125 is currently widely applied in the management of patients with ovarian cancer. However, a change in results of CA 125, which should be considered significant, has not been defined. The aim of this study was to investigate the ability of CA 125 to signal progressive ovarian cancer during fo...... utility of serological tumor markers in patients with ovarian cancer....
International Nuclear Information System (INIS)
Busev, A.I.; Tiptsova, V.G.; Ivanov, V.M.
1978-01-01
The basic methods for extracting thorium from monazites and determining it photometrically and complexometrically are described. Monazite is decomposed by fusion with sodium peroxide, then thorium and the totality of lanthanides are precipitated in the form of oxalates. After the oxalates have been broken down, thorium is determined photometrically with the aid of arsenazo 1, quercetin of 1-2(-pyridylazo)-resorcin. It takes 25 to 30 minutes to photometrically determine Th in monazites with the aid of arsenazo 2 (error: 3 to 5%). Arsenazo 2 is recommended for analysis of monazites containing 20 to 30% of lanthanides. Arsenazo 3 permits determining Th in zircon and in Nb-containing materials. In this case, the determination is possible in strongly acidic solutions, the ratio of arsenazo 3 to Th being 7.5:1. Arsenazo 3 can also be used in determining trace amounts of Th (1x10 -5 to 1x10 -4 %) in rocks, as well as in extraction-photometric determination of Th traces. The dyed compound of Th with arsenazo 3 is extracted with isoamyl alcohol in the presence of diphenylguanidinium chloride and monochloroacetic acid. The method permits determining Th at 1:5x10 8 (0.002 g/ml) dilution. Also described is the iodate-complexometric method for determining Th
Synthesis of [125I]iodoDPA-713: A new probe for imaging inflammation
International Nuclear Information System (INIS)
Wang, Haofan; Pullambhatla, Mrudula; Guilarte, Tomas R.; Mease, Ronnie C.; Pomper, Martin G.
2009-01-01
[ 125 I]IodoDPA-713 [ 125 I]1, which targets the translocator protein (TSPO, 18 kDa), was synthesized in seven steps from methyl-4-methoxybenzoate as a tool for quantification of inflammation in preclinical models. Preliminary in vitro autoradiography and in vivo small animal imaging were performed using [ 125 I]1 in a neurotoxicant-treated rat and in a murine model of lung inflammation, respectively. The radiochemical yield of [ 125 I]1 was 44 ± 6% with a specific radioactivity of 51.8 GBq/μmol (1400 mCi/μmol) and >99% radiochemical purity. Preliminary studies showed that [ 125 I]1 demonstrated increased specific binding to TSPO in a neurotoxicant-treated rat and increased radiopharmaceutical uptake in the lungs of an experimental inflammation model of lung inflammation. Compound [ 125 I]1 is a new, convenient probe for preclinical studies of TSPO activity.
1,25-Dihydroxyvitamin-D3 Induces Avian β-Defensin Gene Expression in Chickens.
Directory of Open Access Journals (Sweden)
Long Zhang
Full Text Available Host defense peptides (HDPs play a critical role in innate immunity. Specific modulation of endogenous HDP synthesis by dietary compounds has been regarded as a novel approach to boost immunity and disease resistance in animal production. 1,25-dihydroxy vitamin D3 (1,25D3 is well known as a powerful HDP inducer in humans, but limited information about the effect of 1,25D3 on HDPs in poultry is available. Here, we sought to examine whether 1,25D3 could stimulate avian β-defensin (AvBD expression in chickens. We used chicken embryo intestinal epithelial cells (CEIEPCs and peripheral blood mononuclear cells (PBMCs to study the effect of 1,25D3 on the expression of AvBDs. We observed that 1,25D3 is able to up-regulate the expression of several AvBDs in CEIEPCs and PBMCs, whereas it increased the amounts of AvBD4 mRNA in CEIEPCs only in the presence of lipopolysaccharide (LPS. On the other hand, LPS treatment not only inhibited the expression of CYP24A1 but also altered the expression pattern of VDR in CEIEPCs. Furthermore, AvBDs were not directly regulated by 1,25D3, as cycloheximide completely blocked 1,25D3-induced expression of AvBDs. Our observations suggest that 1,25D3 is capable of inducing AvBD gene expression and is a potential antibiotic alternative through augmentation of host innate immunity as well as disease control in chickens.
Fate of thymic radioactivity after local labeling with 125Iododeoxyuridine
International Nuclear Information System (INIS)
Laissue, J.A.; Chanana, A.D.; Cottier, H.; Cronkite, E.P.; Joel, D.D.
1976-01-01
The thymic cortex was locally labeled with 125 Iododeoxyuridine ( 125 IUdR) in young adult mice in an attempt to provide a simple quantitative assessment of the fate of cortical thymocytes. Similarly operated and nonoperated mice given 125 IUdR intravenously were used for comparison. Analogous experiments were performed in adrenalectomized animals. More than 90 percent of thymic activity present 1 day after labeling had been lost by day 8. That proportion of radioactivity contributed to a given organ by accumulation of labeled thymic migrants was estimated by comparison of values obtained after local labeling with those acquired after systemic labeling. Thymic cell accumulation was apparent in the intestine, spleen, mesenteric lymph node, and femurs of locally labeled mice; however, only a few percent of the total activity lost from the thymus was accounted for in these lymphoid organs. The pattern of fecal and urinary elimination of 125 I did not markedly differ in the various experimental groups, the bulk of the activity being recovered in the urine. The intestine could not be ruled out as a major site of thymocyte loss. Since significant radiation or pharmacologic toxicity was unlikely with the doses of 125 IUdR used, the data indicated that the vast majority of newly formed thymocytes dies after a short life and only a small fraction of thymic migrants is longer lived
2011-05-09
... From the People's Republic of China: Alignment of Final Countervailing Duty Determination With Final... the People's Republic of China (``PRC'') with the final determination in the companion antidumping..., International Trade Administration, U.S. Department of Commerce, 14th Street and Constitution Avenue, NW...
Karimi-Zarchi, Mojgan; Dehshiri-Zadeh, Najmeh; Sekhavat, Leili; Nosouhi, Fahime
2016-11-01
Cancer antigen 125 (CA-125) is a glycoprotein biomarker that is used in women with pelvic masses such as endometriosis and maybe is useful in practice of patients suspicious to endometriosis. The aim of this study was to evaluate the association between preoperative serum CA-125 levels and clinic pathological characteristic in women with endometriosis, and find out the best serum CA-125 levels cut-off in pre and post menopause women. Serum CA-125 levels in 87 women aged 21-54 years suspected to endometriosis with pelvic pain, dysmenorrhea, or dyspareunia were measured preoperatively. Also the association between clinic pathological characteristic and serum CA-125 level were analyzed. The mean age of women was 32.22±6.91. The mean serum CA-125 level was 49.93±4.30 U/mL. There was a significant correlation between the endometriosis stage, lesion size, adhesion score and preoperative CA-125 plasma concentration. However, we did not found significant differences in age, marital status, patient's complaints, and pelvic pain associated to Ca125 serum level. The suggested preoperative serum cut-off levels in premenopausal and postmenopausal patients were 37 U/ml and 35 U/ml, respectively. According to the results, preoperative serum CA-125 is an important predictor for patients with endometriosis and it should be taken into consideration when surgical management is suspected, especially if stage of disease, lesion size and adhesion score are undertaken.
Closure certification report: TA-35 TSL-125 surface impoundment
International Nuclear Information System (INIS)
1991-01-01
This closure report documents closure activities for the TA-35 TSL-125 surface impoundment and associated structures at Los Alamos National Laboratory (the Laboratory). Prior to formal approval of the closure plan, the decision was made to proceed with closure activities to prevent any further releases from the site following informal discussions with New Mexico Environment Department (NMED) personnel. The closure plan is a revision of the previously submitted draft dated July 1988. Clean closure of the TSL-125 site was accomplished through: Removal and proper disposal of all wastes contained within the surface impoundment system; Decontamination and/or removal and proper disposal of the surface impoundment, its associated structures, and contaminated soil underlying the impoundment area; Sampling and analysis of soil to determine the presence and concentrations of any hazardous constituents remaining in the soil at the TSL-125 site; and Demonstration through a risk assessment that any constituents remaining in the soil at the TSL-125 site pose no threat to human health and the environment. All remaining soil concentrations of hazardous constituents were below health-based action levels. Analytical results indicated that benzidine, n-nitrosodimethylamine, and n-nitrosodi-n-propylamine were not detected at or above their limits of quantitation and beryllium was not present at or above its laboratory detection limit. However, the limits of quantitation and detection for these constituents were greater than their calculated health-based action levels. To demonstrate that these constituents were not present, historical data was researched and it was determined that the constituents were not utilized at the Building 125 site. 4 refs., 8 figs., 1 tab
40 CFR 1042.125 - Maintenance instructions.
2010-07-01
... Section 1042.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION... this section: (i) For EGR-related filters and coolers, PCV valves, and fuel injector tips (cleaning... sensors and actuators, the minimum interval is 3,000 hours: Fuel injectors, turbochargers, catalytic...
International Nuclear Information System (INIS)
1994-01-01
Thorium 230 (Th-230) at the Gunnison, Colorado processing site will require remediation, however, a seasonally fluctuating groundwater table at the site significantly complicates conventional remedial action with respect to cleanup. Therefore, to effectively remediate the site with respect to Radium 226 (Ra-226) and Th-230, the following supplemental standard is proposed: In situ Ra-26 will be remediated to the EPA soil cleanup standards independent of groundwater considerations. In situ Th-230 concentrations will be remediated in the region above the encountered water table so the 1000-year projected Ra-226 concentration complies with the EPA soil cleanup concentration limits. If elevated Th-230 persists to the water table, an additional foot of excavation will be performed and the grid will be backfilled. Excavated grids will be backfilled to the final remedial action grade with clean cobbly soil. Final grid verification that is required below the water table will be performed by extracting and analyzing a single bulk soil sample with the bucket of a backhoe. Modeled surface radon flux values will be estimated and documented. A recommendation will be made that land records should be annotated to identify the presence of residual Th-230
A survey of the past earthquakesin the Eastern Adriatic (14th to early 19th century
Directory of Open Access Journals (Sweden)
P. Albini
2004-06-01
Full Text Available Focusing on the Eastern Adriatic region, from Zadar in the north to Corfu in the south, the background information supporting our knowledge of the seismicity in the time-span 14th to early 19th century is discussed from the point of view of the historical earthquake records. The late 19th century seismological compilations turn out to be those responsible for the uneven spatial and temporal distribution of seismicity suggested by current parametric earthquake catalogues. This awareness asked for a comprehensive reappraisal of the reliability and completeness of the available historical earthquake records. This task was addressed by retrieving in the original version the information already known, by putting the records in the historical context in which they were produced, and finally by sampling historical sources so far not considered. Selected case histories have been presented in some detail also. This material altogether has shown that i current parameterisation of past earthquakes in the Eastern Adriatic should be reconsidered in the light of a critically revised interpretation of the available records; ii collecting new evidence in sources and repositories, not fully exploited so far, is needed. This should aim mostly at overcoming another limitation affecting the evaluation of full sets of earthquake parameters, that is the few observations available for each earthquake. In this perspective, an optimistic assessment of the potential documentation on this area is proposed.
Cox, Richard M.; Citir, Murat; Armentrout, P. B.; Battey, Samuel R.; Peterson, Kirk A.
2016-05-01
Kinetic energy dependent reactions of Th+ with O2 and CO are studied using a guided ion beam tandem mass spectrometer. The formation of ThO+ in the reaction of Th+ with O2 is observed to be exothermic and barrierless with a reaction efficiency at low energies of k/kLGS = 1.21 ± 0.24 similar to the efficiency observed in ion cyclotron resonance experiments. Formation of ThO+ and ThC+ in the reaction of Th+ with CO is endothermic in both cases. The kinetic energy dependent cross sections for formation of these product ions were evaluated to determine 0 K bond dissociation energies (BDEs) of D0(Th+-O) = 8.57 ± 0.14 eV and D0(Th+-C) = 4.82 ± 0.29 eV. The present value of D0 (Th+-O) is within experimental uncertainty of previously reported experimental values, whereas this is the first report of D0 (Th+-C). Both BDEs are observed to be larger than those of their transition metal congeners, TiL+, ZrL+, and HfL+ (L = O and C), believed to be a result of lanthanide contraction. Additionally, the reactions were explored by quantum chemical calculations, including a full Feller-Peterson-Dixon composite approach with correlation contributions up to coupled-cluster singles and doubles with iterative triples and quadruples (CCSDTQ) for ThC, ThC+, ThO, and ThO+, as well as more approximate CCSD with perturbative (triples) [CCSD(T)] calculations where a semi-empirical model was used to estimate spin-orbit energy contributions. Finally, the ThO+ BDE is compared to other actinide (An) oxide cation BDEs and a simple model utilizing An+ promotion energies to the reactive state is used to estimate AnO+ and AnC+ BDEs. For AnO+, this model yields predictions that are typically within experimental uncertainty and performs better than density functional theory calculations presented previously.
Energy Technology Data Exchange (ETDEWEB)
Hakkinen, T. (ed.)
2012-11-01
This report is the final report of Sustainable refurbishment of building facades and exterior walls (SUSREF). SUSREF project was a collaborative (small/medium size) research project within the 7th Framework Programme of the Commission and it was financed under the theme Environment (including climate change) (Grant agreement no. 226858). The project started in October 1st 2009 and ended in April 30th 2012. The project included 11 partners from five countries. SUSREF developed sustainable concepts and technologies for the refurbishment of building facades and external walls. This report together with SUSREF Final report Part B and SUSREF Final Report Part C introduce the main results of the project. Part A focuses on methodological issues. The descriptions of the concepts and the assessment results of the developed concepts are presented in SUSREF Final report part B (generic concepts) and SUSREF Final report Part C (SME concepts). (orig.)
Expression of CA125 in Tissue and Serum of Uterine Serous Carcinoma Patients
Directory of Open Access Journals (Sweden)
Joseph Menczer
2015-09-01
Conclusion: The higher proportion of USC patients with positive CA125 immunohistochemical tissue staining than with elevated serum CA125 levels indicates the presence of some mechanism that prevents the access of CA125 into the circulation. [J Interdiscipl Histopathol 2015; 3(3.000: 102-104
33 CFR 149.125 - What are the requirements for the malfunction detection system?
2010-07-01
... malfunction detection system? 149.125 Section 149.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... Pollution Prevention Equipment § 149.125 What are the requirements for the malfunction detection system? (a... Commandant (CG-5) will evaluate proposed leak-detection systems for natural gas on an individual basis. ...
Environmental geochemistry of 238U, 232Th, 40K and some heavy metals in River Nile sediments
International Nuclear Information System (INIS)
Siddeeg, S. M. B.
2007-06-01
Environmental geochemistry is concerned with the abundance, distribution, and mobility of chemical elements in surface materials at the surface of earth crust. This study aimed at better understanding of geochemical behavior of 238 U, 23 '2Th and 40 K in river sediments and some heavy elements with emphasis on Mg, Ca, Mn, Fe, Ni, Cu, Zn and Pb. The analysis was conducted for a total of 33 bulk sediment samples from White Nile, Blue Nile and River Nile within Khartoum, the samples were fractionated into seven grain sizes each (2000-1000, 1000-500, 500-250, 250-200, 200-125, 125-100 and > 100 μm), using high resolution gamma spectrometer for radionuclides measurements, whereas Particle Induced X-ray Emission (PIXE) was used for heavy metals analysis. On the average, the activity concentration of 238 U, 232 Th and 40 K were 17.90±5.23, 16.38±5.34 and 379.82±107.76 Bq -1 Kg in White Nile, 19.56±5.04, 17.72±4.69, and 494.36±105.79 Bq -1 Kg in Blue Nile and 19.27±2.88, 17.48±2.78, 359.50±83.15 Bq -1 Kg in the River Nile sediments. Results revealed inverse relationship between activity concentration and grain size in White and Blue Nile, while the trend is not clear in the River Nile. In general, the variation of the measured values within single grain size was smaller in White Nile compare to Blue and River Nile sediments, and it was observed that the data are highly scattered in grain size (200-125μm). The ratio between 238 U/ 232 Th is grater than unity in the three rivers indicating that there is relative enrichment of 238 U in the surface sediments. The activity concentration of the fallout radionuclide 137 Cs is one order of magnitude lower in the White Nile sediments (0.89±0.96) Bq -1 Kg compared to values in the Blue Nile sediments (3.60±1.55) Bq -1 Kg. Comparison of the values obtained for natural radionuclides and the fallout radionuclide ( 137 Cs in the three sites with the global data reflect low and /or insignificant difference. For heavy metal
Study on preparation and brain distribution of 125I-β-CIT
International Nuclear Information System (INIS)
Liu Xingdang; Lin Xiangtong
2002-01-01
Objective: To develop a relatively simpler and faster method for the routine preparation of 125 I-β-CIT and animal brain distribution of 125 I-β-CIT. Methods: Peracetic acid or Iodogen as an oxidant was used to prepare 125 I-β-CIT and comparison was made between them. The HPLC purification technique was used to identify the labeled tracer. Stability and safety of the radioiodinated β-CIT were also studied. Groups of mice (n=5) were injected i.v. into the tail vein with 125 I-β-CIT . Animals were killed at 5, 15, 30 and 45 minutes, and 1, 2, 4, 6, 8 and 24 hours. Autoradiography was performed on brains of mice at 4 hours after injection. Results: Two kinds of labeling methods using Iodogen or peracetic acid produced 125 I-β-CIT of radiochemical yields 91.10% ± 8.09%, 54.70 ± 9.81% respectively, with high radiochemical purity (RCP) 99.33% ± 0.15%, 18-25 degree C and pH 1 or 2 is the best for Iodogen preparation. The labeled product was stable for at least 23 days when kept in room temperature, and stable for at least 10 weeks when kept in -4 degree C refrigerator. The peak time of uptake of 125 I-β-CIT in striatum was at four hours after injection and the highest value was 22.93% ± 3.11% ID/g. It's highest uptake rate is 20.09 ± 2.11. Conclusions: The Iodogen preparation method is simpler and has a higher labeling yield than peracetic acid labeling method and the labeling yield is higher than which ever reported abroad. The labeled radiopharmaceutical is stable. 125 I-β-CIT showed the highest accumulation in striatum with high densities of dopamine transporters in brain
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
40 CFR 125.61 - Existence of and compliance with applicable water quality standards.
2010-07-01
... applicable water quality standards. 125.61 Section 125.61 Protection of Environment ENVIRONMENTAL PROTECTION... Water Act § 125.61 Existence of and compliance with applicable water quality standards. (a) There must exist a water quality standard or standards applicable to the pollutant(s) for which a section 301(h...
Th biodistribution in internal contamination of animals
International Nuclear Information System (INIS)
Ciubotariu, M.; Danis, A.; Dumitrescu, G.; Cucu, M.
1999-01-01
Fissionable elements (U,Th) internal contamination have been studied using the fission track method as analysis method of the U and/or Th contaminant elements and Wistar-London breed rats as experiment animals. Different ways to obtain internal contaminations have been investigated: ingestion, inhalation, absorption by skin and through wounds. After the U internal contamination study was carried out, in this stage the Th internal contamination by ingestion is in progress. Using the identical aliquot parts of a solution calibrated in Th, corresponding to an Annual Limit Intake, three Wistar-London breed rats were contaminated. They were kept in normal life conditions and under permanent medical surveillance up to their sacrification. The animals were sacrificed at different time intervals after their contamination: 2 days, 7 days and 14 days, respectively. After the sacrification, their vital organs were sampled, weighed, calcined, re-weighed and finally analysed by track detection using the fission track micro-mappings technique. Also, their evacuations were sampled every 24 hours weighed, calcined and analysed in the same way as the vital organs. The Th fission track micro-mappings technique was used in the following conditions: - mica-muscovite as track detector pre-etched for fossil tracks 18 h in HF-40 per cent at room temperature; - the neutron irradiations were performed in the nuclear reactor VVR-S Bucharest at the neutron fluences of 3.10 15 - 2.10 16 fast neutrons/c m 2 ; - the visualization of the Th induced fission tracks were obtained by chemical etching in HF-40 per cent, 3 h at room temperature; - the Th track micro-mappings obtained in track detectors were studied by optical microscopy using a stereo microscope WILD M7S for ensemble study (X6-X31) and a binocular ZEISS JENA microscope for qualitative and quantitative studies (X150). The biological reference materials calibrated in Th were prepared in our laboratory using the calcined organs and the
Du, J; Li, R; Yu, F; Yang, F; Wang, J; Chen, Q; Wang, X; Zhao, B; Zhang, F
2017-09-01
To explore the protective function of vitamin D (VD)/vitamin D receptor (VDR) on the development of oral lichen planus (OLP) and elaborate the underling mechanism of it. H&E staining, myeloid peroxidase (MPO) assays, quantitative PCR (qPCR), Western blotting, and Elisa were used to test the human biopsies and serum. QPCR, Western blotting, Elisa, and siRNA transfection were also performed in LPS-induced keratinocytes to observe the functions of vitamin D and VDR. The lack of VDR in the diseased biopsies from OLP patients was associated with activated helper T-cell type 1 (Th1)-driven inflammatory response. Importantly, the status of serum 25-hydroxyvitamin D of OLP patients was reduced consistently. In a cultured cell model, 1,25(OH) 2 D 3 could downregulate excessive production of pro-inflammatory factors induced by lipopolysaccharide (LPS) in keratinocyte HaCat cells. Mechanistically, even though LPS-induced cytokines in keratinocytes were inhibited both by nuclear factor-κB (NF-κB) inhibitor and by activator protein 1 (AP-1) inhibitor, VDR-dependent 1,25(OH) 2 D 3 blocked the activation of phosphorylated-NF-κB p65 rather than c-Jun/c-Fos in the presence of LPS stimulation. These results suggest that 1,25(OH) 2 D 3 plays an anti-inflammatory role in OLP by mediating NF-κB signaling pathway but not AP-1 signaling pathway with a VDR-dependent manner, predicting vitamin D supplement may be a potential strategy for the OLP management. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Inhibition effects of {sup 125}I-triplex forming oligonucleotide to hepatoma cells
Energy Technology Data Exchange (ETDEWEB)
Zhongwei, Lv; Min, Hou; Haidong, Cai; Xueyu, Yuan; Yuehua, Yang; Shidong, Yuan [Department of Nuclear Medicine, 10th People' s Hospital, Tongji Univ., Shanghai (China); Junmin, He
2007-08-15
Objective: Triplex forming oligonucleotide (TFO) has been reported as a new antigene strategy. The purpose of this study was to observe the inhibition effects of {sup 125}I-TFO on hepatoma cells and to investigate the possibility of using {sup 125}I-TFO as an antigene radiotherapy technique for hepatocellular carcinoma (HCC) related to HBV. Methods: TFO complementary to the initiator of S gene of HBV was synthesized and labeled with {sup 125}I. HepG2.2.15 cells, in which HBV genome was integrated, were incubated with {sup 125}I-TFO, TFO and {sup 125}I respectively. After incubation, hepatitis B e antigen (HBeAg) and hepatitis B surface antigen (HBsAg) of each group were assayed with ELISA and the survival rate of cells in each group was determined with 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenylte-trazolium bromide (MTT) reduction assay. Results: {sup 125}I-TFO showed a high stability with a radiolabeling rate of >93%. The radiochemical purity of labeled compound was 90.8%, 81.1% and 73.2% respectively after 12, 48 and 72 h at 37 degree C. The peak inhibition effect of {sup 125}I-TFO on synthesizing HBsAg and HBeAg by HepG2.2.15 cells were found at 48 h after transfection, with significantly the highest inhibition rate of 45.2% for HBsAg and 74.5% for HBeAg expression among the three groups(P<0.01 ). As the transfection time prolonged its inhibition effects were stronger. Conclusion: {sup 125}I-TFO may inhibit the antigen expression of HBV and the growth of hepatocarcinoma cells, thus it may provide a new approach to develop gene-based radiotherapeutic pharmaceuticals for anti-HBV and HCC. (authors)
The role of preoperative serum cancer antigen 125 in malignant ovarian germ cell tumors
Directory of Open Access Journals (Sweden)
Ju-Hyun Kim
2018-04-01
Full Text Available Objective: To determine the role of preoperative serum cancer antigen 125 (CA 125 in malignant ovarian germ cell tumors (MOGCTs. Materials and methods: Using information from medical databases of Asan Medical Center (Seoul, Korea, we investigated 161 patients with histologically diagnosed MOGCTs and whose preoperative serum CA 125 had been checked. We determined the optimal cutoff value of CA 125 as > 249.5 U/mL in MOGCTs using a receiver operating characteristic curve. Results: The median patient age was 24 years (range, 6–52 years. The most common histologic type was immature teratoma. Most patients had stage I disease. Thirty-two patients (19.9% had elevated preoperative serum CA 125 levels over 249.5 U/mL. On univariate analysis, tumor size, advanced stage, the presence of ascites, ovarian surface involvement, and tumor rupture were significantly associated with elevated preoperative CA 125 levels (>249.5 U/mL. In the median follow-up time of 87 months (range, 9–271 months, 14 patients had a recurrence, and 5 died of the disease. Patients with an elevated serum preoperative CA 125 level (>249.5 U/mL had poorer disease-free survival, but this was not statistically significant. However, elevated preoperative CA 125 (>249.5 U/mL was significantly associated with poorer overall survival. Conclusions: Elevated preoperative serum CA 125 may have prognostic value in patients with MOGCTs. Keywords: CA-125 antigen, Ovarian germ cell cancer, Prognosis
Metabolism of murine TH 17 cells: Impact on cell fate and function.
Wang, Ran; Solt, Laura A
2016-04-01
An effective adaptive immune response relies on the ability of lymphocytes to rapidly act upon a variety of insults. In T lymphocytes, this response includes cell growth, clonal expansion, differentiation, and cytokine production, all of which place a significant energy burden on the cell. Recent evidence shows that T-cell metabolic reprogramming is an essential component of the adaptive immune response and specific metabolic pathways dictate T-cell fate decisions, including the development of TH 17 versus T regulatory (Treg) cells. TH 17 cells have garnered significant attention due to their roles in the pathology of immune-mediated inflammatory diseases. Attempts to characterize TH 17 cells have demonstrated that they are highly dynamic, adjusting their function to environmental cues, which dictate their metabolic program. In this review, we highlight recent data demonstrating the impact of cellular metabolism on the TH 17/Treg balance and present factors that mediate TH 17-cell metabolism. Some examples of these include the differential impact of the mTOR signaling complexes on T-helper-cell differentiation, hypoxia inducible factor 1 alpha (HIF1α) promotion of glycolysis to favor TH 17-cell development, and ACC1-dependent de novo fatty acid synthesis favoring TH 17-cell development over Treg cells. Finally, we discuss the potential therapeutic options and the implications of modulating TH 17-cell metabolism for the treatment of TH 17-mediated diseases. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Diversity and plasticity of Th cell types predicted from regulatory network modelling.
Directory of Open Access Journals (Sweden)
Aurélien Naldi
Full Text Available Alternative cell differentiation pathways are believed to arise from the concerted action of signalling pathways and transcriptional regulatory networks. However, the prediction of mammalian cell differentiation from the knowledge of the presence of specific signals and transcriptional factors is still a daunting challenge. In this respect, the vertebrate hematopoietic system, with its many branching differentiation pathways and cell types, is a compelling case study. In this paper, we propose an integrated, comprehensive model of the regulatory network and signalling pathways controlling Th cell differentiation. As most available data are qualitative, we rely on a logical formalism to perform extensive dynamical analyses. To cope with the size and complexity of the resulting network, we use an original model reduction approach together with a stable state identification algorithm. To assess the effects of heterogeneous environments on Th cell differentiation, we have performed a systematic series of simulations considering various prototypic environments. Consequently, we have identified stable states corresponding to canonical Th1, Th2, Th17 and Treg subtypes, but these were found to coexist with other transient hybrid cell types that co-express combinations of Th1, Th2, Treg and Th17 markers in an environment-dependent fashion. In the process, our logical analysis highlights the nature of these cell types and their relationships with canonical Th subtypes. Finally, our logical model can be used to explore novel differentiation pathways in silico.
Directory of Open Access Journals (Sweden)
Kaiyun Chen
Full Text Available BACKGROUND: Tumor recurrence is a major problem after curative resection of hepatocellular carcinoma (HCC. The current study evaluated the effects of adjuvant iodine-125 ((125I brachytherapy on postoperative recurrence of HCC. METHODOLOGY/PRINCIPAL FINDINGS: From July 2000 to June 2004, 68 HCC patients undergoing curative hepatectomy were randomly assigned into a (125I adjuvant brachytherapy group (n = 34 and a group of best care (n = 34. Patients in the (125I adjuvant brachytherapy group received (125I seed implantation on the raw surface of resection. Patients in the best care control group received identical treatments except for the (125I seed implantation. Time to recurrence (TTR and 1-, 3- and 5-year overall survival (OS were compared between the two groups. The follow-up ended in January 2010, and lasted for 7.7-106.4 months with a median of 47.6 months. TTR was significantly longer in the (125I group (mean of 60.0 months vs. 36.7 months in the control. The 1-, 3- and 5-year recurrence-free rates of the (125I group were 94.12%, 76.42%, and 73.65% vs. 88.24%, 50.00%, and 29.41% compared with the control group, respectively. The 1-, 3- and 5-year OS rates of the (125I group were 94.12%, 73.53%, and 55.88% vs. 88.24%, 52.94%, and 29.41% compared with the control group, respectively. The (125I brachytherapy decreased the risk of recurrence (HR = 0.310 and the risk of death (HR = 0.364. Most frequent adverse events in the (125I group included nausea, vomiting, arrhythmia, decreased white blood cell and/or platelet counts, and were generally mild and manageable. CONCLUSIONS/SIGNIFICANCE: Adjuvant (125I brachytherapy significantly prolonged TTR and increased the OS rate after curative resection of HCC. TRIAL REGISTRATION: Australian New Zealand Clinical Trials Registry ACTRN12610000081011.
Kamble, Suresh S; Kandasamy, Baburajan; Thillaigovindan, Ranjani; Goyal, Nitin Kumar; Talukdar, Pratim; Seal, Mukut
2015-05-01
Newer dentin bonding agents were developed to improve the quality of composite restoration and to reduce time consumption in its application. The aim of the present study was to evaluate tensile bond strength of 6(th), 7(th) and 8(th) generation bonding agents by in vitro method. Selected 60 permanent teeth were assigned into 20 in each group (Group I: 6(th) generation bonding agent-Adper SE plus 3M ESPE, Group II: 7(th) generation bonding agent-G-Bond GC Corp Japan and Group III: 8(th) generation dentin adhesives-FuturaBond, DC, Voco, Germany). With high-speed diamond disc, coronal dentin was exposed, and selected dentin bonding agents were applied, followed by composite restoration. All samples were saved in saline for 24 h and tensile bond strength testing was done using a universal testing machine. The obtained data were tabulated and statistically analyzed using ANOVA test. The tensile bond strength readings for 6(th) generation bonding agent was 32.2465, for 7(th) generation was 31.6734, and for 8(th)-generation dentine bonding agent was 34.74431. The highest tensile bond strength was seen in 8(th) generation bonding agent compared to 6(th) and 7(th) generation bonding agents. From the present study it can be conclude that 8(th) generation dentine adhesive (Futura DC, Voco, Germany) resulted in highest tensile bond strength compared to 6(th) (Adper SE plus, 3M ESPE) and 7(th) generation (G-Bond) dentin bonding agents.
Energy Technology Data Exchange (ETDEWEB)
Dupont, A [CHUL, Quebec (Canada). Lab. of Molecular Endocrinology and Service of Gastro-Enterology; Coy, D H; Alvarado-Urbina, G; Cote, J; Meyers, C A; McManus, J; Barden, N; De Lean, A; Labrie, F
1979-01-01
A sensitive radioimmunoassay for somatostatin using N-(/sup 125/I)-Tyr-somatostatin is described and compared with using (/sup 125/I)-Tyr/sup 1/-somatostatin. The minimum detectable amount of somatostatin using N-(/sup 125/I)-Tyr-somatostatin as tracer was 0.1 to 0.5 pg, which is approximately 10-fold lower detection limit of the RIA using (/sup 125/I)-Tyr/sup 1/-somatostatin. Moreover, it was found that the shelf-life of N-(/sup 125/I)-Tyr-somatostatin was prolonged in comparison with labelled Tyr/sup 1/-somatostatin. Human pancreatic and gastric extracts displayed immunological similarity to synthetic somatostatin tetradecapeptide.
Labeling Lanreotide with 125I and 188Re. China
International Nuclear Information System (INIS)
Bai Hongsheng
2000-01-01
Lanreotide (D-β-Nal-Cys-Try-D-Trp-Lys-Val-Cys-Thr-NH2) is a new somatostatin analogue. It can bind to human somatostatin receptor (hSSTR) subtype 2 through 5 with high affinity and to hSSTR subtype 1 with low affinity. We investigate labeling condition, quality control and stability in vitro of 125 I-Lanreotide and 188 Re-lanreotide respectively. (A) Lanreotide is labeled with 125 I using Chloramine T. The effect of reaction condition (such as reaction time, pH value, Lanreotide amount, quantity of Chloramine T and reaction volume) on labeling yield is investigated in detail. (B) The labeling yield and radiochemical purity (RP) is measured with paper chromatography (PC) and Sep-Pak C 18 Cartridge. For PC method, 125 I-Lanreotide is spotted on the Whatman No.1 paper and developed in the mixture of CH 3 CH 2 CH 2 CH 2 OH and CH 3 CH 2 OH and NH 4 OH (v/v/v=5:2:1), the Rf value of every component in the mobile phase is given in table 1. For Sep-Pak C 18 Cartridge methods each cartridge is washed with 10 ml of ethanol followed by 10 ml of iso-CH 3 CH 2 CH 2 OH solution. Aliquots of 0.1 mI sample is loaded onto the cartridge, unbound peptide (sodium iodine-125) is eluted with 5 ml of 0.5mol/L sodium acetate solution, 125 I-Lanreotide is eluted with 5 mI of 95% aqueous ethanol solution. (C) The stability of 125 I-Lanreotide in vitro is investigated by labeling compound incubating for 48 hours at 37 deg. C in the 0.9% sodium chloride solution and RP is tested by PC at specific time intervals. (D) Lanreotide is labeled directly with 188 Re via the mixture of citrate and tartate using stannous chloride as reduced agent. The influence of reaction conditions such as pH, temperature, amount of stannous chloride, amount of Lanreotide and reaction time on labeling yield is investigated in detail. At the time, the stability in vitro quality control and animal test are evaluated
[125I] radioiodinated metaraminol: A new platelet-specific labeling agent
International Nuclear Information System (INIS)
Ohmomo, Y.; Yokoyama, A.; Kawai, K.; Arano, Y.; Horiuchi, K.; Saji, H.; Torizuka, K.
1985-01-01
In our search for a platelet-specific labeling agent, metaraminol (MA), a low-toxic pharmaceutical for the treatment of hypotension and cardiogenic shock, attracted our attention. Its active incorporation and accumulation by platelets have been recognized. At first, the preparation of 125 I radioiodinated metaraminol ( 125 I-MA) was carried out using the chloramine-T method. Then, upon the harvest of platelets as platelet-rich plasma (PRP), their labeling with this new radiopharmaceutical was easily performed by incubation for 10 min at 37 0 C. The cell-labeling efficiency was dependent on cell density, reaching 63.0%+-3.1% at 2.4x10 9 cells/ml. The specific incorporation of 125 I-MA by an active transport system similar to that of 5-hydroxytryptamine (5-HT) as well as by passive diffusion was demonstrated. In vitro studies, the unaltered state of 125 I-MA-labeled platelets with their cellular functions fully retained was estimated. In vivo studies carried out in rabbits with induced thrombi in the femoral artery showed a rather rapid disappearance of the radioactivity from circulating blood, reaching a high thrombus-to-blood activity ratio of 19.8+-4.3 within 30 min of the administration of 125 I-MA-labeled autologous platelets. Thus, with the potential availability of 123 I, 123 I-MA-labeled platelets appear to be a promising agent for thrombus imaging using single-emission computed tomography (CT) studies. (orig.)
International Nuclear Information System (INIS)
McCormick, D.J.; Griesmann, G.E.; Huang, Z.; Lennon, V.A.
1986-01-01
A synthetic peptide corresponding to residues 125-147 of the Torpedo acetylcholine receptor (AChR) α subunit proved to be a major antigenic region of the AChR. Rats inoculated with 50 μg of peptide (T α 125-147) developed T cell immunity and antibodies to native AChR and signs of experimental autoimmune myasthenia gravis. They report the synthesis and preliminary testing of a disulfide-looped peptide comprising residues 125-147 of the human AChR α subunit. Peptide H α 125-147 differs from T α 125-147 at residues 139 (Glu for Gln) and 143 (Ser for Thr). In immunoprecipitation assays, antibodies to Torpedo AChR bound 125 I-labelled Hα 125-147 antibody bound Hα 125-147, but monoclonal antibodies to an immunodominant region of native AChR bound neither Hα 125-147 nor T α 125-147. Rats immunized with H α 125-147 produced anti-mammalian muscle AChR antibodies that induced modulation of AChRs from cultured human myotubes. Thus, region 125-147 of the human AChR α subunit is extracellular in muscle, and is both antigenic and immunogenic. It remains to be determined whether or not autoantibodies to this region may in part cause the weakness or myasthenia gravis in man
Inhomogeneity of the nucleus to 125IUdR cytotoxicity
International Nuclear Information System (INIS)
Yasui, L.S.; Hofer, K.G.; Warters, R.L.
1985-01-01
Synchronized suspension cultures of Chinese hamster ovary (CHO) cells were used to determine the lethal effects produced by the decay of 125 I incorporated into different subfractions of the nuclear genome. Such a shift in nuclear incorporation pattern was achieved by using the drug aphidicolin, which inhibits 95% of all nuclear DNA synthesis, is nontoxic to cells in a colony-forming assay, and does not modify the radiation response of CHO cells to X irradiation. These data in combination with survival curves of CHO cells labeled with 125 I-iododeoxyuridine ( 125 IUdR) either with or without aphidicolin showed a dramatic change in the survival response (D 0 : 30 decays/cell and 96 decays/cell, respectively). It is concluded, therefore, that the nucleus is not a homogeneous target for radiation-induced cell death because when subfractions of the nuclear genome are labeled, radically different levels in cell survival are obtained
Li, Xia; Wang, Bin; Li, Yuzhu; Wang, Li; Zhao, Xiangzhong; Zhou, Xianbin; Guo, Yuqi; Jiang, Guosheng; Yao, Chengfang
2013-01-09
The Th1/Th2/Th17/Treg paradigm plays an important role in achieving maternal-fetal immunotolerance and participates in RU486-induced abortion. Excessive uterine bleeding is the most common side effect of RU486-induced abortion; however, its etiopathogenesis has not been fully understood. Therefore, elucidating the correlation between the Th1/Th2/Th17/Treg paradigm and the volume of uterine bleeding may offer novel therapeutic target for reducing uterine bleeding in RU486-induced abortion. Leonurus sibiricus has been used in clinics to reduce postpartum hemorrhage with low toxicity and high efficiency; however, the effective constituents and therapeutic mechanism have not been described. Stachydrine hydrochloride is the main constituent of L. sibiricus, therefore L. sibiricus is regarded as a candidate for reducing uterine bleeding in RU486-induced abortion mice by regulating the Th1/Th2/Th17/Treg paradigm. The purpose of this study was to determine the Th1/Th2/Th17/Treg paradigm in uterine bleeding of RU486-induced abortion mice and to elucidate the immunopharmacologic effects of stachydrine hydrochloride on inducing the Th1/Th2/Th17/Treg paradigm in reducing the uterine bleeding volume in RU486-induced abortion mice. To investigate the Th1/Th2/Th17/Treg paradigm in uterine bleeding during RU486-induced abortion mice, pregnant BALB/c mice were treated with high- and low-dose RU486 (1.5mg/kg and 0.9 mg/kg, respectively), and the serum progesterone (P(4)) protein level, uterine bleeding volume, and proportions of Th1/Th2/Th17/Treg cells in mice at the maternal-fetal interface were detected by ELISA assay, alkaline hematin photometric assay, and flow cytometry, respectively. To determine the regulatory effect of stachydrine hydrochloride on the Th1/Th2/Th17/Treg paradigm in vitro, splenocytes of non-pregnant mice were separated and treated with P(4,) RU486, and/or stachydrine hydrochloride (10(-5)M, 10(-4)M, and 10(-3)M, respectively). The proportions of Th1/Th2/Th17
7 CFR 28.125 - No voiding or modifying claims for payment.
2010-01-01
... Section 28.125 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD... Standards Act Fees and Costs § 28.125 No voiding or modifying claims for payment. Nothing in this subpart...
Activated rat hepatic stellate cells influence Th1/Th2 profile in vitro.
Xing, Zhi-Zhi; Huang, Liu-Ye; Wu, Cheng-Rong; You, Hong; Ma, Hong; Jia, Ji-Dong
2015-06-21
To investigate the effects of activated rat hepatic stellate cells (HSCs) on rat Th1/Th2 profile in vitro. Growth and survival of activated HSCs and CD4(+) T lymphocytes cultured alone or together was assessed after 24 or 48 h. CD4(+) T lymphocytes were then cultured with or without activated HSCs for 24 or 48 h and the proportion of Th1 [interferon (IFN)-γ(+)] and Th2 [interleukin (IL)-4(+)] cells was assessed by flow cytometry. Th1 and Th2 cell apoptosis was assessed after 24 h of co-culture using a caspase-3 staining procedure. Differentiation rates of Th1 and Th2 cells from CD4(+) T lymphocytes that were positive for CD25 but did not express IFN-γ or IL-4 were also assessed after 48 h of co-culture with activated HSCs. Galectin-9 expression in HSCs was determined by immunofluorescence and Western blotting. ELISA was performed to assess galectin-9 secretion from activated HSCs. Co-culture of CD4(+) T lymphocytes with activated rat HSCs for 48 h significantly reduced the proportion of Th1 cells compared to culture-alone conditions (-1.73% ± 0.71%; P Th1/Th2 ratio was significantly decreased (-0.44 ± 0.13; P Th1 cells was decreased (-65.71 ± 9.67; P Th1 (12.27% ± 0.99%; P Th1 cell apoptosis rate was significantly higher than in Th2 cells (P Th1 and Th2 cells; however, the increase in the proportion of Th2 cells was significantly higher than that of Th1 cells (1.85% ± 0.48%; P Th1/Th2 profile, inhibiting the Th1 response and enhancing the Th2 response, and this may be a novel pathway for liver fibrogenesis.
Directory of Open Access Journals (Sweden)
Ayşe Binnur Erbağci
1999-01-01
Full Text Available Information on menstrual cycle dependent variation of tumor markers in healthy women is a subject of diagnostic efficiency and has an impact in elucidating the normal function of these markers. In this study midfollicular and midluteal concentrations of serum CEA, AFP, CA 19-9, CA 125, CA 15-3 and their relations with LH, FSH, prolactin, estradiol and progesterone were evaluated during ovulatory cycles in a group of 23 healthy female individuals. Samples were collected on the 7th and 21st day of the same menstrual cycle. Tumor marker and hormone concentrations were determined with chemiluminescence or electrochemiluminescence EIA methods. A significant phase-dependent difference was observed for CA 15-3, midluteal concentrations (mean ± SEM; 26.33 ± 1.56 U/ml higher than the midfollicular (mean ± SEM; 19.27 ± 1.49 U/ml concentrations (p < 0.001. But an obvious difference for other tumor markers investigated did not exist. Significant correlations of follicular and luteal CA 125 levels with body mass index of the subjects were observed (r:0.52, p < 0.05 and r:0.57, p < 0.005, respectively.
The role of Th1 and Th17 cells in glomerulonephritis.
Azadegan-Dehkordi, Fatemeh; Bagheri, Nader; Shirzad, Hedayatollah; Rafieian-Kopaei, Mahmoud
2015-04-01
T helper (Th) cells as an important part of the immune is responsible for elimination of invading pathogens. But, if Th cell responses are not regulated effectively, the autoimmune diseases might develop. The Th17 subset usually produces interleukin-17A which in experimental models of organ-specific autoimmune inflammation is very important. Directory of open access journals (DOAJ), Google Scholar, Embase, Scopus, PubMed and Web of Science have been searched. Fifty-six articles were found and searched. In the present review article, we tried to summarize the recently published data about characteristics and role of Th1 and Th17 cells and discuss in detail, the potential role of these T helpers immune responses in renal inflammation and renal injury, focusing on glomerulonephritis. Published papers in animal and human studies indicated that autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, classically believed to be Th1-mediated, are mainly derived from a Th17 immune response. Identification of the Th17 subgroup has explained seemingly paradoxical observations and improved our understanding of immune-mediated inflammatory responses. Secretion of IL-17A, as well as IL-17F, IL-21, IL-22, suggests that Th17 subset may play a crucial role as a pleiotropic pro-inflammatory Th subset. There is experimental evidence to support the notion that Th1 and Th17 cells contribute to kidney injury in renal inflammatory diseases like glomerulonephritis.
(E)-[125I]-5-AOIBV: a SPECT radioligand for the vesicular acetylcholine transporter
International Nuclear Information System (INIS)
Emond, Patrick; Mavel, Sylvie; Zea-Ponce, Yolanda; Kassiou, Michael; Garreau, Lucette; Bodard, Sylvie; Drossard, Marie-Laure; Chalon, Sylvie; Guilloteau, Denis
2007-01-01
The premise that, over the course of Alzheimer's disease (AD), changes in the levels of the vesicular acetylcholine transporter (VAChT) occur in parallel with changes to other cholinergic marker proteins provides the basis for the applicability of benzovesamicol derivatives as radioligands for AD studies by single photon emission computed tomography or positron emission tomography. We report the synthesis of enantiopure benzovesamicol derivatives: (R,R) or (S,S)-(E)-2-hydroxy-5-(3-iodoprop-2-en-1-oxy)-3- (4-phenylpiperidino)tetralin [(R,R)-AOIBV: K d =0.45 nM or (S,S)-5-AOIBV: K d =4.3 nM] and their corresponding tributyltin precursors for radioiodination. (R,R or S,S)-5-AOIBV was labeled with iodine-125 from their corresponding n-tributyltin precursors. Both compounds were obtained with radiochemical and optical purity greater than 97% and in radiochemical yields ranging 34-36%. To determine if these compounds could provide an advantage when compared to [ 125 I]-iodo benzovesamicol (IBVM), IBVM was also labeled and used as the reference compound in all ex vivo experiments. Ex vivo biodistribution experiments in rats revealed that [ 125 I]-(R,R)-5-AOIBV displayed the most suitable pharmacological profile as the radioactivity distribution corresponded well with the known VAChT brain density. Moreover, pre-injection of vesamicol prevented the uptake of [ 125 I]-(R,R)-5-AOIBV in striatum, cortex and hippocampus, demonstrating selectivity for the VAChT. However, even if time activity curves of [ 125 I]-(R,R)-5-AOIBV confirmed that this compound could be used to visualize the VAChT in vivo, at each point of the kinetic study, [ 125 I]-(R,R)-5-AOIBV showed a lower specific binding compared to [ 125 I]-IBVM. These results made [ 125 I]-( R,R)-5-AOIBV inferior to [ 125 I]-IBVM for the VAChT exploration in vivo
What about Th1/Th2 in cutaneous leishmaniasis vaccine discovery?
Directory of Open Access Journals (Sweden)
Campos-Neto A.
2005-01-01
Full Text Available The T helper cell type 1 (Th1 response is essential to resist leishmaniasis, whereas the Th2 response favors the disease. However, many leishmanial antigens, which stimulate a Th1 immune response during the disease or even after the disease is cured, have been shown to have no protective action. Paradoxically, antigens associated with an early Th2 response have been found to be highly protective if the Th1 response to them is generated before infection. Therefore, finding disease-associated Th2 antigens and inducing a Th1 immune response to them using defined vaccination protocols is an interesting unorthodox alternative approach to the discovery of a leishmania vaccine.
The preparation of 125I-β-CIT and its biological distribution in animal
International Nuclear Information System (INIS)
Sun Wenshan; Liu Zhenguo; Shen Minghua; Qian Juan; Li Peiyong; Zhu Chengmo; Chen Shengdi
2000-01-01
Objective: To prepare and label the 125 I-β-CIT and study its biological distribution in animal. Methods: 125 I-β-CIT was prepared by the peracetic acid method and the chloramine-T method, and dopamine transporter (DAT) binding properties of 125 I-β-CIT were examined by in vivo biodistribution and inhibition studies in mice and whole body autoradiography in rats. Results: The radiolabelling yields of the peracetic acid and the chloramine-T methods were (53.4 +- 7.9)% and (88.4 +- 3.49)%, respectively. Following intravenous injection in mice, 125 I-β-CIT showed high accumulation in striatum, time to peak level uptake was 2 h after injection. GBR12909 significantly inhibited 125 I-β-CIT binding in striatum, while clomipramine significantly inhibited 125 I-β-CIT binding in hippocampus and cerebral cortex. The rat whole body autoradiography showed that the clearance of the tracer occurred through the hepatobiliary route. Conclusions: The results indicate β-CIT is an agent suitable for DAT imaging and can be used for the study of Parkinson's disease
International Nuclear Information System (INIS)
Durham, R.W.; Joshi, S.R.
1979-01-01
A method is described for the determination of 228 Th, 230 Th, and 232 Th in environmental samples from uranium mining and milling operations. The analytical procedure is based on the direct determination of 228 Th in the sample by high resolution γ-spectrometry followed by extraction and purification of the thorium fraction using high molecular weight amines and an anion-exchange technique, respectively, prior to α-spectrometry to determine isotopic ratios. The lowest level of detection for each thorium isotope is 0.01 pCi/g for solid samples and 20 pCi/l for aqueous samples. Replicate analyses of a typical mine waste stream gave a standard deviation of +-3% for 228 Th. Standard deviations of the 230 Th and 232 Th increased to +-11% apparently due to traces of 210 Po interfering in the α-spectrometry. (author)
33 CFR 162.125 - Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sturgeon Bay and the Sturgeon Bay Ship Canal, Wisc. 162.125 Section 162.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY INLAND WATERWAYS NAVIGATION REGULATIONS § 162.125 Sturgeon Bay and the Sturgeon Bay Ship...
Kim, Jin Kyung; Yuk, Jae-Min; Kim, Soo Yeon; Kim, Tae Sung; Jin, Hyo Sun; Yang, Chul-Su; Jo, Eun-Kyeong
2015-06-01
MicroRNAs (miRNAs) are small noncoding nucleotides that play critical roles in the regulation of diverse biological functions, including the response of host immune cells. Autophagy plays a key role in activating the antimicrobial host defense against Mycobacterium tuberculosis. Although the pathways associated with autophagy must be tightly regulated at a posttranscriptional level, the contribution of miRNAs and whether they specifically influence the activation of macrophage autophagy during M. tuberculosis infection are largely unknown. In this study, we demonstrate that M. tuberculosis infection of macrophages leads to increased expression of miRNA-125a-3p (miR-125a), which targets UV radiation resistance-associated gene (UVRAG), to inhibit autophagy activation and antimicrobial responses to M. tuberculosis. Forced expression of miR-125a significantly blocked M. tuberculosis-induced activation of autophagy and phagosomal maturation in macrophages, and inhibitors of miR-125a counteracted these effects. Both TLR2 and MyD88 were required for biogenesis of miR-125a during M. tuberculosis infection. Notably, activation of the AMP-activated protein kinase significantly inhibited the expression of miR-125a in M. tuberculosis-infected macrophages. Moreover, either overexpression of miR-125a or silencing of UVRAG significantly attenuated the antimicrobial effects of macrophages against M. tuberculosis. Taken together, these data indicate that miR-125a regulates the innate host defense by inhibiting the activation of autophagy and antimicrobial effects against M. tuberculosis through targeting UVRAG. Copyright © 2015 by The American Association of Immunologists, Inc.
Clinical application of permanent implantation of iodine 125 seeds for osseous metastases
International Nuclear Information System (INIS)
Li Jinxin; Zhang Qizhou; Li Guoliang
2010-01-01
Objective: To evaluate the clinical efficacy of permanent implantation of iodine 125 seeds in the treatment of osseous metastases. Methods: Radioactive iodine 125 seeds were implanted permanently in 32 lesions of 25 patients with osseous metastases of different origins. The ostalgia-relieving degree and the imaging alterations of the osseous metastasis lesions were observed. Results: The effective pain-relieving rate was 92% caused by permanent implantation of iodine 125 seeds. Of al 1 the patients, 15 patients achieved complete response, 8 patients obtained partial response (PR), and 2 patients had no change. The pain grade was decreased significantly after the treatment (P 125 I seeds has a definite effect on tumor metastasis and caused minimal damage and few complications. It is worthy of popularization in clinic. (authors)
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J. M.; Grau Carles, A.
1994-07-01
A comparative study of performance of 19-iodo cholesterol {sup 1}25I 3-acetate and sodium iodide samples labeled with 125I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I concentration of 0-90 {mu}g and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol 1 I 3-acetate samples in Tolue ne-alcohol and 0 .04% for Na 125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs.
Kotake, Shigeru; Nanke, Yuki; Yago, Toru; Kawamoto, Manabu; Kobashigawa, Tsuyoshi; Yamanaka, Hisashi
2016-01-01
Rheumatoid arthritis (RA) is a chronic inflammatory disease characterized by the destruction of articular cartilage and bone with elevated levels of proinflammatory cytokines. It has been reported that IL-17 and Th17 cells play important roles in the pathogenesis of RA. Recently, plasticity in helper T cells has been demonstrated; Th17 cells can convert to Th1 cells. It remains to be elucidated whether this conversion occurs in the early phase of RA. Here, we tried to identify Th17 cells, Th1 cells, and Th17 cell-derived Th1 cells (CD161(+)Th1 cells) in the peripheral blood of early-onset RA patients. We also evaluated the effect of methotrexate on the ratio of Th17 cells in early-onset RA patients. The ratio of Th17 cell-derived Th1 cells to CD161(+)Th17 cells was elevated in the peripheral blood of early-onset RA patients. In addition, MTX reduced the ratio of Th17 cells but not Th1 cells. These findings suggest that IL-17 and Th17 play important roles in the early phase of RA; thus, anti-IL-17 antibodies should be administered to patients with RA in the early phase.
Binding of in vivo administrated 125-I-triiodothyronine by the rat liver mitochondria
International Nuclear Information System (INIS)
Fiedorowicz, K.; Nauman, A.; Nauman, J.
1979-01-01
In vivo administrated 125 I-triiodothyronine ( 125 I-T 3 ) was bound by the rat liver mitochondria. About 10 % of hormone was bound with external mitochondrial membrane while the remaining part with matrix and inner mitochondrial membrane. The highest accumulation of 125 I-T 3 in mitochondria was observed 30 min after injection while in the whole liver homogenate the highest hormone accumulation appeared 15 min post injection. Mitochondrial binding sites have a great capacity for T 3 which makes impossible estimation of the kinetic parameters of triiodothyronine-mitochondrium interaction by means of saturation and displacement of 125 I-T 3 . (author)
Festschrift Charpak (Georges) on his 65th birthday
Saudinos, Jean; Garwin, Richard L; Uggerhøj, Erik; CERN. Geneva
1989-01-01
On the occasion of the 65th birthday of Georges Charpak and of his retirement, the Director-General and the EP Division invite you to a symposium in his h. Chairman : P. Lehmann. - J. Saudinos : Quelques applications des détecteurs gazeux à la médecine et à la biologie. - E. Uggerhøj : New steps in the channeling of relativistic particles. - R. Garwin : Remarks from the non-physical world. - G. Charpak : Final speech.
14 CFR 125.375 - Fuel supply: Nonturbine and turbopropeller-powered airplanes.
2010-01-01
...) Thereafter, to fly for 45 minutes at normal crusing fuel consumption. (b) If the airplane is released for any...-powered airplanes. 125.375 Section 125.375 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... AND OPERATIONS CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE...
The relative biological effectiveness of I-125 and Pd-103
International Nuclear Information System (INIS)
Ling, C. Clifton; Li, William X.; Anderson, Lowell L.
1995-01-01
Purpose: To determine the relative biological effectiveness (RBE) of I-125 and Pd-103 relative to Co-60. Methods and Materials: A cell line REC:ras, derived from rat embryo cells, was used. Cells in exponential or plateau phase were irradiated at dose rates of about 0.07 Gy/h and 0.14 Gy/h. To circumvent the interface effect, cells were grown and irradiated on membranes made of cellulose acetate, which has an effective Z of 7.5. I-125 and Pd-103 seeds were placed in a custom designed template that yielded a homogeneous dose distribution in the plane of the cell culture. The dose rates of irradiation were measured by calibrated thermoluminescence dosimetry (TLD) chips. Results and Conclusions: Our measurements yielded an RBE of about 1.4 for I-125 at dose rates of about 0.07 Gy/h, and an RBE of about 1.9 for Pd-103 at dose rates of about 0.07 Gy/h and 0.14 Gy/h. The RBE of I-125 is similar to those measured by other investigators, the RBE for Pd-103 is being reported for the first time
International Nuclear Information System (INIS)
Alenfall, J.; Kant, R.; Batra, S.
1998-01-01
The effect of [ 125 I]PK 11195 was examined in human prostatic tumor cells (DU 145) in culture and compared with Na[ 125 I] and non-radioactive PK 11195. [ 125 I]PK 11195 was clearly cytocidal. The data for dose-related cell survival with [ 125 I]PK 11195 showed a linear relationship. Na[ 125 I] or non-labeled PK 11195 at similar concentrations did not lead to any cell killing. The uptake of [ 125 I]PK 11195 and [ 3 H]PK 11195 in cells was very similar. Fragmentation of DNA measured by agarose gel electrophoresis showed that exposure of DU 145 cells to [ 125 I]PK 11195 for 1, 4 or 24 h caused no fragmentation. These results indicate that nuclear DNA is not the prime binding site for [ 125 I]PK 11195, which is consistent with the presence of specific peripheral benzodiazepine receptors (PBZr) in the mitochondria. The cell killing effect of [ 125 I]PK 11195 suggests the use of PBZr ligand for radiotherapy
Report of a minor 125I exposure in a research laboratory
International Nuclear Information System (INIS)
Lambert, J.P.
1981-01-01
In routine thyroid scanning of personnel whose work involved the use of 125 I in biological research, it was discovered that an individual who had been iodinating proteins periodically for over 6 months showed a high thyroid count rate. It was decided to monitor the individual's thyroid weekly and to curtail his work in the laboratory until the cause of the thyroid uptake could be determined. Initially the 125 I concentration in his thyroid decreased as expected but a subsequent scan on the 21st day showed an 125 I concentration even greater than the initial level despite his absence from the laboratory. However on monitoring his office space, it was discovered that a felt pen was grossly contaminated and that the individual habitually put the pen in his mouth during moments of cogitation. It was concluded that a contaminated glove had transferred some 125 I to the pen during the course of the experiment. (U.K.)
Study of o-125I-benzoate excretion mechanisms in the rabbit
International Nuclear Information System (INIS)
Richter, R.; Laznicek, M.; Kvetina, J.; Laznickova, A.
1990-01-01
An analysis of the mechanisms of renal clearance of o- 125 I-benzoate in the rabbit based on the inhibition of the secretory transport by probenecid showed that o- 125 I-benzoate was eliminated in the kidneys not only by glomerular filtration but also by tubular secretion. The total amount of the drug excreted in the urine was affected by tubular resorption (apparently by the process of passive diffusion), which exceeded tubular secretion. A comparison of the chromatograms of the plasma and the urine before and after the competitive inhibition of the tubular active transport by probenecid revealed a higher amount of o- 125 I-benzoylglucuronide in the urine in the case of inhibition. The results suggest that the kidneys participated in the total biotransformation of o- 125 I-benzoate. The excretion of the original drug and metabolites in the bile contributed less than 1% to the total clearance in rabbits. (author). 3 figs., 3 tabs., 10 refs
Proceedings of the 10th ASIS SIG/CR classification research workshop
DEFF Research Database (Denmark)
This volume is a working copy of the papers presented at the 9th ASIS SIG/CR workshop on classification research, held in Washington, DC, at the ASIS Annual Meeting on Sunday 31 October 1999. The contributions printed here are working papers, and thus, not necessarily in their final form...
Riaz, Tahira; Sollid, Ludvig Magne; Olsen, Ingrid; de Souza, Gustavo Antonio
2016-03-01
T-helper cells are differentiated from CD4+ T cells and are traditionally characterized by inflammatory or immunosuppressive responses in contrast to cytotoxic CD8+ T cells. Mass-spectrometry studies on T-helper cells are rare. In this study, we aimed to identify the proteomes of human Th1 and Th1/Th17 clones derived from intestinal biopsies of Crohn's disease patients and to identify differentially expressed proteins between the two phenotypes. Crohn's disease is an inflammatory bowel disease, with predominantly Th1- and Th17-mediated response where cells of the "mixed" phenotype Th1/Th17 have also been commonly found. High-resolution mass spectrometry was used for protein identification and quantitation. In total, we identified 7401 proteins from Th1 and Th1/Th17 clones, where 334 proteins were differentially expressed. Major differences were observed in cytotoxic proteins that were overrepresented in the Th1 clones. The findings were validated by flow cytometry analyses using staining with anti-granzyme B and anti-perforin and by a degranulation assay, confirming higher cytotoxic features of Th1 compared with Th1/Th17 clones. By testing a larger panel of T-helper cell clones from seven different Crohn's disease patients, we concluded that only a subgroup of the Th1 cell clones had cytotoxic features, and these expressed the surface markers T-cell-specific surface glycoprotein CD28 and were negative for expression of natural killer group 2 member D. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Energy Technology Data Exchange (ETDEWEB)
Owens, Jonathan E-mail: j.owens@clinmed.gla.ac.uk; Tebbutt, Andrew A.; McGregor, Ailsa L.; Kodama, K.; Magar, Sharad S.; Perlman, Michael E.; Robins, David J.; Durant, Graham J.; McCulloch, James
2000-06-01
N-(1-Naphthyl)-N'-(3-[{sup 125}I]-iodophenyl)-N'-methylguanidine ([{sup 125}I]-CNS 1261) was synthesized as a potential radioligand to image N-methyl-D-aspartate (NMDA) receptor activation. [{sup 125}I]-CNS 1261 was prepared by radioiodination of N-(1-naphthyl)-N'-(3-tributylstannylphenyl)-N'-methylguanidine using Na{sup 125}I and peracetic acid. [{sup 125}I]-CNS 1261 uptake in vivo reflected NMDA receptor distribution in normal rat brain, whereas in ischemic rat brain, uptake was markedly increased in areas of NMDA receptor activation. Radiolabeled CNS 1261 appears to be a good candidate for further development as a single photon emission computed tomography tracer in the investigation of NMDA receptor activation in cerebral ischemia.
Energy Technology Data Exchange (ETDEWEB)
Maneschg, W., E-mail: werner.maneschg@mpi-hd.mpg.de [Max Planck Institut fuer Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany); Baudis, L. [Physik Institut der Universitaet Zuerich, Winterthurerstrasse 190, CH-8057 Zuerich (Switzerland); Dressler, R. [Paul Scherrer Institut, CH-5232 Villigen (Switzerland); Eberhardt, K. [Institut fuer Kernchemie, Universitaet Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Eichler, R. [Paul Scherrer Institut, CH-5232 Villigen (Switzerland); Keller, H. [Institut fuer Kernchemie, Universitaet Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Lackner, R. [Max Planck Institut fuer Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany); Praast, B. [Institut fuer Kernchemie, Universitaet Mainz, Fritz-Strassmann-Weg 2, D-55128 Mainz (Germany); Santorelli, R. [Physik Institut der Universitaet Zuerich, Winterthurerstrasse 190, CH-8057 Zuerich (Switzerland); Schreiner, J. [Max Planck Institut fuer Kernphysik, Saupfercheckweg 1, D-69117 Heidelberg (Germany); Tarka, M. [Physik Institut der Universitaet Zuerich, Winterthurerstrasse 190, CH-8057 Zuerich (Switzerland); Wiegel, B.; Zimbal, A. [Physikalisch-Technische Bundesanstalt, Bundesallee 100, D-38116 Braunschweig (Germany)
2012-07-11
A custom-made {sup 228}Th source of several MBq activities was produced for the Borexino experiment to study the external background of the detector. The aim was to reduce the unwanted neutron emission produced via ({alpha},n) reactions in ceramics typically used for commercial {sup 228}Th sources. For this purpose a ThCl{sub 4} solution was chemically converted into ThO{sub 2} and embedded in a gold foil. The paper describes the production of the custom-made source and its characterization by means of {gamma}-activity, dose rate and neutron source strength measurements. From {gamma}-spectroscopic measurements it was deduced that activity transfer from the initial solution to the final source was >91% (at 68% C.L.) and the final activity was (5.41{+-}0.30) MBq. The dose rate was measured with two dosimeters yielding 12.1 mSv/h and 14.3 mSv/h in 1 cm distance. The neutron source strength of the 5.41 MBq {sup 228}Th source was determined to be (6.59{+-}0.85) s{sup -1}.
International Nuclear Information System (INIS)
Rolison, J.M.; Treinen, K.C.; McHugh, K.C.; Gaffney, A.M.; Williams, R.W.
2017-01-01
Uranium certified reference materials (CRM) issued by New Brunswick Laboratory were subjected to dating using four independent uranium-series radiochronometers. In all cases, there was acceptable agreement between the model ages calculated using the 231 Pa- 235 U, 230 Th- 234 U, 227 Ac- 235 U or 226 Ra- 234 U radiochronometers and either the certified 230 Th- 234 U model date (CRM 125-A and CRM U630), or the known purification date (CRM U050 and CRM U100). The agreement between the four independent radiochronometers establishes these uranium certified reference materials as ideal informal standards for validating dating techniques utilized in nuclear forensic investigations in the absence of standards with certified model ages for multiple radiochronometers. (author)
Directory of Open Access Journals (Sweden)
N. L Vaquero
2010-09-01
Full Text Available La enfermedad de Hansen producida por el Mycobacterium leprae, es una enfermedad infecciosa cuyo amplio espectro clínico e inmunopatológico se correlaciona con los diferentes patrones de respuesta Th1/Th2. La activación preferencial de esas subpoblaciones de linfocitos T CD4 juega un rol importante en su patogenia y constituye un modelo natural de esa dicotomía de la respuesta inmune. Ambas formas polares de la lepra presentan un perfil definido de secreción de citoquinas: Th1 (IL2 e IFN? en el polo tuberculoide y Th2 (IL4, IL5, IL10 en el polo lepromatoso. En el primer caso, la respuesta celular adecuada estimula la activación macrofágica y lleva a la destrucción del bacilo. Las lesiones son escasas y limitadas a la piel y nervios periféricos. En el segundo en cambio, la respuesta celular es casi nula y los bacilos se multiplican descontroladamente dentro de los macrófagos, llevando a la diseminación de las lesiones y afectación de otros órganos. La inmunidad humoral está exacerbada y hay un alto nivel de anticuerpos que no pueden eliminar el germen intracelular. Los factores que determinan la diferenciación hacia una respuesta Th1 ó Th2 no se han esclarecido totalmente. Se han postulado varias hipótesis que hacen referencia a factores genéticos, prevalencia de citoquinas en el microambiente celular, disfunción macrofágica; alteración en los receptores Toll de la inmunidad innata, en la expresión de moléculas coestimulatorias, etc En los últimos años se han descubierto nuevas subpoblaciones de linfocitos, (CD4+ CD25+, Tr1, Th3 y Th17 que estarían implicadas en la desregulación de estas respuestas inmunes.Hansen' disease, caused by Mycobacterium leprae, is an infectious illness whose wide clinical and immunopathologic spectrum correl with different Th1/Th2 responses patterns. The prefferencial activation of the CD4 T cells subset play an important rol in it's pathogenia and provides a natural model of that balance
1992-05-08
rations were the primary ration, augmented with local foodstuffs and always plentiful supplies of sodas, juices and fresh fruit. Despite some media ... mushroomed throughout the ’heater. The XVIII Airborne Corps Chief of Staff issued a scathing message to all CONUS, COMMZ and theater medical elements...Large 12s ex 4 ..... Staple i-I S5 Medium 12’s BX 1 --- Staple~ PI 1 Larqe 12S BDA I1 Staple P1 35) M,.d iu m 125 BX 2 379 -007th Medical Battalion
Choi, Mi Hee; Shim, Ha Eun; Yun, Seong-Jae; Kim, Hye Rim; Mushtaq, Sajid; Lee, Chang Heon; Park, Sang Hyun; Choi, Dae Seong; Lee, Dong-Eun; Byun, Eui-Baek; Jang, Beom-Su; Jeon, Jongho
2016-04-19
In this report, we present a rapid and highly efficient method for radioactive iodine labeling of trans-cyclooctene group conjugated biomolecules using inverse-electron-demand Diels-Alder reaction. Radioiodination reaction of the tetrazine structure was carried out using the stannylated precursor 2 to give 125 I-labeled azide ([ 125 I]1) with high radiochemical yield (65±8%) and radiochemical purity (>99%). For radiolabeling application of [ 125 I]1, trans-cyclooctene derived cRGD peptide and human serum albumin were prepared. These substrated were reacted with [ 125 I]1 under mild condition to provide the radiolabeled products [ 125 I]6 and [ 125 I]8, respectively, with excellent radiochemical yields. The biodistribution study of [ 125 I]8 in normal ICR mice showed significantly lower thyroid uptake values than that of 125 I-labeled human serum albumin prepared by a traditional radiolabeling method. Therefore [ 125 I]8 will be a useful radiolabeled tracer in various molecular imaging and biological studies. Those results clearly demonstrate that [ 125 I]1 will be used as a valuable prosthetic group for radiolabeling of biomolecules. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Reinhardt, T.A.; Horst, R.L.
1986-01-01
The authors examined the effect of 1,25-(OH) 2 D 3 on receptor concentration in cultured cells (T-47D). Two days prior to experiment, cells were fed with RPMI 1640 + 10% serum and 24-32 hours prior to experiment the media was replaced with RPMI 1640 + 25 mM Hepes + 1% serum. [ 3 H]-1,25-(OH) 2 D 3 +/- 100-fold molar excess cold hormone was used to treat the cells. Occupied receptors were measured in freshly prepared cytosols. Total receptors were measured following a 16-hour incubation of cytosols in the presence of 0.6 nM [ 3 H]-1,25-(OH) 2 D 3 +/- 100-fold molar excess of cold hormone at 4 0 C. Treatment of cell cultures for 16-18 hours with 0.5-1.0 nM [ 3 H]-1,25-(OH) 2 D 3 resulted in a 30-40% receptor occupancy by the hormone and a 2- to 3-fold increase in total cell receptor as compared to vehicle-treated controls. Time course studies showed a rapid increase in total receptors up to 16 hours post-treatment in the face of declining receptor occupancy. Actinomycin D blocked the [ 3 H]-1,25-(OH) 2 D 3 -dependent rise in cell receptor. The physiological significance of this receptor upregulation is not known nor is it known whether upregulation results from synthesis of new receptors and/or is the result of the activation of preformed receptors by a inducible activator protein
International Nuclear Information System (INIS)
McCannel, Tara A.; McCannel, Colin A.
2014-01-01
Purpose: We initially reported the radiation-attenuating effect of silicone oil 1000 centistokes for iodine 125. The purpose of this report was to compare the clinical outcomes in case patients who had iodine 125 brachytherapy with vitrectomy and silicone oil 1000 centistokes with the outcomes in matched control patients who underwent brachytherapy alone. Methods and Materials: Consecutive patients with uveal melanoma who were treated with iodine 125 plaque brachytherapy and vitrectomy with silicone oil with minimum 1-year follow-up were included. Control patients who underwent brachytherapy alone were matched for tumor size, location, and sex. Baseline patient and tumor characteristics and tumor response to radiation, final visual acuity, macular status, central macular thickness by ocular coherence tomography (OCT), cataract progression, and metastasis at last follow-up visit were compared. Surgical complications were also determined. Results: Twenty case patients met the inclusion criteria. The average follow-up time was 22.1 months in case patients and 19.4 months in control patients. The final logMAR vision was 0.81 in case patients and 1.1 in control patients (P=.071); 8 case patients and 16 control patients had abnormal macular findings (P=.011); and the average central macular thickness by OCT was 293.2 μm in case patients and 408.5 μm in control patients (P=.016). Eleven case patients (55%) and 1 control patient (5%) had required cataract surgery at last follow-up (P=.002). Four patients in the case group and 1 patient in the control group experienced metastasis (P=.18). Among the cases, intraoperative retinal tear occurred in 3 patients; total serous retinal detachment and macular hole developed in 1 case patient each. There was no case of rhegmatogenous retinal detachment, treatment failure, or local tumor dissemination in case patients or control patients. Conclusions: With up to 3 years of clinical follow-up, silicone oil during brachytherapy
Energy Technology Data Exchange (ETDEWEB)
McCannel, Tara A., E-mail: TMcCannel@jsei.ucla.edu; McCannel, Colin A.
2014-06-01
Purpose: We initially reported the radiation-attenuating effect of silicone oil 1000 centistokes for iodine 125. The purpose of this report was to compare the clinical outcomes in case patients who had iodine 125 brachytherapy with vitrectomy and silicone oil 1000 centistokes with the outcomes in matched control patients who underwent brachytherapy alone. Methods and Materials: Consecutive patients with uveal melanoma who were treated with iodine 125 plaque brachytherapy and vitrectomy with silicone oil with minimum 1-year follow-up were included. Control patients who underwent brachytherapy alone were matched for tumor size, location, and sex. Baseline patient and tumor characteristics and tumor response to radiation, final visual acuity, macular status, central macular thickness by ocular coherence tomography (OCT), cataract progression, and metastasis at last follow-up visit were compared. Surgical complications were also determined. Results: Twenty case patients met the inclusion criteria. The average follow-up time was 22.1 months in case patients and 19.4 months in control patients. The final logMAR vision was 0.81 in case patients and 1.1 in control patients (P=.071); 8 case patients and 16 control patients had abnormal macular findings (P=.011); and the average central macular thickness by OCT was 293.2 μm in case patients and 408.5 μm in control patients (P=.016). Eleven case patients (55%) and 1 control patient (5%) had required cataract surgery at last follow-up (P=.002). Four patients in the case group and 1 patient in the control group experienced metastasis (P=.18). Among the cases, intraoperative retinal tear occurred in 3 patients; total serous retinal detachment and macular hole developed in 1 case patient each. There was no case of rhegmatogenous retinal detachment, treatment failure, or local tumor dissemination in case patients or control patients. Conclusions: With up to 3 years of clinical follow-up, silicone oil during brachytherapy
2012-06-22
... From the People's Republic of China: Alignment of Final Countervailing Duty Determination With Final... People's Republic of China (PRC) with the final determination in the companion antidumping duty (AD..., 14th Street and Constitution Avenue NW., Washington, DC 20230; telephone: 202-482-4793 and 202-482-1503...
Iodine-125 metaraminol: A new platelet specific labeling agent
International Nuclear Information System (INIS)
Ohmomo, Y.; Yokoyama, A.; Kawaii, K.; Horiuchi, K.; Saji, H.; Torizuka, K.
1984-01-01
In the search for a platelet specific labeling agent, Metaraminol (MA), which is a sympatomimetic amine used for the treatment of hypotension, cardiogenic shock and well recognized as a drug actively incorporated and accumulated in platelet, attracted the authors' attention. Using the classical chloramine-T iodination method, a high labeling efficiency near 98%, reaching a specific activity up to about 1000 Ci/mmole was obtained. Upon the harvest of platelet, only as platelet rich plasma (PRP), the labeling with this radiopharmaceutical was easily performed by incubation at 37 0 C for 10 min. Labeling efficiency as high as 63.0 +- 3.1% at 24 x 10/sup 8/ cells/ml was obtained. In in-vitro studies, the unaltered state of I-125 MA labeled platelet, with their cellular functions fully retained was demonstrated. Pharmacological study indicated a specific incorporation of I-125 MA by active transport system similar to that of 5-HT, along with passive diffusion. Then the in-vivo study carried out in rabbits with induced thrombi on the femoral artery, showed rather rapid disappearance of the I-125 MA labeled autologous platelet radioactivity, from circulating blood reaching as high thrombus-to-blood activity ratio as 19.8+-4.3 within 30 min post-administration. This new platelet labeling agent, I-125 MA, has many advantages over the use of IN-111 oxine and holds considerable promise for thrombus imaging with single photon emission CT upon the availability of I-123 MA
Iodine-125 radiation of posterior uveal melanoma
International Nuclear Information System (INIS)
Packer, S.
1987-01-01
Twenty-eight cases of posterior choroidal melanoma were treated with iodine-125 in gold eye plaques. Eleven cases were located within 3.0 mm of the optic nerve (group A), nine were within 3.0 mm of the fovea (group B), and eight were within 3.0 mm of the optic nerve and fovea (group C). The mean follow-up of group A was 46.3 months; group B, 25.5 months; and group C, 42.7 months. Complications included macular edema, cataract and tumor growth. Visual acuity remained within two lines of that tested preoperatively for 4 of 11 patients in group A, 4 of 9 in group B, and 5 of 8 in group C. These results with iodine-125 suggest it as an appropriate treatment for patients with choroidal melanoma located near optic nerve and/or macula
Iodine-125 radiation of posterior uveal melanoma
Energy Technology Data Exchange (ETDEWEB)
Packer, S.
1987-12-01
Twenty-eight cases of posterior choroidal melanoma were treated with iodine-125 in gold eye plaques. Eleven cases were located within 3.0 mm of the optic nerve (group A), nine were within 3.0 mm of the fovea (group B), and eight were within 3.0 mm of the optic nerve and fovea (group C). The mean follow-up of group A was 46.3 months; group B, 25.5 months; and group C, 42.7 months. Complications included macular edema, cataract and tumor growth. Visual acuity remained within two lines of that tested preoperatively for 4 of 11 patients in group A, 4 of 9 in group B, and 5 of 8 in group C. These results with iodine-125 suggest it as an appropriate treatment for patients with choroidal melanoma located near optic nerve and/or macula.
Vitamin D and 1,25(OH2D Regulation of T cells
Directory of Open Access Journals (Sweden)
Margherita T. Cantorna
2015-04-01
Full Text Available Vitamin D is a direct and indirect regulator of T cells. The mechanisms by which vitamin D directly regulates T cells are reviewed and new primary data on the effects of 1,25 dihydroxyvitamin D (1,25(OH2D on human invariant natural killer (iNKT cells is presented. The in vivo effects of vitamin D on murine T cells include inhibition of T cell proliferation, inhibition of IFN-γ, IL-17 and induction of IL-4. Experiments in mice demonstrate that the effectiveness of 1,25(OH2D requires NKT cells, IL-10, the IL-10R and IL-4. Comparisons of mouse and human T cells show that 1,25(OH2D inhibits IL-17 and IFN-γ, and induces T regulatory cells and IL-4. IL-4 was induced by 1,25(OH2D in mouse and human iNKT cells. Activation for 72h was required for optimal expression of the vitamin D receptor (VDR in human and mouse T and iNKT cells. In addition, T cells are potential autocrine sources of 1,25(OH2D but again only 48–72h after activation. Together the data support the late effects of vitamin D on diseases like inflammatory bowel disease and multiple sclerosis where reducing IL-17 and IFN-γ, while inducing IL-4 and IL-10, would be beneficial.
Nuovo, Gerard J; Wu, Xin; Volinia, Stefano; Yan, Fengting; di Leva, Gianpiero; Chin, Nena; Nicol, Alcina F; Jiang, Jinmai; Otterson, Gregory; Schmittgen, Thomas D; Croce, Carlo
2010-09-01
Infection by the human papillomavirus (HPV) is a cause of cervical intraepithelial neoplasia (CIN) and cancer. microRNA (miRNA) in situ analysis of the transformation zone epithelia, the site of initial cervical HPV infection, showed that miRNAs let-7c, -99a, 26a, and 125b were the most abundantly expressed. In situ testing of CIN 1 showed a dramatic reduction in miR-125b expression in the koilocytes, the cytologic marker of productive HPV infection. A marked reduction in miR-125b was likewise observed in the HPV-infected cells of the condyloma acuminatum, verruca vulgaris, and epidermodysplasia verruciformis. Reverse transcriptase in situ polymerase chain reaction (PCR) showed that the pre-miRNA 125b was present in the koilocyte, suggesting direct inactivation of the mature miRNA. HEK cells transfected with only the antimiR-125b showed perinuclear halos equivalent to HPV-infected koilocytes. NIH 3T3 cells transfected with the HPV 16 full-length genome and mimetic miR-125b showed a marked reduction in viral DNA and protein synthesis by quantitative PCR and in situ-based analyses, respectively (P=0.002). Alternatively, cotransfection with anti-miR-125b and HPV 16 markedly increased HPV DNA (P=0.002). Sequence analyses showed strong homology between L2 of different HPV genotypes and miR-125b. Transfection with HPV 16 L2 resulted in a marked reduction in miR-125b levels in the NIH 3T3 cells. HPV L2-induced inactivation of miR-125b is associated with the classic cytologic changes of the koilocyte, and the exogenous application of mimetic miR-125b markedly inhibits HPV DNA synthesis.
MicroRNA-125 family members exert a similar role in the regulation of murine hematopoiesis.
Wojtowicz, Edyta E; Walasek, Marta A; Broekhuis, Mathilde J C; Weersing, Ellen; Ritsema, Martha; Ausema, Albertina; Bystrykh, Leonid V; de Haan, Gerald
2014-10-01
MicroRNAs (miRNAs) are crucial for proper functioning of hematopoietic stem and progenitor cells (HSPCs). Members of the miRNA-125 family (consisting of miR-125a, miR-125b1, and miR-125b2) are known to confer a proliferative advantage on cells upon overexpression, to decrease the rate of apoptosis by targeting proapoptotic genes, and to promote differentiation toward the myeloid lineage in mice. However, many distinct biological effects of the three miR-125 species have been reported as well. In the current study, we set out to assess whether the three miRNA-125s that carry identical seed sequences could be functionally different. Our data show that overexpression of each of the three miR-125 family members preserves HSPCs in a primitive state in vitro, results in a competitive advantage upon serial transplantation, and promotes skewing toward the myeloid lineage. All miR-125 family members decreased the pool of phenotypically defined Lin(-)Sca(+)Kit(+)CD48(-)CD150(+) long-term hematopoietic stem cells, simultaneously increasing the self-renewal activity upon secondary transplantation. The downregulation of miR-125s in hematopoietic stem cells abolishes these effects and impairs long-term contribution to blood cell production. The introduction of a point mutation within the miRNA-125 seed sequence abolishes all abovementioned effects and leads to the restoration of normal hematopoiesis. Our results show that all miR-125 family members are similar in function, they likely operate in a seed-sequence-dependent manner, and they induce a highly comparable hematopoietic phenotype. Copyright © 2014 ISEH - International Society for Experimental Hematology. Published by Elsevier Inc. All rights reserved.
Röper, Barbara; Kaisig, Danielle; Auer, Florian; Mergen, Ertan; Molls, Michael
2004-05-01
In radiotherapy of the breast following breast-conserving surgery, the adverse reaction predominantly found is confined to the skin. After phase II studies, Thêta-Cream, containing CM Glucan, Hydroxyprolisilan C und Matrixyl as active substances, was said to have prophylactic properties of preventing acute radiation side effects in skin tissue. In a prospective randomized study, Thêta-cream was compared with standard skin care using Bepanthol lotion. 20 breast cancer patients were randomly assigned to use Thêta-Cream or Bepanthol lotion during radiotherapy. At 0, 30, and 50 Gy, acute skin toxicity was scored with a modified RTOG scoring system. The patients' content with the skin care and the technical assistants' content with the skin marks were recorded. For single aspects of toxicity and their sums in defined skin areas, no differences in median and range between study groups were found. The maximal toxicity anywhere in the breast averaged in a moderate erythema, mild elevation of skin temperature, no desquamation in both groups. Mild itchiness and sporadic efflorescences were more frequently seen with Thêta-Cream. According to a ranking of anonymized breast photos at 50 Gy by independent investigators, side effects were equal. Patients' content was high with both skin care regimens (1.25 on a scale from 0 to 10). With Thêta-Cream a trend toward worse skin marks was noted. Adverse events exclusively occurred in Thêta-Cream users: suspected allergic reaction once, and the necessity for resimulation twice. In direct comparison with dexpanthenol-containing lotion, no advantage for Thêta-Cream was found. Higher costs and problems with skin marks prevent a general recommendation.
{sup 125}I-iomazenil-benzodiazepine receptor binding during psychological stress in rats
Energy Technology Data Exchange (ETDEWEB)
Fukumitsu, Nobuyoshi; Tsuchida, Daisuke; Ogi, Shigeyuki; Uchiyama, Mayuki; Mori, Yutaka [Jikei Univ., Tokyo (Japan). School of Medicine
2002-05-01
We investigated the changes in {sup 125}I-iomazenil ({sup 125}I-IMZ) benzodiazepine receptor (BZR) binding with psychological stress in a rat model. Six male Wistar rats were placed under psychological stress for 1 hour by using a communication box. No physical stress was not received. 1.85 MBq of {sup 125}I-IMZ was injected into the lateral tail vein and the rat was killed 3 hours later. Twenty-micormeter-thick sections of the brain were collected and % injected dose per body weight (% ID/BW) of eleven regions (frontal, parietal, temporal, occipital cortices, caudate putamen, accumubens nuclei, globus pallidus, amygdala, thalamus, hippocampus and hypothalamus) were calculated by autoradiography. The %ID/BW of rats which were placed under psychological stress was compared with that of 6 control rats. The %ID/BW of rats which were placed under psychological stress diffusely tended to show a reduction in {sup 125}I-IMZ-BZR binding. A significant decrease in BZR binding was observed in the hippocampus of the rats which were placed under psychological stress. {sup 125}I-IMZ-BZR binding tended to decrease throughout the brain. (author)
1,25D3 enhances antitumor activity of gemcitabine and cisplatin in human bladder cancer models
Ma, Yingyu; Yu, Wei-Dong; Trump, Donald L.; Johnson, Candace S.
2010-01-01
Background 1,25 dihydroxyvitamin D3 (1,25D3) potentiates the cytotoxic effects of several common chemotherapeutic agents. The combination of gemcitabine and cisplatin (GC) is a current standard chemotherapy regimen for bladder cancer. We investigated whether 1,25D3 could enhance the antitumor activity of GC in bladder cancer model systems. Methods Human bladder cancer T24 and UMUC3 cells were pretreated with 1,25D3 followed by GC. Apoptosis were assessed by annexin V staining. Caspase activation was examined by immunoblot analysis and substrate-based caspase activity assay. The cytotoxic effects were examined using MTT and in vitro clonogenic assay. p73 protein levels were assessed by immunoblot analysis. Knockdown of p73 was achieved by siRNA. The in vivo antitumor activity was assessed by in vivo excision clonogenic assay and tumor regrowth delay in the T24 xenograft model. Results 1,25D3 pretreatment enhanced GC-induced apoptosis and the activities of caspases- 8, 9 and 3 in T24 and UMUC3 cells. 1,25D3 synergistically reduced GC-suppressed surviving fraction in T24 cells. 1,25D3, gemcitabine, or cisplatin induced p73 accumulation, which was enhanced by GC or 1,25D3 and GC. p73 expression was lower in human primary bladder tumor tissue compared with adjacent normal tissue. Knockdown of p73 increased clonogenic capacity of T24 cells treated with 1,25D3, GC or 1,25D3 and GC. 1,25D3 and GC combination enhanced tumor regression compared with 1,25D3 or GC alone. Conclusions 1,25D3 potentiates GC-mediated growth inhibition in human bladder cancer models in vitro and in vivo, which involves p73 induction and apoptosis. PMID:20564622
MicroRNA-125b Affects Vascular Smooth Muscle Cell Function by Targeting Serum Response Factor
Directory of Open Access Journals (Sweden)
Zhibo Chen
2018-04-01
Full Text Available Background/Aims: Increasing evidence links microRNAs to the pathogenesis of peripheral vascular disease. We recently found microRNA-125b (miR-125b to be one of the most significantly down‑regulated microRNAs in human arteries with arteriosclerosis obliterans (ASO of the lower extremities. However, its function in the process of ASO remains unclear. This study aimed to investigate the expression, regulatory mechanisms, and functions of miR-125b in the process of ASO. Methods: Using the tissue explants adherent method, vascular smooth muscle cells (VSMCs were prepared for this study. A rat carotid artery balloon injury model was constructed to simulate the development of vascular neointima, and a lentiviral transduction system was used to overexpress serum response factor (SRF or miR-125b. Quantitative real‑time PCR (qRT‑PCR was used to detect the expression levels of miR‑125b and SRF mRNA. Western blotting was performed to determine the expression levels of SRF and Ki67. In situ hybridization analysis was used to analyze the location and expression levels of miR-125b. CCK-8 and EdU assays were used to assess cell proliferation, and transwell and wound closure assays were performed to measure cell migration. Flow cytometry was used to evaluate cell apoptosis, and a dual-luciferase reporter assay was conducted to examine the effects of miR‑125b on SRF. Immunohistochemistry and immunofluorescence analyses were performed to analyze the location and expression levels of SRF and Ki67. Results: miR-125b expression was decreased in ASO arteries and platelet-derived growth factor (PDGF-BB-stimulated VSMCs. miR-125b suppressed VSMC proliferation and migration but promoted VSMC apoptosis. SRF was determined to be a direct target of miR-125b. Exogenous miR-125b expression modulated SRF expression and inhibited vascular neointimal formation in balloon-injured rat carotid arteries. Conclusions: These findings demonstrate a specific role of the mi
Biodistribution analysis of 125I-albumin-IFN-alpha2b fusion protein in rats
International Nuclear Information System (INIS)
Zhou Yaoyuan; Zhang Rongjun; Cai Gangming; Gu Xiaobo; Jiang Mengjun; Zhang Bo; Yang Min; Cao Guoxian; Yang Jianliang
2009-01-01
125 I-albumin-IFN-alpha2b was prepared with the methods of Ch-T and purified with PD-10 column. The radiochemical purity was measured with TCA (trichloroacetic acid) precipitation. The antiviral activities of 125 I-albumin-IFN-alpha2b and albumin-IFN-alpha2b were compared with WISH/VSV system in vitro. SD rats were injected with 125 I-albumin-IFN-alpha2b subcutaneously and sacrificed at 0.5, 2, 6, 24, 48, 90, 180 and 300 h post-injection. Selected organs were dissected, weighed and their radioactivity was measured using γ-counter. The accumulated radioactivity in the tissues was calculated in terms of percentage of injected dose per gram organ (%ID·g -1 ). The labeling yield was 82.72%. The radiochemical purity of 125 I-albumin-IFN-alpha2b was 95.53%, and its radioactivity was 0.26 MBq/μg. The antiviral bioactivities of albumin-IFN-alpha2b and 125 I-albumin- IFN-alpha2b did not change. Biodistribution analysis of 125 I-albumin-IFN-alpha2b in rats showed that concentrated 125 I-albumin-IFN-alpha2b in blood reached maximum at 6 h post injection, and eliminated slowly. No specific accumulation was seen in other tissues. 125 I-albumin-IFN-alpha2b could maintain in peripheral blood for a long time and it meant albumin-IFN-alpha2b would be an effective long-term interferon. (authors)
Methodology of quality control for brachytherapy {sup 125}I seeds
Energy Technology Data Exchange (ETDEWEB)
Moura, Eduardo S.; Zeituni, Carlos A.; Manzoli, Jose E.; Rostelato, Maria Elisa C.M. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)]. E-mail: esmoura@ipen.br
2007-07-01
This paper presents the methodology of quality control of {sup 125}I seeds used for brachytherapy. The {sup 125}I seeds are millimeter titanium capsules widely used in permanent implants of prostate cancer, allowing a high dose within the tumour and a low dose on the surrounding tissues, with very low harm to the other tissues. Besides, with this procedure, the patients have a low impotence rate and a small incidence of urinary incontinence. To meet the medical standards, an efficient quality control is necessary, showing values with the minimum uncertainness possible, concerning the seeds dimensions and their respective activities. The medical needles are used to insert the seeds inside the prostate. The needles used in brachytherapy have an internal diameter of 1.0 mm, so it is necessary {sup 125}I seeds with an external maximum diameter of 0.85 mm. For the seeds and the spacer positioning on the planning sheet, the seeds must have a length between 4.5 and 5.0 mm. The activities must not vary more than 5% in each batch of {sup 125}I seeds. For this methodology, we used two ionization chamber detectors and one caliper. In this paper, the methodology using one control batch with 75 seeds manufactured by GE Health care Ltd is presented. (author)
Ovarian Fibroma with Meigs Syndrome associated with Elevated CA125 - A Rare Case
Directory of Open Access Journals (Sweden)
Prasad. K. Shetty
2010-07-01
Full Text Available Postmenopausal women with solid adnexal masses, ascites and pleural effusion with elevated CA 125 are highly suggestive for malignant ovarian tumor. However in literature 28 cases Meigs syndrome (Benign ovarian tumor, ascites and right pleural effusion with raised CA 125 have been reported. We report a case of Meigs syndrome caused by right ovarian fibroma with elevated serum CA125 level in a postmenopausal woman
International Nuclear Information System (INIS)
2016-01-01
Preface: The 6th Asian Physics Symposium 2015 (APS 2015) The 6th Asian Physics Symposium 2015 (APS 2015) is organized by the Physics Department, Faculty of Mathematics and Natural Sciences, Bandung Institute of Technology, in collaboration with HFI (Indonesian Physical Society), PAPSI (Physics and Applied Physics Society of Indonesia), HANI (Indonesian Nuclear Scientist Society), HRMI (Indonesian Material Research Society), HAGI (Indonesian Geophysicist Society) - West Java Chapter, and HFMBI (Indonesian Medical Physicist and Biophysicist Society). APS 2015 is aimed at providing a forum of scientific communication and interaction among distinguished scientists working in physics and its related fields. In this scientific event the latest research will be presented, and state-of-the-art developments in the field discussed, to help to guide our future research directions. It is also designed to offer the opportunity for young Indonesian scientists and students to make direct contacts with well-known scientists abroad and thereby foster the existing research collaborations and extend international research networking for the future. The scope of research presented and discussed in this symposium covers theoretical high energy physics, materials sciences and technology, biophysics and medical physics, nuclear science and engineering, earth and planetary sciences, computational physics, instrumentation and measurement, physics education, and interdisciplinary physics. The program of APS 2016 features 6 invited talks and 208 contributed oral presentations, which come from 7 different countries: Japan, South Korea, Singapore, Malaysia, Iraq, Ethiopia, and Indonesia. All papers have been reviewed after they are presented in this event. Selected papers are published in this Institute of Physics (IoP) Conference Series. Finally, I would like to express my sincere appreciation to all of authors for their valuable contributions and also to the members of the committee for
Lifetime measurements in odd-even 125La, 127La isotopes
International Nuclear Information System (INIS)
Starosta, K.; Droste, Ch.; Gundel, S.
1995-01-01
Recoil Distance Method (RDM); lifetime measurements have been carried out for the 125 La and 127 La nuclei to examine the collective structure of the decoupled band based on the unique parity πh 11/2 [550]1/2 orbital. The Stony Brook array of five BGO-suppressed Ge detectors placed at +/- 30, 90, 125 and 150 degree relative to the beam direction in conjunction with the Notre Dame/Argonne plunger was used to measure the stopped and shifted γ-ray peaks as a function of target-stopper distance. The 94 Mo( 35 Cl,2p2n) reaction at beam energy of 155 MeV was used to populate the excited states of 125 La and the 112 Cd( 19 F, 4n) reaction for the 127 La. The preliminary results of lifetime measurements are presented
13th Workshop on Radiation Monitoring for the International Space Station - Final Program
International Nuclear Information System (INIS)
2008-01-01
The Workshop on Radiation Monitoring for the International Space Station (WRMISS) has been held annually since 1996. The major purpose of WRMISS is to provide a forum for discussion of technical issues concerning radiation dosimetry aboard the International Space Station. This includes discussion of new results, improved instrumentation, detector calibration, and radiation environment and transport models. The goal of WRMISS is to enhance international efforts to provide the best information on the space radiation environment in low-Earth orbit and on the exposure of astronauts and cosmonauts in order to optimize the radiation safety of the ISS crew. During the 13 th Annual WRMISS, held in the Institute of Nuclear Physics (Krakow, Poland) on 8-10 September 2008, participants presented 47 lectures
2013-01-01
Background We previously demonstrated that primary Th1Th17 cells are highly permissive to HIV-1, whereas Th1 cells are relatively resistant. Molecular mechanisms underlying these differences remain unknown. Results Exposure to replication competent and single-round VSV-G pseudotyped HIV strains provide evidence that superior HIV replication in Th1Th17 vs. Th1 cells was regulated by mechanisms located at entry and post-entry levels. Genome-wide transcriptional profiling identified transcripts upregulated (n = 264) and downregulated (n = 235) in Th1Th17 vs. Th1 cells (p-value Th17 (nuclear receptors, trafficking, p38/MAPK, NF-κB, p53/Ras, IL-23) vs. Th1 cells (proteasome, interferon α/β). Differentially expressed genes were classified into biological categories using Gene Ontology. Th1Th17 cells expressed typical Th17 markers (IL-17A/F, IL-22, CCL20, RORC, IL-26, IL-23R, CCR6) and transcripts functionally linked to regulating cell trafficking (CEACAM1, MCAM), activation (CD28, CD40LG, TNFSF13B, TNFSF25, PTPN13, MAP3K4, LTB, CTSH), transcription (PPARγ, RUNX1, ATF5, ARNTL), apoptosis (FASLG), and HIV infection (CXCR6, FURIN). Differential expression of CXCR6, PPARγ, ARNTL, PTPN13, MAP3K4, CTSH, SERPINB6, PTK2, and ISG20 was validated by RT-PCR, flow cytometry and/or confocal microscopy. The nuclear receptor PPARγ was preferentially expressed by Th1Th17 cells. PPARγ RNA interference significantly increased HIV replication at levels post-entry and prior HIV-DNA integration. Finally, the activation of PPARγ pathway via the agonist Rosiglitazone induced the nuclear translocation of PPARγ and a robust inhibition of viral replication. Conclusions Thus, transcriptional profiling in Th1Th17 vs. Th1 cells demonstrated that HIV permissiveness is associated with a superior state of cellular activation and limited antiviral properties and identified PPARγ as an intrinsic negative regulator of viral replication. Therefore, triggering PPARγ pathway via non
Energy Technology Data Exchange (ETDEWEB)
Moura, Eduardo Santana de
2011-07-01
The use of brachytherapy technique with iodine-125 seeds to prostate cancer treatment has been used for decades with good clinical outcomes. To aim the Brazilian population necessities, IPEN-CNEN/SP developed the iodine-125 seed prototype with national technology. The objectives of this work are the development and the study of dosimetric procedures associates with the experimental acquisition of the useful parameters for the iodine-125 dosimetric characterization and to evaluate if the developed procedures, in this work, have the basic conditions to determinate the dosimetric analysis, that are fundamental for clinical procedures. The dosimeters selected for the analysis are the TLD-100 (LiF:Mg,Ti), initially these dosimeters were submitted for two selection steps to choose the dosimeters more reproducible for the dosimetric analysis. The two steps were the selection by the mass of the dosimeters and the reproducibility after four irradiation series in a Cobalt-60 irradiator (CTR-IPEN). Afterwards these steps, the dosimeters were irradiated in linear accelerator with 6 MV energy (Service of Radiotherapy - Hospital Israelita Albert Einstein) to yield the individual calibration factors to each dosimeter. After, the dosimeters were used to the irradiations with iodine-125 seed, 6711 model, (GE-Healthcare). The irradiations and others analysis with iodine-125 seeds yield the useful values for the determination of the parameters suggested by the AAPM (American Association of Physicists in Medicine): constant of dose rate, geometry function, dose radial function and anisotropy function. The results showed good agreement with the values published by the literature, for the same iodine- 125 model, this fact confirms that the realized parameters will be able to be used for the IPEN-CNEN iodine-125 seeds dosimetry and quality control. (author)
Labeling Lanreotide with 125I and 188Re
International Nuclear Information System (INIS)
Bai Hongsheng
2000-01-01
Lanreotide is a new somatostatin analogue. It can bind to human somatostatin receptor (hSSTR) subtype 2 through 5 with high affinity and to hSSTR subtype I with low affinity. We investigate labeling condition, quality control and stability in vitro of 125 I-Lanreotide and 188 Re-lanreotide respectively. (A) Lanreotide is labeled with 125 I using Chloramine T. The effect of reaction condition (such as reaction time, pH value, Lanreotide amount, quantity of Chloramine T and reaction volume) on labeling yield is investigated in detail. (B) The labeling yield and radiochemical purity (RP) is measured with paper chromatography (PC) and Sep-Pak C 18 Cartridge. (C) The stability of 125 I-Lanreotide in vitro is investigated by labeling compound incubating for 48 hours at 37 deg C in the 0.9% sodium chloride solution and RP is tested by PC at specific time intervals. (D) Lanreotide is labeled directly with 188 Re via the mixture of citrate and tartate using stannous chloride as reduced agent. The influence of reaction conditions such as pH, temperature, amount of stannous chloride, amount of Lanreotide and reaction time on labeling yield is investigated in detail. At the time, the stability in vitro quality control and animal test are evaluated
Microdosimetry of 125I and 3H in the cell nucleus
International Nuclear Information System (INIS)
Booz, J.; Fidorra, J.; Smit, T.; Charlton, D.E.
1978-01-01
The dosimetry and microdosimetry of iodine-125 and Tritium were analyzed. In particular, a detailed examination of the number and energies of the electrons emitted by iodine-125 was performed and the result considerably changed the currently available data. In this paper, the result of this examination will be summarized and the radiobiological implications will be discussed. A new model of the radiation mechanism of iodine-125 is proposed, which takes the high energy deposition at the molecular level and the high number of emitted Auger-electrons into consideration. On the basis of this model it is concluded that about 40 primary lesions are needed in the DNA for the cellular inactivation of T-cells. (orig./AJ) [de
Microchemical synthesis of the serotonin receptor ligand, 125I-LSD
International Nuclear Information System (INIS)
Hartig, P.R.; Krohn, A.M.; Hirschman, S.A.
1985-01-01
The synthesis and properties of 2-[ 125 I]-lysergic acid diethylamide, the first 125 I-labeled serotonin receptor ligand, are described. A novel microsynthesis apparatus was developed for this synthesis. The apparatus employs a micromanipulator and glass micro tools to handle microliter to nanoliter volumes on a microscope stage. This apparatus should be generally useful for the synthesis of radioligands and other compounds when limited amounts of material must be handled in small volumes
Chloroquine allows the secretion of internalized 125I-epidermal growth factor from fibroblasts
International Nuclear Information System (INIS)
Wakshull, E.; Cooper, J.L.; Wharton, W.
1985-01-01
Incubation of cells with labelled hormone in the presence of the lysosomotropic agent chloroquine produces an enhanced intracellular accumulation of hormone and receptor. Using a pulse-chase paradigm in which cell surface receptors were labelled with 125 I-EGF at 4 degrees C, it was found that when 100 microM chloroquine was present in the 37 degrees C chase medium intact hormone was accumulated in the medium. Without chloroquine, low molecular weight (mw) degradation products were found in the medium. The processes of receptor-mediated endocytosis and subcellular distribution of 125 I-EGF-receptor complexes were unchanged by chloroquine. The source of the intact hormone accumulating in the medium was therefore an intracellular compartment(s). The 125 I-EGF released from the cells could rebind to surface receptors and be re-internalized; rebinding was inhibited by unlabelled EGF or Concanavalin A in the incubation medium. The concentration of unlabelled EGF required to inhibit rebinding was more than three orders of magnitude greater than the amount of 125 I-EGF whose rebinding was inhibited. Thus, the 125 I-EGF released from intracellular sites was rebound preferentially over exogenous EGF. The possible pathways for secretion of intact 125 I-EGF and mechanisms of its preferential rebinding are discussed
Usage of Metaphors in Turkish Language Textbooks Used at 6th, 7th and 8th Grades
Directory of Open Access Journals (Sweden)
Esra Karakas
2013-05-01
Full Text Available The word “Metaphor”, which is equivalent to the terms “istiare” in Arabic or “eğretileme, transfer of idioms” in Turkish, consists of two parts. “Meta” means “later” or “with” whereas “phora” means transfer or conveyance of word. In the recent years metaphor has been the subject and focuses of several studies, and is used to express a concept or situation with another concept or situation. Starting from 1980s, researchers have studied metaphor and concurrently they examined usage of language. It is now been believed that using metaphors is appropriate in order to be able to understand any phenomenon. Metaphor can be used in encouraging learning and improving creative thinking; it can also provide hints for in-the-class methods, techniques and situations. In this context, metaphors are also essential components for Turkish language textbooks. The purpose of this study is to detect the uses of metaphor in Turkish language textbooks of 6th, 7th and 8th grade students. For this purpose the Turkish language textbooks of 6th, 7th and 8th grade students prepared by the Ministry of National Education (MEB were examined with “content analysis method. Considering that metaphors are effective in learning and improving creative thinking, the importance of using metaphors in textbooks is beyond discussion. The data collected throughout this study show that the metaphors detected in 7th and 8th grade Turkish language textbooks are less in number compared to those found in 6th grade Turkish language textbooks. Another important conclusion is that distribution of metaphors among units is not even. The conclusion of the study is that Turkish language textbooks are not prepared in a sensitive and choosy manner with this respect.
Energy Technology Data Exchange (ETDEWEB)
McCormick, D.J.; Griesmann, G.E.; Huang, Z.; Lennon, V.A.
1986-03-05
A synthetic peptide corresponding to residues 125-147 of the Torpedo acetylcholine receptor (AChR) ..cap alpha.. subunit proved to be a major antigenic region of the AChR. Rats inoculated with 50 ..mu..g of peptide (T ..cap alpha.. 125-147) developed T cell immunity and antibodies to native AChR and signs of experimental autoimmune myasthenia gravis. They report the synthesis and preliminary testing of a disulfide-looped peptide comprising residues 125-147 of the human AChR ..cap alpha.. subunit. Peptide H ..cap alpha.. 125-147 differs from T ..cap alpha.. 125-147 at residues 139 (Glu for Gln) and 143 (Ser for Thr). In immunoprecipitation assays, antibodies to Torpedo AChR bound /sup 125/I-labelled H..cap alpha.. 125-147 antibody bound H..cap alpha.. 125-147, but monoclonal antibodies to an immunodominant region of native AChR bound neither H..cap alpha.. 125-147 nor T ..cap alpha.. 125-147. Rats immunized with H ..cap alpha.. 125-147 produced anti-mammalian muscle AChR antibodies that induced modulation of AChRs from cultured human myotubes. Thus, region 125-147 of the human AChR ..cap alpha.. subunit is extracellular in muscle, and is both antigenic and immunogenic. It remains to be determined whether or not autoantibodies to this region may in part cause the weakness or myasthenia gravis in man.
International Nuclear Information System (INIS)
Titayeva, N.A.; Mironov, Y.
1996-01-01
The problem of mantle heterogeneity of the Atlantic Ocean has been investigated. Th/U ratio is a sensitive geochemical tracer. This ratio can be calculated from 232Th/230Th or from 208Pb/206Pb since 230Th and 206Pb are decay product of 238U and 208Pb is a product of 232Th decay. The former way to get Th/U ratio is valid for quaternary volcanic rocks because of the relatively short 230Th half life (80000 years), the latter way gives an integral quantity characterizing the pre-oceanic history beginning from the onset of earth formation and ending about 150 million years ago. Clear distinctions between ''depleted oceanic'' and ''enriched continental'' reservoirs have been drawn from comparative analysis of rocks. (A.C.)
Investigation of internalization and cytotoxicity of 125I-[Tyr3]-octreotide in NCI-H446 cell line
International Nuclear Information System (INIS)
Sun Junjie; Fan Wo; Xu Yujie; Zhang Youjiu; Zhu Ran; Hu Mingjiang
2004-01-01
Objective: To investigate the [Tyr 3 ]-octreotide (TOC) internalizing capacity of NCI-H446 cell line, and the cytotoxicity of 125 I-TOC in NCI-H446 cell line. To assess the therapeutic radiopharmaceutical potentiality of 125 I-TOC for the somatostatin receptor (SSTR) positive tumor. Methods: NCI-H446 cells were incubated together with 125 I-TOC for different periods of time, the amount of internalized 125 I-TOC and the 125 I-TOC bound on the cellular nucleus were detected with γ counter, respectively. The viability of the cells was analyzed by a 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay at different time points with various doses of 125 I-TOC, free 125 I and TOC. Results: 125 I-TOC was internalized into the nucleus and bound on the nucleus in a time-dependent manner. 125 I-TOC bound on the nucleus increased to the highest level at 24 h, the amount of nucleus bound 125 I-TOC at 24 h was 7 times higher than that at 0.5 h. Cytotoxicity of 125 I-TOC in SSTR positive NCI-H446 cells was also dose- and time-dependent. The supreme effect of cytotoxicity was found at 96 h with 74 kBq 125 I-TOC, the survival ratio of cells was reduced to (44.8 ± 7.2)%. Conclusions: 125 I-TOC can be internalized into SSTR positive cells mediated by SSTR. The NCI-H446 cells can be killed by Auger electron emitting from 125 I-TOC. Effect of cytotoxicity showed dose- and time-dependent
21 CFR 201.125 - Drugs for use in teaching, law enforcement, research, and analysis.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs for use in teaching, law enforcement, research, and analysis. 201.125 Section 201.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... § 201.125 Drugs for use in teaching, law enforcement, research, and analysis. A drug subject to § 201...
X-ray spectral study of the Th6p,5f electron states in ThO2 and ThF4
International Nuclear Information System (INIS)
Teterin, Y.A.; Nikitin, A.S.; Teterin, A.Y.; Ivanov, K.E.; Utkin, I.O.; Nerehov, V.A.; Ryzhkov, M.V.; Vukchevich, I.J.
2002-01-01
The study of the Th6p,5f electron states in Th, ThO 2 and ThF was carried out on the basis of the X-ray photoelectron fine spectral structure parameters in the binding energy range of 0-∼ 1000 eV, X-ray O 4,5 (Th) emission spectra of the shallow (0-∼50 eV) electrons and results of theoretical calculations. As a result, despite the absence of the Th5f electrons in thorium atoms, the Th5f atomic orbitals were established to participate in the formation of molecular orbitals in thorium dioxide and tetrafluoride. In the MO LCAO approximation this allowed to suggest the possible existence of filled Th5f electronic states in thorium compounds. On the basis of the X-ray O 4,5 (Th) emission spectral structure parameters the effective formation of the inner valence molecular orbitals in the studied compounds was confirmed. (authors)
International Nuclear Information System (INIS)
John, Christy S.; Bowen, Wayne D.; Fisher, Susan J.; Lim, Benjamin B.; Geyer, Brian C.; Vilner, Bertold J.; Wahl, Richard L.
1999-01-01
The goal of this study was to investigate the potential use of a radioiodinated benzamide, N-[2-(1'-piperidinyl)ethyl]-3-iodo[ 125 I]-4-methoxybenzamide (P[ 125 I]MBA), a sigma receptor binding radioligand for imaging breast cancer. The chemical and radiochemical syntheses of PIMBA are described. The pharmacological evaluation of PIMBA was carried out for sigma-1 and sigma-2 receptor sites. The in vivo pharmacokinetics of the radioiodinated benzamide were determined in rats and comparison of P[ 125 I]MBA with Tc-99m sestamibi were made in a rat mammary tumor model. Sigma-1 affinity (K i ) for PIMBA in guinea pig brain membranes using [ 3 H](+)pentazocine was found to be 11.82±0.68 nM, whereas sigma-2 affinity in rat liver using [ 3 H]DTG (1,3-o-di-tolylguanidine) was 206±11 nM. Sites in guinea pig brain membranes labeled by P[ 125 I]MBA showed high affinity for haloperidol, (+)-pentazocine, BD1008, and PIMBA ( K i =4.87±1.49,8.81±1.97,0.057±0.005,46.9±1.8 nM, respectively). Competition binding studies were carried out in human ductal breast carcinoma cells (T47D). A dose-dependent inhibition of specific binding was observed with several sigma ligands. K i values for the inhibition of P[ 125 I]MBA binding in T47D cells for haloperidol, N-[2-(1'-piperidinyl)]ethyl]4-iodobenzamide (IPAB), N-(N-benzylpiperidin-4-yl)-4-iodobenzamide (4-IBP), and PIMBA were found to be 1.30±0.07, 13±1.5, 5.19±2.3, 1.06±0.5 nM, respectively. The in vitro binding data in guinea pig brain membranes and breast cancer cells confirmed binding to sigma sites. The saturation binding of P[ 125 I]MBA in T47D cells as studied by Scatchard analysis showed saturable binding, with a K d =94±7 nM and a B max =2035±305 fmol/mg of proteins. Biodistribution studies in Sprague-Dawley rats showed a rapid clearance of P[ 125 I]MBA from the normal organs. The potential of PIMBA in imaging breast cancer was evaluated in Lewis rats bearing syngeneic RMT breast cancers, a cancer that closely mimics
Modeling of Teaching 5th-7th-Grade Boys Physical Exercises
Directory of Open Access Journals (Sweden)
Т. Г. Абдулхалікова
2017-09-01
Full Text Available The research objective is to determine the effectiveness of orthogonal variants of teaching 5th-7th graders physical exercises. Materials and methods. The participants in the research were boys of the 5th grade (n = 32, 6th grade (n = 40, 7th grade (n = 52. To achieve the tasks set, the research used the following methods: analysis of scientific and methodological literature; pedagogical testing, pedagogical observation, timing of educational tasks; pedagogical experiment, medical and biological research methods; methods of mathematical statistics, methods of mathematical experiment planning. In order to achieve the objective set, the research has studied the effect of different variants of the educational process structure, namely: the number of repetitions (х1 and rest intervals (х2 when learning the technique of performing physical exercises. The research has conducted a complete factor experiment of type 22. According to the experiment plan, the 5th-7th graders were divided into training groups. In total, there were 12 experimental groups organized. Research results. The analysis of the regression equations shows that the teaching of physical exercises to the 5th-7th-grade boys is mostly influenced by rest intervals between repetitions (х2. The number of repetitions (х1 has somewhat less influence. The interaction of these factors is insignificant when teaching physical exercises and becomes much more influential only when teaching a switch leg pull-over exercise (х1х2. Conclusions. To increase the effectiveness of teaching 5th-7th graders physical exercises, it is necessary to shorten rest intervals between repetition to 60 s and to reduce the number of repetitions to six. When teaching boys the switch leg pull-over exercise, rest intervals should be increased to 120 s and the number of repetitions — to twelve.
Organic Linker Defines the Excited-State Decay of Photocatalytic MIL-125(Ti)-Type Materials.
Santaclara, Jara G; Nasalevich, Maxim A; Castellanos, Sonia; Evers, Wiel H; Spoor, Frank C M; Rock, Kamila; Siebbeles, Laurens D A; Kapteijn, Freek; Grozema, Ferdinand; Houtepen, Arjan; Gascon, Jorge; Hunger, Johannes; van der Veen, Monique A
2016-02-19
Recently, MIL-125(Ti) and NH2 -MIL-125(Ti), two titanium-based metal-organic frameworks, have attracted significant research attention in the field of photocatalysis for solar fuel generation. This work reveals that the differences between these structures are not only based on their light absorption range but also on the decay profile and topography of their excited states. In contrast to MIL-125(Ti), NH2 -MIL-125(Ti) shows markedly longer lifetimes of the charge-separated state, which improves photoconversion by the suppression of competing decay mechanisms. We used spectroelectrochemistry and ultrafast spectroscopy to demonstrate that upon photoexcitation in NH2 -MIL-125(Ti) the electron is located in the Ti-oxo clusters and the hole resides on the aminoterephthalate unit, specifically on the amino group. The results highlight the role of the amino group in NH2 -MIL-125(Ti), the electron donation of which extends the lifetime of the photoexcited state substantially. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Sacramento, Priscila M; Monteiro, Clarice; Dias, Aleida S O; Kasahara, Taissa M; Ferreira, Thaís B; Hygino, Joana; Wing, Ana Cristina; Andrade, Regis M; Rueda, Fernanda; Sales, Marisa C; Vasconcelos, Claudia Cristina; Bento, Cleonice A M
2018-05-02
Excessive levels of pro-inflammatory cytokines in the central nervous system (CNS) are associated with reduced serotonin (5-HT) synthesis, a neurotransmitter with diverse immune effects. In this study, we evaluated the ability of exogenous 5-HT to modulate the T-cell behavior of patients with multiple sclerosis (MS), a demyelinating autoimmune disease mediated by Th1 and Th17 cytokines. Here, 5-HT attenuated, in vitro, T-cell proliferation and Th1 and Th17 cytokines production in cell cultures from MS patients. Additionally, 5-HT reduced IFN-γ and IL-17 release by CD8 + T-cells. By contrast, 5-HT increased IL-10 production by CD4 + T-cells from MS patients. A more accurate analysis of these IL-10-secreting CD4 + T-cells revealed that 5-HT favors the expansion of FoxP3 + CD39 + regulatory T cells (Tregs) and type 1 regulatory T cells. Notably, this neurotransmitter also elevated the frequency of Treg17 cells, a novel regulatory T-cell subset. The effect of 5-HT in up-regulating CD39 + Treg and Treg17 cells was inversely correlated with the number of active brain lesions. Finally, in addition to directly reducing cytokine production by purified Th1 and Th17 cells, 5-HT enhanced in vitro Treg function. In summary, our data suggest that serotonin may play a protective role in the pathogenesis of MS. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
40 CFR 1045.125 - What maintenance instructions must I give to buyers?
2010-07-01
... give to buyers? 1045.125 Section 1045.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... maintenance within the useful life period for aftertreatment devices, pulse-air valves, fuel injectors, oxygen... to address problems related to special situations, such as atypical engine operation. You must...
5 CFR 1201.125 - Administrative law judge.
2010-01-01
... PRACTICES AND PROCEDURES Procedures for Original Jurisdiction Cases Special Counsel Disciplinary Actions § 1201.125 Administrative law judge. (a) An administrative law judge will hear a disciplinary action... complaint seeking disciplinary action against a Federal or District of Columbia government employee for a...
Potential pathogenetic role of Th17, Th0, and Th2 cells in erosive and reticular oral lichen planus.
Piccinni, M-P; Lombardelli, L; Logiodice, F; Tesi, D; Kullolli, O; Biagiotti, R; Giudizi, Mg; Romagnani, S; Maggi, E; Ficarra, G
2014-03-01
The role of Th17 cells and associated cytokines was investigated in oral lichen planus. 14 consecutive patients with oral lichen planus were investigated. For biological studies, tissues were taken from reticular or erosive lesions and from normal oral mucosa (controls) of the same patient. mRNA expression for IL-17F, IL-17A, MCP-1, IL-13, IL-2, IL-10, IL-1β, RANTES, IL-4, IL-12B, IL-8, IFN-γ, TNF-α, IL-1α, IL-18, TGF-β1, IL-23R, IL-7, IL-15, IL-6, MIG, IP-10, LTB, VEGF, IL-5, IL-27, IL-23A, GAPDH, PPIB, Foxp3, GATA3, and RORC was measured using the QuantiGene 2.0. Results showed that Th17-type and Th0-type molecules' mRNAs, when compared with results obtained from tissue controls, were increased in biopsies of erosive lesions, whereas Th2-type molecules' mRNAs were increased in reticular lesions. When the CD4+ T-cell clones, derived from oral lichen planus tissues and tissue controls, were analyzed, a higher prevalence of Th17 (confirmed by an increased CD161 expression) and Th0 CD4+ T clones was found in erosive lesions, whereas a prevalence of Th2 clones was observed in reticular lesions. Our data suggest that Th17, Th0, and Th2 cells, respectively, may have a role in the pathogenesis of erosive and reticular oral lichen planus. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Hawthorne, M.F.
1999-01-01
The 8th International Symposium on Neutron Capture Therapy for Cancer (8th ISNCTC) was held in La Jolla, CA on Sept. 13-18, 1998. This biennial meeting of the International Society for Neutron Capture Therapy (ISNCT) was hosted by Society President M.F. Hawthorne (UCLA Dept. of Chemistry and Biochemistry). The Symposium brought together scientists (300 registrants from 21 countries) from diverse fields to report the latest developments in NCT. Topics of the 275 papers presented (30 plenary lectures, 81 oral presentations, and 164 posters) included the physics of neutron sources, chemistry of tumor-targeting agents, dosimetry, radiobiological studies, and clinical applications
Campanati, Anna; Orciani, Monia; Lazzarini, Raffaella; Ganzetti, Giulia; Consales, Veronica; Sorgentoni, Giulia; Di Primio, Roberto; Offidani, Annamaria
2017-04-01
Psoriasis is a disease characterized by an imbalance between Th 1 and Th 17 and Th 2 inflammatory axes, in which cutaneous mesenchymal stem cells (MSCs) are early involved, as they show a greater relative expression of several genes encoding for Th 1 and Th 17 cytokines. Therapeutic implications of TNF-α inhibitors on differentiated skin cells have been largely described in psoriasis; however, their effects on MSCs derived from patients with psoriasis have been only partially described. The aim of this work was to evaluate the effect of TNF-α inhibitors on cytokine milieu expressed by MSCs isolated from the skin of patients with psoriasis. Resident MSCs from skin of patients with psoriasis and healthy subjects have been isolated, characterized and profiled by PCR and ELISA for the expression of 22 cytokines involved in Th 1 , Th 2 and Th 17 pathways, both before and after 12 weeks therapy with TNF-α inhibitors. The administration of TNF-α inhibitors for 12-weeks acts on MSCs as follows: it reduces the expression of several Th 1 -Th 17 cytokines whose levels are elevated at baseline (IL-6, IL-8, IL-12, IL-23A, IFN-γ, TNF-α, CCL2, CCL20, CXCL2, CXCL5, IL-17A, IL-17C, IL-17F, IL-21, G-CSF). Similarly, it enhances the expression of several Th 2 cytokines which are underexpressed at baseline (IL-2, IL-4, IL-5), reducing the expression of those overexpressed at baseline (TGF-β and IL-13). TNF-α inhibitors could contribute to reduce the pathological imbalance between the Th 1 -Th 17 vs Th 2 axis in MSCs of patients with psoriasis. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Energy Technology Data Exchange (ETDEWEB)
MooN, Ern Soo; Park, Yoh Han; Cho, Chang Ho; Park, In Soo; Lee, Chong Suk; Lee, Hak Choong [National Medical Center, Seoul (Korea, Republic of)
1978-09-15
Hyperthyroidism may be defined as those clinical conditions which result from an increase in the circulating levels of one or both thyroid hormones. Hyperthyroidism in broad sense could be classified with toxic diffuse goiter, toxic adenomatous goiter, and toxic multinodular goiter on the basis of the circulating thyroid hormone levels. For this study, the subject included 94 cases with hyperthyroidism were presented in 77 with toxic diffuse goiter, 8 with toxic adenomatous goiter, and 9 with toxic multinodular goiter on the levels of {sup 125}IT{sub 3} resin uptake rate and serum thyroxine (T{sub 4}). The observed results were as follows: 1) In the cases of hyperthyroidism including toxic diffuse goiter, toxic adenomatous goiter, and toxic multinodular goiter, 20.21% of the patients were male and 79.79% female. The majority of the patients were in 2nd to 4th decades of their lives. 2) There were objective signs clearly manifested in hyperthyroidism including toxic diffuse goiter and toxic adenomatous goiter which were rare in the multinodular goiter. The clinical signs in toxic diffuse and toxic adenomatous goiter included wide pulse pressure, tachycardia, systolic murmur, exophthalmos, tremor and warm skin etc. 3) The most frequent complaints of the patients with hyperthyroidism were palpitation, weight loss, increased appetite, perspiration, heat intolerance, nervousness, exertional dyspnea, and menstrual disturbance etc. There was no clear difference in the incidence of symptoms between toxic diffuse goiter and toxic adenomatous goiter, but there was clear difference between toxic multinodular goiter. 4) Considering of results of {sup 125}IT{sub 3} resin uptake rate and serum T{sub 4} level in toxic diffuse goiter, toxic adenomatous goiter and toxic multinodular goiter, {sup 125}IT{sub 3} resin uptake rate was 49.15+-9.94% (mean) and serum T{sub 4} 21.29+-7.04 ug/dl (mean) in toxic diffuse goiter. In toxic multinodular goiter, {sup 125}I T{sub 3} resin uptake
Interstitially implanted I125 for prostate cancer using transrectal ultrasound
International Nuclear Information System (INIS)
Greenburg, S.; Petersen, J.; Hansen-Peters, I.; Baylinson, W.
1990-01-01
Prostate cancer is the third leading cause of death from cancer among men in the United States. Traditional treatments for prostate cancer are prostatectomy, external beam irradiation, and interstitial implantation of Iodine125 (I125) via laparotomy. These treatments are associated with significant morbidity and limitations. Based on experience with I125 interstitial implantation by transrectal ultrasound guidance for early-stage prostate cancer, it seems that this newer method of treatment has greater accuracy of placement and distribution of the isotope and has had few reported complications. The need for a surgical incision has been eliminated. Hospitalization time also has been decreased, creating the need for ambulatory and inpatient nurses to understand the importance of their respective roles in providing coordinated quality care for these patients. Nurses in these departments must have knowledge of the procedure, radiation safety, and common side effects related to the implant
Proteolytic activity of beef liver determined by natural /sup 125/I-labelled substrates
Energy Technology Data Exchange (ETDEWEB)
Blahovec, J; Ondrus, I [Vysoka Skola Veterinarska, Kosice (Czechoslovakia)
1975-07-01
The method of determining the enzymatic activity of acid proteinases is described. The method is based on the use of /sup 125/I-labelled natural protein substrates. /sup 125/I-labelled albumin, /sup 125/I-globulin and /sup 125/I-insulin were tested for the determination of activities. All the substrates were hydrolyzed with the enzymes of the supernatant fraction (106,000 g) of beef liver homogenate in the acid pH zone. Optimum enzymatic reaction conditions were tested, the dependence of the reaction on the enzyme concentration, time and temperature was determined, pH optimum was ascertained for the individual substrates, and pH stability was determined. The results show that the method is suitable for determining the enzymatic activity of proteinases of cathepsin character.
40 CFR 125.122 - Determination of unreasonable degradation of the marine environment.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Determination of unreasonable degradation of the marine environment. 125.122 Section 125.122 Protection of Environment ENVIRONMENTAL... environment. (a) The director shall determine whether a discharge will cause unreasonable degradation of the...
Role of TPS in 125I brachytherapy for orbital tumors
International Nuclear Information System (INIS)
Ren Ling; Dai Haojie; Li Quan
2012-01-01
Objective: To investigate the role of TPS in 125 I brachytherapy for orbital tumors. Methods: Sixty-six patients with orbital tumor treated with 125 I seeds from 2005 to 2009 were retrospectively analyzed. Forty-three patients were treated using TPS guided brachytherapy and the prescribed dose was 140 Gy. Other 23 patients were treated without TPS but simply implanted with 125 I seeds at 1 cm intervals in parallel with each other intraoperatively. CT and TPS quality verification were performed postoperatively in all patients. Also, CT and (or) MRI examination were performed at 3, 6, 12 and 24 months after brachytherapy for follow-up. χ 2 test and Kaplan-Meier survival analysis with log-rank significance test were used with SPSS 17.0. Results: A total of 1070 125 I seeds were implanted in 66 cases, on average, (16.2 ± 7.3) seeds for each patient. The satisfaction rates of postoperative quality verification in patients with and without TPS pre-plans were 79.07% (34/43) and 43.48% (10/23) respectively (χ 2 =8.542, P=0.003). Ten patients were lost in follow-up. Local recurrence rates in patients with favorable postoperative quality verification were 0 (0/37) in 3 months, 6.25% (2/32) in 6 months, 13.64% (3/22) in 12 months and 3/9 in 24 months respectively, which were significantly different from those (5.26% (1/19), 16.67% (3/18), 30.77% (4/13), 6/6) in the patients with inferior postoperative quality verification (χ 2 =9.017, P=0.0003). Conclusions: TPS plays an important role in 125 I brachytherapy for orbital tumors. Also, postoperative quality verification by TPS may help predict the local recurrence after brachytherapy. (authors)
International Nuclear Information System (INIS)
Maxwell, J.L.; Baynes, J.W.; Thorpe, S.R.
1988-01-01
Residualizing labels for protein, such as dilactitol-125I-tyramine (125I-DLT) and cellobiitol-125I-tyramine, have been used to identify the tissue and cellular sites of catabolism of long-lived plasma proteins, such as albumin, immunoglobulins, and lipoproteins. The radioactive degradation products formed from labeled proteins are relatively large, hydrophilic, resistant to lysosomal hydrolases, and accumulate in lysosomes in the cells involved in degradation of the carrier protein. However, the gradual loss of the catabolites from cells (t1/2 approximately 2 days) has limited the usefulness of residualizing labels in studies on longer lived proteins. We describe here a higher molecular weight (Mr approximately 5000), more efficient residualizing glycoconjugate label, inulin-125I-tyramine (125I-InTn). Attachment of 125I-InTn had no effect on the plasma half-life or tissue sites of catabolism of asialofetuin, fetuin, or rat serum albumin in the rat. The half-life for hepatic retention of degradation products from 125I-InTn-labeled asialofetuin was 5 days, compared to 2.3 days for 125I-DLT-labeled asialofetuin. The whole body half-lives for radioactivity from 125I-InTn-, 125I-DLT-, and 125I-labeled rat serum albumin were 7.5, 4.3, and 2.2 days, respectively. The tissue distribution of degradation products from 125I-InTn-labeled proteins agreed with results of previous studies using 125I-DLT, except that a greater fraction of total degradation products was recovered in tissues. Kinetic analyses indicated that the average half-life for retention of 125I-InTn degradation products in tissues is approximately 5 days and suggested that in vivo there are both slow and rapid routes for release of degradation products from cells
Radioimmunoassay for etorphine in horses with a 125I analog of etorphine
International Nuclear Information System (INIS)
Tai, C.L.; Wang, C.; Weckman, T.J.; Popot, M.A.; Woods, W.E.; Yang, J.M.; Blake, J.; Tai, H.H.; Tobin, T.
1988-01-01
To improve the sensitivity and specificity of screening for etorphine in horses, an 125 I-labeled etorphine analog was synthesized and an antibody to etorphine was raised in rabbits. A radioimmunoassay (RIA) for etorphine was developed, using these reagents. Bound and free 125 I-labeled etorphine was separated by a double-antibody method that reduced interference from materials associated with equine urine. The 125 I-labeled etorphine binding was rarely greater than 250 pg of background etorphine equivalents/ml in raw urine and was 100 pg/ml in hydrolyzed urine. The 125 I-RIA was capable of detecting etorphine equivalents in urine above these background values. Etorphine equivalents were detected in equine urine samples for about 7 days after 4 mares were dosed with 0.22 microgram of etorphine/kg of body weight, IV. The stability of etorphine in urine from these mares was evaluated. Urine from these dosed mares was held in constant -20 C storage, and aliquots were repeatedly frozen and thawed. When analyzed for etorphine equivalents using an 125 I-RIA, etorphine and its metabolites in urine samples were stable for less than or equal to 38 days if continuously frozen and also were resistant to repeated freezing and thawing
Analysis of pion production data measured by HADES in proton-proton collisions at 1.25 GeV
International Nuclear Information System (INIS)
Agakishiev, G.; Belyaev, A.; Chernenko, S.; Fateev, O.; Ierusalimov, A.; Ladygin, V.; Vasiliev, T.; Zanevsky, Y.; Balanda, A.; Dybczak, A.; Michalska, B.; Palka, M.; Przygoda, W.; Salabura, P.; Trebacz, R.; Belver, D.; Cabanelas, P.; Garzon, J.A.; Berger-Chen, J.C.; Epple, E.; Fabbietti, L.; Lalik, R.; Lapidus, K.; Muenzer, R.; Blanco, A.; Fonte, P.; Lopes, L.; Mangiarotti, A.; Boehmer, M.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R.; Maier, L.; Siebenson, J.; Weber, M.; Boyard, J.L.; Hennino, T.; Liu, T.; Ramstein, B.; Finocchiaro, P.; Schmah, A.; Spataro, S.; Froehlich, I.; Goebel, K.; Lorenz, M.; Markert, J.; Michel, J.; Muentz, C.; Pachmayer, Y.C.; Pechenova, O.; Rustamov, A.; Stroebele, H.; Tarantola, A.; Teilab, K.; Galatyuk, T.; Gonzalez-Diaz, D.; Gumberidze, M.; Kornakov, G.; Golubeva, M.; Guber, F.; Ivashkin, A.; Karavicheva, T.; Kurepin, A.; Reshetin, A.; Sadovsky, A.; Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Pechenov, V.; Pietraszko, J.; Schwab, E.; Sturm, C.; Traxler, M.; Yurevich, S.; Iori, I.; Kaempfer, B.; Kotte, R.; Naumann, L.; Wendisch, C.; Wuestenfeld, J.; Krasa, A.; Krizek, F.; Kugler, A.; Sobolev, Yu.G.; Tlusty, P.; Wagner, V.; Kuc, H.; Kuehn, W.; Metag, V.; Spruck, B.; Lebedev, A.; Parpottas, Y.; Tsertos, H.; Stroth, J.; Sarantsev, A.V.; Nikonov, V.A.
2015-01-01
Baryon resonance production in proton-proton collisions at a kinetic beam energy of 1.25 GeV is investigated. The multi-differential data were measured by the HADES Collaboration. Exclusive channels with one pion in the final state (npπ + and ppπ 0 ) were put to extended studies based on various observables in the framework of a one-pion exchange model and with solutions obtained within the framework of a partial wave analysis (PWA) of the Bonn-Gatchina group. The results of the PWA confirm the dominant contribution of the Δ(1232), yet with a sizable impact of the N (1440) and non-resonant partial waves. (orig.)
Analysis of pion production data measured by HADES in proton-proton collisions at 1.25 GeV
Energy Technology Data Exchange (ETDEWEB)
Agakishiev, G.; Belyaev, A.; Chernenko, S.; Fateev, O.; Ierusalimov, A.; Ladygin, V.; Vasiliev, T.; Zanevsky, Y. [Joint Institute of Nuclear Research, Dubna (Russian Federation); Balanda, A.; Dybczak, A.; Michalska, B.; Palka, M.; Przygoda, W.; Salabura, P.; Trebacz, R. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Belver, D.; Cabanelas, P.; Garzon, J.A. [Univ. de Santiago de Compostela, LabCAF. F. Fisica, Santiago de Compostela (Spain); Berger-Chen, J.C.; Epple, E.; Fabbietti, L.; Lalik, R.; Lapidus, K.; Muenzer, R. [' ' Origin and Structure of the Universe' ' , Excellence Cluster, Garching (Germany); Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Blanco, A.; Fonte, P.; Lopes, L.; Mangiarotti, A. [Fisica Experimental de Particulas, LIP-Laboratorio de Instrumentacao e, Coimbra (Portugal); Boehmer, M.; Friese, J.; Gernhaeuser, R.; Jurkovic, M.; Kruecken, R.; Maier, L.; Siebenson, J.; Weber, M. [Technische Universitaet Muenchen, Physik Department E12, Garching (Germany); Boyard, J.L.; Hennino, T.; Liu, T.; Ramstein, B. [Univ. Paris-Sud, Universite Paris-Saclay, Institut de Physique Nucleaire, CNRS-IN2P3, Orsay Cedex (France); Finocchiaro, P.; Schmah, A.; Spataro, S. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Catania (Italy); Froehlich, I.; Goebel, K.; Lorenz, M.; Markert, J.; Michel, J.; Muentz, C.; Pachmayer, Y.C.; Pechenova, O.; Rustamov, A.; Stroebele, H.; Tarantola, A.; Teilab, K. [Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt (Germany); Galatyuk, T.; Gonzalez-Diaz, D.; Gumberidze, M.; Kornakov, G. [Technische Universitaet Darmstadt, Darmstadt (Germany); Golubeva, M.; Guber, F.; Ivashkin, A.; Karavicheva, T.; Kurepin, A.; Reshetin, A.; Sadovsky, A. [Russian Academy of Science, Institute for Nuclear Research, Moscow (Russian Federation); Heinz, T.; Holzmann, R.; Koenig, I.; Koenig, W.; Kolb, B.W.; Lang, S.; Pechenov, V.; Pietraszko, J.; Schwab, E.; Sturm, C.; Traxler, M.; Yurevich, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Iori, I. [Sezione di Milano, Istituto Nazionale di Fisica Nucleare, Milano (Italy); Kaempfer, B.; Kotte, R.; Naumann, L.; Wendisch, C.; Wuestenfeld, J. [Helmholtz-Zentrum Dresden-Rossendorf, Institut fuer Strahlenphysik, Dresden (Germany); Krasa, A.; Krizek, F.; Kugler, A.; Sobolev, Yu.G.; Tlusty, P.; Wagner, V. [Academy of Sciences of Czech Republic, Nuclear Physics Institute, Rez (Czech Republic); Kuc, H. [Jagiellonian University of Cracow, Smoluchowski Institute of Physics, Krakow (Poland); Univ. Paris-Sud, Universite Paris-Saclay, Institut de Physique Nucleaire, CNRS-IN2P3, Orsay Cedex (France); Kuehn, W.; Metag, V.; Spruck, B. [Justus Liebig Universitaet Giessen, II.Physikalisches Institut, Giessen (Germany); Lebedev, A. [Institute of Theoretical and Experimental Physics, Moscow (Russian Federation); Parpottas, Y.; Tsertos, H. [University of Cyprus, Department of Physics, Nicosia (Cyprus); Stroth, J. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt (Germany); Sarantsev, A.V.; Nikonov, V.A. [PNPI, NRC ' ' Kurchatov Institute' ' , Gatchina (Russian Federation); Collaboration: HADES Collaboration
2015-10-15
Baryon resonance production in proton-proton collisions at a kinetic beam energy of 1.25 GeV is investigated. The multi-differential data were measured by the HADES Collaboration. Exclusive channels with one pion in the final state (npπ{sup +} and ppπ{sup 0}) were put to extended studies based on various observables in the framework of a one-pion exchange model and with solutions obtained within the framework of a partial wave analysis (PWA) of the Bonn-Gatchina group. The results of the PWA confirm the dominant contribution of the Δ(1232), yet with a sizable impact of the N (1440) and non-resonant partial waves. (orig.)
Analysis of 125Xe electron-photon coincidence decay
International Nuclear Information System (INIS)
Klingberg, F.J.; Biegalski, S.R.
2016-01-01
As part of the verification component of the Comprehensive Nuclear-Test-Ban Treaty (CTBT), environmental gas samples originating from nuclear fission are analyzed for the presence of 131m Xe, 133m Xe, 133 Xe, and 135 Xe. In this work, the non-traditional radioxenon isotope 125 Xe was investigated. The isotope was produced as an isotopically pure sample via neutron activation of 124 Xe at the University of Texas at Austin Nuclear Engineering Teaching Lab's TRIGA MARK II Reactor. The sample was then measured using a HPGe detector as well as an ARSA-style b-c coincidence detector. Potential sources and sensitivities for production of 125 Xe are also considered for relevance to the CTBT verification mission. (author)
Iodine-125 implants for carcinoma of the prostate
International Nuclear Information System (INIS)
Peschel, R.E.; Fogel, T.D.; Kacinski, B.M.; Kelly, K.; Mate, T.P.
1985-01-01
One hundred-thirteen patients underwent Iodine-125 prostate implant and lymphadenectomy at Yale-New Haven Hospital from 1974 through 1980. The distribution by clinical stage was: 7 Stage A2, 86 Stage B, and 20 Stage C patients. Ninety-four patients had a negative lymphadenectomy and 19 patients (17%) had metastatic disease in the pelvic lymph nodes (N+). The actuarial 5-year survival for all 113 patients was 87%. Local tumor control was 85% for all Stage B patients and 75% for all Stage C patients. Only 10 patients (9%) have developed long-term gastrointestinal or genitourinary complications following their implant. Iodine-125 implant appears to be a reasonable alternate form of therapy in highly selected groups of patients with carcinoma of the prostate
International Nuclear Information System (INIS)
Leurs, R.; Beusenberg, F.D.; Bast, A.; Van Amsterdam, J.G.; Timmerman, H.
1990-01-01
The beta-adrenoceptor antagonist (-)-3-[ 125 I]iodocyanopindolol ([ 125 I]ICYP) binds with high affinity and in saturable way to membranes of guinea pig alveolar macrophages. The equilibrium dissociation constant for [ 125 I]ICYP is 24.3 +/- 1.2 pM, and the number of binding sites is 166.3 +/- 13.7 fmol/mg protein (N = 4, +/- SEM). Displacement studies with selective antagonists showed that [ 125 I]ICYP labels beta 2-adrenoceptors on guinea pig alveolar macrophages
Chen, Renxiang; Wang, Yi-Wen; Fornace, Albert J; Li, Heng-Hong
2016-12-01
Two major CD4 + T-helper (Th) lineages are Th1 and Th2, and well balanced Th1/Th2 responses are essential for immune function. In previously published studies, it was reported that radiation induces a Th1/Th2 immune imbalance toward a Th2-dominant direction, and this imbalance may contribute to postirradiation immune dysfunction. The polarization of Th cells is driven by the cytokine milieu and controlled by intracellular regulatory pathways that respond to cytokine signaling. It is widely accepted that radiation induces cytokine aberration, however, the precise alterations of cytokines in various tissue environments have been difficult to evaluate. In addition, the effects of radiation on the intrinsic functions of Th cells remain uncharacterized. Therefore, how radiation affects Th1/Th2 balance remains somewhat unclear. To address this, we investigated the changes in the polarization capability of Th cells by isolating them from mice previously exposed to radiation and assessing the cells in an established in vitro Th polarization system. Our novel results demonstrate that prior exposure to radiation led to the persistent aberration of the inherent capability of Th cells to differentiate into Th1 and Th2 lineages. The parallel changes in expression of Th1-specific master transcription factors and the key genes in metabolic reprograming indicated that radiation affects the core components in Th1 polarization. While Th1 differentiation was impaired after irradiation, little adverse effect was observed in Th2 differentiation; both of these findings contribute to the known phenotypes of Th1/Th2 imbalance caused by radiation.
Role of Th1 and Th2 cells in autoimmune demyelinating disease
Nagelkerken, L.
1998-01-01
Evidence is accumulating that Th1 cells play an important role in the development of multiple sclerosis (MS) and experimental allergic encephalomyelitis (EAE), whereas Th2 cells contribute to recovery from disease. A maj or determinant in the development of Th1 and Th2 cells is the type of
Energy Technology Data Exchange (ETDEWEB)
Delgado S, B; Zambrano A, F; Lavalley E, C; Ferro F, G; Lezama C, J
1991-03-15
Due to the half, relatively short life, of the I-125 used in the radioinmunoanalisis (he/she LAUGHS) of hormones realcionadas with the thyroid, frequently it is observed that they are the other reagents of commercial cases without using, reason for the one which you piede the possibility to use in their entirety statements kits for the CREEK, what causes lost economic and another type of deficiencies. Presently work the results are presented obtained on the characteristics of quality of commercial stuches for the CREEK of hormones of the thyroid profile (T3, T4 and TSH), after substituting to the different radiotrazadores in this cases. The marcaje of the hormones with I-125 was made by means of the method of the cloramina T with 25 seconds of reaction for each hormone, purifying the T3 and the T4 for cromatografia liquidates of high efficiency and to the TSH for cromatografia of likeness in a column of cellulose microcristalina of 6 x 0.8 cm. the substitution of the radiotrazador is made in the commercial cases and the protocol was continued proposed by the makers, giving a coefficient of correlation of -0-997, as a result after the comparison of the straight line among the cases without and with substitution of the radiotrazador; besides certain parameters of quality of the such rehearsals as: the maximum unions (50%+-5) and inespecifica (<5%), slope of the straight line (-2.1 + - 0.2), and other coming from the use of samples of control of quality. We can conclude that at the moment we have in the ININ radiotrazadores of T3, T4 and TSH of good quality, like to be substituted in commercial cases and to use this way to the maximum these games of reagents that are so expensive. (Author)
Study on apoptosis of prostate cancer cell induced by 125I seed irradiation
International Nuclear Information System (INIS)
Liao Anyan; Wang Junjie; Wang Jidong; Zhuang Hongqing; Zhao Yong
2007-01-01
Objective: To explore the mechanism of apoptosis induced by 125 I seed irradiation on PC3 cells. Methods: Human prostate cancer cell line PC3 was treated by irradiation of 125 I (2.77 cGy/h) with various dose. Agarose gel electrophoresis of DNA and flows cytometry were used to detect the apoptosis of PC3 cells and indirect immunofluorescence assay was used to detect the expression of Bcl-2. The activity of Caspase-3 was measured by Caspase Colorimetric Assay Kits. Results: Apoptosis of PC3 cells could be efficiently induced by 125 I seed irradiation. The apoptotic peaks were found by flow cytometry and DNA ladder appeared on 1.8% agarose gel. The activity of Caspase-3 on PC3 cells treated by 125 I seed irradiation was not changed significantly. Bcl-2 gene expression was down-regulated with the sample concentration increased. Conclusion: 125 I irradiation can induce the apoptosis of PC3 cells and the mechanism of apoptosis is related with down regulation of Bcl-2 gene expression and is not related with Caspase-3 activity. (authors)
International Nuclear Information System (INIS)
Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J. M.; Grau Carles, A.
1994-01-01
A comparative study of performance of 19-iodo cholesterol 1 25I 3-acetate and sodium iodide samples labeled with 125I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I concentration of 0-90 μg and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol 1 I 3-acetate samples in Tolue ne-alcohol and 0 .04% for Na 125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs
In vivo binding of 125I-LSD to serotonin 5-HT2 receptors in mouse brain
International Nuclear Information System (INIS)
Hartig, P.R.; Scheffel, U.; Frost, J.J.; Wagner, H.N. Jr.
1985-01-01
The binding of 125 I-LSD (2-[ 125 I]-lysergic acid diethylamide) was studied in various mouse brain regions following intravenous injection of the radioligand. The high specific activity of 125 I-LSD enabled the injection of low mass doses (14ng/kg), which are well below the threshold for induction of any known physiological effect of the probe. The highest levels of 125 I-LSD binding were found in the frontal cortex, olfactory tubercles, extra-frontal cortex and striatum while the lowest level was found in the cerebellum. Binding was saturable in the frontal cortex but increased linearly in the cerebellum with increasing doses of 125 I-LSD. Serotonergic compounds potently inhibited 125 I-LSD binding in cortical regions, olfactory tubercles, and hypothalamus but had no effect in the cerebellum. Dopaminergic compounds caused partial inhibition of binding in the striatum while adrenergic compounds were inactive. From these studies the authors conclude that 125 I-LSD labels serotonin 5-HT 2 receptor sites in cortical regions with no indication that other receptor sites are labeled. In the olfactory tubercles and hypothalamus, 125 I-LSD labeling occurs predominantly or entirely at serotonic 5-HT 2 sites. In the striatum, 125 I-LSD labels approximately equal proportions of serotonergic and dopaminergic sites. These data indicate that 125 I-LSD labels serotonin receptors in vivo and suggests that appropriate derivatives of 2I-LSD may prove useful for tomographic imaging of serotonin 5-HT 2 receptors in the mammalian cortex
The expression of miR-125b regulates angiogenesis during the recovery of heat-denatured HUVECs.
Zhou, Situo; Zhang, Pihong; Liang, Pengfei; Huang, Xiaoyuan
2015-06-01
In previous studies we found that miR-125b was down-regulated in denatured dermis of deep partial thickness burn patients. Moreover, miR-125b inhibited tumor-angiogenesis associated with the decrease of ERBB2 and VEGF expression in ovarian cancer cells and breast cancer cells, etc. In this study, we investigated the expression patterns and roles of miR-125b during the recovery of denatured dermis and heat-denatured human umbilical vein endothelial cells (HUVECs). Deep partial thickness burns in Sprague-Dawley rats and the heat-denatured cells (52°C, 35 s) were used for analysis. Western blot analysis and real-time PCR were applied to evaluate the expression of miR-125b and ERBB2 and VEGF. The ability of angiogenesis in heat-denatured HUVECs was analyzed by scratch wound healing and tube formation assay after pri-miR-125b or anti-miR-125b transfection. miR-125b expression was time-dependent during the recovery of heat-denatured dermis and HUVECs. Moreover, miR-125b regulated ERBB2 mRNA and Protein Expression and regulated angiogenesis association with regulating the expression of VEGF in heat-denatured HUVECs. Taken together our results show that the expression of miR-125b is time-dependent and miR-125b plays a regulatory role of angiogenesis during wound healing after burns. Copyright © 2014 Elsevier Ltd and ISBI. All rights reserved.
International Nuclear Information System (INIS)
Roa, Wilson H.Y.; Miller, Gerald G.; McEwan, Alexander J.B.; McQuarrie, Steve A.; Tse, Jeanie; Wu, Jonn; Wiebe, Leonard I.
1998-01-01
Purpose: Iodine-125 induces cell death by a mechanism similar to that of high linear energy transfer (high-LET) radiation. This study investigates the cytotoxicity of high-specific-activity [ 125 I]meta-iodobenzylguanidine ( 125 I-mIBG) in human SK-N-MC neuroblastoma cells grown as three-dimensional multicellular spheroids. Materials and Methods: Spheroids were incubated with high-specific-activity 125 I-mIBG (6 mCi/μg, 1000 times that of the conventional specific activity used for autoradiography). Cytotoxicity was assessed by fluorescence viability markers and confocal microscopy for intact spheroids, fluorescence-activated cell sorting and clonogenic assay, and clonogenic assays for dispersed whole spheroids. Distribution of radioactive mIBG was determined by quantitative light-microscope autoradiography of spheroid cryostat sections. Dose estimation was based on temporal knowledge of the retained radioactivity inside spheroids, and of the radiolabel's emission characteristics. Findings were compared with those of spheroids treated under the same conditions with 131 I-mIBG, cold mIBG, and free iodine-125. Results: 125 I-mIBG exerted significant cell killing. Complete spheroids were eradicated when they were treated with 500 μCi of 125 I-mIBG, while those treated with 500 μCi or 1000 μCi of 131 I-mIBG were not. The observed difference in cytotoxicity between treatments with 125 I- and 131 I-mIBG could not be accounted for by the absorbed dose of spheroid alone. The peripheral, proliferating cell layer of the spheroids remained viable at the moderate radioactivity of 100 μCi for both isotopes. Cytotoxicity induced by 125 I-mIBG was quantitatively comparable by the peripheral rim thickness to that of 131 I-mIBG at the dose of 100 μCi. The peripheral rim thickness decreased most significantly in the first 17 hours after initial treatment. There was no statistical decrease in the rim thickness identified afterwards for the second, third, and fourth days of
40 CFR 1048.125 - What maintenance instructions must I give to buyers?
2010-07-01
... using fuel that causes substantially more engine performance problems than commercial fuels of the same... give to buyers? 1048.125 Section 1048.125 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... intervals, except as specified in paragraphs (a)(3), (b) and (c) of this section: (i) For catalysts, fuel...
Prokofiev: Sinfonia Concertante Op. 125 / Pierre-E. Barbier
Barbier, Pierre-E.
1998-01-01
Uuest heliplaadist "Prokofiev: Sinfonia Concertante Op. 125; Miaskowsky: Cello Concerto Op. 66, sellisti Truls Mörk ja City of Birmingham Symphony Orchestra, joht. Paavo Järvi" Virgin Classics 5 45282 2. (1988)
Directory of Open Access Journals (Sweden)
Shang Li
2018-01-01
Full Text Available Purpose. CD4+LAP+ T cells are newly discovered regulatory T cells (Tregs. The aim of this study is to investigate the balance of Th1/Th2 and LAP+Tregs/Th17 in mice after allogeneic corneal transplantation. Methods. A total of 65 mice received orthotopic penetrating transplantation. According to the survival scores of the grafts, the mice were divided into the rejection group and the survival group 3 weeks after transplantation. Th1, Th2, Th17, and regulatory T cells in the ipsilateral drainage lymph nodes and spleens were measured with flow cytometry. The related cytokines in aqueous humor were also analyzed. Results. The frequencies of Foxp3+Tregs, GARP+Tregs, and LAP+Tregs in the survival group were significantly higher than those in the rejection group. And the expression trend of CD4+LAP+ T cells and CD4+GARP+ T cells was consistent. The level of IFN-γ, TNF, IL-6, and IL-17A markedly increased in aqueous humor during corneal allograft rejection. The ratio of Th1/Th2 and Th17/LAP+Tregs significantly increased in the rejection group at the 3rd week after corneal transplantation. Conclusion. LAP+Tregs might be regarded as substitute for Foxp3+Tregs. The balance of Th1/Th2 and LAP+Tregs/Th17 is crucial for corneal allograft survival.
7 CFR 929.125 - Committee review procedures.
2010-01-01
... MASSACHUSETTS, RHODE ISLAND, CONNECTICUT, NEW JERSEY, WISCONSIN, MICHIGAN, MINNESOTA, OREGON, WASHINGTON, AND LONG ISLAND IN THE STATE OF NEW YORK Rules and Regulations § 929.125 Committee review procedures... Committee within 30 days after receipt of the Committee's determination of sales history, a request for a...
I-125 seed dose estimates in heterogeneous phantom
International Nuclear Information System (INIS)
Branco, Isabela S.L.; Antunes, Paula C.G.; Cavalieri, Tassio A.; Moura, Eduardo S.; Zeituni, Carlos A.; Yoriyaz, Helio
2015-01-01
Brachytherapy plays an important role in the healing process involving tumors in a variety of diseases. Several studies are currently conducted to examine the heterogeneity effects of different tissues and organs in brachytherapy clinical situations and a great effort has been made to incorporate new methodologies to estimate doses with greater accuracy. The objective of this study is to contribute to the assessment of heterogeneous effects on dose due to I-125 brachytherapy source in the presence of different materials with different densities and chemical compositions. The study was performed in heterogeneous phantoms using materials that simulate human tissues. Among these is quoted: breast, fat, muscle, lungs (exhaled and inhaled) and bones with different densities. Monte Carlo simulations for dose calculation in these phantoms were held and subsequently validated. The model 6711 I-125 seed was considered because it is widely used as a brachytherapy permanent implant and the one used in clinics and hospitals in Brazil. Thermoluminescent dosimeters TLD-700 (LiF: Mg, Ti) were simulated for dose assess. Several tissue configurations and positioning of I-125 sources were studied by simulations for future dose measurements. The methodology of this study so far shall be suitable for accurate dosimetric evaluation for different types of brachytherapy treatments, contributing to brachytherapy planning systems complementation allowing a better assessment of the dose actually delivered to the patient. (author)
I-125 seed dose estimates in heterogeneous phantom
Energy Technology Data Exchange (ETDEWEB)
Branco, Isabela S.L.; Antunes, Paula C.G.; Cavalieri, Tassio A.; Moura, Eduardo S.; Zeituni, Carlos A.; Yoriyaz, Helio, E-mail: isabela.slbranco@gmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2015-07-01
Brachytherapy plays an important role in the healing process involving tumors in a variety of diseases. Several studies are currently conducted to examine the heterogeneity effects of different tissues and organs in brachytherapy clinical situations and a great effort has been made to incorporate new methodologies to estimate doses with greater accuracy. The objective of this study is to contribute to the assessment of heterogeneous effects on dose due to I-125 brachytherapy source in the presence of different materials with different densities and chemical compositions. The study was performed in heterogeneous phantoms using materials that simulate human tissues. Among these is quoted: breast, fat, muscle, lungs (exhaled and inhaled) and bones with different densities. Monte Carlo simulations for dose calculation in these phantoms were held and subsequently validated. The model 6711 I-125 seed was considered because it is widely used as a brachytherapy permanent implant and the one used in clinics and hospitals in Brazil. Thermoluminescent dosimeters TLD-700 (LiF: Mg, Ti) were simulated for dose assess. Several tissue configurations and positioning of I-125 sources were studied by simulations for future dose measurements. The methodology of this study so far shall be suitable for accurate dosimetric evaluation for different types of brachytherapy treatments, contributing to brachytherapy planning systems complementation allowing a better assessment of the dose actually delivered to the patient. (author)
Effects of 1,25-dihydroxycholecalciferol on 47calcium absorption in post-menopausal osteoporosis.
Caniggia, A; Vattimo, A
1979-07-01
Measurement of 47Calcium absorption was performed on eleven women with post-menopausal osteoporosis. The study was repeated after 10 days treatment with 1 microgram daily of 1,25(OH)2D3. These patients showed a statistically significant improvement of fractional calcium absorption that was inversely correlated to the basal values. The prompt improvement of the intestinal calcium transport in post-menopausal osteoporotic women, a few days after the administration of physiological doses of 1,25(OH)2D3, suggests that these patients synthesize inappropriately small amounts of 1,25(OH)2D3 because of their oestrogen deficiency. This could be an important pathogenetic factor in post-menopausal osteoporosis, as the efficiency of the adaptation of calcium absorption to low calcium intakes is dependent on 1,25(OH)2D3.
Wu, Shu-Yan; Wang, Li-Dan; Xu, Guang-Mei; Yang, Si-di; Deng, Qi-Feng; Li, Yuan-Yuan; Huang, Rui
2017-08-01
Salmonella enterica serovar typhimurium (S. typhimurium) are facultative intracellular enteric pathogens causing disease with a broad range of hosts. It was known that Th1-type cytokines such as IFN-γ, IL-12, and TNF-α etc. could induce protective immunity against intracellular pathogens, while Th2-type cytokines such as IL-4, IL-10, and IL-13 etc. are proved to help pathogens survive inside hosts and cause severe infection. One of the critical virulence factor attributes to the pathogenesis of S. typhimurium is Salmonella plasmid virulence genes (spv). Until now, the interaction between spv locus and the predictable generation of Th1 or Th2 immune responses to Salmonella has not been identified. In this study, zebrafish adults were employed to explore the effect of spv locus on Salmonella pathogenesis as well as host adaptive immune responses especially shift of Th1/Th2 balance. The pathological changes of intestines and livers in zebrafish were observed by hematoxylin-eosin (HE) staining and electron microscopy. Levels of the transcription factors of Th1 (Tbx21) and Th2 (GATA3) were measured by real-time quantitative PCR (RT-qPCR). Expression of cytokines were determined by using RT-qPCR and ELISA, respectively. Results showed that spv operon aggravates damage of zebrafish. Furthermore, it demonstrated that spv locus could inhibit the transcription of tbx21 gene and suppress the expression of cytokines IFN-γ, IL-12 and TNF-α. On the contrary, the transcription of gata3 gene could be promoted and the expression of cytokines IL-4, IL-10 and IL-13 were enhanced by spv locus. Taken together, our data revealed that spv locus could aggravate Salmonella infection of zebrafish adult by inducing an imbalance of Th1/Th2 immune response and resulting in a detrimental Th2 bias of host. Copyright © 2017. Published by Elsevier Ltd.
Effect of organic matter on 125I diffusion in bentonite
International Nuclear Information System (INIS)
Tao Wu; Qing Zheng
2015-01-01
Through-diffusion method was conducted to investigate the diffusion behavior of 125 I in bentonite in present of organic matter, such as polyaminopolycarboxylate EDTA, oxalic acid, hydrazine and humic acid HA. The effective diffusion coefficient D e value and rock capacity factor α were (2.32.6) × 10 -11 m 2 /s and 0.040-0.052, respectively. The small difference showed that iodine was preferentially associated with silicoaluminate mineral as an inorganic form. In present of HA, the D a value of 125 I was almost two orders of magnitude higher than that of HA and humic substances HS. The D e and α derived from the experiments were used to simulate its diffusion in the designed bentonite obstacle of high-level radioactive waste repository and the results showed that 125 I can be transported from 30 to 50 cm thickness of bentonite to the far-field of repository in several years. (author)
Energy Technology Data Exchange (ETDEWEB)
de Martin, B W [Sao Paulo Univ. (Brazil). Faculdade de Medicina Veterinaria e Zootecnia
1975-01-01
A study is made on the thyroid function of thoroughbred female equines, aged between five through twelve years, in varying stages of pregnancy, using 'in vitro' tests /sup 125/I.T/sub 3/ and /sup 125/I-T/sub 4/.
Retnla (relmalpha/fizz1 suppresses helminth-induced Th2-type immunity.
Directory of Open Access Journals (Sweden)
John T Pesce
2009-04-01
Full Text Available Retnla (Resistin-like molecule alpha/FIZZ1 is induced during Th2 cytokine immune responses. However, the role of Retnla in Th2-type immunity is unknown. Here, using Retnla(-/- mice and three distinct helminth models, we show that Retnla functions as a negative regulator of Th2 responses. Pulmonary granuloma formation induced by the eggs of the helminth parasite Schistosoma mansoni is dependent on IL-4 and IL-13 and associated with marked increases in Retnla expression. We found that both primary and secondary pulmonary granuloma formation were exacerbated in the absence of Retlna. The number of granuloma-associated eosinophils and serum IgE titers were also enhanced. Moreover, when chronically infected with S. mansoni cercariae, Retnla(-/- mice displayed significant increases in granulomatous inflammation in the liver and the development of fibrosis and progression to hepatosplenic disease was markedly augmented. Finally, Retnla(-/- mice infected with the gastrointestinal (GI parasite Nippostrongylus brasiliensis had intensified lung pathology to migrating larvae, reduced fecundity, and accelerated expulsion of adult worms from the intestine, suggesting Th2 immunity was enhanced. When their immune responses were compared, helminth infected Retnla(-/- mice developed stronger Th2 responses, which could be reversed by exogenous rRelmalpha treatment. Studies with several cytokine knockout mice showed that expression of Retnla was dependent on IL-4 and IL-13 and inhibited by IFN-gamma, while tissue localization and cell isolation experiments indicated that eosinophils and epithelial cells were the primary producers of Retnla in the liver and lung, respectively. Thus, the Th2-inducible gene Retnla suppresses resistance to GI nematode infection, pulmonary granulomatous inflammation, and fibrosis by negatively regulating Th2-dependent responses.
(E)-[{sup 125}I]-5-AOIBV: a SPECT radioligand for the vesicular acetylcholine transporter
Energy Technology Data Exchange (ETDEWEB)
Emond, Patrick [INSERM U619, 37000 Tours (France); Universite Francois-Rabelais de Tours, CHRU, Hopital Bretonneau, Service de Medecine nucleaire, 37000 Tours (France); Mavel, Sylvie [INSERM U619, 37000 Tours (France); Universite Francois-Rabelais de Tours, CHRU, Hopital Bretonneau, Service de Medecine nucleaire, 37000 Tours (France)], E-mail: sylvie.mavel@univ-tours.fr; Zea-Ponce, Yolanda [INSERM U619, 37000 Tours (France); Universite Francois-Rabelais de Tours, CHRU, Hopital Bretonneau, Service de Medecine nucleaire, 37000 Tours (France); Kassiou, Michael [Discipline of Medical Radiation Sciences, Brain and Mind Research Institute, University of Sydney, NSW 2050 (Australia); School of Chemistry, University of Sydney, NSW 2006 (Australia); Garreau, Lucette; Bodard, Sylvie; Drossard, Marie-Laure; Chalon, Sylvie; Guilloteau, Denis [INSERM U619, 37000 Tours (France); Universite Francois-Rabelais de Tours, CHRU, Hopital Bretonneau, Service de Medecine nucleaire, 37000 Tours (France)
2007-11-15
The premise that, over the course of Alzheimer's disease (AD), changes in the levels of the vesicular acetylcholine transporter (VAChT) occur in parallel with changes to other cholinergic marker proteins provides the basis for the applicability of benzovesamicol derivatives as radioligands for AD studies by single photon emission computed tomography or positron emission tomography. We report the synthesis of enantiopure benzovesamicol derivatives: (R,R) or (S,S)-(E)-2-hydroxy-5-(3-iodoprop-2-en-1-oxy)-3- (4-phenylpiperidino)tetralin [(R,R)-AOIBV: K{sub d}=0.45 nM or (S,S)-5-AOIBV: K{sub d}=4.3 nM] and their corresponding tributyltin precursors for radioiodination. (R,R or S,S)-5-AOIBV was labeled with iodine-125 from their corresponding n-tributyltin precursors. Both compounds were obtained with radiochemical and optical purity greater than 97% and in radiochemical yields ranging 34-36%. To determine if these compounds could provide an advantage when compared to [{sup 125}I]-iodo benzovesamicol (IBVM), IBVM was also labeled and used as the reference compound in all ex vivo experiments. Ex vivo biodistribution experiments in rats revealed that [{sup 125}I]-(R,R)-5-AOIBV displayed the most suitable pharmacological profile as the radioactivity distribution corresponded well with the known VAChT brain density. Moreover, pre-injection of vesamicol prevented the uptake of [{sup 125}I]-(R,R)-5-AOIBV in striatum, cortex and hippocampus, demonstrating selectivity for the VAChT. However, even if time activity curves of [{sup 125}I]-(R,R)-5-AOIBV confirmed that this compound could be used to visualize the VAChT in vivo, at each point of the kinetic study, [{sup 125}I]-(R,R)-5-AOIBV showed a lower specific binding compared to [{sup 125}I]-IBVM. These results made [{sup 125}I]-( R,R)-5-AOIBV inferior to [{sup 125}I]-IBVM for the VAChT exploration in vivo.
Disruption of CTCF at the miR-125b1 locus in gynecological cancers
International Nuclear Information System (INIS)
Soto-Reyes, Ernesto; Herrera, Luis A; González-Barrios, Rodrigo; Cisneros-Soberanis, Fernanda; Herrera-Goepfert, Roberto; Pérez, Víctor; Cantú, David; Prada, Diddier; Castro, Clementina; Recillas-Targa, Félix
2012-01-01
In cancer cells, transcriptional gene silencing has been associated with genetic and epigenetic defects. The disruption of DNA methylation patterns and covalent histone marks has been associated with cancer development. Until recently, microRNA (miRNA) gene silencing was not well understood. In particular, miR-125b1 has been suggested to be an miRNA with tumor suppressor activity, and it has been shown to be deregulated in various human cancers. In the present study, we evaluated the DNA methylation at the CpG island proximal to the transcription start site of miR-125b1 in cancer cell lines as well as in normal tissues and gynecological tumor samples. In addition, we analyzed the association of CTCF and covalent histone modifications at the miR-125b1 locus. To assess the DNA methylation status of the miR-125b1, genomic DNA was transformed with sodium bisulfite, and then PCR-amplified with modified primers and sequenced. The miR-125b1 gene expression was analyzed by qRT-PCR using U6 as a control for constitutive gene expression. CTCF repressive histone marks abundance was evaluated by chromatin immunoprecipitation assays. The disruption of CTCF in breast cancer cells correlated with the incorporation of repressive histone marks such H3K9me3 and H3K27me3 as well as with aberrant DNA methylation patterns. To determine the effect of DNA methylation at the CpG island of miR-125b1 on the expression of this gene, we performed a qRT-PCR assay. We observed a significant reduction on the expression of miR-125b1 in cancer cells in comparison with controls, suggesting that DNA methylation at the CpG island might reduce miR-125b1 expression. These effects were observed in other gynecological cancers, including ovarian and cervical tumors. A reduction of miR-125b1 expression in cancers, correlated with methylation, repressive histone marks and loss of CTCF binding at the promoter region
{sup 125}I Labelling of Protein Using Immobilized Enzyme
Energy Technology Data Exchange (ETDEWEB)
Kim, Jae Rok; Park, Kyung Bae; Awh, Ok Doo [Korea Advanced Energy Research Institute, Daejeon (Korea, Republic of)
1984-03-15
For an effective solid-phase labelling of protein with {sup 125}I, studies on the immobilization of lactoperoxidase (LPO) on the inner wall of polystyrene tubes were carried out. Labelling of bovine serum albumin (BSA) and insulin was also practiced using the LPO immobilized tubes. The immobilized enzyme of about 2.5 mu g/tube was sufficient for small scale labelling since the results of radio-paper chromatography of the labelling mixture of insulin indicated that the yields were sufficiently high (80%) even in the reactions conducted at room temperature for 60 sec. The results of the Sephadex column chromatography indicated that the labelled products were not contaminated with LPO-{sup 125}I, and the radiochemical purity of the products was more than 90%. In considering the general trend that the {sup 125}I labelled protein obtained by using LPO maintains its intactness better than those obtained by using chloramine-T, together with the tendency of yield enhancing with increase of reactants-concentration, the LPO immobilized tube method is estimated to be one of the simple methods of labelling. The product might be applicable without further purification.
Evaluation of paracavernous cranial nerves (3rd to 6th) with CT
International Nuclear Information System (INIS)
Tsuha, Mitsuru; Okamura, Tomomi; Abiko, Seisho; Aoki, Hideo
1984-01-01
We have now used CT to evaluate the cavernous sinuses, especially the 3rd, 4th, 5th, and 6th cranial nerves. adjacent to them. Twenty cases, presumably all having sellar or parasellar lesions, were examined by means of thin-slice (2-4 mm) axial and coronal (including both direct and reconstructed methods) CT studies. Moreover, three blocks of the sellar region obtained from adult cadavers were examined beforehand by CT scan, and the courses of the respective paracavernous cranial nerves were confirmed by microsurgical dissection. As a result, the following conclusions were obtained. 1. It was valuable to perform a post-enhanced direct coronal study for the definite identification of the paracavernous cranial nerves (3rd to 6th cranial nerves). 2. Also valuable was a magnified CT film of the parasellar regions, which made the identification of the parasellar cranial nerves clearer. 3. In the clinical cases showing a normal shape of the cavernous sinuses on CT, each cranial nerve was evaluated. In the axial studies (almost 10 to 15 degrees anterior to Reid's basal line), the frequencies of the identification of the 3rd, 5th, and 6th cranial nerves were 76%, 97% (as to the Gasserian ganglion), and 21% respectively. None of the 4th cranial nerve was visualized in the cases examined. On the other hand, the frequencies of the identification of the 3rd, 5th, and 6th cranial nerves were 83%, 86%, and 21% respectively in the direct coronal studies and 62%, 57%, and 4% in those of the reconstructed films. The visualization of each cranial nerve in the direct coronal study was better than when the reconstructed method was used. Finally, a schematic presentation of the cranial nerves adjacent to the cavernous sinuses was made in the axial and coronal projections. (J.P.N.)
Preparation of 125I labelled compound
International Nuclear Information System (INIS)
Rafii, H.; Beiki, D.; Matlubi, M.; Jalilian, A.R.; Motamedi, F.; Karimian, A.R.; Najafi, R.; Babaei, M.; Kamali Dehghan, M.; Shah-Hossaini, G.R.; Shafahi, S.K.; Keshavarzi, F.
2002-01-01
Iodinated compounds with 131 I, 125 I and 123 I have been widely used for biochemical function studies. In conjunction with SPECT, [ 123 I] labelled proteins have various diagnostic and therapeutic applications in nuclear medicine. In this study, synthesis and quality control of [ 18 F]radiofluorinated and radioiodinated of some proteins and peptides as well as their biological behaviors are considered to be investigated. (author)
Final address by Mr. R.W. Boswell, President of the 17th session of the General Conference
International Nuclear Information System (INIS)
1973-01-01
''It is becoming increasingly apparent to many countries of the world that the provision of an adequate supply of energy to their communities is not only a matter of science and technological development, but also that the sociological and political impact of the technical decision involved is of great importance. I am not one of those who is prepared to extrapolate the exponential curves of demand for a definite period in the future and reach a doomsday conclusion. But it is certainly true that on a world basis our present fuels have limited lives and will need to be supplemented or perhaps replaced by other resources. I am sure these resources will be found, but I am equally sure that we must look forward to a long period when Governments will require advice from men or organizations who are truly inter-disciplinary in the broadest sense of that word. Workers in the field of nuclear energy through sheer necessity have, I believe, developed this inter-disciplinary approach in greater depth than perhaps their colleagues working in the more conventional forms of energy and some countries, I believe, have already begun to exploit the special talents of such people and organizations. This Agency has already moved to diversify its activities particularly towards work on the impact of nuclear energy on the environment, but protection of the environment is but one of many sociological questions that one can expect to be raised in world forums in the coming years. I personally feel that your Agency, uniquely among the United Nations family, is in a position to make a major contribution to the solution of those problems.'' These words were taken from the final address by Mr. R.W. Boswell, Chairman of the Australian AEC, President of the 17th Session of the General Conference. (author)
Thermal expansion studies on Th(MoO4)2, Na2Th(MoO4)3 and Na4Th(MoO4)4
International Nuclear Information System (INIS)
Keskar, Meera; Krishnan, K.; Dahale, N.D.
2008-01-01
Thermal expansion behavior of Th(MoO 4 ) 2 , Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 was studied under vacuum in the temperature range of 298-1123 K by high temperature X-ray diffractometer. Th(MoO 4 ) 2 was synthesized by reacting ThO 2 with 2 mol of MoO 3 , at 1073 K in air and Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 were prepared by reacting Th(MoO 4 ) 2 with 1 and 2 mol of Na 2 MoO 4 , respectively at 873 K in air. The XRD data of Th(MoO 4 ) 2 was indexed on orthorhombic system where as XRD data of Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 were indexed on tetragonal system. The lattice parameters and cell volume of all the three compounds, fit into polynomial expression with respect to temperature, showed positive thermal expansion (PTE) up to 1123 K. The average value of thermal expansion coefficients for Th(MoO 4 ) 2 , Na 2 Th(MoO 4 ) 3 and Na 4 Th(MoO 4 ) 4 were determined from the high temperature data
International Nuclear Information System (INIS)
Liu Wenshu
1992-01-01
A self-made radioimmunoassay CA125 kit (using OC125 monoclonal antibody ascites offered by Dr. Bast Laboratory which was purified, solidified and labelled with 125 I) was used for serum determination in 80 patients with epithelial ovarian cancer and in 40 standard antigen samples. The results demonstrated a statistically significant correlation between our self-made CA 125 kit and an imported CENTOCOR CA125 kit (P 125 kit is very useful in monitoring epithelial ovarian cancer
125I-β-CIT imaging study of striatal dopamine transporters in mice model of parkinsonism
International Nuclear Information System (INIS)
Liu Zhenguo; Sun Wenshan; Weng Zhongfang; Chen Shengdi; Shen Minghua; Zhu Chengmo
2001-01-01
Objective: To detect the activity of striatal dopamine transporters (DAT) in lesions of different order of severity of MPTP-induced mice model of parkinsonism by autoradiography with 125 I-β-CIT and to evaluate the clinical use of the β-CIT imaging for DAT detection. Methods: With regard to the different duration (days) of MPTP treatment, the C57BL mice were randomly divided into 5 groups, that is MPTP 1, 3, 5 and 7 day groups and control group treated with normal saline instead of MPTP. Two hours after intravenous administration with 125 I-β-CIT of 148 kBq, the brain tissue sections were imaged by autoradiography. The levels of dopamine (DA) and its metabolites were measured by high performance liquid chromatography and electrochemical detection (HPLC-ECD). The tyrosine hydroxylase (TH)-positive cells and fibres in the substantia nigra and striatum of the mice were observed by means of immunohistochemical technique. Results: As compared with control group, the radioactivity ratios of striatum to cortex (ST/CX) in 4 MPTP-treated groups were significantly reduced, by 20%, 42%, 45% and 52%, respectively. The concentrations of DA in the striatum of 4 MPTP-treated groups were remarkably decreased, by 47%, 75%, 95% and 95%, respectively. The gradual loss of DA neurons and fibres in the substantia nigra and striatum in 4 MPTP-treated groups was observed under microscopy. Conclusions: The functional abnormality of DAT paralleled the changes observed in neurochemistry and neuropathology studies in the lesions of different order of injury of the MPTP-treated mice. The β-CIT scanning for the activity of DAT may be useful for diagnosing PD at earlier phase and for monitoring the progression of the disease
... Morgan M, Boyd J, Drapking R, Seiden MV. Cancers arising in the ovary. In: Niederhuber JE, Armitage JO, Doroshow JH, Kastan MB, Tepper JE, eds. Abeloff's Clinical Oncology . 5th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap 89. ... Florida Cancer Specialists & Research Institute, Wellington, FL. Review provided by ...
Energy Technology Data Exchange (ETDEWEB)
Cox, Richard M; Citir, Murat; Armentrout, P. B., E-mail: armentrout@chem.utah.edu [Department of Chemistry, University of Utah, Salt Lake City, Utah 84112-0850 (United States); Battey, Samuel R.; Peterson, Kirk A. [Department of Chemistry, Washington State University, Pullman, Washington 99164-4630 (United States)
2016-05-14
Kinetic energy dependent reactions of Th{sup +} with O{sub 2} and CO are studied using a guided ion beam tandem mass spectrometer. The formation of ThO{sup +} in the reaction of Th{sup +} with O{sub 2} is observed to be exothermic and barrierless with a reaction efficiency at low energies of k/k{sub LGS} = 1.21 ± 0.24 similar to the efficiency observed in ion cyclotron resonance experiments. Formation of ThO{sup +} and ThC{sup +} in the reaction of Th{sup +} with CO is endothermic in both cases. The kinetic energy dependent cross sections for formation of these product ions were evaluated to determine 0 K bond dissociation energies (BDEs) of D{sub 0}(Th{sup +}–O) = 8.57 ± 0.14 eV and D{sub 0}(Th{sup +}–C) = 4.82 ± 0.29 eV. The present value of D{sub 0} (Th{sup +}–O) is within experimental uncertainty of previously reported experimental values, whereas this is the first report of D{sub 0} (Th{sup +}–C). Both BDEs are observed to be larger than those of their transition metal congeners, TiL{sup +}, ZrL{sup +}, and HfL{sup +} (L = O and C), believed to be a result of lanthanide contraction. Additionally, the reactions were explored by quantum chemical calculations, including a full Feller-Peterson-Dixon composite approach with correlation contributions up to coupled-cluster singles and doubles with iterative triples and quadruples (CCSDTQ) for ThC, ThC{sup +}, ThO, and ThO{sup +}, as well as more approximate CCSD with perturbative (triples) [CCSD(T)] calculations where a semi-empirical model was used to estimate spin-orbit energy contributions. Finally, the ThO{sup +} BDE is compared to other actinide (An) oxide cation BDEs and a simple model utilizing An{sup +} promotion energies to the reactive state is used to estimate AnO{sup +} and AnC{sup +} BDEs. For AnO{sup +}, this model yields predictions that are typically within experimental uncertainty and performs better than density functional theory calculations presented previously.
Separation of 134Cs and 137Cs from 125I solution for medical applications
International Nuclear Information System (INIS)
Ram, Ramu; Dash, Ashutosh; Banerjee, Dayamoy
2015-01-01
While neutron irradiation of natural Xe gas followed by wet chemical dissolution of activation products constitutes a successful paradigm for the small scale production 125 I, the concomitant production of 134 Cs and 137 Cs emerged as the primary impediment which necessitates purification of 125 I solution. This paper describes an ion-exchange chromatographic technique using Resorcinol Formaldehyde (RF) resin to purify 125 I solution from 134 Cs and 137 Cs impurities. A thorough investigation of the adsorption parameters of RF resin was carried out to arrive at the experimental conditions resulting optimum retention of 134 Cs and 137 Cs impurities. Based on the experimental findings, an optimized separation procedure was developed in which the neutron irradiated dissolved products at pH ∝ 13 was passed through a chromatography column containing RF resin where in 134 Cs and 137 Cs impurities gets adsorbed leaving behind 125 I to appear in the effluent. The overall recovery of 125 I was >90% with acceptable purity amenable for clinical applications.
N-(m-[125I]iodophenyl)maleimide: an agent for high yield radiolabeling of antibodies
International Nuclear Information System (INIS)
Khawli, L.A.; Van den Abbeele, A.D.; Kassis, A.I.
1992-01-01
In an effort to radiolabel antibodies, N-(m-[ 125 I]iodophenyl)maleimide (m-[ 125 I]IPM) was prepared by the demetallation of an N-[m-tri-(n-butyl)stannylphenyl]maleimide intermediate. The unlabeled intermediate was synthesized in ≥ 75% yield using a palladium catalyzed reaction of hexabutylditin with m-bromoaniline, followed by reaction with maleic anhydride and ring annulation. All products were confirmed by NMR and elemental analysis. Labeling with 125 I was carried out in a biphasic mixture containing chloramine-T (radiochemical yield ≥ 70%). Rabbit IgG modified with the heterobifunctional crosslinking agent N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP) and bovine serum albumin were conjugated with m-[ 125 I]IPM (yield: 40 and 80%, respectively). In addition, m-[ 125 I]IPM was conjugated to rabbit IgG subunits (HL) in 70% yield. The in vitro stability of the radiolabeled proteins in serum showed < 1% deiodination over 24h. (author)
Disproportionate rise in serum CA 125 in case of budd chiari syndrome: an unusual presentation
Prasad D. Game; Madhuri P. Holay; Satyanarayan Durgam; Sandeep Kharkar
2015-01-01
Ca 125 is used as a diagnostic and prognostic biomarker for ovarian cancer. The level of CA 125 is also elevated in benign conditions like Budd Chiari syndrome, liver cirrhosis and heart failure. But very high level of CA 125 is rarely associated with benign conditions and this can mislead the physician. Here we present a case of budd chiari syndrome in postpartum period associated with very high level of CA 125 which is an unusual presentation. [Int J Res Med Sci 2015; 3(8.000): 2129-2131
Selective binding of 2-[125I]iodo-nisoxetine to norepinephrine transporters in the brain
International Nuclear Information System (INIS)
Kung, M.-P.; Choi, Seok-Rye; Hou, Catherine; Zhuang, Z.-P.; Foulon, Catherine; Kung, Hank F.
2004-01-01
A radioiodinated ligand, (R)-N-methyl-(2-[ 125 I]iodo-phenoxy)-3-phenylpropylamine, [ 125 I]2-INXT, targeting norepinephrine transporters (NET), was successfully prepared. A no-carrier-added product, [ 125 I]2-INXT, displayed a saturable binding with a high affinity (K d =0.06 nM) in the homogenates prepared from rat cortical tissues as well as from LLC-PK 1 cells expressing NET. A relatively low number of binding sties (B max =55 fmol/mg protein) measured with [ 125 I]2-INXT in rat cortical homogenates is consistent with the value reported for a known NET ligand, [ 3 H]nisoxetine. Competition studies with various compounds on [ 125 I]2-INXT binding clearly confirmed the pharmacological specificity and selectivity for NET binding sites. Following a tail-vein injection of [ 125 I]2-INXT in rats, a good initial brain uptake was observed (0.56% dose at 2 min) followed by a slow washout from the brain (0.2% remained at 3 hours post-injection). The hypothalamus (a NET-rich region) to striatum (a region devoid of NET) ratio was 1.5 at 3 hours post-i.v. injection. Pretreatment of rats with nisoxetine significantly inhibited the uptake of [ 125 I]2-INXT (70-100% inhibition) in locus coeruleus, hypothalamus and raphe nuclei, regions known to have a high density of NET; whereas escitalopram, a serotonin transporter ligand, did not show a similar effect. Ex vivo autoradiography of rat brain sections of [ 125 I]2-INXT (at 3 hours after an i.v. injection) displayed an excellent regional brain localization pattern corroborated to the specific NET distribution in the brain. The specific brain localization was significantly reduced by a dose of nisoxetine pretreatment. Taken together, the data suggest that [ 123 I]2-INXT may be useful for mapping NET binding sites in the brain
34 CFR 12.5 - Who may apply for surplus Federal real property?
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Who may apply for surplus Federal real property? 12.5 Section 12.5 Education Office of the Secretary, Department of Education DISPOSAL AND UTILIZATION OF... Federal real property: (a) A State. (b) A political subdivision or instrumentality of a State. (c) A tax...
Investigation of the metabolism of 125I orthohippuric acid (sodium salt) in rats
International Nuclear Information System (INIS)
Boegl, W.; Stockhausen, K.; Censori, M.; Jahn, M.; Sander, B.
1977-07-01
100 μCi Iodine-125-labeled Orthoiodohippurate (sodium salt) were applied i.v. to two Wistar rats. Urine and faeces were collected during several days over periods of 24 hours in a metabolic cage. The urine was analysed both directly and after separation of the radioactive substances with an adsorbtive resin by means of TLC and HPLC. The faeces were extracted and then separated like the urine. The two main metabolites of I-125 Orthoiodohippurate (Hipp) were I-125 Orthoiodobenzoic acid (Benz) and J-125 Iodide (I). The mixture of metabolites in the first 24 hours urine urine was composed of: approximately 20% Benz, appeoximately 70% Hipp, approximately 10% I. During the following days, this composition showed a few changes. The most appropriate method for analyzing proved to be the direct HPLC of the metabolic urine and faeces extract. (orig./MG) [de
41 CFR 102-33.125 - If we use Federal aircraft, what are our management responsibilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If we use Federal aircraft, what are our management responsibilities? 102-33.125 Section 102-33.125 Public Contracts and... Parts Overview § 102-33.125 If we use Federal aircraft, what are our management responsibilities? If you...
21 CFR 801.125 - Medical devices for use in teaching, law enforcement, research, and analysis.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Medical devices for use in teaching, law enforcement, research, and analysis. 801.125 Section 801.125 Food and Drugs FOOD AND DRUG ADMINISTRATION... Directions for Use § 801.125 Medical devices for use in teaching, law enforcement, research, and analysis. A...
Energy Technology Data Exchange (ETDEWEB)
Rodriguez, L; Rebollo, D V; Ruiz, J M
1986-07-01
In this paper a new method of synthesis of 19-iodo cholesterol labelled with ''125 I, from commercial cholesterol, is described. Its high chemical (96%) and radiochemical (99.9%) purities high yield and short time of preparation permit us to dispose or a more accessible labelled compound, which results appropriates for clinical investigations and in the diagnosis of disturbances of the suprarenal glands. (Author) 9 refs.
News from the Library: The 8th edition Karlsruhe nuclide chart has been released
CERN Library
2012-01-01
The 8th edition of the Karlsruhe Nuclide Chart contains new data not found in the 7th edition. Since 1958, the well-known Karlsruhe Nuclide Chart has provided scientists with structured, valuable information on the half-lives, decay modes and energies of radioactive nuclides. The chart is used in many disciplines in physics (health physics, radiation protection, nuclear and radiochemistry, astrophysics, etc.) but also in the life and earth sciences (biology, medicine, agriculture, geology, etc.). The 8th edition of the Karlsruhe Nuclide Chart contains new data on 737 nuclides not found in the 7th edition. In total, nuclear data on 3847 experimentally observed ground states and isomers are presented. A new web-based version of this chart is in the final stages of development for use within the Nucleonica Nuclear Science Portal - a portal for which CERN has an institutional license. The chart is also available in paper format. If you want to buy a paper version of the chart, ple...
41 CFR 105-71.125 - Program income.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Program income. 105-71... GOVERNMENTS 71.12-Post-Award Requirements/Financial Administration § 105-71.125 Program income. (a) General. Grantees are encouraged to earn income to defray program costs. Program income includes income from fees...
27 CFR 28.125 - Disposition of forms.
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Withdrawal of Wine Without Payment of Tax for..., or Transportation to a Manufacturing Bonded Warehouse § 28.125 Disposition of forms. On removal of the wines from the premises of the bonded wine cellar, the proprietor shall forward one copy of TTB...
14 CFR 125.91 - Airplane requirements: General.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane requirements: General. 125.91... AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Airplane Requirements...
International Nuclear Information System (INIS)
Scholten, J.C.; Fietzke, J.; Mangini, A.; Stoffers, P.
2000-01-01
As part of the German JOINT GLOBAL OCEAN FLUX STUDY (JGOFS) the aim of the project was to investigate the particle dynamics in the water column, especially to estimate the trapping efficiencies of sediment traps deployed in the eastern North Atlantic (L1: 33 N 21 W; L2: 47 N 19.5 W; L3: 54,4 N 21,1 W; ESTOC: 29,07 N 15,25 W; OMEX: 49 N 12,5 W). This investigation was based on measurements of the distribution of natural radionuclides in the water column and in sediment traps. In the upper water column (≤1000 m) the 230 Th concentrations are similar at all locations investigated and a reversible scavenging model was able to describe the 230 Th distribution. In the deep water-column at L2 and L3 the 230 Th concentrations were significantly lower than predicted from the reversible scavenging model. The 230 Th concentrations here could be described by a scavenging-mixing model which assumes an advection of 230 Th depleted water masses and a rapid ventilation between 3 and 25 years. Based on two models, a mass balance for 230 Th and 231 Pa and a constant removal model, sediment trap efficiencies were calculated to be between 9% and 143%. The lowest efficiencies (9%-36%) were determined in the 500 m and 1000 m traps and no direct relation between water currents velocities and trapping biases were observed. The correction for trapping biases were found to be important for the understanding of the regional differences in the particle flux in the eastern north Atlantic. (orig.) [de
GSK-3 Inhibition Sensitizes Acute Myeloid Leukemia Cells to 1,25D-Mediated Differentiation
Gupta, Kalpana; Stefan, Tammy; Ignatz-Hoover, James; Moreton, Stephen; Parizher, Gary; Saunthararajah, Yogen; Wald, David N.
2017-01-01
1,25-dihydroxyvitamin D3 (1,25D), the biologically active form of vitamin D, is widely considered a promising therapy for acute myeloid leukemia (AML) based on its ability to drive differentiation of leukemic cells. However, clinical trials have been disappointing in part to dose-limiting hypercalcemia. Here we show how inhibiting glycogen synthase kinase 3 (GSK3) can improve the differentiation response of AML cells to 1,25D-mediated differentiation. GSK3 inhibition in AML cells enhanced the differentiating effects of low concentrations of 1,25D. In addition, GSK3 inhibition augmented the ability of 1,25D to induce irreversible growth inhibition and slow the progression of AML in mouse models. Mechanistic studies revealed that GSK3 inhibition led to the hyperphosphorylation of the vitamin D receptor (VDR), enabling an interaction between VDR and the coactivator, SRC-3 (NCOA3), thereby increasing transcriptional activity. We also found that activation of JNK-mediated pathways in response to GSK3 inhibition contributed to the potentiation of 1,25D-induced differentiation. Taken together, our findings offer a preclinical rationale to explore the repositioning of GSK3 inhibitors to enhance differentiation-based therapy for AML treatment. PMID:26964622
Asymmetrically deformed third minimum in the 231Th and 233Th fission barriers
International Nuclear Information System (INIS)
Blons, J.; Mazur, C.; Paya, D.; Ribrag, M.; Weigmann, H.
1981-01-01
Neutron induced fission cross-sections of 230 Th and 232 Th have been measured up to 5 MeV. The electron linear accelerator (GELINA) has been used as a neutron time of flight spectrometer with a nominal resolution of 84 psec/m for 230 Th(n,f) and 42 psec/m for 232 Th(n,f) reaction. The fission fragment detector was a 6 cell gas scintillator filled with xenon. The existence of fine structure peaks, a few keV wide, in both the 230 Th(n,f) and 232 Th(n,f) cross sections, is definitively confirmed. The analysis of the two vibrational resonances located respectively at 720 keV for 230 Th(the figure) and 1.6 MeV for 232 Th, shows clearly that these peaks can be interpreted, in terms of two rotational bands with opposite parities. This parity degeneracy is a consequence of the asymmetric, pear-like deformation of the excited nucleus [ru
Vidal, Marcos; Ramana, Chilakamarti V.; Dusso, Adriana S.
2002-01-01
The cytokine gamma interferon (IFN-γ) and the calcitropic steroid hormone 1,25-dihydroxyvitamin D (1,25D) are activators of macrophage immune function. In sarcoidosis, tuberculosis, and several granulomatoses, IFN-γ induces 1,25D synthesis by macrophages and inhibits 1,25D induction of 24-hydroxylase, a key enzyme in 1,25D inactivation, causing high levels of 1,25D in serum and hypercalcemia. This study delineates IFN-γ-1,25D cross talk in human monocytes-macrophages. Nuclear accumulation of Stat1 and vitamin D receptor (VDR) by IFN-γ and 1,25D promotes protein-protein interactions between Stat1 and the DNA binding domain of the VDR. This prevents VDR-retinoid X receptor (RXR) binding to the vitamin D-responsive element, thus diverting the VDR from its normal genomic target on the 24-hydroxylase promoter and antagonizing 1,25D-VDR transactivation of this gene. In contrast, 1,25D enhances IFN-γ action. Stat1-VDR interactions, by preventing Stat1 deactivation by tyrosine dephosphorylation, cooperate with IFN-γ/Stat1-induced transcription. This novel 1,25D-IFN-γ cross talk explains the pathogenesis of abnormal 1,25D homeostasis in granulomatous processes and provides new insights into 1,25D immunomodulatory properties. PMID:11909970
NLDAS Forcing Data L4 Hourly 0.125 x 0.125 degree V001
National Aeronautics and Space Administration — This data set contains the forcing data for Phase 1 of the North American Land Data Assimilation System (NLDAS-1). The data are in 1/8th degree grid spacing and...
miR-125b affects mitochondrial biogenesis and impairs brite adipocyte formation and function
Directory of Open Access Journals (Sweden)
Maude Giroud
2016-08-01
Full Text Available Objective: In rodents and humans, besides brown adipose tissue (BAT, islands of thermogenic adipocytes, termed “brite” (brown-in-white or beige adipocytes, emerge within white adipose tissue (WAT after cold exposure or β3-adrenoceptor stimulation, which may protect from obesity and associated diseases. microRNAs are novel modulators of adipose tissue development and function. The purpose of this work was to characterize the role of microRNAs in the control of brite adipocyte formation. Methods/Results: Using human multipotent adipose derived stem cells, we identified miR-125b-5p as downregulated upon brite adipocyte formation. In humans and rodents, miR-125b-5p expression was lower in BAT than in WAT. In vitro, overexpression and knockdown of miR-125b-5p decreased and increased mitochondrial biogenesis, respectively. In vivo, miR-125b-5p levels were downregulated in subcutaneous WAT and interscapular BAT upon β3-adrenergic receptor stimulation. Injections of an miR-125b-5p mimic and LNA inhibitor directly into WAT inhibited and increased β3-adrenoceptor-mediated induction of UCP1, respectively, and mitochondrial brite adipocyte marker expression and mitochondriogenesis. Conclusion: Collectively, our results demonstrate that miR-125b-5p plays an important role in the repression of brite adipocyte function by modulating oxygen consumption and mitochondrial gene expression. Author Video: Author Video Watch what authors say about their articles Keywords: miR-125b-5p, White adipocyte, Brite adipocyte, Mitochondriogenesis
Magen, Eli; Feldman, Arie; Cohen, Ziona; Alon, Dora Ben; Minz, Evegeny; Chernyavsky, Alexey; Linov, Lina; Mishal, Joseph; Schlezinger, Menacham; Sthoeger, Zev
2010-02-01
A possible link between chronic vascular inflammation and arterial hypertension is now an object of intensive studies. To compare Th1/Th2/Th17 cells-related cytokines, circulating endothelial progenitor cells (EPC), and endothelial function in subjects with resistant arterial hypertension (RAH) and controlled arterial hypertension (CAH). Blood pressure was measured by electronic sphygmomanometer. EPC were identified as CD34+/CD133+/kinase insert domain receptor (KDR)+ cells by flow cytometry. Th1/Th2/Th17 cells-related cytokines were identified using the Human Th1/Th2/Th17 Cytokines MultiAnalyte ELISArray Kit. Endothelium-dependent (FMD) vasodilatation of brachial artery was measured by Doppler ultrasound scanning. RAH group (n = 20) and CAH group (n = 20) and 17 healthy individuals (control group) were recruited. In the RAH group, lower blood levels of EPC number (42.4 +/- 16.7 cells/mL) and EPC% (0.19 +/- 0.08%) were observed than in the CAH group (93.1 +/- 88.7 cells/mL; P = 0.017; 0.27 +/- 0.17; P = 0.036) and control group (68.5 +/- 63.6 cells/mL; P < 0.001; 0.28 +/- 0.17%; P = 0.003), respectively. Plasma transforming growth factor-beta1 levels were significantly higher in the RAH group (1767 +/- 364 pg/mL) than in the CAH group (1292 +/- 349; P < 0.001) and in control group (1203 +/- 419 pg/mL; P < 0.001). In the RAH group, statistically significant negative correlation was observed between systolic blood pressure and EPC% (r = -0.72, P < 0.01). FMD in the RAH group was significantly lower (5.5 +/- 0.8%) than in the CAH group (9.2 +/- 1.4; P < 0.001) and in healthy controls (10.1 +/- 1.1%; P < 0.001). RAH is characterized by reduced circulating EPC, substantial endothelial dysfunction, and increased plasma transforming growth factor-beta1 levels.
Vidal, Marcos; Ramana, Chilakamarti V.; Dusso, Adriana S.
2002-01-01
The cytokine gamma interferon (IFN-γ) and the calcitropic steroid hormone 1,25-dihydroxyvitamin D (1,25D) are activators of macrophage immune function. In sarcoidosis, tuberculosis, and several granulomatoses, IFN-γ induces 1,25D synthesis by macrophages and inhibits 1,25D induction of 24-hydroxylase, a key enzyme in 1,25D inactivation, causing high levels of 1,25D in serum and hypercalcemia. This study delineates IFN-γ-1,25D cross talk in human monocytes-macrophages. Nuclear accumulation of ...
Fiscal year 1993 1/25-scale sludge mobilization testing
International Nuclear Information System (INIS)
Powell, M.R.; Golcar, G.R.; Hymas, C.R.; McKay, R.L.
1995-04-01
Sixteen 1/25-scale sludge mobilization experiments were conducted in fiscal year (FY) 1993. The results of this testing are presented in this document. The ability of a single, centrally-located, scale model mixer pump to resuspend a layer of simulated tank sludge was evaluated for five different simulant types. The resistance of these simulants to the mobilizing action of the mixer pump jets was not found to adequately correlate with simulant vane shear strength. The data indicate that the simulant cohesion, as quantified by tensile strength, may provide a good measure of mobilization resistance. A single test was done to evaluate whether indexed mixer pump rotation is significantly more effective than the planned continuous oscillation. No significant difference was found in the sludge mobilization caused by these two modes of operation. Two tests were conducted using a clay-based sludge simulant that contained approximately 5 wt% soluble solids. The distance to which the mixer pump jets were effective for this simulant was approximately 50% greater than on similar simulants that did not contain soluble solids. The implication is that sludge dissolution effects may significantly enhance the performance of mixer pumps in some tanks. The development of a means to correlate the magnitude of this effect with waste properties is a direction for future work. Two tests were performed with the goal of determining whether the 1/25-scale sludge mobilization data can be scaled linearly to 1/12-scale. The two 1/25-scale tests were conducted using the same simulant recipe as had been used in previous 1/12-scale tests. The difficulty of matching the 1/25-scale simulants, with those used previously is thought to have adversely affected the results. Further tests are needed to determine whether the data from sludge mobilization tests can be linearly scaled
14 CFR 125.407 - Maintenance log: Airplanes.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Maintenance log: Airplanes. 125.407 Section... OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6... Maintenance log: Airplanes. (a) Each person who takes corrective action or defers action concerning a reported...
Anti-tumor effects of Egr-IFN γ gene therapy combined with 125I-UdR radionuclide therapy
International Nuclear Information System (INIS)
Zhao Jingguo; Ni Yanjun; Song Xiangfu; Li Yanyi; Yang Wei; Sun Ting; Ma Qingjie; Gao Fengtong
2008-01-01
Objective: To explore the anti-tumor effects of Egr-IFNγ gene therapy combined with 125 I-UdR radionuclide therapy in mice bearing H22 hepatocarcinoma and its mechanism. Methods: The recombinant plasmid pcDNAEgr-IFNγ mixed with liposome was injected into tumor. 48 h later, 370 kBq 125 I-UdR was injected into tumor. The tumor growth rates at different times were observed. After 3 d gene-radionuclide therapy, the concentration of IFNγ in cytoplasm of H22 cells and cytotoxic activities of splenic CTL of the mice in different groups were examined. Results: The tumor growth rates of pcDNAEgr-IFNγ + 125 I-UdR group were obviously lower than those of control group, 125 I-UdR group and pcDNAEgr-1 + 125 I-UdR group 6-15 d after gene-radionuclide therapy. IFNγ protein was found in cytoplasm of H22 cells in pcDNAEgr-IFNγ + 125 I-UdR group after 3 d gene-radionuclide therapy. Cytotoxic activity of splenic CTL in pcDNAEgr-IFNγ + 125 I-UdR group was significantly higher than that in the other groups (P 125 I-UdR radionuclide therapy are better than those of 125 I-UdR therapy. (authors)
Vuong, H E; Pérez de Sevilla Müller, L; Hardi, C N; McMahon, D G; Brecha, N C
2015-10-29
Transgenic mouse lines are essential tools for understanding the connectivity, physiology and function of neuronal circuits, including those in the retina. This report compares transgene expression in the retina of a tyrosine hydroxylase (TH)-red fluorescent protein (RFP) mouse line with three catecholamine-related Cre recombinase mouse lines [TH-bacterial artificial chromosome (BAC)-, TH-, and dopamine transporter (DAT)-Cre] that were crossed with a ROSA26-tdTomato reporter line. Retinas were evaluated and immunostained with commonly used antibodies including those directed to TH, GABA and glycine to characterize the RFP or tdTomato fluorescent-labeled amacrine cells, and an antibody directed to RNA-binding protein with multiple splicing to identify ganglion cells. In TH-RFP retinas, types 1 and 2 dopamine (DA) amacrine cells were identified by their characteristic cellular morphology and type 1 DA cells by their expression of TH immunoreactivity. In the TH-BAC-, TH-, and DAT-tdTomato retinas, less than 1%, ∼ 6%, and 0%, respectively, of the fluorescent cells were the expected type 1 DA amacrine cells. Instead, in the TH-BAC-tdTomato retinas, fluorescently labeled AII amacrine cells were predominant, with some medium diameter ganglion cells. In TH-tdTomato retinas, fluorescence was in multiple neurochemical amacrine cell types, including four types of polyaxonal amacrine cells. In DAT-tdTomato retinas, fluorescence was in GABA immunoreactive amacrine cells, including two types of bistratified and two types of monostratified amacrine cells. Although each of the Cre lines was generated with the intent to specifically label DA cells, our findings show a cellular diversity in Cre expression in the adult retina and indicate the importance of careful characterization of transgene labeling patterns. These mouse lines with their distinctive cellular labeling patterns will be useful tools for future studies of retinal function and visual processing. Published by Elsevier
Oxidative stress modulates the cytokine response of differentiated Th17 and Th1 cells.
Abimannan, Thiruvaimozhi; Peroumal, Doureradjou; Parida, Jyoti R; Barik, Prakash K; Padhan, Prasanta; Devadas, Satish
2016-10-01
Reactive oxygen species (ROS) signaling is critical in T helper (Th) cell differentiation; however its role in differentiated Th cell functions is unclear. In this study, we investigated the role of oxidative stress on the effector functions of in vitro differentiated mouse Th17 and Th1 cells or CD4 + T cells from patients with Rheumatoid Arthritis using pro-oxidants plumbagin (PB) and hydrogen peroxide. We found that in mouse Th cells, non-toxic concentration of pro-oxidants inhibited reactivation induced expression of IL-17A in Th17 and IFN-γ in Th1 cells by reducing the expression of their respective TFs, RORγt and T-bet. Interestingly, in both the subsets, PB increased the expression of IL-4 by enhancing reactivation induced ERK1/2 phosphorylation. We further investigated the cytokine modulatory effect of PB on CD4 + T cells isolated from PBMCs of patients with Rheumatoid Arthritis, a well-known Th17 and or Th1 mediated disease. In human CD4 + T cells from Rheumatoid Arthritis patients, PB reduced the frequencies of IL-17A + (Th17), IFN - γ + (Th1) and IL-17A + /IFN - γ + (Th17/1) cells and also inhibited the production of pro-inflammatory cytokines TNF-α and IL-6. N-Acetyl Cysteine (NAC) an antioxidant completely reversed PB mediated cytokine modulatory effects in both mouse and human cells indicating a direct role for ROS. Together our data suggest that oxidative microenvironment can alter cytokine response of terminally differentiated cells and thus altering intracellular ROS could be a potential way to target Th17 and Th1 cells in autoimmune disorders. Copyright © 2016. Published by Elsevier Inc.
Energy Technology Data Exchange (ETDEWEB)
Somessari, Samir Luiz
2010-07-01
The aim of this work is to develop an automation system for iodine-125 radioactive seed production by (Nd:YAG) laser welding, which has been used successfully in Low Dose Rate (LDR) brachytherapy treatment. This small seed consists of a welded titanium capsule, with 0.8mm in diameter and 4.5mm in length, containing iodine-125 adsorbed onto a silver rod. The iodine-125 seeds are implanted into the human prostate to irradiate the tumor for cancer treatment. Nowadays, the Radiation Technology Center, at IPEN-CNEN/SP imports and distributes 36,000 iodine-125 seeds per year, for the clinics and hospitals in the country. However, the Brazilian market potential is now over 8,000 iodine-125 seeds per month. The local production of these iodine-125 radioactive sources becomes a priority for the Institute, in order to reduce the price and the problems of prostate cancer management. It will permit to spread their use to a largest number of patients in Brazil. On the other hand, the industrial automation plays an important role for iodine-125 seeds in order to increase the productivity, with high quality and assurance, avoiding human factors, implementing and operating with Good Manufacturing Practices (GMP). The technology consists of appliance electronic and electro-mechanical parts and components to control machines and processes. The automation system technology for iodine-125 seed production developed in this work was mainly assembled employing Programmable Logic Controller (PLC), stepper motors, drivers, (Nd:YAG) laser welding machine, photoelectric sensors and supervisory. (author)
Kol, A; Walker, N J; Nordstrom, M; Borjesson, D L
2016-01-01
Detrimental Th17 driven inflammatory and autoimmune disease such as Crohn's disease, graft versus host disease and multiple sclerosis remain a significant cause of morbidity and mortality worldwide. Multipotent stromal/stem cell (MSC) inhibit Th17 polarization and activation in vitro and in rodent models. As such, MSC based therapeutic approaches are being investigated as novel therapeutic approaches to treat Th17 driven diseases in humans. The significance of naturally occurring diseases in dogs is increasingly recognized as a realistic platform to conduct pre-clinical testing of novel therapeutics. Full characterization of Th17 cells in dogs has not been completed. We have developed and validated a flow-cytometric method to detect Th17 cells in canine blood. We further demonstrate that Th17 and other IL17 producing cells are present in tissues of dogs with naturally occurring chronic inflammatory diseases. Finally, we have determined the kinetics of a canine specific Th17 polarization in vitro and demonstrate that canine MSC inhibit Th17 polarization in vitro, in a PGE2 independent mechanism. Our findings provide fundamental research tools and suggest that naturally occurring diseases in dogs, such as inflammatory bowel disease, may be harnessed to translate novel MSC based therapeutic strategies that target the Th17 pathway.
Meigs’ Syndrome with Elevated Serum CA125: Case Report and Review of the Literature
Directory of Open Access Journals (Sweden)
Mongkol Benjapibal
2009-04-01
Full Text Available An elevated serum CA125 level in association with a pelvic mass, pleural effusion, and massive ascites usually signifies a dismal prognosis in a postmenopausal woman. However, surgery and histopathological examination are required for the correct diagnosis and treatment, since an elevated CA125 level can be falsely positive for ovarian malignancy. We present a case of Meigs’ syndrome due to right ovarian fibroma with elevated CA125 level in a postmenopausal woman.
The use of anisotropic data in 125I prostate implants
International Nuclear Information System (INIS)
Fox, R.A.; Haworth, A.; Mina, L.L.
1997-01-01
The report recently published by the American Association of Physicists in Medicine (AAPM) Task Group 43 (TG43) recommends the use of a two dimensional dose distribution function for the dosimetry associated with 125 I, 192 Ir and 103 Pd sources. For commercial planning systems that cannot be readily adapted to use a two dimensional function, a point source approximation is provided. The dose distribution around an array of 125 I seeds has been calculated using the two dimensional model and the point source approximation. Isodose distributions through selected planes and dose volume histograms of selected cubic volumes show that differences between the two models for this array are insignificant, particularly in view of the uncertainties associated with using the data which is provided by TG43 for the two dimensional anisotropy function and that it should be retained for planning prostrate treatments with 125 I seeds. It is recommended that each application must be examined separately to establish the extent to which an isotropic dose distribution is applicable
Energy Technology Data Exchange (ETDEWEB)
Rodriguez, L.; Rebollo, D. V.; Ruiz, J. M.
1986-07-01
In this paper a new method of synthesis of 19-iodo cholesterol labelled with ''125 I, from commercial cholesterol, is described. Its high chemical (96%) and radiochemical (99.9%) purities high yield and short time of preparation permit us to dispose or a more accessible labelled compound, which results appropriates for clinical investigations and in the diagnosis of disturbances of the suprarenal glands. (Author) 9 refs.
Closure certification report: TA-35 TSL-125 surface impoundment
International Nuclear Information System (INIS)
1991-01-01
This report summarizes the actions that were taken to clean close the TA-35 TSL-125 surface impoundment Building 125 is used for developing electron guns and related laser assemblies/equipment for a Laser Technology Research Program at the Laboratory. There is no permanent outfall from the surface impoundment; however, the impoundment accidentally overtopped on December 3, 1986, spilling an unknown volume of insulating oil and water into Ten Site Canyon. Sandbags were installed around the surface impoundment on June 25, 1988, to provide additional freeboard in the impoundment and reduce the risk of overtopping during a precipitation event. On July 1, 1988, the impoundment again overtopped releasing an unknown volume of insulating oil and water. Actions taken include removal of waste from the surface impoundment and its associated structures, decontamination of the floor trough and piping inside Building 125, grouting of the piping connecting the floor drain/trough system to the impoundment, decontamination, removal, and disposal of the impoundment liner and sandbags lining the top of the impoundment, and removal and disposal of contaminated soil underlying the impoundment area. Procedures followed to verify that clean closure objectives have been met are also documented in this report. Initial verification was performed through an extensive soil sampling and analysis program
42 CFR 412.125 - Effect of change of ownership on payments under the prospective payment systems.
2010-10-01
... prospective payment systems. 412.125 Section 412.125 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM PROSPECTIVE PAYMENT SYSTEMS FOR INPATIENT HOSPITAL SERVICES Payments to Hospitals Under the Prospective Payment Systems § 412.125 Effect of change of...
International Nuclear Information System (INIS)
Goldhagen, P.; Freeman, M.L.; Hall, E.J.
1981-01-01
During the past year, members of this laboratory have measured the Relative Biological Effectiveness (RBE) of photons from encapsulated 125 I sources (mean energy = 28.33 keV) using 661.6 keV 137 Cs gamma rays as a standard for comparison. These experiments were performed at clinically relevant dose rates and used reduction of the reproductive viability of mammalian cells as an endpoint. This section will discuss how dosimetry problems special to 125 I influence the design of the apparatus and will describe the ionization chamber to be used for measuring dose rates from both 125 I and 137 Cs photons
Upregulation of [125I] CGP42112 binding in the rat brainstem following nodose ganglionectomy
International Nuclear Information System (INIS)
Roulston, C.L.; Lawrence, A.J.; Jarrott, B.; Widdop, R.E.
1999-01-01
Full text: [ 125 I] CGP42112 is a specific ligand which has been used to demonstrate the presence of angiotensin AT 2 receptors in peripheral and brain tissue, although [ 125 I] CGP42112 also binds to a non-angiotensin II (Ang II) site. In the present study we have examined [ 125 I] CGP42112 binding in the brainstem following nodose ganglionectomy using autoradiography. Male spontaneously hypertensive rats (SHR) and Wistar Kyoto (WKY) rats underwent unilateral nodose ganglionectomy or sham operation (anaesthetised with methohexitone, 60mg/kg ip). Following a 14 day recovery period, animals were killed and slide mounted brainstem sections (14μm) were prepared and incubated in the presence of either [ 125 I] (Sar 1 Ile 8 )Ang II (0.5nM), [ 125 I] CGP42112 (0.3nM) or [ 3 H] PKI11195 (3nM, a marker for activated microglia). Following incubation, slides were apposed to film for 10 days. Specific binding was determined in adjacent sections by co-incubations with either the AT 1 receptor antagonist losartan, the AT 2 receptor antagonist PD 123319, Ang II or PKI11195 (all at 10μM). In the ganglionectomised groups, there were significant reductions in [ 125 I] (Sar 1 Ile 8 )Ang II binding on the denervated side of the nucleus of the solitary tract (NTS) by 30 ± 2 % (n=5, P 125 I] CGP42112 binding in the NTS revealed an AT 2 receptor component which was displaceable by PD 123319 and Ang II (∼60%), and a non-Ang II component (∼40%). Nodose ganglionectomy increased the density of [ 125 I] CGP42112 binding on the denervated side of the NTS by 55 ± 3 % (n=5, P 125 I] CGP42112 binding in the NTS of the ganglionectomised groups was comprised of a greater non-Ang II component than in the sham group, since only ∼30% was displaced by PD123319 and Ang II. [ 125 I] CGP42112 also revealed high binding density in the dorsal motor nucleus and the nucleus ambiguus on the denervated side in both SHR and WKY rats. This binding was absent in shams and was only ∼30-40% displaceable
International Nuclear Information System (INIS)
Du Xueming; Xu Jianhui; Lang Jianhua; Tian Xiurong; Dong Wei
2008-01-01
Objective: To explore the effectiveness and safety of the combined multi-disciplinary techniques with 125 I seeds to treat the malignant obstructive jaundice. Methods: 18 cases:of malignant obstructive jaundice were divided into 2 groups. A group with ERBD technique followed by CT-guided interstitial 125 I seeds implantation, B group with 125 I seeds implantation during the operation and gallbladder-intestine anastomosis later on. After 2 months amelioration (CR, PR,SD, PD) of the obstructive jaundice was observed with inspection of liver functions. Results: All cases were ameliorated with 44% patients in group A and 56% patients in group B, showing no significant statistical difference (P>0.05); and the liver functions were also relieved in both groups with no statistical significance (P>0.05). Conclusion: Multi-disciplinary techniques combined with 125 I seeds implantation is effective in the management of the malignant obstructive jaundice. No significant difference for relief and liver function were found between CT-guided and during operation interstitial 125 I seeds implantations, but it seems more quickly relief or recovery was achieved in the latter. (authors)
Synthesis of the 123I- and 125I-labeled cholinergic nerve marker (-)-5-iodobenzovesamicol
International Nuclear Information System (INIS)
Van Dort, M.E.; Jung, Y.-W.; Gildersleeve, D.L.; Hagen, C.A.; Kuhl, D.E.; Wieland, D.M.
1993-01-01
The highly toxic curaremimetic and cholinergic neuron marker (-)-5-iodobenzovesamicol (IBVM) has been labeled with iodine-125 and iodine-123. [ 125 I]IBVM, suitable for animal distribution and ex vivo autoradiographic studies, was synthesized by solid-state exchanger; isolated yields were 65-89% with specific activities in the range of 130-200 Ci/mmol. The synthesis of no-carrier-added (-)-5-[ 125 I]IBVM from the corresponding chiral (-)-5-(tri-n-butyltin) derivative using Na 125 I was evaluated using the oxidants H 2 O 2 , peracetic acid and chloramine-T. Both peracetic acid and chloramine-T gave good yields (70-95%). However, when Na 123 I was utilized, acceptable yields of [ 123 I]IBVM were obtained only with chloramine-T. Distribution analyses of [ 125 I]IBVM and [ 123 I]IBVM in mice 4 h following intravenous administration show essentially equivalent concentrations of the two tracers in the four brain regions sampled. The exceptionally high specific activity of [ 123 I]IBVM has made possible the evaluation of this radiotracer in humans. (Author)
How to Use CA-125 More Effectively in the Diagnosis of Deep Endometriosis
Directory of Open Access Journals (Sweden)
Marco Aurelio Pinho Oliveira
2017-01-01
Full Text Available Deep infiltrative endometriosis (DIE is a severe form of the disease. The median time interval from the onset of symptoms to diagnosis of endometriosis is around 8 years. In this prospective study patients were divided into two groups: cases (34 DIE patients and control (20 tubal ligation patients. The main objective of this study was to evaluate the performance of CA-125 measurement in the menstrual and midcycle phases of the cycle, as well as the difference in its levels between the two phases, for the early diagnosis of DIE. Area Under the Curve (AUC of CA-125 in menstrual phase and of the difference between menstrual and midcycle phases had the best performance (both with AUC = 0.96, followed by CA-125 in the midcycle (AUC = 0.89. The ratio between menstrual and midcycle phases had the worst performance. CA-125 may be useful for the diagnosis of deep endometriosis, especially when both are collected during menstruation and in midcycle. These may help to decrease the long interval until the definitive diagnosis of DIE. Multicentric studies with larger samples should be performed to better evaluate the cost-effectiveness of measuring CA-125 in two different phases of the menstrual cycle.
14th German nuclear law symposium
International Nuclear Information System (INIS)
Burgi, Martin
2013-01-01
Nuclear law is still relevant and topical. The nuclear power phase-out in response to the nuclear accident of Fukushima and the turnaround in German energy policy raise new legal issues. In several lectures of practioners and scientists the 14th German Nuclear Law Symposium examined questions regarding the retrofitting of nuclear power plants, their decommissioning and disposal, the current developements in the European nuclear and radiation protection law and the search for a final nuclear waste repository. The nuclear law provides examples for central challenges of administrative law, such as the independence of authorities and the protection of third parties. The discussions between the almost 150 participants are documented in several reports.
45 CFR 2544.125 - Who has the authority to solicit and accept or reject a donation?
2010-10-01
... reject a donation? 2544.125 Section 2544.125 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE SOLICITATION AND ACCEPTANCE OF DONATIONS § 2544.125 Who has the authority to solicit and accept or reject a donation? The Chief Executive Officer (CEO...
DEFF Research Database (Denmark)
Tuxen, Malgorzata K.; Sölétormos, G; Petersen, P H
2001-01-01
The main objective with cancer antigen 125 (CA 125), carcinoembryonic antigen (CEA), and tissue polypeptide antigen (TPA) monitoring of ovarian cancer patients is to detect an early change of disease activity with high reliability. We hypothesized that a monitoring scheme for ovarian cancer patie...
International Nuclear Information System (INIS)
Somessari, Samir L.; Feher, Anselmo; Sprenger, Francisco E.; Rostellato, Maria E.C.M.; Moura, Joao A.; Costa, Osvaldo L.; Calvo, Wilson A.P.
2011-01-01
The objective of this work is to develop an automation system for Quality Control in the production of Iodine-125 sealed sources, after undergoing the process of laser beam welding. These sources, also known as Iodine-125 seeds are used, successfully, in the treatment of cancer by brachytherapy, with low-dose rates. Each small seed is composed of a welded titanium capsule with 0.8 mm diameter and 4.5 mm in length, containing Iodine-125 adsorbed on an internal silver wire. The seeds are implanted in the human prostate to irradiate the tumor and treat the cancerous cells. The technology to automate the quality control system in the manufacture of Iodine-125 seeds consists in developing and associate mechanical parts, electronic components and pneumatic circuits to control machines and processes. The automation technology for Iodine-125 seed production developed in this work employs programmable logic controller, step motors, drivers of control, electrical-electronic interfaces, photoelectric sensors, interfaces of communication and software development. Industrial automation plays an important role in the production of Iodine-125 seeds, with higher productivity and high standard of quality, facilitating the implementation and operation of processes with good manufacturing practices. Nowadays, the Radiation Technology Center at IPEN-CNEN/SP imports and distributes 36,000 Iodine-125 seeds per year for clinics and hospitals in the whole country. However, the Brazilian potential market is of 8,000 Iodine-125 seeds per month. Therefore, the local production of these radioactive seeds has become a priority for the Institute, aiming to reduce the price and increase the supply to the population in Brazil. (author)
Relative biological effectiveness of 125I seeds for low-dose-rate irradiation of PANC-1
International Nuclear Information System (INIS)
Wang Jidong; Wang Junjie; Zhuang Hongqing; Liao Anyan; Zhao Yong
2008-01-01
Objective: To investigate the relative biological effectiveness(RBE) of National Model 6711 125 I seeds and the response patterns of PANC-1 exposed to 125 I seeds irradiation. Methods: PANC-1 cells in exponential growth were irradiated at initial dose rate of 2.59 cGy/h in vitro and exposed to 1, 2, 4, 6, 8 and 10 Gy. Meanwhile, the other part of cells were exposed to the same doses by 60 Co at dose rate of 2.21 Gy/min. After irradiation, the cells were stained by trypan blue to measure the cellular mortality rate and to compare the changes along with plating times of 12, 24, 48 and 72 h after 4 Gy. The colonies were counted to obtain the plating efficiencies by colony-forming assay and the cell surviving faction was calculated to plot cell survival curves, and RBE of 125 I seeds relative to 60 Co was determined. Results: The cell death rate for continuous low- dose-rate (LDR) irradiation by 125 I seeds was greater than 60 Co at the same doses above or equal to 4 Gy. After 4 Gy irradiation, the cellular mortality rates were increased with times. The difference was significant between 125 I seeds and 60 Co. The survival fractions of 125 I were lower than those of 60 Co, and the RBE of 125 I relative to 60 Co was determined to be 1.45. Conclusion: The cell-killing effects for continuous low-dose-rate (LDR) irradiation by 125 I seeds are greater than acute high-dose-rate of 60 Co. (authors)
Energy Technology Data Exchange (ETDEWEB)
Somessari, Samir L.; Feher, Anselmo; Sprenger, Francisco E.; Rostellato, Maria E.C.M.; Moura, Joao A.; Costa, Osvaldo L.; Calvo, Wilson A.P., E-mail: somessar@ipen.b, E-mail: afeher@ipen.b, E-mail: sprenger@ipen.b, E-mail: elisaros@ipen.b, E-mail: olcosta@ipen.b, E-mail: wapcalvo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-07-01
The objective of this work is to develop an automation system for Quality Control in the production of Iodine-125 sealed sources, after undergoing the process of laser beam welding. These sources, also known as Iodine-125 seeds are used, successfully, in the treatment of cancer by brachytherapy, with low-dose rates. Each small seed is composed of a welded titanium capsule with 0.8 mm diameter and 4.5 mm in length, containing Iodine-125 adsorbed on an internal silver wire. The seeds are implanted in the human prostate to irradiate the tumor and treat the cancerous cells. The technology to automate the quality control system in the manufacture of Iodine-125 seeds consists in developing and associate mechanical parts, electronic components and pneumatic circuits to control machines and processes. The automation technology for Iodine-125 seed production developed in this work employs programmable logic controller, step motors, drivers of control, electrical-electronic interfaces, photoelectric sensors, interfaces of communication and software development. Industrial automation plays an important role in the production of Iodine-125 seeds, with higher productivity and high standard of quality, facilitating the implementation and operation of processes with good manufacturing practices. Nowadays, the Radiation Technology Center at IPEN-CNEN/SP imports and distributes 36,000 Iodine-125 seeds per year for clinics and hospitals in the whole country. However, the Brazilian potential market is of 8,000 Iodine-125 seeds per month. Therefore, the local production of these radioactive seeds has become a priority for the Institute, aiming to reduce the price and increase the supply to the population in Brazil. (author)
Ascites promotes cell migration through the repression of miR-125b in ovarian cancer.
Yang, Lan; Zhang, Xiaoli; Ma, Yiming; Zhao, Xinhua; Li, Bin; Wang, Hongying
2017-08-01
Interactions between ovarian cancer cells and the surrounding tumor microenvironment are not well characterized. Here, we investigated the molecular mechanisms by which malignant ascites promote the metastasis of ovarian cancer. It was found that ovarian cancer ascites promoted ovarian cancer cell migration which was attenuated by either heat inactivation or antibody blockade of TGF-β. High level (at ng/ml level) of TGF-β was detected in the ascites. In addition, ascites repressed the expression of miRNA-125b in a TGF-β-dependent manner. Mimic of miR-125b blocked ascites-induced cell migration. Furthermore, Gab2 (a target gene of miR-125b) was elevated by ascites in a TGF-β-dependent manner. And forced expression of Gab2 reversed the inhibition of migration induced by miR-125b mimic. Most importantly, the expression of miR-125b and Gab2 mRNA was negatively correlated in ovarian cancer specimens. Taken together, our finding suggested that TGF-β in ascites promoted cancer cell migration through repression of miR-125b in ovarian cancer. This might provide a novel therapeutic target for ovarian cancer in the future.
Synthesis and 125I labelling of a precursor for imaging nicotinic acetylcholine receptors
International Nuclear Information System (INIS)
Liu Yuxia; Liu Ning; Yang Yuanyou; Zan Liangbiao; Liao Jiali; Jin Jiannan; Sichuan Univ., Chengdu
2006-01-01
Nicotinic Acetylcholine Receptors (nAChRs) are involved in various pharmacological effects or diseases, such as Alzheimer's Disease, Parkinson's Disease and tobacco addiction. It will be very appealing to image nAChRs in vivo, diagnose and treat the above diseases, and probe the mechanism of nAChRs in tobacco addiction if the suitable radioactive labeled compound can be synthesized. In this study, (s)-5-(tri-butylstannyl)-3{[1-(tert-butoxycarbonyl)-2-azetidinyl]methoxy} pyridine, a precursor for imaging nAChRs, was synthesized with commercial 2-furfurylamine and (s)-2-azetidinecarboxylic acid as starting materials, and was further labeled with 125/123 I. The whole procedure for radiosynthesis needs 50-55 min and more than 30% of the 125 I are found in the purified 5-[ 125 I]-A-85380. Even staying for 3 days at room temperature in vitro, the purified 5-[ 125 I]-I-85380 can maintain its stability, with a radiochemical purity of more than 95%. (authors)
In vivo study about specific captation of 125 I-insulin by rat brain structures
International Nuclear Information System (INIS)
Sanvitto, G.L.
1986-01-01
The specific captation of 125 I-insulin was evaluated by brain structures, as olfactory bulbous, hypothalamus and cerebellum in rats, from in vivo experiences that including two different aspects: captation measure of 125 I-insulin after the intravenous injection of the labelled hormone, in fed rats and in rats with 48 h of fast or convulsion, procedure by the pentylene tetrazole; captation measure of 125 I-insulin after intra-cerebral-ventricular injection of the labelled hormone in fed rats. (C.G.C.)
24 CFR 266.125 - Scope and nature of sanctions.
2010-04-01
... AUTHORITIES HOUSING FINANCE AGENCY RISK-SHARING PROGRAM FOR INSURED AFFORDABLE MULTIFAMILY PROJECT LOANS Housing Finance Agency Requirements § 266.125 Scope and nature of sanctions. (a) Actions by Designated...
Modulation of chicken macrophage effector function by Th1/Th2 cytokines
Regulation of macrophage activity by TH1/2 cytokines is important to maintain the balance of immunity to provide adequate protective immunity while avoiding excessive inflammation. IFN-gamma and IL-4 are the hallmark TH1 and TH2 cytokines, respectively. In avian species, information concerning reg...
I-125 input into antibodies molecules specific to australian antigen
International Nuclear Information System (INIS)
Abdukayumov, A. M.; Chistyakov, P.G.; Garajshina, G. R.
1999-01-01
There are experimental data on I-125 input into antibodies molecules specific to superficial antigen of hepatitis B virus (australian antigen). Three ways of input are submitted: with the help of T chloramine usage, Bolton-Hunter Reagent and with the help of iodogen. There are also comparative characteristics of iodized products obtained: molar radioactivity, radiochemical frequency, immuno - reactivity. The report also discusses advantages and disadvantages of the used methods for inputting I-125 into antibodies to australian antigen in order to study the possibility of creating radio immunological test system for detecting superficial antigen of B hepatitis
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Carriage of narcotic drugs, marihuana, and depressant or stimulant drugs or substances. 125.39 Section 125.39 Aeronautics and Space FEDERAL AVIATION... AIRCRAFT Certification Rules and Miscellaneous Requirements § 125.39 Carriage of narcotic drugs, marihuana...
Down-regulation of Notch signaling pathway reverses the Th1/Th2 imbalance in tuberculosis patients.
Li, Qifeng; Zhang, Hui; Yu, Liang; Wu, Chao; Luo, Xinhui; Sun, He; Ding, Jianbing
2018-01-01
Th1/Th2 imbalance to Th2 is of significance in the peripheral immune responses in Tuberculosis (TB) development. However, the mechanisms for Th1/Th2 imbalance are still not well determined. Notch signaling pathway is involved in the peripheral T cell activation and effector cell differentiation. However, whether it affects Th1/Th2 imbalance in TB patients is still not known. Here, we used γ-secretase inhibitor (DAPT) to treat the peripheral blood mononuclear cells (PBMCs) from healthy people or individuals with latent or active TB infection in vitro, respectively. Then, the Th1/Th2 ratios were determined by flow cytometry, and cytokines of IFN-γ, IL-4, IL-10 in the culture supernatant were measured by CBA method. The Notch signal pathway associated proteins Hes1, GATA3 and T-bet were quantitated by real-time PCR or immunoblotting. Our results showed that DAPT effectively inhibited the protein level of Hes1. In TB patients, the Th2 ratio increased in the PBMCs, alone with the high expression of GATA3 and IL-4, resulting in the high ratios of Th2/Th1 and GATA3/T-bet in TB patients. However, Th2 cells ratio decreased after blocking the Notch signaling pathway by DAPT and the Th2/Th1 ratio in TB patients were DAPT dose-dependent, accompanied by the decrease of IL-4 and GATA3. But, its influence on Th1 ratio and Th1 related T-bet and IFN-γ levels were not significant. In conclusion, our results suggest that blocking Notch signaling by DAPT could inhibit Th2 responses and restore Th1/Th2 imbalance in TB patients. Copyright © 2017. Published by Elsevier B.V.
Li, Huajun; Li, Shuxian; Zheng, Jianfeng; Cai, Chunyan; Ye, Bin; Yang, Jun; Chen, Zhimin
2015-03-01
Enterovirus 71 (EV71) infection can cause severe neurological complications including meningoencephalitis (ME) in some patients with hand, foot and mouth disease (HFMD). However, to date no studies have reported changes in cytokine concentrations and their correlations with clinical variables in patients with ME following EV71 infection. In this study, responses of Th1/Th2 cytokine, including IL-2, IL-4, IL-6, IL-10, TNF-α and IFN-γ, in cerebrospinal fluid (CSF) from patients with EV71-related HFMD with ME and patients with febrile convulsions (FC) were analyzed using cytometric bead array technology. It was found that CSF IL-6 and IFN-γ concentrations were significantly higher in patients with EV71-related ME than in those with FC. Additionally, both CSF IL-6 and IFN-γ concentrations were correlated with CSF cytology, fever duration and duration of hospital stay. More interestingly, a positive correlation between CSF IL-6 and IFN-γ concentrations was observed. Finally, receiver operating characteristic analysis revealed that when a cutoff value of 9.40 pg/mL was set for IL-6, the sensitivity and specificity were 84.5% and 85.5%, respectively, for discriminating EV71-related ME from FC. In conclusion, IL-6 and IFN-γ may be associated with EV71-induced neuropathology. © 2015 The Societies and Wiley Publishing Asia Pty Ltd.
International Nuclear Information System (INIS)
Quirion, R.; Chabot, J.-G.; Dore, S.; Seto, D.; Kar, S.
1997-01-01
Administration of kainic acid evokes acute seizure in hippocampal pathways that results in a complex sequence of functional and structural alterations resembling human temporal lobe epilepsy. The structural alterations induced by kainic acid include selective loss of neurones in CA1-CA3 subfields and the hilar region of the dentate gyrus followed by sprouting and permanent reorganization of the synaptic connections of the mossy fibre pathways. Although the neuronal degeneration and process of reactive synaptogenesis have been extensively studied, at present little is known about means to prevent pathological conditions leading to kainate-induced cell death. In the present study, to address the role of insulin-like growth factors I and II, and insulin in neuronal survival as well as synaptic reorganization following kainate-induced seizure, the time course alterations of the corresponding receptors were evaluated. Additionally, using histological preparations, the temporal profile of neuronal degeneration and hypertrophy of resident astroglial cells were also studied. [ 125 I]Insulin-like growth factor I binding was found to be decreased transiently in almost all regions of the hippocampal formation at 12 h following treatment with kainic acid. The dentate hilar region however, exhibited protracted decreases in [ 125 I]insulin-like growth factor I receptor sites throughout (i.e. 30 days) the study. [ 125 I]Insulin-like growth factor II receptor binding sites in the hippocampal formation were found to be differentially altered following systemic administration of kainic acid. A significant decrease in [ 125 I]insulin-like growth factor II receptor sites was observed in CA1 subfield and the pyramidal cell layer of the Ammon's horn at all time points studied whereas the hilar region and the stratum radiatum did not exhibit alteration at any time. A kainate-induced decrease in [ 125 I]insulin receptor binding was noted at all time points in the molecular layer of the
The fundamental investigation of Triosorb M-125 test
International Nuclear Information System (INIS)
Kato, Sotoe; Takeda, Isao; Tsuzaki, Yoshimasa
1975-01-01
This is a report on the fundamental investigation of Triosorb M-125 test, which is a simple method developed by Abbott Laboratories for measuring the triiodothyronine (T 3 ) in the blood. In this method the radioactive 125 I labeled T 3 is used and the values are corrected by the uptake ratio of the control serum. These are the points of difference from Triosorb test. The results of our fundamental investigation were as follows. 1) The T 3 M values were more or less affected by the volume of the added serum. 2) The accuracy of the incubation temperature is not necessary. 3) The stable values were obtained for 20 to 30 minutes of incubation. 4) The exact volume of the serum being added, a extremely good reproducibility could be obtained. 5) The values determined by this method and Triosorb test showed a very good correlation (γ=0.94). (auth.)
Comparative dosimetry of prostate brachytherapy with I-125 and Pd-103 seeds via SISCODES/MCNP
Energy Technology Data Exchange (ETDEWEB)
Trindade, Bruno Machado; Falcao, Patricia Lima, E-mail: bmtrindade@yahoo.com [Nucleo de Radiacoes Ionizantes - Universidade Federal de Minas Gerais (NRI/UFMG), Belo Horizonte, MG (Brazil); Christovao, Marilia Tavares [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Trindade, Daniela de Fatima Maia [Centro Universitario Una, Belo Horizonte, MG (Brazil); Campos, Tarcisio Passos Ribeiro de [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)
2012-09-15
Objective: The present paper is aimed at presenting a comparative dosimetric study of prostate brachytherapy with I-125 and Pd-103 seeds. Materials and Methods: A protocol for both implants with 148 seeds was simulated on a heterogeneous three-dimensional pelvic phantom by means of the SISCODES/MCNP5 codes. Dose-volume histograms on prostate, rectum and bladder, dose indexes D10, D30, D90, D0.5cc, D2cc and D7cc, and representations of the spatial dose distribution were evaluated. Results: For a D90 index equivalent to the prescription dose, the initial activity of each I-125 seed was calculated as 0.42 mCi and of Pd-103 as 0.94 mCi. The maximum dose on the urethra was 90% and 108% of the prescription dose for I-125 and Pd-103, respectively. The D2cc for I-125 was 30 Gy on the rectum and 127 Gy on the bladder; for Pd-103 was 29 Gy on the rectum and 189 Gy on the bladder. The D10 on the pubic bone was 144 Gy for I-125 and 66 Gy for Pd-103. Conclusion: The results indicate that Pd-103 and I-125 implants could deposit the prescribed dose on the target volume. Among the findings of the present study, there is an excessive radiation exposure of the pelvic bones, particularly with the I-125 protocol. (author)
41 CFR 102-192.125 - What is the appropriate managerial level for an agency mail manager?
2010-07-01
... managerial level for an agency mail manager? 102-192.125 Section 102-192.125 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.125 What is the appropriate managerial level for an agency mail manager? The agency mail manager should be at a managerial...
Energy Technology Data Exchange (ETDEWEB)
John, Christy S. E-mail: radcsj@gwumc.edu; Bowen, Wayne D.; Fisher, Susan J.; Lim, Benjamin B.; Geyer, Brian C.; Vilner, Bertold J.; Wahl, Richard L
1999-05-01
The goal of this study was to investigate the potential use of a radioiodinated benzamide, N-[2-(1'-piperidinyl)ethyl]-3-iodo[{sup 125}I]-4-methoxybenzamide (P[{sup 125}I]MBA), a sigma receptor binding radioligand for imaging breast cancer. The chemical and radiochemical syntheses of PIMBA are described. The pharmacological evaluation of PIMBA was carried out for sigma-1 and sigma-2 receptor sites. The in vivo pharmacokinetics of the radioiodinated benzamide were determined in rats and comparison of P[{sup 125}I]MBA with Tc-99m sestamibi were made in a rat mammary tumor model. Sigma-1 affinity (K{sub i}) for PIMBA in guinea pig brain membranes using [{sup 3}H](+)pentazocine was found to be 11.82{+-}0.68 nM, whereas sigma-2 affinity in rat liver using [{sup 3}H]DTG (1,3-o-di-tolylguanidine) was 206{+-}11 nM. Sites in guinea pig brain membranes labeled by P[{sup 125}I]MBA showed high affinity for haloperidol, (+)-pentazocine, BD1008, and PIMBA (K{sub i}=4.87{+-}1.49,8.81{+-}1.97,0.057{+-}0.005,46.9{+-}1.8 nM), respectively). Competition binding studies were carried out in human ductal breast carcinoma cells (T47D). A dose-dependent inhibition of specific binding was observed with several sigma ligands. K{sub i} values for the inhibition of P[{sup 125}I]MBA binding in T47D cells for haloperidol, N-[2-(1'-piperidinyl)]ethyl]4-iodobenzamide (IPAB), N-(N-benzylpiperidin-4-yl)-4-iodobenzamide (4-IBP), and PIMBA were found to be 1.30{+-}0.07, 13{+-}1.5, 5.19{+-}2.3, 1.06{+-}0.5 nM, respectively. The in vitro binding data in guinea pig brain membranes and breast cancer cells confirmed binding to sigma sites. The saturation binding of P[{sup 125}I]MBA in T47D cells as studied by Scatchard analysis showed saturable binding, with a K{sub d}=94{+-}7 nM and a B{sub max}=2035{+-}305 fmol/mg of proteins. Biodistribution studies in Sprague-Dawley rats showed a rapid clearance of P[{sup 125}I]MBA from the normal organs. The potential of PIMBA in imaging breast cancer was
3-(/sup 125/I)iodo-4-hydroxyphenobarbitone for use in radioimmunoassay
Energy Technology Data Exchange (ETDEWEB)
Mason, P.A.; Law, B. (Home Office Central Research Establishment, Aldermaston (UK))
1982-03-01
A method is described for the preparation of a barbiturate derivative, 3-iodo-4-hydroxyphenobarbitone, labelled with (/sup 125/I)iodine. The structure of the compound was confirmed by synthesis and purification of the (/sup 127/I)iodine derivative followed by mass spectral studies. The (/sup 125/I)iodine labelled barbiturate has proved to be chemically stable and has been shown to bind to a barbiturate antiserum. It should, therefore, prove to be very useful for the development of a radioimmunoassay for barbiturates.
Cytokines in systemic lupus erythematosus: far beyond Th1/Th2 dualism lupus: cytokine profiles.
Guimarães, Poliana Macedo; Scavuzzi, Bruna Miglioranza; Stadtlober, Nicole Perugini; Franchi Santos, Lorena Flor da Rosa; Lozovoy, Marcell Alysson Batisti; Iriyoda, Tatiana Mayumi Veiga; Costa, Neide Tomimura; Reiche, Edna Maria Vissoci; Maes, Michael; Dichi, Isaias; Simão, Andréa Name Colado
2017-10-01
The aims of this study were to delineate cytokine profiles of systemic lupus erythematosus (SLE), construct prediction models for diagnosis and disease activity using those profiles, and to examine the associations between TNFB Ncol polymorphism, body mass index (BMI) and vitamin D levels with cytokine levels. Two hundred SLE patients and 196 healthy controls participated in this case-control study. Plasma cytokines levels of tumor necrosis factor (TNF)-α, interferon (IFN)-γ, interleukin (IL)-1β, IL- 4, IL-6, IL-10, IL-12 and IL-17 were measured and cytokines profiles were computed. IL-6, IL-12, IL-17, IFN-γ and IL-10 levels were significantly higher in SLE, while IL-4 was lower in SLE. The Th1/Th2 and Th1+Th17/Th2 profiles were significantly higher in SLE than in healthy controls, whereas there were no significant differences in the proinflammatory cytokine profile (TNFα+IL-6+IL-1β). In total, 90.4% of all subjects were correctly classified using Th1+Th17 profile and IL-10 (positively associated) and IL-4 (negatively associated) as predictor variables (sensitivity=66.7% and specificity=96.9%). In all, 20.9% of the variance in the SLE Disease Activity Index was predicted by the Th1+Th17/Th2 ratio, IL-10 and BMI (all positively) and proinflammatory profile (inversely associated). B1/B1 genotype is accompanied by increased IL-17 and Th17/Th2 ratio, while B1/B2 genotype is accompanied by higher IL-4 and IFNγ values. 25-OH vitamin D was inversely associated with IFN-γ levels. SLE is accompanied by Th1, Th17 and Treg profile and lowered IL-4 production. Lowered vitamin D levels and B1/B1 genotype, but not BMI, contribute to changes in cytokines profiles. Future treatments should target Th1, Th2 and Th17 profiles rather than inflammatory cytokines.
Half-life determination of 125I
International Nuclear Information System (INIS)
De Felice, P.; Ientile, P.; Zicari, C.
1990-01-01
The half-life of 125 I was determined by measuring the activity of an initial 3 kBq source at several times. Over a period of two months, 96 absolute measurements were performed, using the sum-peak method to give a half-life of (59.38±0.03) d. A discussion is presented on the effect of correcting for accidental coincidences on the half-life measurements by comparing the results with and without this correction. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Yuan, Jian; Xiao, Gelei [Department of Neurosurgery, Xiangya Hospital, Central South University, Changsha, Hunan 410008 (China); The Institute of Skull Base Surgery & Neuro-oncology at Hunan, Changsha, Hunan 410008 (China); Peng, Gang [Department of Neurosurgery, Xiangya Hospital, Central South University, Changsha, Hunan 410008 (China); Liu, Dingyang [Department of Neurosurgery, Xiangya Hospital, Central South University, Changsha, Hunan 410008 (China); The Institute of Skull Base Surgery & Neuro-oncology at Hunan, Changsha, Hunan 410008 (China); Wang, Zeyou [Cancer Research Institute, Central South University, Changsha, Hunan 410008 (China); Liao, Yiwei; Liu, Qing [Department of Neurosurgery, Xiangya Hospital, Central South University, Changsha, Hunan 410008 (China); The Institute of Skull Base Surgery & Neuro-oncology at Hunan, Changsha, Hunan 410008 (China); Wu, Minghua [The Institute of Skull Base Surgery & Neuro-oncology at Hunan, Changsha, Hunan 410008 (China); Cancer Research Institute, Central South University, Changsha, Hunan 410008 (China); Yuan, Xianrui, E-mail: xry69@163.com [Department of Neurosurgery, Xiangya Hospital, Central South University, Changsha, Hunan 410008 (China); The Institute of Skull Base Surgery & Neuro-oncology at Hunan, Changsha, Hunan 410008 (China)
2015-02-06
Highlights: • Expression of miR-125a-5p is inversely correlated with that of TAZ in glioma cells. • MiR-125a-5p represses TAZ expression in glioma cells. • MiR-125a-5p directly targets the 3′ UTR of TAZ mRNA and promotes its degradation. • MiR-125a-5p represses CTGF and survivin via TAZ, and inhibits glioma cell growth. • MiR-125a-5p inhibits the stem cell features of HFU-251 MG cells. - Abstract: Glioblastoma (GBM) is the most lethal brain tumor due to the resistance to conventional therapies, such as radiotherapy and chemotherapy. TAZ, an important mediator of the Hippo pathway, was found to be up-regulated in diverse cancers, including in GBM, and plays important roles in tumor initiation and progression. However, little is known about the regulation of TAZ expression in tumors. In this study, we found that miR-125a-5p is an important regulator of TAZ in glioma cells by directly targeting the TAZ 3′ UTR. MiR-125a-5p levels are inversely correlated with that of TAZ in normal astrocytes and a panel of glioma cell lines. MiR-125a-5p represses the expression of TAZ target genes, including CTGF and survivin, and inhibits cell proliferation and induces the differentiation of GBM cells; whereas over-expression of TAZ rescues the effects of miR-125a-5p. This study revealed a mechanism for TAZ deregulation in glioma cells, and also demonstrated a tumor suppressor role of miR-125a-5p in glioblastoma cells.
International Nuclear Information System (INIS)
Yuan, Jian; Xiao, Gelei; Peng, Gang; Liu, Dingyang; Wang, Zeyou; Liao, Yiwei; Liu, Qing; Wu, Minghua; Yuan, Xianrui
2015-01-01
Highlights: • Expression of miR-125a-5p is inversely correlated with that of TAZ in glioma cells. • MiR-125a-5p represses TAZ expression in glioma cells. • MiR-125a-5p directly targets the 3′ UTR of TAZ mRNA and promotes its degradation. • MiR-125a-5p represses CTGF and survivin via TAZ, and inhibits glioma cell growth. • MiR-125a-5p inhibits the stem cell features of HFU-251 MG cells. - Abstract: Glioblastoma (GBM) is the most lethal brain tumor due to the resistance to conventional therapies, such as radiotherapy and chemotherapy. TAZ, an important mediator of the Hippo pathway, was found to be up-regulated in diverse cancers, including in GBM, and plays important roles in tumor initiation and progression. However, little is known about the regulation of TAZ expression in tumors. In this study, we found that miR-125a-5p is an important regulator of TAZ in glioma cells by directly targeting the TAZ 3′ UTR. MiR-125a-5p levels are inversely correlated with that of TAZ in normal astrocytes and a panel of glioma cell lines. MiR-125a-5p represses the expression of TAZ target genes, including CTGF and survivin, and inhibits cell proliferation and induces the differentiation of GBM cells; whereas over-expression of TAZ rescues the effects of miR-125a-5p. This study revealed a mechanism for TAZ deregulation in glioma cells, and also demonstrated a tumor suppressor role of miR-125a-5p in glioblastoma cells
Distribution of Th-230 and Th-228 in food (I)
Energy Technology Data Exchange (ETDEWEB)
Kang, Hee Dong; Kim, Wan; Lim, X. J.; Choi, M. S.; Kim, C. J.; Zheng, Y. Z. [Kyungpook National Univ., Daegu (Korea, Republic of); Kim, Do Sung [Daegu Univ., Daegu (Korea, Republic of)
2003-03-15
Natural radioisotopes contained in foods can enter the human body by ingestion and contribute to internal doses to the population. It is necessary to measure the concentration of natural radioisotopes especially thorium in Korean foods and estimate the internal doses. In this study, we have established the thorium measuring process based on the thorium extraction chemical process and alpha spectroscopic method. The concentration of Th-228, Th-230 and Th-232 in Korean milk, meats(pork, beef and chicken) and grain (wheat, bean and rice) are measured and internal doses are estimated.
Downregulation of miR-125b in metastatic cutaneous malignant melanoma.
Glud, Martin; Rossing, Maria; Hother, Christoffer; Holst, Line; Hastrup, Nina; Nielsen, Finn C; Gniadecki, Robert; Drzewiecki, Krzysztof T
2010-12-01
This study aimed to identify microRNA species involved in the earliest metastatic event in cutaneous malignant melanoma (MM). Samples from 28 patients with MM [stage T2 (tumor), M0 (distant metastasis)] were grouped by the presence of micrometastasis in the sentinel lymph nodes (N0/N1). Melanoma cells were harvested from primary, cutaneous MM tumors by laser-capture microdissection, and microRNA expression profiles were obtained by the microarray technique. Results were validated by quantitative reverse transcription PCR. We found that miR-125b was downregulated in the primary cutaneous melanomas that produced early metastases (T2, N1, M0) compared with the sentinel lymph node-negative (T2, N0, M0) melanomas. MiR-125b has earlier been found to be downregulated in other tumor types and in atypic naevi compared with the common acquired naevi. In conclusion, miR-125b may be involved in an early progression of cutaneous MM.
Effect of xanthohumol on Th1/Th2 balance in a breast cancer mouse model.
Zhang, Wenchao; Pan, Yanlong; Gou, Panhong; Zhou, Cheng; Ma, Lianqing; Liu, Qiming; Du, Yuping; Yang, Jinbo; Wang, Qin
2018-01-01
Xanthohumol (XN), a prenylflavonoid found in the hop plant, Humulus lupulus, exhibits a variety of biological activities. Numerous studies have reported that XN inhibits the growth of many types of cancer cells, but the effects of XN on tumor immunity have not yet been studied. We explored the effect of XN on Th1/Th2 balance and the underlying mechanism based on a BALB/c-4T1 breast cancer mouse model. The results showed that XN significantly slowed down tumor growth and inhibited expression of antitumor proliferation protein Ki-67 as well as breast cancer-specific marker cancer antigen 15-3 (CA15-3). Flow cytometric analysis revealed that XN enhanced the secretion of perforin, granzyme B and increased the ratio of CD8+/CD25+. ELISA analysis of cytokine results demonstrated that XN obviously upregulated Th1 cytokines, while downregulated Th2 cytokines. Th1/Th2 ratio analysis by flow cytometry illustrated that XN regulated the balance drift to Th1 polarization. Western blotting and immunohistochemistry (IHC) results manifested that XN induced expression of T-bet, a Th1-specific transcription factor. Furthermore, we found that XN significantly promoted the phosphorylation of signal transducer and activator of transcription (STAT)4. Our results demonstrated that XN promoted Th1/Th2 balance towards Th1 polarization, and STAT4 may play a positive role in the regulation of Th1/Th2 cytokines by XN.