Dicty_cDB: Contig-U12545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

Dicty_cDB: Contig-U10823-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

Dicty_cDB: Contig-U13065-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

Dicty_cDB: Contig-U08861-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

Dicty_cDB: Contig-U06829-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

Dicty_cDB: Contig-U12073-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U09615-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

Dicty_cDB: Contig-U04432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600 Chro...ni**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

Dicty_cDB: Contig-U15828-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U01750-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U07021-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U16108-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16108-1 gap included 1456 4 1889609 1888449 MINUS 4 6 U16108 0 0 2 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U16108-1 Contig ID Contig-U16108-1 Contig update 2004. 6.11 Contig sequence >Contig-U16108-1 (Contig-U16108-1Q) /CSM_Contig/Contig-U1610...AAAATCA TAAAATCAAAAATTGTATAATTAAAATAAAAATAAAAAAAAAAACAAAAA TAAAAAAAAAAAACAA Gap gap included Contig length 1...DFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIGDNFYTKTGYNEIAETNNIIILYPQALET...---NYVNNDNIKTMFDIQSEHAFITNSFGNNCTYLGPDYINNCNFNAPWDFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIG

Dicty_cDB: Contig-U13974-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

Dicty_cDB: Contig-U16008-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

Dicty_cDB: Contig-U11342-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

Dicty_cDB: Contig-U11195-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

Dicty_cDB: Contig-U01791-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01791-1 no gap 527 2 7629792 7630319 PLUS 1 1 U01791 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01791-1 Contig ID Contig-U01791-1 Contig update 2001. 8.29 Contig sequence >Contig-U01791-1 (Contig...-U01791-1Q) /CSM_Contig/Contig-U01791-1Q.Seq.d GTTTGATTATAATTTATATGAATGTGAAATTAGACAAGCATTATCAAATA ...TCGTTCCCTTATGATTTAAGAACAACTTT GAATAGTTACAGAAATGGTGAATTTAGTATTTATCAATAAATTTTTTTTT AAAGATTTATAATTAAAATAAAAAAAA Gap no gap Contig...SILWSIESIGSLIVSAQINDDRETMELLHRYQIPQKFLIPLF QILALIDQLEKDLSHQIELDKFTINRDYYFLKSFSNLIEPPLNCLGILKTSRPHFRIFKL VGKNMISQVLETIG

Dicty_cDB: Contig-U09412-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

Dicty_cDB: Contig-U12357-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

Dicty_cDB: Contig-U10996-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

Dicty_cDB: Contig-U12049-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

Dicty_cDB: Contig-U13894-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

Dicty_cDB: Contig-U15462-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

Dicty_cDB: Contig-U09720-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

Dicty_cDB: Contig-U09379-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

Dicty_cDB: Contig-U15566-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

Dicty_cDB: Contig-U04334-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs

Dicty_cDB: Contig-U10335-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

Dicty_cDB: Contig-U12399-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

Dicty_cDB: Contig-U11404-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

Dicty_cDB: Contig-U09569-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

Dicty_cDB: Contig-U15306-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15306-1 no gap 2452 3 3887051 3889342 PLUS 54 91 U15306 0 0 0 49 4 1 0 0 0 0 0 0 0 0 Show Contig...-U15306-1 Contig ID Contig-U15306-1 Contig update 2004. 6.11 Contig sequence >Contig-U15306-1 (Contig...-U15306-1Q) /CSM_Contig/Contig-U15306-1Q.Seq.d AAGCATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTA...TTTTAGAACTTCAAAAAATAGTAC AAATTTTTTCAAATTAAGATAAAAAAAATAAAACAAAAATTAATTTAAAA CA Gap no gap Contig length 2452...*naagtgkgeegrt*hkslpywlapqvkgsvmprggqghygasrggrkhmgidfssivg qdivapisgkvvnfkgartkypmlqlypskkftefdylqmlyvhppvginmgasyqvsvg dtig

Dicty_cDB: Contig-U14772-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

Dicty_cDB: Contig-U11141-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

Dicty_cDB: Contig-U13202-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

Dicty_cDB: Contig-U15062-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15062-1 no gap 1282 3 4759691 4758480 MINUS 5 6 U15062 0 0 0 0 0 0 1 0 1 1 1 0 1 0 Show Contig...-U15062-1 Contig ID Contig-U15062-1 Contig update 2004. 6.11 Contig sequence >Contig-U15062-1 (Contig...-U15062-1Q) /CSM_Contig/Contig-U15062-1Q.Seq.d CAAATATTTAAATAAATTTAACATTATAAAAACAAAAATTAATAAAGTA...TTTTCAATAGATAATAATAAAAAAAAAAAAAAAAAAA AAAAAAAAATTATTTTAAAAATAAAAAAAAAA Gap no gap Contig length 1282 Chromos...KMSHNHNSNNNKTTTTTTNDSGSAIANGINLEKILADVKECN YNLVNSITATEAIQKEKESLENELSTKGTIGDGKRIKKLQYNISLQTETLMKTLMKLDSL SITG

Dicty_cDB: Contig-U09432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

Dicty_cDB: Contig-U15005-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

Dicty_cDB: Contig-U10406-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10406-1 no gap 661 4 1621526 1620875 MINUS 1 1 U10406 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U10406-1 Contig ID Contig-U10406-1 Contig update 2002. 9.13 Contig sequence >Contig-U10406-1 (Contig...-U10406-1Q) /CSM_Contig/Contig-U10406-1Q.Seq.d NNNNNNNNNNATAAGTAAAAGAGTTATTGGTCCAAGATTAGATGATGACA...TACAAATAAGTAAAGTTG ATAAAGAACAT Gap no gap Contig length 661 Chromosome number (1....cid sequence XXXISKRVIGPRLDDDNNNNDNDKFNNNNKKAIGPSRIGPTIGPSIGPSRYNTNNNDSNH NSNNDDDDDSSEEDEEDTKSEWERVRNMIENNKN

Dicty_cDB: Contig-U16457-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

Dicty_cDB: Contig-U04768-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

Dicty_cDB: Contig-U13326-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

Dicty_cDB: Contig-U15036-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

Dicty_cDB: Contig-U13455-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

Dicty_cDB: Contig-U14400-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

Dicty_cDB: Contig-U10709-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

Dicty_cDB: Contig-U10837-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

Dicty_cDB: Contig-U12765-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

Dicty_cDB: Contig-U09480-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

Dicty_cDB: Contig-U09345-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

Dicty_cDB: Contig-U15323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

Dicty_cDB: Contig-U14236-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

Dicty_cDB: Contig-U10291-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY

Dicty_cDB: Contig-U07545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07545-1 no gap 439 3 4955441 4955098 MINUS 1 1 U07545 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U07545-1 Contig ID Contig-U07545-1 Contig update 2002. 5. 9 Contig sequence >Contig-U07545-1 (Contig...-U07545-1Q) /CSM_Contig/Contig-U07545-1Q.Seq.d ATATGAAATACTTAATACTTTTAATTTTCCTTTTAATAAATTCAACTTTT...ATGTTTCAGAGTCTGGTTG Gap no gap Contig length 439 Chromosome number (1..6, M) 3 Chromosome length 6358359 Sta...e MKYLILLIFLLINSTFGNIQFSKYISNSGNDNNSCGSFTSPCKTIGYSIQQIKSYEYNQY SIEILLDSGNYYSQNPINLYGLNISISAQNSNDLVQFLVPNINGT

Dicty_cDB: Contig-U15359-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15359-1 no gap 1420 6 1334613 1333192 MINUS 3 3 U15359 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show Contig...-U15359-1 Contig ID Contig-U15359-1 Contig update 2004. 6.11 Contig sequence >Contig-U15359-1 (Contig...-U15359-1Q) /CSM_Contig/Contig-U15359-1Q.Seq.d TATAGCATCATTTGCAAAGTTTAGTTTAAAGAAAAAAGAGAAAGCGGAA...A AAAAAAACTGGAAAAATTAA Gap no gap Contig length 1420 Chromosome number (1..6, M) 6 Chromosome length 3595308...SSGF DEPSLAVMYVDRALKGASAVQTIGRLSRVSKGKNACYIVDFVNTRREISDAFGQYWRETC LKGETRKTVLELKLNRVLGKLSAIEPLANGRLEESVEYILRD

Dicty_cDB: Contig-U09581-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

Dicty_cDB: Contig-U04729-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq

Dicty_cDB: Contig-U06929-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06929-1 no gap 726 5 4252576 4251850 MINUS 1 1 U06929 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06929-1 Contig ID Contig-U06929-1 Contig update 2001. 8.30 Contig sequence >Contig-U06929-1 (Contig...-U06929-1Q) /CSM_Contig/Contig-U06929-1Q.Seq.d AGTTCATTCATTTAGTCGTATGATAGTATCACCATTTATAAATCCAAAAT...TAAATTAAATAAATA Gap no gap Contig length 726 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start p...PSAISNNSNNS NNNDDNRPPILGLPFLFDYKNRITRGSRFFETIHYKIVHVTSATEFGIRRISKLYGTKWQ LEIGLKHQITQSGALQCLFTHTIGQTTIFGLSFGF

Dicty_cDB: Contig-U15525-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15525-1 gap included 3361 6 202399 204109 PLUS 34 57 U15525 0 0 7 0 7 6 0 0 4 3 7 0 0 0 Show Contig...-U15525-1 Contig ID Contig-U15525-1 Contig update 2004. 6.11 Contig sequence >Contig-U15525-1 (Contig-U15525-1Q) /CSM_Contig/Contig-U15525...ATTTAATTAAATAATAATA Gap gap included Contig length 3361 Chromosome number (1..6, M) 6 Chromosome length 3595...TEATCLILSVD ETVQNNQAEQAQAGPQINNQTRQALSRVEVFKQ--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKVLCLNIELELK...lslnsiqslpqlkqlv*ssll mkpfkiiklnklklvhklitkhvklyhg*rcss--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKV

Dicty_cDB: Contig-U09822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

Dicty_cDB: Contig-U11883-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

Dicty_cDB: Contig-U13680-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

Dicty_cDB: Contig-U15718-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15718-1 gap included 3735 6 2645446 2642451 MINUS 153 276 U15718 0 0 0 118 ...1 0 0 20 3 10 1 0 0 0 Show Contig-U15718-1 Contig ID Contig-U15718-1 Contig update 2004. 6.11 Contig sequence >Contig...-U15718-1 (Contig-U15718-1Q) /CSM_Contig/Contig-U15718-1Q.Seq.d AAATTATTAAATTGTTTATTAATTTTTTTTTTTAC...CCTG Gap gap included Contig length 3735 Chromosome number (1..6, M) 6 Chromosome length 3595308 Start point...ptqtppptqtpt nhsigvnecdccpegqycllifghercfiandggdgipeetigcpgvttgtptstdggtg hytesgtgnphlcdrhhcrsgmechvingipecl

Dicty_cDB: Contig-U15573-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

Dicty_cDB: Contig-U01204-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

Dicty_cDB: Contig-U12043-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

Dicty_cDB: Contig-U16467-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

Dicty_cDB: Contig-U12682-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U15069-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

Dicty_cDB: Contig-U12316-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

Fiscal loss and program fidelity: impact of the economic downturn on HIV/STI prevention program fidelity.

Science.gov (United States)

Catania, Joseph A; Dolcini, M Margaret; Gandelman, Alice A; Narayanan, Vasudha; McKay, Virginia R

2014-03-01

The economic downturn of 2007 created significant fiscal losses for public and private agencies conducting behavioral prevention. Such macro-economic changes may influence program implementation and sustainability. We examined how public and private agencies conducting RESPECT, a brief HIV/STI (sexually transmitted infection) counseling and testing intervention, adapted to fiscal loss and how these adaptations impacted program fidelity. We collected qualitative and quantitative data in a national sample of 15 agencies experiencing fiscal loss. Using qualitative analyses, we examined how program fidelity varied with different types of adaptations. Agencies reported three levels of adaptation: agency-level, program-level, and direct fiscal remedies. Private agencies tended to use direct fiscal remedies, which were associated with higher fidelity. Some agency-level adaptations contributed to reductions in procedural fit, leading to negative staff morale and decreased confidence in program effectiveness, which in turn, contributed to poor fidelity. Findings describe a "work stress pathway" that links program fiscal losses to poor staff morale and low program fidelity.

Construction of a YAC contig and STS map spanning 2.5 Mbp in Xq25, the critical region for the X-linked lymphoproliferative (XLP) gene

Energy Technology Data Exchange (ETDEWEB)

Lanyi, A.; Li, B.F.; Li, S. [Univ. of Nebraska Medical Center, Omaha, NE (United States)] [and others

1994-09-01

X-linked lymphoproliferative disease (XLP) is characterized by a marked vulnerability in Epstein-Barr virus (EBV) infection. Infection of XLP patients with EBV invariably results in fatal mononucleosis, agammaglobulinemia or B-cell lymphoma. The XLP gene lies within a 10 cM region in Xq25 between DXS42 and DXS10. Initial chromosome studies revealed an interstitial, cytogenetically visible deletion in Xq25 in one XLP family (43-004). We estimated the size of the Xq25 deletion by dual laser flow karyotyping to involve 2% of the X chromosome, or approximately 3 Mbp of DNA sequences. To further delineate the deletion we performed a series of pulsed field gel electrophoresis (PFGE) analyses which showed that DXS6 and DXS100, two Xq25-specific markers, are missing from 45-004 DNA. Five yeast artificial chromosomes (YACs) from a chromosome X specific YAC library containing sequences deleted in patient`s 43-004 DNA were isolated. These five YACs did not overlap, and their end fragments were used to screen the CEPH MegaYAC library. Seven YACs were isolated from the CEPH MegaYAC library. They could be arranged into a contig which spans between DXS6 and DXS100. The contig contains a minimum of 2.5 Mbp of human DNA. A total of 12 YAC end clone, lambda subclones and STS probes have been used to order clones within the contig. These reagents were also used in Southern blot and patients showed interstitial deletions in Xq25. The size of these deletions range between 0.5 and 2.5 Mbp. The shortest deletion probably represents the critical region for the XLP gene.

Projector : automatic contig mapping for gap closure purposes

NARCIS (Netherlands)

van Hijum, SAFT; Zomer, AL; Kuipers, OP; Kok, J

2003-01-01

Projector was designed for automatic positioning of contigs from an unfinished prokaryotic genome onto a template genome of a closely related strain or species. Projector mapped 84 contigs of Lactococcus lactis MG1363 (corresponding to 81% of the assembly nucleotides) against the genome of L.lactis

COCACOLA: binning metagenomic contigs using sequence COmposition, read CoverAge, CO-alignment and paired-end read LinkAge.

Science.gov (United States)

Lu, Yang Young; Chen, Ting; Fuhrman, Jed A; Sun, Fengzhu

2017-03-15

The advent of next-generation sequencing technologies enables researchers to sequence complex microbial communities directly from the environment. Because assembly typically produces only genome fragments, also known as contigs, instead of an entire genome, it is crucial to group them into operational taxonomic units (OTUs) for further taxonomic profiling and down-streaming functional analysis. OTU clustering is also referred to as binning. We present COCACOLA, a general framework automatically bin contigs into OTUs based on sequence composition and coverage across multiple samples. The effectiveness of COCACOLA is demonstrated in both simulated and real datasets in comparison with state-of-art binning approaches such as CONCOCT, GroopM, MaxBin and MetaBAT. The superior performance of COCACOLA relies on two aspects. One is using L 1 distance instead of Euclidean distance for better taxonomic identification during initialization. More importantly, COCACOLA takes advantage of both hard clustering and soft clustering by sparsity regularization. In addition, the COCACOLA framework seamlessly embraces customized knowledge to facilitate binning accuracy. In our study, we have investigated two types of additional knowledge, the co-alignment to reference genomes and linkage of contigs provided by paired-end reads, as well as the ensemble of both. We find that both co-alignment and linkage information further improve binning in the majority of cases. COCACOLA is scalable and faster than CONCOCT, GroopM, MaxBin and MetaBAT. The software is available at https://github.com/younglululu/COCACOLA . fsun@usc.edu. Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com

YAC contig information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available 8908/lsdba.nbdc00318-06-001 Description of data contents YAC contigs on the rice chromosomes Data file File name: rgp_physical...map_yac_contigs.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physical...sciencedbc.jp/togodb/view/rgp_physicalmap_yac_contigs#en Data acquisition method The range including YAC con...m Description Chrom. No. Chromosome number Region Region number Physical map image The file name of rice physical...n Download License Update History of This Database Site Policy | Contact Us YAC contig information - RGP physicalmap | LSDB Archive ...

Contig-Layout-Authenticator (CLA): A Combinatorial Approach to Ordering and Scaffolding of Bacterial Contigs for Comparative Genomics and Molecular Epidemiology.

Science.gov (United States)

Shaik, Sabiha; Kumar, Narender; Lankapalli, Aditya K; Tiwari, Sumeet K; Baddam, Ramani; Ahmed, Niyaz

2016-01-01

A wide variety of genome sequencing platforms have emerged in the recent past. High-throughput platforms like Illumina and 454 are essentially adaptations of the shotgun approach generating millions of fragmented single or paired sequencing reads. To reconstruct whole genomes, the reads have to be assembled into contigs, which often require further downstream processing. The contigs can be directly ordered according to a reference, scaffolded based on paired read information, or assembled using a combination of the two approaches. While the reference-based approach appears to mask strain-specific information, scaffolding based on paired-end information suffers when repetitive elements longer than the size of the sequencing reads are present in the genome. Sequencing technologies that produce long reads can solve the problems associated with repetitive elements but are not necessarily easily available to researchers. The most common high-throughput technology currently used is the Illumina short read platform. To improve upon the shortcomings associated with the construction of draft genomes with Illumina paired-end sequencing, we developed Contig-Layout-Authenticator (CLA). The CLA pipeline can scaffold reference-sorted contigs based on paired reads, resulting in better assembled genomes. Moreover, CLA also hints at probable misassemblies and contaminations, for the users to cross-check before constructing the consensus draft. The CLA pipeline was designed and trained extensively on various bacterial genome datasets for the ordering and scaffolding of large repetitive contigs. The tool has been validated and compared favorably with other widely-used scaffolding and ordering tools using both simulated and real sequence datasets. CLA is a user friendly tool that requires a single command line input to generate ordered scaffolds.

Evaluating display fidelity and interaction fidelity in a virtual reality game.

Science.gov (United States)

McMahan, Ryan P; Bowman, Doug A; Zielinski, David J; Brady, Rachael B

2012-04-01

In recent years, consumers have witnessed a technological revolution that has delivered more-realistic experiences in their own homes through high-definition, stereoscopic televisions and natural, gesture-based video game consoles. Although these experiences are more realistic, offering higher levels of fidelity, it is not clear how the increased display and interaction aspects of fidelity impact the user experience. Since immersive virtual reality (VR) allows us to achieve very high levels of fidelity, we designed and conducted a study that used a six-sided CAVE to evaluate display fidelity and interaction fidelity independently, at extremely high and low levels, for a VR first-person shooter (FPS) game. Our goal was to gain a better understanding of the effects of fidelity on the user in a complex, performance-intensive context. The results of our study indicate that both display and interaction fidelity significantly affect strategy and performance, as well as subjective judgments of presence, engagement, and usability. In particular, performance results were strongly in favor of two conditions: low-display, low-interaction fidelity (representative of traditional FPS games) and high-display, high-interaction fidelity (similar to the real world).

Dicty_cDB: Contig-U16279-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AB254080 |pid:none) Streptomyces kanamyceticus kanam... 47 0.002 CP000964_3229( CP000964 |pid:none) Klebsiella pneumoni...nkkmtkpvasyeldekrfltllgkligetenlqnrppalipiednag rhviealtpylkanggvleleqvhcdpvnypkrgniiie... letters Score E Sequences producing significant alignments: (bits) Value Contig-U16279-1 (Contig-U16279-1Q....................................................done Score E Sequences producing significant alignments: (bits) Val....................................done Score E Sequences producing significant alignments: (bits) Val

Use of simulated data sets to evaluate the fidelity of Metagenomicprocessing methods

Energy Technology Data Exchange (ETDEWEB)

Mavromatis, Konstantinos; Ivanova, Natalia; Barry, Kerri; Shapiro, Harris; Goltsman, Eugene; McHardy, Alice C.; Rigoutsos, Isidore; Salamov, Asaf; Korzeniewski, Frank; Land, Miriam; Lapidus, Alla; Grigoriev, Igor; Richardson, Paul; Hugenholtz, Philip; Kyrpides, Nikos C.

2006-12-01

Metagenomics is a rapidly emerging field of research for studying microbial communities. To evaluate methods presently used to process metagenomic sequences, we constructed three simulated data sets of varying complexity by combining sequencing reads randomly selected from 113 isolate genomes. These data sets were designed to model real metagenomes in terms of complexity and phylogenetic composition. We assembled sampled reads using three commonly used genome assemblers (Phrap, Arachne and JAZZ), and predicted genes using two popular gene finding pipelines (fgenesb and CRITICA/GLIMMER). The phylogenetic origins of the assembled contigs were predicted using one sequence similarity--based (blast hit distribution) and two sequence composition--based (PhyloPythia, oligonucleotide frequencies) binning methods. We explored the effects of the simulated community structure and method combinations on the fidelity of each processing step by comparison to the corresponding isolate genomes. The simulated data sets are available online to facilitate standardized benchmarking of tools for metagenomic analysis.

Use of simulated data sets to evaluate the fidelity of metagenomic processing methods

Energy Technology Data Exchange (ETDEWEB)

Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Barry, Kerrie [U.S. Department of Energy, Joint Genome Institute; Shapiro, Harris [U.S. Department of Energy, Joint Genome Institute; Goltsman, Eugene [U.S. Department of Energy, Joint Genome Institute; McHardy, Alice C. [IBM T. J. Watson Research Center; Rigoutsos, Isidore [IBM T. J. Watson Research Center; Salamov, Asaf [U.S. Department of Energy, Joint Genome Institute; Korzeniewski, Frank [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Grigoriev, Igor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute

2007-01-01

Metagenomics is a rapidly emerging field of research for studying microbial communities. To evaluate methods presently used to process metagenomic sequences, we constructed three simulated data sets of varying complexity by combining sequencing reads randomly selected from 113 isolate genomes. These data sets were designed to model real metagenomes in terms of complexity and phylogenetic composition. We assembled sampled reads using three commonly used genome assemblers (Phrap, Arachne and JAZZ), and predicted genes using two popular gene-finding pipelines (fgenesb and CRITICA/GLIMMER). The phylogenetic origins of the assembled contigs were predicted using one sequence similarity-based ( blast hit distribution) and two sequence composition-based (PhyloPythia, oligonucleotide frequencies) binning methods. We explored the effects of the simulated community structure and method combinations on the fidelity of each processing step by comparison to the corresponding isolate genomes. The simulated data sets are available online to facilitate standardized benchmarking of tools for metagenomic analysis.

An information theoretic approach to use high-fidelity codes to calibrate low-fidelity codes

Energy Technology Data Exchange (ETDEWEB)

Lewis, Allison, E-mail: lewis.allison10@gmail.com [Department of Mathematics, North Carolina State University, Raleigh, NC 27695 (United States); Smith, Ralph [Department of Mathematics, North Carolina State University, Raleigh, NC 27695 (United States); Williams, Brian [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Figueroa, Victor [Sandia National Laboratories, Albuquerque, NM 87185 (United States)

2016-11-01

For many simulation models, it can be prohibitively expensive or physically infeasible to obtain a complete set of experimental data to calibrate model parameters. In such cases, one can alternatively employ validated higher-fidelity codes to generate simulated data, which can be used to calibrate the lower-fidelity code. In this paper, we employ an information-theoretic framework to determine the reduction in parameter uncertainty that is obtained by evaluating the high-fidelity code at a specific set of design conditions. These conditions are chosen sequentially, based on the amount of information that they contribute to the low-fidelity model parameters. The goal is to employ Bayesian experimental design techniques to minimize the number of high-fidelity code evaluations required to accurately calibrate the low-fidelity model. We illustrate the performance of this framework using heat and diffusion examples, a 1-D kinetic neutron diffusion equation, and a particle transport model, and include initial results from the integration of the high-fidelity thermal-hydraulics code Hydra-TH with a low-fidelity exponential model for the friction correlation factor.

Fidelity deviation in quantum teleportation

OpenAIRE

Bang, Jeongho; Ryu, Junghee; Kaszlikowski, Dagomir

2018-01-01

We analyze the performance of quantum teleportation in terms of average fidelity and fidelity deviation. The average fidelity is defined as the average value of the fidelities over all possible input states and the fidelity deviation is their standard deviation, which is referred to as a concept of fluctuation or universality. In the analysis, we find the condition to optimize both measures under a noisy quantum channel---we here consider the so-called Werner channel. To characterize our resu...

Dicty_cDB: Contig-U03802-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available T-2KB Trichosurus... 48 3e-11 4 ( DY894715 ) CeleSEQ14351 Cunninghamella elegans pBluescript (... 58 4e-11 3... letters Score E Sequences producing significant alignments: (bits) Value Contig-U03802-1 (Contig-U... letters Searching..................................................done Score E Sequences producing significant al...1... 62 4e-05 1 ( EJ306703 ) 1095390099376 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-05 1 ( CP000238 ) Baumannia cicadellinicola... AY241394 |pid:none) Melopsittacus undulatus Mn superox... 244 2e-63 AF329270_1( AF329270 |pid:none) Gallus gallus manganes

LTC: a novel algorithm to improve the efficiency of contig assembly for physical mapping in complex genomes

Directory of Open Access Journals (Sweden)

Feuillet Catherine

2010-11-01

Full Text Available Abstract Background Physical maps are the substrate of genome sequencing and map-based cloning and their construction relies on the accurate assembly of BAC clones into large contigs that are then anchored to genetic maps with molecular markers. High Information Content Fingerprinting has become the method of choice for large and repetitive genomes such as those of maize, barley, and wheat. However, the high level of repeated DNA present in these genomes requires the application of very stringent criteria to ensure a reliable assembly with the FingerPrinted Contig (FPC software, which often results in short contig lengths (of 3-5 clones before merging as well as an unreliable assembly in some difficult regions. Difficulties can originate from a non-linear topological structure of clone overlaps, low power of clone ordering algorithms, and the absence of tools to identify sources of gaps in Minimal Tiling Paths (MTPs. Results To address these problems, we propose a novel approach that: (i reduces the rate of false connections and Q-clones by using a new cutoff calculation method; (ii obtains reliable clusters robust to the exclusion of single clone or clone overlap; (iii explores the topological contig structure by considering contigs as networks of clones connected by significant overlaps; (iv performs iterative clone clustering combined with ordering and order verification using re-sampling methods; and (v uses global optimization methods for clone ordering and Band Map construction. The elements of this new analytical framework called Linear Topological Contig (LTC were applied on datasets used previously for the construction of the physical map of wheat chromosome 3B with FPC. The performance of LTC vs. FPC was compared also on the simulated BAC libraries based on the known genome sequences for chromosome 1 of rice and chromosome 1 of maize. Conclusions The results show that compared to other methods, LTC enables the construction of highly

Construction of a yeast artifical chromosome contig spanning the spinal muscular atrophy disease gene region

Energy Technology Data Exchange (ETDEWEB)

Kleyn, P.W.; Wang, C.H.; Vitale, E.; Pan, J.; Ross, B.M.; Grunn, A.; Palmer, D.A.; Warburton, D.; Brzustowicz, L.M.; Gilliam, T.G. (New York State Psychiatric Institute, NY (United States)); Lien, L.L.; Kunkel, L.M. (Howard Hughes Medical Institute, Boston, MA (United States))

1993-07-15

The childhood spinal muscular atrophies (SMAs) are the most common, serious neuromuscular disorders of childhood second to Duchenne muscular dystrophy. A single locus for these disorders has been mapped by recombination events to a region of 0.7 centimorgan (range, 0.1-2.1 centimorgans) between loci D5S435 and MAP1B on chromosome 5q11.2-13.3. By using PCR amplification to screen yeast artificial chromosome (YAC) DNA pools and the PCR-vectorette method to amplify YAC ends, a YAC contig was constructed across the disease gene region. Nine walk steps identified 32 YACs, including a minimum of seven overlapping YAC clones (average size, 460 kb) that span the SMA region. The contig is characterized by a collection of 30 YAC-end sequence tag sites together with seven genetic markers. The entire YAC contig spans a minimum of 3.2 Mb; the SMA locus is confined to roughly half of this region. Microsatellite markers generated along the YAC contig segregate with the SMA locus in all families where the flanking markers (D5S435 and MAP1B) recombine. Construction of a YAC contig across the disease gene region is an essential step in isolation of the SMA-encoding gene. 26 refs., 3 figs., 1 tab.

Site fidelity, mate fidelity, and breeding dispersal in American kestrels

Science.gov (United States)

Steenhof, K.; Peterson, B.E.

2009-01-01

We assessed mate fidelity, nest-box fidelity, and breeding dispersal distances of American Kestrels (falco sparverius) nesting in boxes in southwestern Idaho from 1990 through 2006. Seventy-seven percent of boxes had different males and 87% had different females where nest-box occupants were identified in consecutive years. High turnover rates were partly a result of box-switching. Forty-eight percent of males and 58% of females that nested within the study area in successive years used different boxes. The probability of changing boxes was unrelated to gender, nesting success in the prior year, or years of nesting experience. Breeding dispersal distances for birds that moved to different boxes averaged 2.2 km for males (max = 22 km) and 3.2 km for females (max = 32 km). Approximately 70% of birds that nested in consecutive years on the study area had a different mate in the second year. Mate fidelity was related to box fidelity but not to prior nesting success or years of nesting experience. Mate changes occurred 32% of the time when the previous mate was known to be alive and nesting in the area. Kestrels that switched mates and boxes did not improve or decrease their subsequent nesting success. Kestrels usually switched to mates with less experience and lower lifetime productivity than their previous mates. The costs of switching boxes and mates were low, and there were no obvious benefits to fidelity. The cost of "waiting" for a previous mate that might have died could be high in species with high annual mortality.

Dicty_cDB: Contig-U14477-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

Fidelity deviation in quantum teleportation

Science.gov (United States)

Bang, Jeongho; Ryu, Junghee; Kaszlikowski, Dagomir

2018-04-01

We analyze the performance of quantum teleportation in terms of average fidelity and fidelity deviation. The average fidelity is defined as the average value of the fidelities over all possible input states and the fidelity deviation is their standard deviation, which is referred to as a concept of fluctuation or universality. In the analysis, we find the condition to optimize both measures under a noisy quantum channel—we here consider the so-called Werner channel. To characterize our results, we introduce a 2D space defined by the aforementioned measures, in which the performance of the teleportation is represented as a point with the channel noise parameter. Through further analysis, we specify some regions drawn for different channel conditions, establishing the connection to the dissimilar contributions of the entanglement to the teleportation and the Bell inequality violation.

THE CONCEPT OF FIDELITY IN COMICS TRANSLATION

Directory of Open Access Journals (Sweden)

Erico Assis

2016-11-01

Full Text Available The long-discussed – and frequently dismissed – concept of translation faithfulness or translation fidelity, though usually applied to literary texts, has its fair share of applications when considered for comics translation. In literary translation, non-linguistic portions such as illustrations are often considered addenda or “paratexts” relative to the main, linguistic text. Comics, by its turn, present a certain set of features which single them out as a form that demands a new concept of “text” and, therefore, of translation fidelity. The comic-reading process, as pertaining to cognitive apprehension, implies interpretative accords that differ from the ones in purely linguistic texts: each and every element of the comics page – non-linguistic (mainly imagetic signs, linguistic signs, panel borders, typography and such – are intertwined and should be perceived in regards to its spatial and topological relations. This approach to understanding comics is based on Groensteen (1999 and his concepts of arthrology, spatio-topia, page layout, breakdown and braiding. As for translation fidelity, we rely on authors such as Berman (1984, Guidere (2010 and Aubert (1993. On comics translation, Zanettin (2008, Rota (2008 and Yuste Frías (2010, 2011 are of particular interest. Based on various concepts of fidelity – supported by samples of translated comics with varied degrees of fidelity to the source text – we discuss the different grounds of source-text fidelity, target-reader fidelity and source-author fidelity in the following instances: linguistic sign fidelity, imagetic sign fidelity, spatio-topia fidelity, typographic fidelity and format fidelity.

The binning of metagenomic contigs for microbial physiology of mixed cultures.

Science.gov (United States)

Strous, Marc; Kraft, Beate; Bisdorf, Regina; Tegetmeyer, Halina E

2012-01-01

So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population. In the present study eight metagenomic samples from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to existing algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a 100 times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt).

The binning of metagenomic contigs for microbial physiology of mixed cultures

Directory of Open Access Journals (Sweden)

Marc eStrous

2012-12-01

Full Text Available So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population.In the present study eight metagenomic samples originating from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to exisiting algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a hunderd times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt.

CSAR-web: a web server of contig scaffolding using algebraic rearrangements.

Science.gov (United States)

Chen, Kun-Tze; Lu, Chin Lung

2018-05-04

CSAR-web is a web-based tool that allows the users to efficiently and accurately scaffold (i.e. order and orient) the contigs of a target draft genome based on a complete or incomplete reference genome from a related organism. It takes as input a target genome in multi-FASTA format and a reference genome in FASTA or multi-FASTA format, depending on whether the reference genome is complete or incomplete, respectively. In addition, it requires the users to choose either 'NUCmer on nucleotides' or 'PROmer on translated amino acids' for CSAR-web to identify conserved genomic markers (i.e. matched sequence regions) between the target and reference genomes, which are used by the rearrangement-based scaffolding algorithm in CSAR-web to order and orient the contigs of the target genome based on the reference genome. In the output page, CSAR-web displays its scaffolding result in a graphical mode (i.e. scalable dotplot) allowing the users to visually validate the correctness of scaffolded contigs and in a tabular mode allowing the users to view the details of scaffolds. CSAR-web is available online at http://genome.cs.nthu.edu.tw/CSAR-web.

Nuclear power plant training simulator fidelity assessment

International Nuclear Information System (INIS)

Carter, R.J.; Laughery, K.R.

1985-01-01

The fidelity assessment portion of a methodology for evaluating nuclear power plant simulation facilities in regard to their appropriateness for conducting the Nuclear Regulatory Commission's operating test was described. The need for fidelity assessment, data sources, and fidelity data to be collected are addressed. Fidelity data recording, collection, and analysis are discussed. The processes for drawing conclusions from the fidelity assessment and evaluating the adequacy of the simulator control-room layout were presented. 3 refs

AcEST: [AcEST

Lifescience Database Archive (English)

Full Text Available CL2194Contig1 771 2 Adiantum capillus-veneris contig: CL2194contig1 sequence. Link to clone list...apillus-veneris contig: CL2194contig1 sequence. Link to clone list Link to clone list Clone ID BP915172 DK95

Physiological Based Simulator Fidelity Design Guidance

Science.gov (United States)

Schnell, Thomas; Hamel, Nancy; Postnikov, Alex; Hoke, Jaclyn; McLean, Angus L. M. Thom, III

2012-01-01

The evolution of the role of flight simulation has reinforced assumptions in aviation that the degree of realism in a simulation system directly correlates to the training benefit, i.e., more fidelity is always better. The construct of fidelity has several dimensions, including physical fidelity, functional fidelity, and cognitive fidelity. Interaction of different fidelity dimensions has an impact on trainee immersion, presence, and transfer of training. This paper discusses research results of a recent study that investigated if physiological-based methods could be used to determine the required level of simulator fidelity. Pilots performed a relatively complex flight task consisting of mission task elements of various levels of difficulty in a fixed base flight simulator and a real fighter jet trainer aircraft. Flight runs were performed using one forward visual channel of 40 deg. field of view for the lowest level of fidelity, 120 deg. field of view for the middle level of fidelity, and unrestricted field of view and full dynamic acceleration in the real airplane. Neuro-cognitive and physiological measures were collected under these conditions using the Cognitive Avionics Tool Set (CATS) and nonlinear closed form models for workload prediction were generated based on these data for the various mission task elements. One finding of the work described herein is that simple heart rate is a relatively good predictor of cognitive workload, even for short tasks with dynamic changes in cognitive loading. Additionally, we found that models that used a wide range of physiological and neuro-cognitive measures can further boost the accuracy of the workload prediction.

Dicty_cDB: CHA362 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

Mitotic chromosome transmission fidelity mutants in Saccharomyces cerevisiae

International Nuclear Information System (INIS)

Spencer, F.; Gerring, S.L.; Connelly, C.; Hieter, P.

1990-01-01

The authors have isolated 136 independent EMS-induced mutations in haploid yeast strains that exhibit decreased chromosome transmission fidelity in mitosis. Eight-five percent of the mutations are recessive and 15% are partially dominant. Complementation analysis between MATa and MATα isolates identifies 11 chromosome transmission fidelity (CTF) complementation groups, the largest of which is identical to CHL1. For 49 independent mutations, no corresponding allele has been recovered in the opposite mating type. The initial screen monitored the stability of a centromere-linked color marker on a nonessential yeast chromosome fragment; the mitotic inheritance of natural yeast chromosome III is also affected by the ctf mutations. Of the 136 isolates identified, seven were inviable at 37 degree and five were inviable at 11 degree. In all cases tested, these temperature conditional lethalities cosegregated with the chromosome instability phenotype. Five additional complementation groups (ctf12 through ctf16) have been defined by complementation analysis of the mutations causing inviability at 37 degree. All of the mutant strains showed normal sensitivity to ultraviolet and γ-irradiation

Dicty_cDB: CHR241 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

CBrowse: a SAM/BAM-based contig browser for transcriptome assembly visualization and analysis.

Science.gov (United States)

Li, Pei; Ji, Guoli; Dong, Min; Schmidt, Emily; Lenox, Douglas; Chen, Liangliang; Liu, Qi; Liu, Lin; Zhang, Jie; Liang, Chun

2012-09-15

To address the impending need for exploring rapidly increased transcriptomics data generated for non-model organisms, we developed CBrowse, an AJAX-based web browser for visualizing and analyzing transcriptome assemblies and contigs. Designed in a standard three-tier architecture with a data pre-processing pipeline, CBrowse is essentially a Rich Internet Application that offers many seamlessly integrated web interfaces and allows users to navigate, sort, filter, search and visualize data smoothly. The pre-processing pipeline takes the contig sequence file in FASTA format and its relevant SAM/BAM file as the input; detects putative polymorphisms, simple sequence repeats and sequencing errors in contigs and generates image, JSON and database-compatible CSV text files that are directly utilized by different web interfaces. CBowse is a generic visualization and analysis tool that facilitates close examination of assembly quality, genetic polymorphisms, sequence repeats and/or sequencing errors in transcriptome sequencing projects. CBrowse is distributed under the GNU General Public License, available at http://bioinfolab.muohio.edu/CBrowse/ liangc@muohio.edu or liangc.mu@gmail.com; glji@xmu.edu.cn Supplementary data are available at Bioinformatics online.

Fidelity in clinical simulation

DEFF Research Database (Denmark)

Jensen, Sanne; Nøhr, Christian; Rasmussen, Stine Loft

2013-01-01

Clinical simulation may be used to identify user needs for context sensitive functionalities in e-Health. The objective with this paper is to describe how user requirements and use cases in a large EHR-platform procurement may be validated by clinical simulation using a very low-fidelity prototype...... without any existing test data. Instead of using test scenarios and use cases, the healthcare professionals who are participating in the clinical simulation are generating both scenario and patient data themselves. We found that this approach allows for an imaginative discussion, not restricted by known...... functionalities and limitations, of the ideal EHR-platform. Subsequently, we discuss benefits and challenges of using an extremely low fidelity environment and discuss the degree of fidelity necessary for conducting clinical simulation....

Dicty_cDB: Contig-U05126-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CP000939 ) Clostridium botulinum B1 str. Okra, complete genome. 34 2.5 18 ( GE803619 ) EST_scau_evk_893885 ...scauevk mixed_tissue Sebastes... 32 2.6 3 ( AM462416 ) Vitis vinifera contig VV78X219254.19, whole genom...

Assessing the link between implementation fidelity and health outcomes for a trial of intensive case management by community health workers: a mixed methods study protocol.

Science.gov (United States)

Schmidt, Barbara; Watt, Kerrianne; McDermott, Robyn; Mills, Jane

2017-07-17

Better systems of care are required to address chronic disease in Indigenous people to ensure they can access all their care needs. Health research has produced evidence about effective models of care and chronic disease strategies to address Indigenous health, however the transfer of research findings into routine clinical practice has proven challenging. Complex interventions, such as those related to chronic disease, have many components that are often poorly implemented and hence rarely achieve implementation fidelity. Implementation fidelity is "the degree to which programs are implemented as intended by the program developer". Knowing if an intervention was implemented as planned is fundamental to knowing what has contributed to the success of an intervention. The aim of this study is to adapt the implementation fidelity framework developed by Keith et al. and apply it to the intervention implemented in phase 1 of the Getting Better at Chronic Care in North Queensland study. The objectives are to quantify the level of implementation fidelity achieved during phase 1 of the study, measure the association between implementation fidelity and health outcomes and to explore the features of the primary health care system that contributed to improved health outcomes. A convergent parallel mixed methods study design will be used to develop a process for assessing implementation fidelity. Information collected via a questionnaire and routine data generated during phase 1 of the study will be used to explain the context for the intervention in each site and develop an implementation fidelity score for each component of the intervention. A weighting will be applied to each component of the intervention to calculate the overall implementation score for each participating community. Statistical analysis will assess the level of association between implementation fidelity scores and health outcomes. Health services research seeks to find solutions to social and technical

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB568 (Link to dictyBase) - G23244 DDB0217993 Contig-U02062-1...ary VF (Link to library) Clone ID VFB568 (Link to dictyBase) Atlas ID - NBRP ID G23244 dictyBase ID DDB02179...93 Link to Contig Contig-U02062-1 | Contig-U11831-1 Original site URL http://dict...TELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDRD...STELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDR

Dicty_cDB: SHE365 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHE365 (Link to dictyBase) - G23163 DDB0185626 Contig-U11298-1...ary SH (Link to library) Clone ID SHE365 (Link to dictyBase) Atlas ID - NBRP ID G23163 dictyBase ID DDB01856...26 Link to Contig Contig-U11298-1 | Contig-U13252-1 Original site URL http://dict...VEIAFSDKTPSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDE...PSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDEQQQQQISSQ

Quantum nondemolition measurement saturates fidelity trade-off

International Nuclear Information System (INIS)

Mista, L.; Filip, R.

2005-01-01

Full text: A general quantum measurement on an unknown quantum state enables us to estimate what the state originally was. Simultaneously, the measurement has a destructive effect on a measured quantum state which is reflected by the decrease of the output fidelity. We show for any d-level system that quantum non-demolition measurement controlled by a suitably prepared ancilla is a measurement in which the decrease of the output fidelity is minimal. The ratio between the estimation fidelity and the output fidelity can be continuously controlled by the preparation of the ancilla. Different measurement strategies on the ancilla to gain maximum estimation fidelity are analyzed. A feasible scheme of such a measurement for atomic and optical 2-level systems based on basic controlled-NOT gate is discussed. (author)

Dicty_cDB: VFB330 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB330 (Link to dictyBase) - G22107 DDB0216429 Contig-U02054-1...ary VF (Link to library) Clone ID VFB330 (Link to dictyBase) Atlas ID - NBRP ID G22107 dictyBase ID DDB02164...29 Link to Contig Contig-U02054-1 | Contig-U16357-1 Original site URL http://dict...d Amino Acid sequence *k*k*NKMKLDPKALRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGY...LRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGYDFLALKTLVSRGVCSYVGNQIGVGKESDIYIVAND

Fidelity of quantum interferometers

International Nuclear Information System (INIS)

Bahder, Thomas B.; Lopata, Paul A.

2006-01-01

For a generic interferometer, the conditional probability density distribution p(φ|m), for the phase φ given measurement outcome m will generally have multiple peaks. Therefore, the phase sensitivity of an interferometer cannot be adequately characterized by the standard deviation, such as Δφ∼1/√(N) (the standard limit), or Δφ∼1/N (the Heisenberg limit). We propose an alternative measure of phase sensitivity--the fidelity of an interferometer--defined as the Shannon mutual information between the phase shift φ and the measurement outcomes m. As an example application of interferometer fidelity, we consider a generic optical Mach-Zehnder interferometer, used as a sensor of a classical field. For the case where there exists no a priori information on the phase shift, we find the surprising result that maximally entangled state input leads to a lower fidelity than Fock state input, for the same photon number

High-fidelity quantum driving

DEFF Research Database (Denmark)

Bason, Mark George; Viteau, Matthieu; Malossi, Nicola

2011-01-01

Accurately controlling a quantum system is a fundamental requirement in quantum information processing and the coherent manipulation of molecular systems. The ultimate goal in quantum control is to prepare a desired state with the highest fidelity allowed by the available resources...... and the experimental constraints. Here we experimentally implement two optimal high-fidelity control protocols using a two-level quantum system comprising Bose–Einstein condensates in optical lattices. The first is a short-cut protocol that reaches the maximum quantum-transformation speed compatible...

Mate fidelity and breeding site tenacity in a monogamous sandpiper, the black turnstone

Science.gov (United States)

Handel, C.M.; Gill, R.E.

2000-01-01

We examined the relationship between mate fidelity and breeding site tenacity during a 5-year study of the black turnstone, Arenaria melanocephala, a socially monogamous sandpiper breeding in subarctic Alaska. We tested the predictions of several hypotheses regarding the incidence of divorce and the benefits of fidelity to mate and breeding site. Interannual return rates to the breeding grounds (88% for males, 79% for females) were among the highest yet recorded for any scolopacid sandpiper, and 88% of returning birds nested on their previous year's territory. The annual divorce rate was only 11%, and mate fidelity was significantly linked to fidelity to territory but independent of sex and year. Males arrived in spring significantly earlier than their mates and interannual fidelity was influenced by the relative timing of arrival of pair members. Reunited pairs had significantly higher fledging success than new pairs formed after death or divorce. The incidence of divorce was unrelated to reproductive success the previous year, although birds nested significantly further away after failure than after a successful nesting attempt. Sightings of marked individuals suggested that members of pairs do not winter together, and breeding site tenacity provides a mechanism through which pair members can reunite. We reject the 'incompatibility' hypothesis for divorce in turnstones, and our data contradict predictions of the 'better option' hypothesis. Alternatively, we propose the 'bet-hedging' hypothesis to explain the occurrence of divorce, which transpires when an individual pairs with a new mate to avoid the cost of waiting for a previous mate to return. Such costs can include remaining unmated, if the former mate has died, or experiencing lower reproductive success because of delayed breeding.

Dicty_cDB: Contig-U11311-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available A from... 58 6e-07 2 ( AM481444 ) Vitis vinifera contig VV78X144362.4, whole genome... 68 1e-06 1 ( AY604469 ) Prodonto...117 4e-27 AY604469_1( AY604469 |pid:none) Prodontorhabditis wirthi strain DF... 125 5e-27 ( P25202 ) RecName

The trajectory of fidelity in a multiyear trial of the family check-up predicts change in child problem behavior.

Science.gov (United States)

Chiapa, Amanda; Smith, Justin D; Kim, Hanjoe; Dishion, Thomas J; Shaw, Daniel S; Wilson, Melvin N

2015-10-01

Therapist fidelity to evidence-based family interventions has consistently been linked to child and family outcomes. However, few studies have evaluated the potential ebb and flow of fidelity of therapists over time. We examined therapist drift in fidelity over 4 years in the context of a Family Check-Up prevention services in early childhood (ages 2-5 years). At age 2, families engaging in Women, Infants, and Children Nutritional Supplement Program services were randomized and offered annual Family Check-Ups. Seventy-nine families with a child in the clinical range of problem behaviors at age 2 years were included in this analysis. Latent growth modeling revealed a significant linear decline in fidelity over time (M = -0.35, SD = 0.35) and that steeper declines were related to less improvement in caregiver-reported problem behaviors assessed at ages 7.5/8.5 years (b = -.69, p = .003; β = -.95, 95% CI [-2.11, -0.22]). These findings add to the literature concerning the need to continually monitor therapist fidelity to an evidence-based practice over time to optimize family benefits. Limitations and directions for future research are discussed. (c) 2015 APA, all rights reserved).

Multi-fidelity stochastic collocation method for computation of statistical moments

Energy Technology Data Exchange (ETDEWEB)

Zhu, Xueyu, E-mail: xueyu-zhu@uiowa.edu [Department of Mathematics, University of Iowa, Iowa City, IA 52242 (United States); Linebarger, Erin M., E-mail: aerinline@sci.utah.edu [Department of Mathematics, University of Utah, Salt Lake City, UT 84112 (United States); Xiu, Dongbin, E-mail: xiu.16@osu.edu [Department of Mathematics, The Ohio State University, Columbus, OH 43210 (United States)

2017-07-15

We present an efficient numerical algorithm to approximate the statistical moments of stochastic problems, in the presence of models with different fidelities. The method extends the multi-fidelity approximation method developed in . By combining the efficiency of low-fidelity models and the accuracy of high-fidelity models, our method exhibits fast convergence with a limited number of high-fidelity simulations. We establish an error bound of the method and present several numerical examples to demonstrate the efficiency and applicability of the multi-fidelity algorithm.

Dicty_cDB: Contig-U16102-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 0 6 ( BJ408668 ) Dictyostelium discoideum cDNA clone:dds46g14, 3' ... 44 3.0 2 ( CV162186 ) CS_hyp_01d11_M13Reverse Blue crab hypoder...08_M13Reverse Blue crab hypodermis, nor... 42 3.6 2 ( AM474408 ) Vitis vinifera contig VV78X173370.5, whole

AFFECT: Altered-Fidelity Framework for Enhancing Cognition and Training

Directory of Open Access Journals (Sweden)

Ryan Patrick McMahan

2016-11-01

Full Text Available In this paper, we present a new framework for analyzing and designing virtual reality (VR techniques. This framework is based on two concepts—system fidelity (i.e., the degree with which real-world experiences are reproduced by a system and memory (i.e., the formation and activation of perceptual, cognitive, and motor networks of neurons. The premise of the framework is to manipulate an aspect of system fidelity in order to assist a stage of memory. We call it the Altered-Fidelity Framework for Enhancing Cognition and Training (AFFECT. AFFECT provides nine categories of approaches to altering system fidelity to positively affect learning or training. These categories are based on the intersections of three aspects of system fidelity (interaction fidelity, scenario fidelity, and display fidelity and three stages of memory (encoding, implicit retrieval, and explicit retrieval. In addition to discussing the details of our new framework, we show how AFFECT can be used as a tool for analyzing and categorizing VR techniques designed to facilitate learning or training. We also demonstrate how AFFECT can be used as a design space for creating new VR techniques intended for educational and training systems.

Local environment can enhance fidelity of quantum teleportation

Science.gov (United States)

BadziaĢ, Piotr; Horodecki, Michał; Horodecki, Paweł; Horodecki, Ryszard

2000-07-01

We show how an interaction with the environment can enhance fidelity of quantum teleportation. To this end, we present examples of states which cannot be made useful for teleportation by any local unitary transformations; nevertheless, after being subjected to a dissipative interaction with the local environment, the states allow for teleportation with genuinely quantum fidelity. The surprising fact here is that the necessary interaction does not require any intelligent action from the parties sharing the states. In passing, we produce some general results regarding optimization of teleportation fidelity by local action. We show that bistochastic processes cannot improve fidelity of two-qubit states. We also show that in order to have their fidelity improvable by a local process, the bipartite states must violate the so-called reduction criterion of separability.

Dicty_cDB: SHA665 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

Dicty_cDB: CHE687 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

Dicty_cDB: CHK172 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHK172 (Link to dictyBase) - - - Contig-U11104-1 - (Link to Or...iginal site) CHK172F 626 - - - - - - Show CHK172 Library CH (Link to library) Clone ID CHK172 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11104-1 Original site URL http://dictycdb.b...HEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYTRASKAYIHLAQYDQAASII VRGLVFDPRN...KMDHEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYT

Dicty_cDB: CHA557 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHA557 (Link to dictyBase) - - - Contig-U15635-1 - (Link to Or...iginal site) CHA557F 620 - - - - - - Show CHA557 Library CH (Link to library) Clone ID CHA557 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15635-1 Original site URL http://dictycdb.b...HSIEIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGTGTDLPLL KWLEKYTFPVESKFKD...EIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGT

Dicty_cDB: SLA117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

Fidelity imaging for atomic force microscopy

Energy Technology Data Exchange (ETDEWEB)

Ghosal, Sayan, E-mail: ghos0087@umn.edu; Salapaka, Murti, E-mail: murtis@umn.edu [Nanodynamics Systems Laboratory, Department of Electrical and Computer Engineering, University of Minnesota, Minneapolis, Minnesota 55455 (United States)

2015-01-05

Atomic force microscopy is widely employed for imaging material at the nanoscale. However, real-time measures on image reliability are lacking in contemporary atomic force microscopy literature. In this article, we present a real-time technique that provides an image of fidelity for a high bandwidth dynamic mode imaging scheme. The fidelity images define channels that allow the user to have additional authority over the choice of decision threshold that facilitates where the emphasis is desired, on discovering most true features on the sample with the possible detection of high number of false features, or emphasizing minimizing instances of false detections. Simulation and experimental results demonstrate the effectiveness of fidelity imaging.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB882 (Link to dictyBase) - - - Contig-U13884-1 VFB882E (Link...) Clone ID VFB882 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13884-1 Ori... m_ : 1.00 48.0 %: cytoplasmic 44.0 %: nuclear 4.0 %: mitochondrial 4.0 %: peroxisomal >> predict

Refined mapping and YAC contig construction of the X-linked cleft palate and ankyloglossia locus (CPX) including the proximal X-Y homology breakpoint within Xq21.3

Energy Technology Data Exchange (ETDEWEB)

Forbes, S.A.; Brennan, L.; Richardson, M. [Queen Charlotte`s Hospital, London (United Kingdom)] [and others

1996-01-01

The gene for X-linked cleft palate (CPX) has previously been mapped in an Icelandic kindred between the unordered proximal markers DXS1002/DXS349/DXS95 and the distal marker DXYS1X, which maps to the proximal end of the X-Y homology region in Xq21.3. Using six sequence-tagged sites (STSs) within the region, a total of 91 yeast artificial chromosome (YAC) clones were isolated and overlapped in a single contig that spans approximately 3.1 Mb between DXS1002 and DXYS1X. The order of microsatellite and STS markers in this was established as DXS1002-DXS1168-DXS349-DXS95-DXS364-DXS1196-DXS472-DXS1217-DXYS1X. A long-range restriction map of this region was created using eight nonchimeric, overlapping YAC clones. Analysis of newly positioned polymorphic markers in recombinant individuals from the Icelandic family has enabled us to identify DXS1196 and DXS1217 as the flanking markers for CPX. The maximum physical distance containing the CPX gene has been estimated to be 2.0 Mb, which is spanned by a minimum set of five nonchimeric YAC clones. In addition, YAC end clone and STS analyses have pinpointed the location of the proximal boundary of the X-Y homology region within the map. 40 refs., 2 figs., 2 tabs.

Dicty_cDB: SSB171 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

Dicty_cDB: SSE149 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSE149 (Link to dictyBase) - - - Contig-U01658-1 | Contig-U165... library) Clone ID SSE149 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U016...58-1 | Contig-U16509-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 64 1e-17 2 AC100496...egans clone T13G4, complete sequence. 36 5.0 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus p

Dicty_cDB: SFH450 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFH450 (Link to dictyBase) - - - Contig-U13857-1 SFH450F (Link... to Original site) SFH450F 623 - - - - - - Show SFH450 Library SF (Link to library) Clone ID SFH450 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13857-1 Original site URL http://dict...IMIIFLCLEATFDQPYHSIGGFIIVCSGYQLGQGIAGGAFSGIIPDVVHPSQSGI ASGWLGVGFSLGLLIGTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICT...GTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICTMHEDSND EWSFDGSLPSFFKSLHLPSSIYFNFYWVLITRFFNTLGIYMIFSFLLYFATDIIGQTNLM T

Dicty_cDB: SFC488 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFC488 (Link to dictyBase) - - - Contig-U10843-1 SFC488F (Link... to Original site) SFC488F 556 - - - - - - Show SFC488 Library SF (Link to library) Clone ID SFC488 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...ETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLLLDPMVKLPLITRMRMAKD...yhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQAQ SASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICT

Dicty_cDB: CFH353 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH353 (Link to dictyBase) - - - Contig-U16205-1 CFH353Z (Link... to Original site) - - CFH353Z 625 - - - - Show CFH353 Library CF (Link to library) Clone ID CFH353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dict...RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIRVELKP...: ---RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIR

Dicty_cDB: SFF779 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF779 (Link to dictyBase) - - - Contig-U16255-1 SFF779Z (Link... to Original site) - - SFF779Z 731 - - - - Show SFF779 Library SF (Link to library) Clone ID SFF779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...NATCSSLNCNAQQMSCKYVXQACHETSCCPDIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLA...DIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSH

Dicty_cDB: SHL605 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHL605 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) SHL605F 632 - - - - - - Show SHL605 Library SH (Link to library) Clone ID SHL605 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...VDLIRGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQK LTYIQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICT...KRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL RPAFPKLREKLDDPE

Dicty_cDB: CHD753 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHD753 (Link to dictyBase) - - - Contig-U15579-1 - (Link to Or...iginal site) - - CHD753Z 650 - - - - Show CHD753 Library CH (Link to library) Clone ID CHD753 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dictycdb.b...---IQACGPDNNYQCEFVDKICNTTNDKCLVESCEIGFGCLAIPKNCNDNDPCTTDHCDP AIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICT...NPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVPPRPTP TPLPADPPPYDLEEGCLV

Dicty_cDB: SSA581 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

Dicty_cDB: SFI222 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT

Dicty_cDB: SLE232 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA

Dicty_cDB: VFJ144 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFJ144 (Link to dictyBase) - - - Contig-U12576-1 - (Link to Or...iginal site) - - VFJ144Z 698 - - - - Show VFJ144 Library VF (Link to library) Clone ID VFJ144 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dictycdb.b...IGIDDELGPQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Translated A...PQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Frame B: ---givrkyl*

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (

Dicty_cDB: VFH641 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFH641 (Link to dictyBase) - - - Contig-U16151-1 VFH641E (Link... Clone ID VFH641 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...nificant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum

Visual communication - Information and fidelity. [of images

Science.gov (United States)

Huck, Freidrich O.; Fales, Carl L.; Alter-Gartenberg, Rachel; Rahman, Zia-Ur; Reichenbach, Stephen E.

1993-01-01

This assessment of visual communication deals with image gathering, coding, and restoration as a whole rather than as separate and independent tasks. The approach focuses on two mathematical criteria, information and fidelity, and on their relationships to the entropy of the encoded data and to the visual quality of the restored image. Past applications of these criteria to the assessment of image coding and restoration have been limited to the link that connects the output of the image-gathering device to the input of the image-display device. By contrast, the approach presented in this paper explicitly includes the critical limiting factors that constrain image gathering and display. This extension leads to an end-to-end assessment theory of visual communication that combines optical design with digital processing.

Dicty_cDB: SHI867 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

Dicty_cDB: SSI339 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

Dicty_cDB: SHI777 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

Dicty_cDB: VHB478 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHB478 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHB478Z 556 - - - - Show VHB478 Library VH (Link to library) Clone ID VHB478 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...cid sequence ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITT...xxcxlf*trknp*kyfrkkmdsqqkrfxr*xfn*vhlsl sgxy Frame C: ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT

Dicty_cDB: SHL102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk

Dicty_cDB: CFG115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICTDNNDCTMDWCNQLTGECVYQ...ng significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC278 (Link to dictyBase) - - - Contig-U13504-1 VFC278E (Link... Clone ID VFC278 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13504-1 Original site URL http://dict...0.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for VFC278 is cyt 5' end seq. ID VFC278F 5' end se

Fidelity and Game-based Technology in Management Education

Directory of Open Access Journals (Sweden)

Edgard B. Cornacchione Jr.

2012-04-01

Full Text Available This study explores educational technology and management education by analyzing fidelity in game-basedmanagement education interventions. A sample of 31 MBA students was selected to help answer the researchquestion: To what extent do MBA students tend to recognize specific game-based academic experiences, interms of fidelity, as relevant to their managerial performance? Two distinct game-based interventions (BG1 andBG2 with key differences in fidelity levels were explored: BG1 presented higher physical and functional fidelitylevels and lower psychological fidelity levels. Hypotheses were tested with data from the participants, collectedshortly after their experiences, related to the overall perceived quality of game-based interventions. The findingsreveal a higher overall perception of quality towards BG1: (a better for testing strategies, (b offering betterbusiness and market models, (c based on a pace that better stimulates learning, and (d presenting a fidelity levelthat better supports real world performance. This study fosters the conclusion that MBA students tend torecognize, to a large extent, that specific game-based academic experiences are relevant and meaningful to theirmanagerial development, mostly with heightened fidelity levels of adopted artifacts. Agents must be ready andmotivated to explore the new, to try and err, and to learn collaboratively in order to perform.

Dicty_cDB: AFJ353 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFJ353 (Link to dictyBase) - - - Contig-U10972-1 AFJ353P (Link... to Original site) AFJ353F 592 AFJ353Z 580 AFJ353P 1172 - - Show AFJ353 Library AF (Link to library) Clone ID AFJ353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...SISTGLPNLSGGKINTNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICT...TNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICTHKVGCTVVNRCIDNANP

Dicty_cDB: SFA408 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFA408 (Link to dictyBase) - - - Contig-U10972-1 SFA408P (Link... to Original site) SFA408F 509 SFA408Z 686 SFA408P 1195 - - Show SFA408 Library SF (Link to library) Clone ID SFA408 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...YLSXDQVESIIASIKGKVIQLSKDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYVVQHL ...KDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYV

Dicty_cDB: SLG821 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLG821 (Link to dictyBase) - - - Contig-U15540-1 SLG821P (Link... to Original site) SLG821F 638 SLG821Z 554 SLG821P 1192 - - Show SLG821 Library SL (Link to library) Clone ID SLG821 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...MSPSSPICLPESPMGAQHWESGL--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT...*--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB866 (Link to dictyBase) - - - Contig-U16349-1 VFB866Z (Link... to Original site) - - VFB866Z 631 - - - - Show VFB866 Library VF (Link to library) Clone ID VFB866 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...ce ---SSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMP DMSQCANWTKMCSSSGQLYNSQITSDYCVASVADAVPIMRMYFH...RGCLHAIELTCSYALMLVAMTFNVALFFAV Translated Amino Acid sequence (All Frames) Frame A: ---SSVDSISNLPTTMQLFAGIKSICT

Dicty_cDB: VHL364 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHL364 (Link to dictyBase) - - - Contig-U16205-1 - (Link to Or...iginal site) - - VHL364Z 668 - - - - Show VHL364 Library VH (Link to library) Clone ID VHL364 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dictycdb.b...mino Acid sequence ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN GGDASTDGVQRDLLPIVEGCMVSTKYGQ...itwyh*tyrrgykf*lxys*r*nscfrysrh*ktfk Frame B: ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN G

Dicty_cDB: VHK472 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHK472 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHK472Z 392 - - - - Show VHK472 Library VH (Link to library) Clone ID VHK472 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b....10 Translated Amino Acid sequence ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT...wstlqlsnhirllcrlcc*rrsnhenvlshwylglypl*ilgtk n*psicwfmv Frame B: ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSP

Dicty_cDB: CFJ816 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS

Dicty_cDB: CFI686 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFI686 (Link to dictyBase) - - - Contig-U15579-1 CFI686P (Link... to Original site) CFI686F 185 CFI686Z 445 CFI686P 610 - - Show CFI686 Library CF (Link to library) Clone ID CFI686 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT PTVTPT...LVXXCXIGFGCXAIXKNCNXNDPXXXDXCDXXIGCYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT

Dicty_cDB: VHA365 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY

Dicty_cDB: VFF110 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv

Dicty_cDB: SLE110 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL

Dicty_cDB: SSB322 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E

Dicty_cDB: AHB126 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT

Dicty_cDB: VHC776 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHC776 (Link to dictyBase) - - - Contig-U15722-1 VHC776P (Link... to Original site) VHC776F 593 VHC776Z 895 VHC776P 1468 - - Show VHC776 Library VH (Link to library) Clone ID VHC776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...CDNNTGNCTCHNEXFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDN...XFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDNEHIGN GCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTK

Dicty_cDB: VHK477 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHK477 (Link to dictyBase) - - - Contig-U11536-1 VHK477P (Link... to Original site) VHK477F 685 VHK477Z 794 VHK477P 1459 - - Show VHK477 Library VH (Link to library) Clone ID VHK477 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11536-1 Original site URL http://dict...QIGTYSFEGKFIKKAIINGNRIVTINN KLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAI...NQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAIVIVSVVFVIILALFIIVKFSKS

Dicty_cDB: SFD793 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFD793 (Link to dictyBase) - - - Contig-U16255-1 SFD793P (Link... to Original site) SFD793F 660 SFD793Z 689 SFD793P 1349 - - Show SFD793 Library SF (Link to library) Clone ID SFD793 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATCSSLNCNAQQMSCKYVQQACHETSC CPDIPQCQIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTT...TGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTTGSHTTTGGSTTG

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Dicty_cDB: VHI141 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

Dicty_cDB: VFL117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT

Dicty_cDB: VHC263 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS

Dicty_cDB: VHO201 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

Dicty_cDB: AFI379 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFI379 (Link to dictyBase) - - - Contig-U08795-1 AFI379P (Link... to Original site) AFI379F 645 AFI379Z 836 AFI379P 1471 - - Show AFI379 Library AF (Link to library) Clone ID AFI379 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGL...KIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGLMSGKIMGEYL

Dicty_cDB: SFH459 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFH459 (Link to dictyBase) - - - Contig-U16336-1 SFH459P (Link... to Original site) SFH459F 606 SFH459Z 728 SFH459P 1334 - - Show SFH459 Library SF (Link to library) Clone ID SFH459 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...KTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKT...TVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTH

Dicty_cDB: CHR591 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHR591 (Link to dictyBase) - - - Contig-U11865-1 CHR591P (Link... to Original site) CHR591F 557 CHR591Z 706 CHR591P 1243 - - Show CHR591 Library CH (Link to library) Clone ID CHR591 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11865-1 Original site URL http://dict... IDPYEIQQNKQSNNSNSNSNRNLTPNSSSPTNQRKNKQEDDDDESKLDDESDLNERFQKV VLRFREFPSLDTNLYRLQEICT...DLNERFQKV VLRFREFPSLDTNLYRLQEICTDLLHISQDFIHTVKTYGRIIIEERYLKEKTIQSRSIGG H--- ---RK

Dicty_cDB: SFF125 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT

Dicty_cDB: VHL434 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHL434 (Link to dictyBase) - - - Contig-U16336-1 VHL434P (Link... to Original site) VHL434F 546 VHL434Z 778 VHL434P 1304 - - Show VHL434 Library VH (Link to library) Clone ID VHL434 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...EVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPES-- - --...GFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFL

Dicty_cDB: CHN802 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHN802 (Link to dictyBase) - - - Contig-U16336-1 CHN802P (Link... to Original site) CHN802F 543 CHN802Z 788 CHN802P 1311 - - Show CHN802 Library CH (Link to library) Clone ID CHN802 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...ASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL...NETKFINQCINEIKEELKGDMQKKTVAVQKLTY IQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICT

Dicty_cDB: SLA340 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLA340 (Link to dictyBase) - - - Contig-U16510-1 - (Link to Or...iginal site) - - SLA340Z 466 - - - - Show SLA340 Library SL (Link to library) Clone ID SLA340 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16510-1 Original site URL http://dictycdb.b.... 2 Translated Amino Acid sequence ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICTISICIIFICIICSNYS CNYNCNYSCNYN...qpqlqlqlqlqpqpqlqpqlqpq lplkfnqktffikyhynnffnnnsikk*y*kspffl Frame C: ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICT

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB713 (Link to dictyBase) - - - Contig-U16602-1 VFB713F (Link... to Original site) VFB713F 471 - - - - - - Show VFB713 Library VF (Link to library) Clone ID VFB713 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...ar 12.0 %: cytoplasmic 8.0 %: vacuolar 8.0 %: mitochondrial 8.0 %: endoplasmic reticulum >> predict

Dicty_cDB: AFN878 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFN878 (Link to dictyBase) - - - Contig-U15540-1 AFN878P (Link... to Original site) AFN878F 592 AFN878Z 531 AFN878P 1123 - - Show AFN878 Library AF (Link to library) Clone ID AFN878 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...D VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPLYFHFTLTNPLTNEVVLQSLINVNVK...YESYRIYIHPSLGYSGNAKRFKQQPD VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPL

Dicty_cDB: AFL122 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFL122 (Link to dictyBase) - - - Contig-U11144-1 AFL122P (Link... to Original site) AFL122F 837 AFL122Z 711 AFL122P 1538 - - Show AFL122 Library AF (Link to library) Clone ID AFL122 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11144-1 Original site URL http://dict...GPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICTIHQPRSNIYDM FDNLLLLGDGNTIYYGKANKALEYFNANGYHCSEKTNPADFFLDLINTQVEDQADSD...TLNFYAQLKMPRDVPLKEKLQRVQDIIDEMGLNRCADTLVGTADNKIRGISGGERR RVTISIELLTGPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICT

Dicty_cDB: VHH831 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHH831 (Link to dictyBase) - - - Contig-U15722-1 VHH831P (Link... to Original site) VHH831F 586 VHH831Z 930 VHH831P 1496 - - Show VHH831 Library VH (Link to library) Clone ID VHH831 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...HFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTKGLTCEESRLLIESLDSINS KGGTINIIGYFGNTT...STPNGTCDNNTGNCTCHNEHFGNG CEFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCST

Dicty_cDB: CFE262 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFE262 (Link to dictyBase) - - - Contig-U16368-1 CFE262P (Link... to Original site) CFE262F 652 CFE262Z 401 CFE262P 1053 - - Show CFE262 Library CF (Link to library) Clone ID CFE262 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...HRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIINGHPTCIRGDGYL...VNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIING

Dicty_cDB: VHJ417 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHJ417 (Link to dictyBase) - G23450 DDB0202154 Contig-U12507-1...brary) Clone ID VHJ417 (Link to dictyBase) Atlas ID - NBRP ID G23450 dictyBase ID DDB0202154 Link to Contig ...Contig-U12507-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHJ4-...LLSAVSDSSVQSLSSSI--- ---IDEIKQSVFGATAIIGQSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN...QSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN YQKDGSNNNNNNNNNNSNNSNSNSSSNNSGSNNSSNNNSPNNLTPKKQTFKSLSTSSSTP NNLSQ

Dicty_cDB: SHE695 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHE695 (Link to dictyBase) - G22060 DDB0217012 Contig-U12072-1...brary) Clone ID SHE695 (Link to dictyBase) Atlas ID - NBRP ID G22060 dictyBase ID DDB0217012 Link to Contig ...Contig-U12072-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHE6-...CPISDCSDHGYCDTSIGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMN...IGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMNFVSCPTPNRSVCSGWGTCNNQTGICT

Dicty_cDB: SLB394 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLB394 (Link to dictyBase) - G24120 DDB0184167BP Contig-U13982... (Link to library) Clone ID SLB394 (Link to dictyBase) Atlas ID - NBRP ID G24120 dictyBase ID DDB0184167BP L...ink to Contig Contig-U13982-1 Original site URL http://dictycdb.biol.tsukuba.ac.j...2 Translated Amino Acid sequence TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT...e B: TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT

Dicty_cDB: SHF448 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHF448 (Link to dictyBase) - - - Contig-U11503-1 SHF448E (Link...) Clone ID SHF448 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...quence qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKD...mnvnlkimrigltqlxisyrfy Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAV...nts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX

Dicty_cDB: SFC123 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

Fidelity and game-based technology in management education

OpenAIRE

Cornacchione Jr.,Edgard B.

2012-01-01

This study explores educational technology and management education by analyzing fidelity in game-based management education interventions. A sample of 31 MBA students was selected to help answer the research question: To what extent do MBA students tend to recognize specific game-based academic experiences, in terms of fidelity, as relevant to their managerial performance? Two distinct game-based interventions (BG1 and BG2) with key differences in fidelity levels were explored: BG1 presented...

Dicty_cDB: FC-BR21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BR21 (Link to dictyBase) - - - Contig-U15384-1 | Contig-U16443-1 FC-BR2...1P (Link to Original site) FC-BR21F 551 FC-BR21Z 122 FC-BR21P 673 - - Show FC-BR21 Library FC (L...ink to library) Clone ID FC-BR21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Cont...ig-U15384-1 | Contig-U16443-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR2...1Q.Seq.d/ Representative seq. ID FC-BR21P (Link to Original site) Representative DNA sequence >FC-BR21 (FC-BR2

Dicty_cDB: FC-AI07 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

Dicty_cDB: FC-AI22 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

An empirical study of multidimensional fidelity of COMPASS consultation.

Science.gov (United States)

Wong, Venus; Ruble, Lisa A; McGrew, John H; Yu, Yue

2018-06-01

Consultation is essential to the daily practice of school psychologists (National Association of School Psychologist, 2010). Successful consultation requires fidelity at both the consultant (implementation) and consultee (intervention) levels. We applied a multidimensional, multilevel conception of fidelity (Dunst, Trivette, & Raab, 2013) to a consultative intervention called the Collaborative Model for Promoting Competence and Success (COMPASS) for students with autism. The study provided 3 main findings. First, multidimensional, multilevel fidelity is a stable construct and increases over time with consultation support. Second, mediation analyses revealed that implementation-level fidelity components had distant, indirect effects on student Individualized Education Program (IEP) outcomes. Third, 3 fidelity components correlated with IEP outcomes: teacher coaching responsiveness at the implementation level, and teacher quality of delivery and student responsiveness at the intervention levels. Implications and future directions are discussed. (PsycINFO Database Record (c) 2018 APA, all rights reserved).

Dicty_cDB: CHA851 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHA851 (Link to dictyBase) - - - Contig-U16368-1 - (Link to Or...iginal site) CHA851F 614 - - - - - - Show CHA851 Library CH (Link to library) Clone ID CHA851 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dictycdb.b...TCCXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT...nly*skttgttttllnlcraiism*srwn dlysstkqlyqy*ipmlpis--- Frame C: VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT

Dicty_cDB: SFF103 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT

Dicty_cDB: VHA622 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHA622 (Link to dictyBase) - - - Contig-U15767-1 VHA622P (Link... to Original site) VHA622F 458 VHA622Z 778 VHA622P 1216 - - Show VHA622 Library VH (Link to library) Clone ID VHA622 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...HVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLP QGNCSNTPVDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTCQPSTGQCEYSD...qisnqkmrenlf*lrelsnqilikkkefqf*ivwmpmil*ik rqelvgqmvlsiflxitklviqnlpnlvk--- ---ACNEDEKXITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICT

Dicty_cDB: CHF177 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHF177 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - CHF177Z 395 - - - - Show CHF177 Library CH (Link to library) Clone ID CHF177 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...LLLWDVQGFPCXFAVEG GQCIDPSSLKVGGKYSFIAFSTCRXKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Translated Amino A...XKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Homology vs CSM-cDNA Score E Sequences producing significant

Dicty_cDB: AFF341 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFF341 (Link to dictyBase) - - - Contig-U15579-1 AFF341P (Link... to Original site) AFF341F 158 AFF341Z 283 AFF341P 441 - - Show AFF341 Library AF (Link to library) Clone ID AFF341 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...GCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICTPTPSVTPTVTPXVTXTVT Translated Amino Aci...*fliikkk--- ---DHCDPAIGCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICT

Dicty_cDB: CFF487 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFF487 (Link to dictyBase) - - - Contig-U15579-1 CFF487P (Link... to Original site) CFF487F 143 CFF487Z 518 CFF487P 661 - - Show CFF487 Library CF (Link to library) Clone ID CFF487 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTV Translated Amino A...ESCEIGFGCLAIPKNCNDNDPCTTDHCD PAIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTP

Dicty_cDB: CHI134 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

Dicty_cDB: VFM148 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB590 (Link to dictyBase) - - - Contig-U09552-1 VFB590P (Link... to Original site) VFB590F 225 VFB590Z 118 VFB590P 343 - - Show VFB590 Library VF (Link to library) Clone ID VFB590 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Original site URL http://dict...ed Amino Acid sequence IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEEXKT...--- ---riyqinkvvmxhxlhn*lxvaxivxlgxvnvkihvexix Frame C: IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT

Dicty_cDB: CHC113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

Dicty_cDB: VHP253 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD

Dicty_cDB: VHP243 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

Dicty_cDB: AFA460 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFA460 (Link to dictyBase) - - - Contig-U15574-1 AFA460Z (Link... to Original site) - - AFA460Z 170 - - - - Show AFA460 Library AF (Link to library) Clone ID AFA460 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...date 2001. 6. 2 Translated Amino Acid sequence ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK T...it* Frame B: ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK Frame C:

Dicty_cDB: VHM522 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHM522 (Link to dictyBase) - - - Contig-U15767-1 VHM522P (Link... to Original site) VHM522F 575 VHM522Z 747 VHM522P 1302 - - Show VHM522 Library VH (Link to library) Clone ID VHM522 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...PV--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTC...rtrf q*cklss--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCE

Dicty_cDB: VHE138 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

Dicty_cDB: VHD652 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHD652 (Link to dictyBase) - - - Contig-U15722-1 VHD652P (Link... to Original site) VHD652F 573 VHD652Z 707 VHD652P 1260 - - Show VHD652 Library VH (Link to library) Clone ID VHD652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...NYTIPCGSNSNNVLCGSYHSTVPRKYLSLGFVNGSTHSYSKDGLMITYISQDTTNDNDC KRYTTNV--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT...i*vlflql viilflvvvivimycvdhiiqlfhasifhwdllmavhiviaktd***hiyhriqqmimia kdiqqm*--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB603 (Link to dictyBase) - - - Contig-U16505-1 VFB603Z (Link... to Original site) - - VFB603Z 496 - - - - Show VFB603 Library VF (Link to library) Clone ID VFB603 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16505-1 Original site URL http://dict...al 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VF

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC221 (Link to dictyBase) - - - Contig-U09438-1 VFC221Z (Link... to Original site) - - VFC221Z 496 - - - - Show VFC221 Library VF (Link to library) Clone ID VFC221 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09438-1 Original site URL http://dict... mitochondrial 8.0 %: peroxisomal 4.0 %: cytoskeletal 4.0 %: Golgi >> prediction for VFC221 is cyt 5' end se

Dicty_cDB: VHL663 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHL663 (Link to dictyBase) - - - Contig-U15767-1 VHL663P (Link... to Original site) VHL663F 574 VHL663Z 702 VHL663P 1256 - - Show VHL663 Library VH (Link to library) Clone ID VHL663 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...WPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQG FNDVSYPV--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQG...ik rqelvgqmvlsifl*itklviqnlpnlvkifqfkeiss*igmekhmniviqitsqltdkv smm*aiq--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGI

Dicty_cDB: SFH236 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB676 (Link to dictyBase) - - - Contig-U12091-1 VFB676E (Link...) Clone ID VFB676 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12091-1 Ori...NA, complete cds. 2155 0.0 1 U66525 |U66525.1 Dictyostelium discoideum ORFveg114 ...toplasmic 16.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VF

Entanglement-fidelity relations for inaccurate ancilla-driven quantum computation

International Nuclear Information System (INIS)

Morimae, Tomoyuki; Kahn, Jonas

2010-01-01

It was shown by T. Morimae [Phys. Rev. A 81, 060307(R) (2010)] that the gate fidelity of an inaccurate one-way quantum computation is upper bounded by a decreasing function of the amount of entanglement in the register. This means that a strong entanglement causes the low gate fidelity in the one-way quantum computation with inaccurate measurements. In this paper, we derive similar entanglement-fidelity relations for the inaccurate ancilla-driven quantum computation. These relations again imply that a strong entanglement in the register causes the low gate fidelity in the ancilla-driven quantum computation if the measurements on the ancilla are inaccurate.

Dicty_cDB: SHI251 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

Dicty_cDB: SLJ344 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLJ344 (Link to dictyBase) - - - Contig-U16255-1 SLJ344P (Link... to Original site) SLJ344F 253 SLJ344Z 273 SLJ344P 526 - - Show SLJ344 Library SL (Link to library) Clone ID SLJ344 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...Amino Acid sequence GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT TGGSTTGSHTTTGGSTTGSHTTTG---...li tilffniqrlykkkkkkkkkknkp*tklkin*kk Frame B: GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT

Dicty_cDB: SFC534 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFC534 (Link to dictyBase) - - - Contig-U15579-1 SFC534P (Link... to Original site) SFC534F 158 SFC534Z 334 SFC534P 492 - - Show SFC534 Library SF (Link to library) Clone ID SFC534 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...fiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT...lfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT

Dicty_cDB: VHH756 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHH756 (Link to dictyBase) - - - Contig-U15767-1 VHH756P (Link... to Original site) VHH756F 658 VHH756Z 686 VHH756P 1324 - - Show VHH756 Library VH (Link to library) Clone ID VHH756 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...YEYSNSNYFPINGQGF NDVSYPVPRGYVPISGESWTSMSTSTSLKGNNYNFC--- ---DSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCGANDEDKCKTW...*psw*fricqiw*kssnskryrvklewrsi*i**fkllpn*rtrfq *cklssskrlctnfwrildinvnfnfikg**l*fl--- ---DSSLCNDNNICTIDICVHE

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB760 (Link to dictyBase) - - - Contig-U12286-1 VFB760P (Link... to Original site) VFB760F 474 VFB760Z 691 VFB760P 1165 - - Show VFB760 Library VF (Link to library) Clone ID VFB760 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12286-1 Original site URL http://dict...CCACTTAATTCCAGAAGG sequence update 2001. 6. 1 Translated Amino Acid sequence LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICT...cmfllqsfxnplnsrr Frame C: LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICTDS

Dicty_cDB: VSK196 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSK196 (Link to dictyBase) - - - Contig-U10274-1 VSK196P (Link... to Original site) VSK196F 423 VSK196Z 453 VSK196P 876 - - Show VSK196 Library VS (Link to library) Clone ID VSK196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10274-1 Original site URL http://dict...TTATNAACAATTAAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence kdgklvslkdfikdqkpivlyfypkdetsict...*NKIX--- ---KLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKY QKFIEAGADVI

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB670 (Link to dictyBase) - - - Contig-U16447-1 VFB670Z (Link... to Original site) - - VFB670Z 541 - - - - Show VFB670 Library VF (Link to library) Clone ID VFB670 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16447-1 Original site URL http://dict... 0.00 m_ : 1.00 44.0 %: nuclear 28.0 %: cytoplasmic 16.0 %: cytoskeletal 8.0 %: peroxisomal 4.0 %: mitochondrial >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB779 (Link to dictyBase) - - - Contig-U15331-1 VFB779P (Link... to Original site) VFB779F 328 VFB779Z 402 VFB779P 730 - - Show VFB779 Library VF (Link to library) Clone ID VFB779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15331-1 Original site URL http://dict...cuolar 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB779 i

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB893 (Link to dictyBase) - - - Contig-U15009-1 VFB893P (Link... to Original site) VFB893F 337 VFB893Z 727 VFB893P 1064 - - Show VFB893 Library VF (Link to library) Clone ID VFB893 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15009-1 Original site URL http://dict... 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFB893

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB615 (Link to dictyBase) - - - Contig-U16602-1 VFB615F (Link... to Original site) VFB615F 636 - - - - - - Show VFB615 Library VF (Link to library) Clone ID VFB615 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB615 is cyt 5' end seq. ID VFB615F

Route Fidelity during Marine Megafauna Migration

Directory of Open Access Journals (Sweden)

Travis W. Horton

2017-12-01

Full Text Available The conservation and protection of marine megafauna require robust knowledge of where and when animals are located. Yet, our ability to predict animal distributions in space and time remains limited due to difficulties associated with studying elusive animals with large home ranges. The widespread deployment of satellite telemetry technology creates unprecedented opportunities to remotely monitor animal movements and to analyse the spatial and temporal trajectories of these movements from a variety of geophysical perspectives. Reproducible patterns in movement trajectories can help elucidate the potential mechanisms by which marine megafauna navigate across vast expanses of open-ocean. Here, we present an empirical analysis of humpback whale (Megaptera novaeangliae, great white shark (Carcharodon carcharias, and northern elephant seal (Mirounga angustirostris satellite telemetry-derived route fidelity movements in magnetic and gravitational coordinates. Our analyses demonstrate that: (1 humpback whales, great white sharks and northern elephant seals are capable of performing route fidelity movements across millions of square kilometers of open ocean with a spatial accuracy of better than 150 km despite temporal separations as long as 7 years between individual movements; (2 route fidelity movements include significant (p < 0.05 periodicities that are comparable in duration to the lunar cycles and semi-cycles; (3 latitude and bedrock-dependent gravitational cues are stronger predictors of route fidelity movements than spherical magnetic coordinate cues when analyzed with respect to the temporally dependent moon illumination cycle. We further show that both route fidelity and non-route fidelity movement trajectories, for all three species, describe overlapping in-phase or antiphase sinusoids when individual movements are normalized to the gravitational acceleration present at migratory departure sites. Although these empirical results provide an

Dicty_cDB: FC-AJ15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB533 (Link to dictyBase) - G02515 DDB0218082 Contig-U10369-1...brary) Clone ID VFB533 (Link to dictyBase) Atlas ID - NBRP ID G02515 dictyBase ID DDB0218082 Link to Contig ...Contig-U10369-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB5-... %: cytoskeletal 4.0 %: extracellular, including cell wall 4.0 %: peroxisomal >> predict

Dicty_cDB: VFJ256 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFJ256 (Link to dictyBase) - - - Contig-U10140-1 VFJ256E (Link...) Clone ID VFJ256 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10140-1 Ori...*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICTDLCLC AYTDHGHCGVLTEEGFIENEKSIIRLG...iiikiih iiyivdmpiqlldhgkvimsf*nln*fiqfllqi*liqklklnpyqdnikfqvi**lnf* dhwlrkd*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICT...pdate 2002.12.18 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ432755 ) Dict

Dicty_cDB: SFE109 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFE109 (Link to dictyBase) - - - Contig-U10771-1 SFE109P (Link... to Original site) SFE109F 197 SFE109Z 630 SFE109P 827 - - Show SFE109 Library SF (Link to library) Clone ID SFE109 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10771-1 Original site URL http://dict...anslated Amino Acid sequence elnykfhftlnttqiei*inknfllflf*fffyfqi*iqlcfilkllllptiink*INKI FLKKK--- ---VTTSQCESLIQAGVDGLRVGMGVGSICT...fkfnsvsy*nyyyyqpslink*ik ff*kk--- ---VTTSQCESLIQAGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSSQYNVPI IADGGIRTIGHII

Dicty_cDB: SFL482 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFL482 (Link to dictyBase) - - - Contig-U15494-1 SFL482P (Link... to Original site) SFL482F 434 SFL482Z 394 SFL482P 828 - - Show SFL482 Library SF (Link to library) Clone ID SFL482 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15494-1 Original site URL http://dict...cftclww*qmcqmcp*qnrscfln*rtknr*nclqeatkrfkt ker*EIIQINVVININHFLLIKKK--- ---ICTHIEKMVQRLTYRRRLSYRTTSNATKIVKTP...KQQK DLKQKKDKKSSK*m Translated Amino Acid sequence (All Frames) Frame A: icthiekmvqrltyrrrlsyrttsnatkivktpgg

Dicty_cDB: SSL592 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSL592 (Link to dictyBase) - - - Contig-U14332-1 SSL592E (Link... to Original site) - - - - - - SSL592E 244 Show SSL592 Library SS (Link to library) Clone ID SSL592 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14332-1 Original site URL http://dict...ence niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k Translated Amino Acid...kqncitl*ikkinllkk Frame C: niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k

Dicty_cDB: CHN208 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHN208 (Link to dictyBase) - - - Contig-U11696-1 - (Link to Or...iginal site) CHN208F 157 - - - - - - Show CHN208 Library CH (Link to library) Clone ID CHN208 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dictycdb.b...ces producing significant alignments: (bits) Value N AC149612 |AC149612.1 Ictalurus punctatus clone CH212-98...nuclear 20.0 %: mitochondrial 8.0 %: vacuolar 4.0 %: peroxisomal >> prediction fo

Dicty_cDB: SLH678 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLH678 (Link to dictyBase) - - - Contig-U04159-1 SLH678E (Link... to Original site) - - - - - - SLH678E 373 Show SLH678 Library SL (Link to library) Clone ID SLH678 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04159-1 Original site URL http://dict... producing significant alignments: (bits) Value N ( AU039970 ) Dictyostelium discoideum slug cDNA, clone SLG...865. 323 e-129 2 ( AU039381 ) Dictyostelium discoideum slug cDNA, clone SLH678. 3

Dicty_cDB: VHA386 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHA386 (Link to dictyBase) - - - Contig-U11201-1 - (Link to Or...iginal site) - - VHA386Z 730 - - - - Show VHA386 Library VH (Link to library) Clone ID VHA386 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11201-1 Original site URL http://dictycdb.b...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08646 |L08646.1 Dict...19 1 CX835130 |AF255664_1 major vault protein [Ictalurus punctatus], mRNA sequenc

Dicty_cDB: SLD420 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLD420 (Link to dictyBase) - - - Contig-U16325-1 SLD420E (Link... to Original site) - - - - - - SLD420E 434 Show SLD420 Library SL (Link to library) Clone ID SLD420 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict... 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AF066071 ) Dict...yostelium discoideum SP85 (pspB) gene, comple... 860 0.0 1 ( AC117075 ) Dictyostelium

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB689 (Link to dictyBase) - - - Contig-U16603-1 VFB689P (Link... to Original site) VFB689F 476 VFB689Z 663 VFB689P 1139 - - Show VFB689 Library VF (Link to library) Clone ID VFB689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...mbrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB689 is cyt 5' end seq. ID

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB551 (Link to dictyBase) - - - Contig-U16449-1 VFB551P (Link... to Original site) VFB551F 194 VFB551Z 178 VFB551P 372 - - Show VFB551 Library VF (Link to library) Clone ID VFB551 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16449-1 Original site URL http://dict...0 %: cytoplasmic 16.0 %: cytoskeletal 12.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB490 (Link to dictyBase) - - - Contig-U16603-1 VFB490P (Link... to Original site) VFB490F 588 VFB490Z 683 VFB490P 1271 - - Show VFB490 Library VF (Link to library) Clone ID VFB490 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB838 (Link to dictyBase) - - - Contig-U14973-1 VFB838P (Link... to Original site) VFB838F 562 VFB838Z 443 VFB838P 1005 - - Show VFB838 Library VF (Link to library) Clone ID VFB838 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14973-1 Original site URL http://dict...plasmic 12.0 %: Golgi 12.0 %: nuclear 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB585 (Link to dictyBase) - - - Contig-U09875-1 VFB585Z (Link... to Original site) - - VFB585Z 664 - - - - Show VFB585 Library VF (Link to library) Clone ID VFB585 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09875-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N AC116551 |AC116551.2 Dictyostelium discoi...ces producing significant alignments: (bits) Value AC116551_43( AC116551 |pid:none) Dictyostelium discoideum

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB625 (Link to dictyBase) - - - Contig-U13825-1 VFB625P (Link... to Original site) VFB625F 492 VFB625Z 685 VFB625P 1177 - - Show VFB625 Library VF (Link to library) Clone ID VFB625 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13825-1 Original site URL http://dict... %: cytoplasmic 16.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for VFB625 is mit 5

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB742 (Link to dictyBase) - - - Contig-U14919-1 VFB742P (Link... to Original site) VFB742F 590 VFB742Z 468 VFB742P 1058 - - Show VFB742 Library VF (Link to library) Clone ID VFB742 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14919-1 Original site URL http://dict...mbrane 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB742 is cyt 5' end seq. ID VFB742

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB817 (Link to dictyBase) - - - Contig-U16229-1 VFB817P (Link... to Original site) VFB817F 504 VFB817Z 193 VFB817P 697 - - Show VFB817 Library VF (Link to library) Clone ID VFB817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16229-1 Original site URL http://dict...%: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB817 is cyt 5' end seq. ID VFB817F 5' end se

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB720 (Link to dictyBase) - - - Contig-U16603-1 VFB720P (Link... to Original site) VFB720F 521 VFB720Z 353 VFB720P 874 - - Show VFB720 Library VF (Link to library) Clone ID VFB720 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: cytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFB720 is nuc 5' end se

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB644 (Link to dictyBase) - - - Contig-U10683-1 VFB644F (Link... to Original site) VFB644F 519 - - - - - - Show VFB644 Library VF (Link to library) Clone ID VFB644 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10683-1 Original site URL http://dict...7 9 AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-407176... %: nuclear 8.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB868 (Link to dictyBase) - - - Contig-U15649-1 VFB868F (Link... to Original site) VFB868F 110 - - - - - - Show VFB868 Library VF (Link to library) Clone ID VFB868 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15649-1 Original site URL http://dict...c 4.0 %: cytoskeletal >> prediction for VFB868 is nuc 5' end seq. ID VFB868F 5' end seq. >VFB868F.Seq TATTAA

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB804 (Link to dictyBase) - - - Contig-U13849-1 VFB804P (Link... to Original site) VFB804F 150 VFB804Z 637 VFB804P 787 - - Show VFB804 Library VF (Link to library) Clone ID VFB804 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13849-1 Original site URL http://dict... nuclear 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: plasma membrane 4.0 %: vesicles of secretory system >> predict

Fidelity approach in topological superconductors with disorders

Energy Technology Data Exchange (ETDEWEB)

Tian, Wen-Chuan; Huang, Guang-Yao; Wang, Zhi, E-mail: physicswangzhi@gmail.com; Yao, Dao-Xin, E-mail: yaodaox@mail.sysu.edu.cn

2015-03-20

We apply the fidelity approach to study the topological superconductivity in spin–orbit coupling nanowire system. The wire is modeled as a one layer lattice chain with Zeeman energy and spin–orbit coupling, which is in proximity to a multi-layer superconductor. In particular, we study the effects of disorders and find that the fidelity susceptibility has multiple peaks. It is revealed that one peak indicates the topological quantum phase transition, while other peaks are signaling the pinning of the Majorana bound states by disorders. - Highlights: • We introduce fidelity approach to study the topological superconducting nanowire with disorders. • We study the quantum phase transition in the wire. • We investigate the disorder pinning of the Majorana bound states in the wire.

Fidelity approach in topological superconductors with disorders

International Nuclear Information System (INIS)

Tian, Wen-Chuan; Huang, Guang-Yao; Wang, Zhi; Yao, Dao-Xin

2015-01-01

We apply the fidelity approach to study the topological superconductivity in spin–orbit coupling nanowire system. The wire is modeled as a one layer lattice chain with Zeeman energy and spin–orbit coupling, which is in proximity to a multi-layer superconductor. In particular, we study the effects of disorders and find that the fidelity susceptibility has multiple peaks. It is revealed that one peak indicates the topological quantum phase transition, while other peaks are signaling the pinning of the Majorana bound states by disorders. - Highlights: • We introduce fidelity approach to study the topological superconducting nanowire with disorders. • We study the quantum phase transition in the wire. • We investigate the disorder pinning of the Majorana bound states in the wire

Unified universal quantum cloning machine and fidelities

Energy Technology Data Exchange (ETDEWEB)

Wang Yinan; Shi Handuo; Xiong Zhaoxi; Jing Li; Mu Liangzhu [School of Physics, Peking University, Beijing 100871 (China); Ren Xijun [School of Physics and Electronics, Henan University, Kaifeng 4750011 (China); Fan Heng [Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China)

2011-09-15

We present a unified universal quantum cloning machine, which combines several different existing universal cloning machines together, including the asymmetric case. In this unified framework, the identical pure states are projected equally into each copy initially constituted by input and one half of the maximally entangled states. We show explicitly that the output states of those universal cloning machines are the same. One importance of this unified cloning machine is that the cloning procession is always the symmetric projection, which reduces dramatically the difficulties for implementation. Also, it is found that this unified cloning machine can be directly modified to the general asymmetric case. Besides the global fidelity and the single-copy fidelity, we also present all possible arbitrary-copy fidelities.

Adherence to hand hygiene guidelines - significance of measuring fidelity.

Science.gov (United States)

Korhonen, Anne; Ojanperä, Helena; Puhto, Teija; Järvinen, Raija; Kejonen, Pirjo; Holopainen, Arja

2015-11-01

The aim was to evaluate the usability of fidelity measures in compliance evaluation of hand hygiene. Adherence to hand hygiene guidelines is important in terms of patient safety. Compliance measures seldom describe how exactly the guidelines are followed. A cross-sectional observation study in a university hospital setting was conducted. Direct observation by trained staff was performed using a standardised observation form supplemented by fidelity criteria. A total of 830 occasions were observed in 13 units. Descriptive statistics (frequency, mean, percentages and range) were used as well as compliance rate by using a standard web-based tool. In addition, the binomial standard normal deviate test was conducted for comparing different methods used in evaluation of hand hygiene and in comparison between professional groups. Measuring fidelity to guidelines was revealed to be useful in uncovering gaps in hand hygiene practices. The main gap related to too short duration of hand rubbing. Thus, although compliance with hand hygiene guidelines measured using a standard web-based tool was satisfactory, the degree of how exactly the guidelines were followed seemed to be critical. Combining the measurement of fidelity to guidelines with the compliance rate is beneficial in revealing inconsistency between optimal and actual hand hygiene behaviour. Evaluating fidelity measures is useful in terms of revealing the gaps between optimal and actual performance in hand hygiene. Fidelity measures are suitable in different healthcare contexts and easy to measure according to the relevant indicators of fidelity, such as the length of hand rubbing. Knowing the gap facilitates improvements in clinical practice. © 2015 John Wiley & Sons Ltd.

Ground-state fidelity in the BCS-BEC crossover

International Nuclear Information System (INIS)

Khan, Ayan; Pieri, Pierbiagio

2009-01-01

The ground-state fidelity has been introduced recently as a tool to investigate quantum phase transitions. Here, we apply this concept in the context of a crossover problem. Specifically, we calculate the fidelity susceptibility for the BCS ground-state wave function, when the intensity of the fermionic attraction is varied from weak to strong in an interacting Fermi system, through the BCS-Bose-Einstein Condensation crossover. Results are presented for contact and finite-range attractive potentials and for both continuum and lattice models. We conclude that the fidelity susceptibility can be useful also in the context of crossover problems.

Dicty_cDB: AFJ513 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFJ513 (Link to dictyBase) - G20675 DDB0218542 Contig-U10004-1...brary) Clone ID AFJ513 (Link to dictyBase) Atlas ID - NBRP ID G20675 dictyBase ID DDB0218542 Link to Contig ...Contig-U10004-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFJ5-...LLVNLVV VNDSGDIEPDTIIPLVDG--- ---SCFECSLXAFPPQVSYAICTIANTPRVPEHCIQWALLFGLQDATLEKPFDPKQFDND NPDHMNWLFECAKKRAE...r*r*rll*ti*ncycrfrfnrskkmd*wfis*fsc ck**w*y*trynhsig*ww--- ---SCFECSLXAFPPQVSYAICT

Dicty_cDB: SHD573 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHD573 (Link to dictyBase) - - - Contig-U11503-1 SHD573E (Link...Clone ID SHD573 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...LFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGALWITSENINNENN NYTI...ststtts ax***d*eyyhcysyfgldl Frame C: fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKD...vegicus clone CH230-428C17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 48 3e-12 3 AC116984 |AC116984.2 Dict

Multi-infill strategy for kriging models used in variable fidelity optimization

Directory of Open Access Journals (Sweden)

Chao SONG

2018-03-01

Full Text Available In this paper, a computationally efficient optimization method for aerodynamic design has been developed. The low-fidelity model and the multi-infill strategy are utilized in this approach. Low-fidelity data is employed to provide a good global trend for model prediction, and multiple sample points chosen by different infill criteria in each updating cycle are used to enhance the exploitation and exploration ability of the optimization approach. Take the advantages of low-fidelity model and the multi-infill strategy, and no initial sample for the high-fidelity model is needed. This approach is applied to an airfoil design case and a high-dimensional wing design case. It saves a large number of high-fidelity function evaluations for initial model construction. What’s more, faster reduction of an aerodynamic function is achieved, when compared to ordinary kriging using the multi-infill strategy and variable-fidelity model using single infill criterion. The results indicate that the developed approach has a promising application to efficient aerodynamic design when high-fidelity analyses are involved. Keywords: Aerodynamics, Infill criteria, Kriging models, Multi-infill, Optimization

Dicty_cDB: SHA393 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

Dicty_cDB: VSK446 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSK446 (Link to dictyBase) - - - Contig-U15105-1 VSK446E (Link... Clone ID VSK446 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict... r... 269 4e-71 AF402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 269 4e-71 FJ196315_1( ....00 84.0 %: cytoplasmic 12.0 %: mitochondrial 4.0 %: nuclear >> prediction for VSK446 is cyt 5' end seq. ID

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB593 (Link to dictyBase) - - - Contig-U02438-1 VFB593E (Link...) Clone ID VFB593 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02438-1 Ori...0.009 6 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25...sequence. 46 0.031 2 AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 m...ap 4657875-4914984 strain AX4, complete sequence. 34 0.051 14 AC116960 |AC116960.2 Dictyostelium discoideum

Entanglement fidelity of the standard quantum teleportation channel

Energy Technology Data Exchange (ETDEWEB)

Li, Gang; Ye, Ming-Yong, E-mail: myye@fjnu.edu.cn; Lin, Xiu-Min

2013-09-16

We consider the standard quantum teleportation protocol where a general bipartite state is used as entanglement resource. We use the entanglement fidelity to describe how well the standard quantum teleportation channel transmits quantum entanglement and give a simple expression for the entanglement fidelity when it is averaged on all input states.

Commentary: Learning from Variations in Fidelity of Implementation

Science.gov (United States)

Balu, Rekha; Doolittle, Fred

2016-01-01

The articles in this special issue discuss efforts to improve academic reading outcomes for students and ways to achieve high implementation fidelity of promising strategies. At times the authors discuss if--and how--strong fidelity is associated with strong outcomes and potentially even impacts (the difference between program and control group…

Fidelity induced distance measures for quantum states

International Nuclear Information System (INIS)

Ma Zhihao; Zhang Fulin; Chen Jingling

2009-01-01

Fidelity plays an important role in quantum information theory. In this Letter, we introduce new metric of quantum states induced by fidelity, and connect it with the well-known trace metric, Sine metric and Bures metric for the qubit case. The metric character is also presented for the qudit (i.e., d-dimensional system) case. The CPT contractive property and joint convex property of the metric are also studied.

Asymmetric strand segregation: epigenetic costs of genetic fidelity?

Directory of Open Access Journals (Sweden)

Diane P Genereux

2009-06-01

Full Text Available Asymmetric strand segregation has been proposed as a mechanism to minimize effective mutation rates in epithelial tissues. Under asymmetric strand segregation, the double-stranded molecule that contains the oldest DNA strand is preferentially targeted to the somatic stem cell after each round of DNA replication. This oldest DNA strand is expected to have fewer errors than younger strands because some of the errors that arise on daughter strands during their synthesis fail to be repaired. Empirical findings suggest the possibility of asymmetric strand segregation in a subset of mammalian cell lineages, indicating that it may indeed function to increase genetic fidelity. However, the implications of asymmetric strand segregation for the fidelity of epigenetic information remain unexplored. Here, I explore the impact of strand-segregation dynamics on epigenetic fidelity using a mathematical-modelling approach that draws on the known molecular mechanisms of DNA methylation and existing rate estimates from empirical methylation data. I find that, for a wide range of starting methylation densities, asymmetric -- but not symmetric -- strand segregation leads to systematic increases in methylation levels if parent strands are subject to de novo methylation events. I found that epigenetic fidelity can be compromised when enhanced genetic fidelity is achieved through asymmetric strand segregation. Strand segregation dynamics could thus explain the increased DNA methylation densities that are observed in structured cellular populations during aging and in disease.

Dicty_cDB: SSB721 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB721 (Link to dictyBase) ssb721 G20804 DDB0230090 Contig-U04...594-1 SSB721E (Link to Original site) - - - - - - SSB721E 549 Show SSB721 Library SS (Link to library) Clone ID SSB721 (Link to dict...yBase) Atlas ID ssb721 NBRP ID G20804 dictyBase ID DDB0230090 Link to Contig Contig-...U04594-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSB7-A/SSB72...quence update 1997.11.25 Translated Amino Acid sequence NDINSIVCKANSQCPTSHICTSSNKCIIKYSSKVGEKCTDSPLQCRVFNGEI

Dicty_cDB: SLG865 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLG865 (Link to dictyBase) - G22488 DDB0184443 Contig-U04159-1... SLG865E (Link to Original site) - - - - - - SLG865E 373 Show SLG865 Library SL (Link to library) Clone ID SLG865 (Link to dict...yBase) Atlas ID - NBRP ID G22488 dictyBase ID DDB0184443 Link to Contig Contig-U04159-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLG8-C/SLG865Q.Seq.d/ ...quence update 1998. 6.28 Translated Amino Acid sequence KAQLETDLKNICTLVPSNITMECKF

Dicty_cDB: VFB113 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

Dicty_cDB: CFE213 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFE213 (Link to dictyBase) - - - Contig-U16381-1 CFE213F (Link... to Original site) CFE213F 111 - - - - - - Show CFE213 Library CF (Link to library) Clone ID CFE213 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict...yostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 9e-24 3 X51892 |X51892.1 Dict

Dicty_cDB: SSF210 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSF210 (Link to dictyBase) - - - Contig-U16581-1 SSF210P (Link... to Original site) SSF210F 183 SSF210Z 197 SSF210P 380 - - Show SSF210 Library SS (Link to library) Clone ID SSF210 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...nt alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 339...01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalcin, mRNA s

Dicty_cDB: VFI196 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFI196 (Link to dictyBase) - - - Contig-U16512-1 - (Link to Or...iginal site) - - VFI196Z 168 - - - - Show VFI196 Library VF (Link to library) Clone ID VFI196 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16512-1 Original site URL http://dictycdb.b...ces. 40 8.8 1 CK407044 |CK407044.1 AUF_IfLvr_212_p04 Ictalurus furcatus liver cDNA library Ictalurus furcatu...%: nuclear 36.0 %: mitochondrial 16.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for VFI196 is nuc 5'

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel

Dicty_cDB: VSE812 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSE812 (Link to dictyBase) - - - Contig-U14773-1 VSE812E (Link... to Original site) - - - - - - VSE812E 721 Show VSE812 Library VS (Link to library) Clone ID VSE812 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14773-1 Original site URL http://dict...re E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...9 AF401554_1( AF401554 |pid:none) Ictalurus punctatus ribosomal prot... 132 1e-29 protein update 2009. 7.31

Dicty_cDB: SSD329 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSD329 (Link to dictyBase) - - - Contig-U16581-1 SSD329F (Link... to Original site) SSD329F 444 - - - - - - Show SSD329 Library SS (Link to library) Clone ID SSD329 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide... DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictal

Dicty_cDB: CFE853 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFE853 (Link to dictyBase) - - - Contig-U16381-1 CFE853F (Link... to Original site) CFE853F 109 - - - - - - Show CFE853 Library CF (Link to library) Clone ID CFE853 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyost...elium discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60

Dicty_cDB: CFH668 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH668 (Link to dictyBase) - - - Contig-U13860-1 - (Link to Or...iginal site) - - CFH668Z 651 - - - - Show CFH668 Library CF (Link to library) Clone ID CFH668 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13860-1 Original site URL http://dictycdb.b...s) Value N AC116987 |AC116987.2 Dictyostelium discoideum chromosome 2 map 3527441-3568052 strain AX4, comple...te sequence. 58 1e-11 6 AC116305 |AC116305.2 Dictyostelium discoideum chromosome

Dicty_cDB: SFD117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict

Dicty_cDB: AFK740 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFK740 (Link to dictyBase) - - - Contig-U16381-1 AFK740F (Link... to Original site) AFK740F 107 - - - - - - Show AFK740 Library AF (Link to library) Clone ID AFK740 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...es producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyosteliu...m discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60 gen

Dicty_cDB: SLF689 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLF689 (Link to dictyBase) - - - Contig-U16284-1 SLF689Z (Link... to Original site) - - SLF689Z 320 - - - - Show SLF689 Library SL (Link to library) Clone ID SLF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16284-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N ( AC116305 ) Dictyostelium discoideum... chromosome 2 map 1005175... 478 e-131 1 ( AU053477 ) Dictyostelium discoideum slug cDNA, clone SLI726. 478 e-131 1 ( AU053102 ) Dict

Dicty_cDB: CFH744 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH744 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH744F 118 - - - - - - Show CFH744 Library CF (Link to library) Clone ID CFH744 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ng significant alignments: (bits) Value N X51892 |X51892.1 Dictyostelium discoide...um SP60 gene for spore coat protein. 80 1e-23 3 AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 m

Dicty_cDB: SSJ546 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSJ546 (Link to dictyBase) - - - Contig-U16581-1 SSJ546F (Link... to Original site) SSJ546F 445 - - - - - - Show SSJ546 Library SS (Link to library) Clone ID SSJ546 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoi...2, DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

Dicty_cDB: SSF689 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSF689 (Link to dictyBase) - - - Contig-U16581-1 SSF689F (Link... to Original site) SSF689F 443 - - - - - - Show SSF689 Library SS (Link to library) Clone ID SSF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...core E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum ...A sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictaluru

Dicty_cDB: CFH713 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH713 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH713F 133 - - - - - - Show CFH713 Library CF (Link to library) Clone ID CFH713 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

Dicty_cDB: CFH518 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH518 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH518F 131 - - - - - - Show CFH518 Library CF (Link to library) Clone ID CFH518 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-22 3 AC115685 |AC115685.1 Dictyos

Dicty_cDB: VHI285 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD

Dicty_cDB: CHQ307 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHQ307 (Link to dictyBase) - - - Contig-U16403-1 CHQ307P (Link... to Original site) CHQ307F 441 CHQ307Z 669 CHQ307P 1090 - - Show CHQ307 Library CH (Link to library) Clone ID CHQ307 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16403-1 Original site URL http://dict...EDPATQLSSLKFESDKEKEQALLWAFLASYLPEDKGS LQKEFVKHVEYTLAQTKSECTDF--- ---fvmplvmkictslvlvlkrstk*rklfmmenshqtldglv...0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N M77492 |M77492.1 Dict

Dicty_cDB: VHH893 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHH893 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - VHH893Z 385 - - - - Show VHH893 Library VH (Link to library) Clone ID VHH893 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...anio rerio alanyl-tRNA synthetase... 48 9e-05 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatus isolate C1

Dicty_cDB: CFI225 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFI225 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFI225F 133 - - - - - - Show CFI225 Library CF (Link to library) Clone ID CFI225 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

Dicty_cDB: SSG552 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSG552 (Link to dictyBase) - - - Contig-U16581-1 - (Link to Or...iginal site) SSG552F 449 - - - - - - Show SSG552 Library SS (Link to library) Clone ID SSG552 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dictycdb.b...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide.... 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalc

Dicty_cDB: SHE682 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHE682 (Link to dictyBase) - - - Contig-U11295-1 - (Link to Or...iginal site) SHE682F 142 - - - - - - Show SHE682 Library SH (Link to library) Clone ID SHE682 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11295-1 Original site URL http://dictycdb.b... 2 CB936849 |CB936849.1 IpCGJx13_9_A11_23 IpCGJx13 Ictalurus punctatus cDNA clone...8.0 %: cytoplasmic 28.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane 4.0

Dicty_cDB: SHH247 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHH247 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - SHH247Z 601 - - - - Show SHH247 Library SH (Link to library) Clone ID SHH247 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b...pdate 2002.12. 6 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...ogaster SD01519 fu... 56 6e-07 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatu

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC154 (Link to dictyBase) - - - Contig-U16363-1 VFC154Z (Link... to Original site) - - VFC154Z 551 - - - - Show VFC154 Library VF (Link to library) Clone ID VFC154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16363-1 Original site URL http://dict...s: (bits) Value N U82513 |U82513.1 Dictyostelium discoideum random slug cDNA25 protein (rsc25) mRNA, partial...producing significant alignments: (bits) Value U82513_1( U82513 |pid:none) Dictyostelium discoideum random s

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC175 (Link to dictyBase) - - - Contig-U16358-1 VFC175F (Link... to Original site) VFC175F 507 - - - - - - Show VFC175 Library VF (Link to library) Clone ID VFC175 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16358-1 Original site URL http://dict...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dict...eletal 4.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFC175 is

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB614 (Link to dictyBase) - - - Contig-U16382-1 VFB614Z (Link... to Original site) - - VFB614Z 219 - - - - Show VFB614 Library VF (Link to library) Clone ID VFB614 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...ments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...tin mRNA ITL-1, 3' end. 339 9e-90 1 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-2

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB714 (Link to dictyBase) - - - Contig-U12859-1 VFB714F (Link... to Original site) VFB714F 545 - - - - - - Show VFB714 Library VF (Link to library) Clone ID VFB714 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12859-1 Original site URL http://dict... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36936 |U36936.1 Dict...Score E Sequences producing significant alignments: (bits) Value U36936_1( U36936 |pid:none) Dictyostelium d

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB830 (Link to dictyBase) - - - Contig-U13825-1 VFB830P (Link... to Original site) VFB830F 566 VFB830Z 634 VFB830P 1200 - - Show VFB830 Library VF (Link to library) Clone ID VFB830 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13825-1 Original site URL http://dict...m3a: 0.00 m3b: 0.00 m_ : 1.00 56.0 %: mitochondrial 28.0 %: cytoplasmic 16.0 %: nuclear >> prediction for VF

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB667 (Link to dictyBase) - - - Contig-U13894-1 VFB667Z (Link... to Original site) - - VFB667Z 633 - - - - Show VFB667 Library VF (Link to library) Clone ID VFB667 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13894-1 Original site URL http://dict... update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117075 |AC117075.2 Dict...chondrial 4.0 %: vacuolar 4.0 %: peroxisomal >> prediction for VFB667 is cyt 5' e

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC129 (Link to dictyBase) - - - Contig-U16543-1 VFC129F (Link... to Original site) VFC129F 276 - - - - - - Show VFC129 Library VF (Link to library) Clone ID VFC129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16543-1 Original site URL http://dict... vs DNA Score E Sequences producing significant alignments: (bits) Value N M91382 |M91382.1 Dictyostelium di...scoideum thioredoxin (TRX2) mRNA, 5' end. 281 2e-96 3 M91384 |M91384.1 Dictyostelium discoideum thioredoxin

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC222 (Link to dictyBase) - - - Contig-U16046-1 VFC222Z (Link... to Original site) - - VFC222Z 339 - - - - Show VFC222 Library VF (Link to library) Clone ID VFC222 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16046-1 Original site URL http://dict...pdate 2002.12.15 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dict...etical LO... 88 8e-17 AC115592_28( AC115592 |pid:none) Dictyostelium discoideum c

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB776 (Link to dictyBase) - - - Contig-U13978-1 VFB776P (Link... to Original site) VFB776F 513 VFB776Z 602 VFB776P 1115 - - Show VFB776 Library VF (Link to library) Clone ID VFB776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13978-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N L41839 |L41839.1 Dictyoste....00 48.0 %: cytoplasmic 32.0 %: nuclear 16.0 %: cytoskeletal 4.0 %: peroxisomal >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC231 (Link to dictyBase) - - - Contig-U16593-1 VFC231P (Link... to Original site) VFC231F 428 VFC231Z 202 VFC231P 630 - - Show VFC231 Library VF (Link to library) Clone ID VFC231 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16593-1 Original site URL http://dict...amoeba histolytica genomic, DNA sequence. 48 0.13 1 AC116984 |AC116984.2 Dictyostelium discoideum chromosome...mbrane 4.0 %: vesicles of secretory system 4.0 %: extracellular, including cell wall >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB552 (Link to dictyBase) - - - Contig-U16480-1 VFB552P (Link... to Original site) VFB552F 529 VFB552Z 562 VFB552P 1091 - - Show VFB552 Library VF (Link to library) Clone ID VFB552 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16480-1 Original site URL http://dict...nce (All Frames) Frame A: kvtv*liiylkiknetficisifdfsyfhcksrlpicfl*iq*iinwwc*rycssfky*w nnikyyi*fyniictkyticc...cuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: Golgi >> prediction for V

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB751 (Link to dictyBase) - - - Contig-U16480-1 VFB751P (Link... to Original site) VFB751F 134 VFB751Z 560 VFB751P 694 - - Show VFB751 Library VF (Link to library) Clone ID VFB751 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16480-1 Original site URL http://dict...4.0 %: endoplasmic reticulum >> prediction for VFB751 is cyt 5' end seq. ID VFB751F 5' end seq. >VFB751F.Seq

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB703 (Link to dictyBase) - - - Contig-U14188-1 VFB703Z (Link... to Original site) - - VFB703Z 680 - - - - Show VFB703 Library VF (Link to library) Clone ID VFB703 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14188-1 Original site URL http://dict...ENCE, 18 unordered pieces. 36 0.038 5 AC115680 |AC115680.2 Dictyostelium discoideum chromosome 2 map 4415041...4-226K1, *** SEQUENCING IN PROGRESS ***, 52 unordered pieces. 46 0.31 5 AC116977 |AC116977.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB843 (Link to dictyBase) - - - Contig-U15729-1 VFB843F (Link... to Original site) VFB843F 566 - - - - - - Show VFB843 Library VF (Link to library) Clone ID VFB843 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15729-1 Original site URL http://dict...roducing significant alignments: (bits) Value N U64830 |U64830.1 Dictyostelium discoideum AX2 protein tyrosi...ne kinase gene, complete cds. 1114 0.0 1 U01064 |U01064.1 Dictyostelium discoideum AX2 protein tyrosine kina

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB632 (Link to dictyBase) - - - Contig-U16585-1 VFB632Z (Link... to Original site) - - VFB632Z 181 - - - - Show VFB632 Library VF (Link to library) Clone ID VFB632 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16585-1 Original site URL http://dict...g significant alignments: (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657...%: cytoplasmic 12.0 %: mitochondrial 8.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for VFB632 is nuc

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC124 (Link to dictyBase) - - - Contig-U12017-1 VFC124Z (Link... to Original site) - - VFC124Z 496 - - - - Show VFC124 Library VF (Link to library) Clone ID VFC124 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12017-1 Original site URL http://dict...e E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum... chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 835 0.0 2 U67089 |U67089.1 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC242 (Link to dictyBase) - - - Contig-U16280-1 VFC242F (Link... to Original site) VFC242F 431 - - - - - - Show VFC242 Library VF (Link to library) Clone ID VFC242 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16280-1 Original site URL http://dict...3( S18663 ) coronin - slime mold (Dictyostelium discoideum) ... 270 1e-71 AY52578...asmic 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFC242 is nuc 5' end seq. ID

Quantum critical scaling of fidelity in BCS-like model

International Nuclear Information System (INIS)

Adamski, Mariusz; Jedrzejewski, Janusz; Krokhmalskii, Taras

2013-01-01

We study scaling of the ground-state fidelity in neighborhoods of quantum critical points in a model of interacting spinful fermions—a BCS-like model. Due to the exact diagonalizability of the model, in one and higher dimensions, scaling of the ground-state fidelity can be analyzed numerically with great accuracy, not only for small systems but also for macroscopic ones, together with the crossover region between them. Additionally, in the one-dimensional case we have been able to derive a number of analytical formulas for fidelity and show that they accurately fit our numerical results; these results are reported in the paper. Besides regular critical points and their neighborhoods, where well-known scaling laws are obeyed, there is the multicritical point and critical points in its proximity where anomalous scaling behavior is found. We also consider scaling of fidelity in neighborhoods of critical points where fidelity oscillates strongly as the system size or the chemical potential is varied. Our results for a one-dimensional version of a BCS-like model are compared with those obtained recently by Rams and Damski in similar studies of a quantum spin chain—an anisotropic XY model in a transverse magnetic field. (paper)

Quantum Fidelity and Thermal Phase Transitions in a Two-Dimensional Spin System

International Nuclear Information System (INIS)

Wang Bo; Kou Su-Peng; Huang Hai-Lin; Sun Zhao-Yu

2012-01-01

We investigate the ability of quantum fidelity in detecting the classical phase transitions (CPTs) in a two-dimensional Heisenberg—Ising mixed spin model, which has a very rich phase diagram and is exactly soluble. For a two-site subsystem of the model, the reduced fidelity (including the operator fidelity and the fidelity susceptibility) at finite temperatures is calculated, and it is found that an extreme value presents at the critical temperature, thus shows a signal for the CPTs. In some parameter region, the signal becomes blurred. We propose to use the 'normalized fidelity susceptibility' to solve this problem

Fidelity for kicked atoms with gravity near a quantum resonance.

Science.gov (United States)

Dubertrand, Rémy; Guarneri, Italo; Wimberger, Sandro

2012-03-01

Kicked atoms under a constant Stark or gravity field are investigated for experimental setups with cold and ultracold atoms. The parametric stability of the quantum dynamics is studied using the fidelity. In the case of a quantum resonance, it is shown that the behavior of the fidelity depends on arithmetic properties of the gravity parameter. Close to a quantum resonance, the long-time asymptotics of the fidelity is studied by means of a pseudoclassical approximation introduced by Fishman et al. [J. Stat. Phys. 110, 911 (2003)]. The long-time decay of fidelity arises from the tunneling out of pseudoclassical stable islands, and a simple ansatz is proposed which satisfactorily reproduces the main features observed in numerical simulations.

Validation of the Standard Mobility Application Programming Interface Fidelity 1 and 2

Science.gov (United States)

2006-07-01

Cross-Country, Dry) 16000-fl 14000 12000- O- U 00 - ielt 0 0 Fidelity2 %0 10000 8000- 4000-zo-- Over Even Under N Fidelity 1 8151 14224 4553 0...Road, Snow) 90% 70% -j S60% > 50% ~40% E 30% S20% 1 0% - ielt 0% 0 5 10 15 20 STNDMob - NRMM (rriph) Figure 57. M923/M200A1 Fidelity 1 vs. Fidelity 2

Sobriety Treatment and Recovery Teams: Implementation Fidelity and Related Outcomes.

Science.gov (United States)

Huebner, Ruth A; Posze, Lynn; Willauer, Tina M; Hall, Martin T

2015-01-01

Although integrated programs between child welfare and substance abuse treatment are recommended for families with co-occurring child maltreatment and substance use disorders, implementing integrated service delivery strategies with fidelity is a challenging process. This study of the first five years of the Sobriety Treatment and Recovery Team (START) program examines implementation fidelity using a model proposed by Carroll et al. (2007). The study describes the process of strengthening moderators of implementation fidelity, trends in adherence to START service delivery standards, and trends in parent and child outcomes. Qualitative and quantitative measures were used to prospectively study three START sites serving 341 families with 550 parents and 717 children. To achieve implementation fidelity to service delivery standards required a pre-service year and two full years of operation, persistent leadership, and facilitative actions that challenged the existing paradigm. Over four years of service delivery, the time from the child protective services report to completion of five drug treatment sessions was reduced by an average of 75 days. This trend was associated with an increase in parent retention, parental sobriety, and parent retention of child custody. Conclusions/Importance: Understanding the implementation processes necessary to establish complex integrated programs may support realistic allocation of resources. Although implementation fidelity is a moderator of program outcome, complex inter-agency interventions may benefit from innovative measures of fidelity that promote improvement without extensive cost and data collection burden. The implementation framework applied in this study was useful in examining implementation processes, fidelity, and related outcomes.

Dicty_cDB: CHD534 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHD534 (Link to dictyBase) - - - Contig-U15540-1 CHD534E (Link...) Clone ID CHD534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Ori...nts: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 ma...p 215673-367476 strain AX4, complete sequence. 40 1e-05 6 AC117081 |AC117081.2 Dictyostelium discoideum chro...mosome 2 map 5862124-6045772 strain AX4, complete sequence. 40 2e-05 5 AJ277590 |AJ277590.1 Dictyostelium di

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB752 (Link to dictyBase) - - - Contig-U14717-1 VFB752E (Link...) Clone ID VFB752 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14717-1 Ori...s: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4,... complete sequence. 1215 0.0 11 AC115594 |AC115594.2 Dictyostelium discoideum chr...omosome 2 map 4071862-4101005 strain AX4, complete sequence. 113 3e-47 8 AC116920 |AC116920.2 Dictyostelium

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB606 (Link to dictyBase) - - - Contig-U16382-1 VFB606E (Link...) Clone ID VFB606 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ucing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 22...28 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2...2028 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4, comple

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB662 (Link to dictyBase) - - - Contig-U15118-1 VFB662E (Link...) Clone ID VFB662 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15118-1 Ori... significant alignments: (bits) Value N AF039211 |AF039211.1 Dictyostelium discoideum ADP/ATP translocase mR...NA, complete cds. 1011 0.0 2 AF100676 |AF100676.1 Dictyostelium discoideum ADP/ATP translocase gene, complet...drial 4.0 %: extracellular, including cell wall 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> predict

Dicty_cDB: VHF145 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB668 (Link to dictyBase) - G00394 DDB0168247 Contig-U09555-1...brary) Clone ID VFB668 (Link to dictyBase) Atlas ID - NBRP ID G00394 dictyBase ID DDB0168247 Link to Contig ...Contig-U09555-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...uences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dictyostelium discoideum chromo...tein Score E Sequences producing significant alignments: (bits) Value AC117076_25

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB677 (Link to dictyBase) - G02518 DDB0188526 Contig-U02066-1...brary) Clone ID VFB677 (Link to dictyBase) Atlas ID - NBRP ID G02518 dictyBase ID DDB0188526 Link to Contig ...Contig-U02066-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...nfnytrgccsygdl*wy*gtr*tih*kdr*lwcassfenfndtictit mfnr**sstwfeilskrsih*rgikc*hd*nh..._25( AC116960 |pid:none) Dictyostelium discoideum chromoso... 90 2e-16 CP001276_520( CP001276 |pid:none) The

Gain tuning and fidelity in continuous-variable quantum teleportation

International Nuclear Information System (INIS)

Ide, Toshiki; Hofmann, Holger F.; Furusawa, Akira; Kobayashi, Takayoshi

2002-01-01

The fidelity of continuous-variable teleportation can be optimized by changing the gain in the modulation of the output field. We discuss the gain dependence of fidelity for coherent, vacuum, and one-photon inputs and propose optimal gain tuning strategies for corresponding input selections

Intervention Fidelity in Special and General Education Research Journals

Science.gov (United States)

Swanson, Elizabeth; Wanzek, Jeanne; Haring, Christa; Ciullo, Stephen; McCulley, Lisa

2013-01-01

Treatment fidelity reporting practices are described for journals that published general and special education intervention research with high impact factors from 2005 through 2009. The authors reviewed research articles, reported the proportion of intervention studies that described fidelity measurement, detailed the components of fidelity…

Dicty_cDB: SSL472 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSL472 (Link to dictyBase) - - - Contig-U14592-1 SSL472F (Link... to Original site) SSL472F 185 - - - - - - Show SSL472 Library SS (Link to library) Clone ID SSL472 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14592-1 Original site URL http://dict...group) genomic DNA, chromosome 6, PAC clone:P0036F10, WORKING DRAFT SEQUENCE, 1 ordered pieces. 44 0.59 1 AC114263 |AC114263.2 Dict...library Plasmodium falciparum 3D7 cDNA 5' similar to TR:O96129 O96129 PREDICTED MEMBRANE ASSOCIATED PROTEIN.

Dicty_cDB: SSH414 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSH414 (Link to dictyBase) - - - Contig-U16581-1 SSH414Z (Link... to Original site) - - SSH414Z 448 - - - - Show SSH414 Library SS (Link to library) Clone ID SSH414 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium... SAMPLING. 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: VHE867 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

Dicty_cDB: SSD571 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSD571 (Link to dictyBase) - - - Contig-U16581-1 SSD571Z (Link... to Original site) - - SSD571Z 415 - - - - Show SSD571 Library SS (Link to library) Clone ID SSD571 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...Brassica oleracea genomic clone BONRK12, DNA sequence. 50 0.025 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

Dicty_cDB: VHO349 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHO349 (Link to dictyBase) - - - Contig-U11939-1 - (Link to Or...iginal site) - - VHO349Z 412 - - - - Show VHO349 Library VH (Link to library) Clone ID VHO349 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11939-1 Original site URL http://dictycdb.b...4 |CK424794.1 AUF_IpSto_12_h11 Stomach cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 42 6.1 1 dna...ial 8.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VHO349 is

Dicty_cDB: CFH521 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH521 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH521F 134 - - - - - - Show CFH521 Library CF (Link to library) Clone ID CFH521 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict.... 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict

Dicty_cDB: FC-IC0102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC-IC (Link to library) FC-IC0102 (Link to dictyBase) - - - Contig-U16527-1 FC-IC01...02F (Link to Original site) FC-IC0102F 434 - - - - - - Show FC-IC0102 Library FC-IC (Link to library) Clone ...ID FC-IC0102 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dict... (bits) Value N AB088483 |AB088483.1 Dictyostelium discoideum gene for gamete and mating-type specific prote...oducing significant alignments: (bits) Value AB088483_1( AB088483 |pid:none) Dictyostelium discoideum gmsA g

Dicty_cDB: SSK552 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSK552 (Link to dictyBase) - - - Contig-U04708-1 SSK552Z (Link... to Original site) - - SSK552Z 713 - - - - Show SSK552 Library SS (Link to library) Clone ID SSK552 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04708-1 Original site URL http://dict...equence. 40 0.26 5 BM029272 |BM029272.1 IpSkn00291 Skin cDNA library Ictalurus pu...0 m3a: 0.00 m3b: 0.00 m_ : 1.00 76.0 %: nuclear 20.0 %: cytoplasmic 4.0 %: plasma membrane >> prediction for

Dicty_cDB: SSG335 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSG335 (Link to dictyBase) - - - Contig-U16509-1 SSG335F (Link... to Original site) SSG335F 200 - - - - - - Show SSG335 Library SS (Link to library) Clone ID SSG335 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...y vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium d...iscoideum mRNA. 64 1e-17 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Icta

Dicty_cDB: CFE801 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFE801 (Link to dictyBase) - - - Contig-U12894-1 CFE801Z (Link... to Original site) - - CFE801Z 690 - - - - Show CFE801 Library CF (Link to library) Clone ID CFE801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12894-1 Original site URL http://dict...6e1 5', mRNA sequence. 36 5.4 2 CK426247 |CK426247.1 AUF_IpTes_24_l09 Testis cDNA library Ict...A26838 )prestalk protein precursor - slime mold (Dictyoste... 66 9e-10 AC117072_6

Dicty_cDB: AFJ817 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFJ817 (Link to dictyBase) - - - Contig-U15574-1 AFJ817F (Link... to Original site) AFJ817F 172 - - - - - - Show AFJ817 Library AF (Link to library) Clone ID AFJ817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...alue N AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-4071762 strain AX4, complete s...es. 42 1.1 2 BE213059 |BE213059.1 IpBrn01690 Brain cDNA library Ictalurus punctatus cDNA 5', mRNA sequence.

Dicty_cDB: SSG316 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSG316 (Link to dictyBase) - - - Contig-U16509-1 SSG316F (Link... to Original site) SSG316F 231 - - - - - - Show SSG316 Library SS (Link to library) Clone ID SSG316 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideu...m mRNA. 64 3e-12 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: FC-AY04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AY04 (Link to dictyBase) - - - Contig-U16521-1 FC-AY04Z (Li...nk to Original site) - - FC-AY04Z 583 - - - - Show FC-AY04 Library FC (Link to library) Clone ID FC-AY04 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16521-1 Original site URL http://dict...10 4 CA753827 |AF402814_1 ( AF402814 ) 40S ribosomal protein S6 [Ictalurus puncta...0.00 m_ : 1.00 92.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-AY04 is cyt 5' e

Dicty_cDB: CHP827 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHP827 (Link to dictyBase) - - - Contig-U15898-1 - (Link to Or...iginal site) CHP827F 148 - - - - - - Show CHP827 Library CH (Link to library) Clone ID CHP827 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15898-1 Original site URL http://dictycdb.b...ments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain ...18q21 clone:RP11-866E20, WORKING DRAFT SEQUENCE, 18 unordered pieces. 42 0.073 4 CK406764 |CK406764.1 AUF_IfLvr_212_c09 Ict

Dicty_cDB: AFI444 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFI444 (Link to dictyBase) - - - Contig-U16560-1 AFI444Z (Link... to Original site) - - AFI444Z 326 - - - - Show AFI444 Library AF (Link to library) Clone ID AFI444 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16560-1 Original site URL http://dict...e ... 109 2e-36 B27806( B27806 ) ubiquitin (clone lambda229) - slime mold (Dictyo...s... 109 2e-36 A27806( A27806 ) polyubiquitin 5 (clone pLK229) - slime mold (Dict... 109 6e-36 M19666_1( M19

Dicty_cDB: SSE436 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSE436 (Link to dictyBase) - - - Contig-U16509-1 SSE436P (Link... to Original site) SSE436F 222 SSE436Z 178 SSE436P 400 - - Show SSE436 Library SS (Link to library) Clone ID SSE436 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...EQUENCING IN PROGRESS ***, 5 unordered pieces. 42 0.13 3 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

Dicty_cDB: SFF105 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF105 (Link to dictyBase) - - - Contig-U14516-1 SFF105Z (Link... to Original site) - - SFF105Z 217 - - - - Show SFF105 Library SF (Link to library) Clone ID SFF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14516-1 Original site URL http://dict...pieces. 44 0.77 1 CF971786 |CF971786.1 AUB_IfLvr00258 Ictalurus furcatus liver cDNA library Ictalurus furcat...endoplasmic reticulum >> prediction for SFF105 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq. -

Dicty_cDB: SSF105 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSF105 (Link to dictyBase) - - - Contig-U16581-1 SSF105F (Link... to Original site) SSF105F 432 - - - - - - Show SSF105 Library SS (Link to library) Clone ID SSF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-126 3 BZ46365...028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: SSG307 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSG307 (Link to dictyBase) - - - Contig-U16382-1 SSG307Z (Link... to Original site) - - SSG307Z 391 - - - - Show SSG307 Library SS (Link to library) Clone ID SSG307 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...om clone CH211-202E12. 36 0.97 7 CF263546 |CF263546.1 AUA_IpTrk00012 Trunk kidney cDNA library Ictalurus pun...ytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for SSG307 is nuc 5' end seq.

Dicty_cDB: SSI468 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

Dicty_cDB: SSK129 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSK129 (Link to dictyBase) - - - Contig-U16021-1 SSK129Z (Link... to Original site) - - SSK129Z 372 - - - - Show SSK129 Library SS (Link to library) Clone ID SSK129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16021-1 Original site URL http://dict...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dict...419632 |CK419632.1 AUF_IpOva_21_i24 Ovary cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 36 0.54 2

Dicty_cDB: SSC474 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSC474 (Link to dictyBase) - - - Contig-U07719-1 SSC474P (Link... to Original site) SSC474F 368 SSC474Z 238 SSC474P 606 - - Show SSC474 Library SS (Link to library) Clone ID SSC474 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07719-1 Original site URL http://dict...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU071762 ) Dictyostelium di...scoideum slug cDNA, clone SSC474. 448 e-121 1 ( AU060185 ) Dictyostelium discoideum slug cDNA, clone SLA535.

Dicty_cDB: CFC652 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFC652 (Link to dictyBase) - - - Contig-U02523-1 CFC652Z (Link... to Original site) - - CFC652Z 713 - - - - Show CFC652 Library CF (Link to library) Clone ID CFC652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02523-1 Original site URL http://dict... clone DKEY-104M9 in linkage group 19. 46 0.73 1 AC148615 |AC148615.2 Ictalurus punctatus clone CH212-99A22,...luding cell wall 4.0 %: peroxisomal >> prediction for CFC652 is mit 5' end seq. ID - 5' end seq. - Length of

Dicty_cDB: SSD250 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSD250 (Link to dictyBase) - - - Contig-U14716-1 SSD250E (Link... to Original site) - - - - - - SSD250E 491 Show SSD250 Library SS (Link to library) Clone ID SSD250 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14716-1 Original site URL http://dict...t alignments: (bits) Value N U20432 |U20432.1 Dictyostelium discoideum TagB (tagB) gene, complete cds. 151 1...cName: Full=Cytochrome b-c1 complex subunit 7; AltNam... 45 0.001 DQ399515_1( DQ399515 |pid:none) Ictalurus

Dicty_cDB: FC-AK01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AK01 (Link to dictyBase) - - - Contig-U15038-1 FC-AK01E (Li...nk to Original site) - - - - - - FC-AK01E 996 Show FC-AK01 Library FC (Link to library) Clone ID FC-AK01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15038-1 Original site URL http://dict...s clone omyk-evn... 172 6e-79 AF401557_1( AF401557 |pid:none) Ictalurus punctatus...reticulum 4.0 %: vacuolar >> prediction for FC-AK01 is mit 5' end seq. ID - 5' end seq. - Length of 5' end s

Dicty_cDB: SSF865 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSF865 (Link to dictyBase) - - - Contig-U16581-1 SSF865Z (Link... to Original site) - - SSF865Z 436 - - - - Show SSF865 Library SS (Link to library) Clone ID SSF865 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...s producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-115...0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

Dicty_cDB: VSH207 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict

Dicty_cDB: VFI685 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFI685 (Link to dictyBase) - - - Contig-U16455-1 - (Link to Or...iginal site) - - VFI685Z 189 - - - - Show VFI685 Library VF (Link to library) Clone ID VFI685 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dictycdb.b...ignments: (bits) Value N ( BJ432495 ) Dictyostelium discoideum cDNA clone:ddv18i22, 3' ... 313 1e-81 1 ( X55...973 ) D. discoideum EF1-I gene for elongation factor 1 al... 305 3e-79 1 ( AU285051 ) Dict

Dicty_cDB: VSK324 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSK324 (Link to dictyBase) - G24005 DDB0233069 Contig-U15575-1... VSK324F (Link to Original site) VSK324F 364 - - - - - - Show VSK324 Library VS (Link to library) Clone ID VSK324 (Link to dict...yBase) Atlas ID - NBRP ID G24005 dictyBase ID DDB0233069 Link to Contig Contig-U15575-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSK3-A/VSK324Q.Seq.d/ ...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117070 |AC117070.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC162 (Link to dictyBase) - - - Contig-U16455-1 VFC162P (Link... to Original site) VFC162F 367 VFC162Z 501 VFC162P 868 - - Show VFC162 Library VF (Link to library) Clone ID VFC162 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...elongation factor 1 alpha. 896 0.0 3 AF016242 |AF016242.1 Dictyostelium discoideu... vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC162 is nuc 5' end seq. ID VFC162F 5'

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB612 (Link to dictyBase) - - - Contig-U16272-1 VFB612P (Link... to Original site) VFB612F 631 VFB612Z 640 VFB612P 1271 - - Show VFB612 Library VF (Link to library) Clone ID VFB612 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...es producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal prot...gi 4.0 %: plasma membrane >> prediction for VFB612 is nuc 5' end seq. ID VFB612F

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB611 (Link to dictyBase) - - - Contig-U16239-1 VFB611P (Link... to Original site) VFB611F 650 VFB611Z 704 VFB611P 1354 - - Show VFB611 Library VF (Link to library) Clone ID VFB611 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16239-1 Original site URL http://dict...ant alignments: (bits) Value N AC116989 |AC116989.2 Dictyostelium discoideum chro...mosome 2 map complement(3527391-3470188) strain AX4, complete sequence. 42 5e-10 9 AC116987 |AC116987.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB489 (Link to dictyBase) - - - Contig-U16382-1 VFB489P (Link... to Original site) VFB489F 178 VFB489Z 501 VFB489P 679 - - Show VFB489 Library VF (Link to library) Clone ID VFB489 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...: (bits) Value N AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2...e cds. 783 0.0 3 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4,

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB847 (Link to dictyBase) - - - Contig-U16272-1 VFB847P (Link... to Original site) VFB847F 528 VFB847Z 749 VFB847P 1277 - - Show VFB847 Library VF (Link to library) Clone ID VFB847 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...core E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ...ear 24.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: plasma membrane 4.0 %: endoplasmic reticulum >> predictio

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB788 (Link to dictyBase) - - - Contig-U14924-1 VFB788P (Link... to Original site) VFB788F 158 VFB788Z 768 VFB788P 926 - - Show VFB788 Library VF (Link to library) Clone ID VFB788 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14924-1 Original site URL http://dict... (bits) Value N AC115592 |AC115592.2 Dictyostelium discoideum chromosome 2 map 1-...2_6( AC115592 |pid:none) Dictyostelium discoideum chromosom... 520 e-146 CU459003_2449( CU459003 |pid:none)

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB895 (Link to dictyBase) - - - Contig-U10164-1 VFB895P (Link... to Original site) VFB895F 578 VFB895Z 699 VFB895P 1277 - - Show VFB895 Library VF (Link to library) Clone ID VFB895 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10164-1 Original site URL http://dict...ore E Sequences producing significant alignments: (bits) Value N AC115604 |AC115604.2 Dictyostelium discoide...um chromosome 2 map 4354771-4414991 strain AX4, complete sequence. 42 5e-06 9 M18106 |M18106.1 Dictyostelium

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC101 (Link to dictyBase) - - - Contig-U16544-1 VFC101Z (Link... to Original site) - - VFC101Z 556 - - - - Show VFC101 Library VF (Link to library) Clone ID VFC101 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16544-1 Original site URL http://dict...t alignments: (bits) Value N AY164994 |AY164994.1 Dictyostelium discoideum RTNLC (RTNLC) mRNA, complete cds.... 969 0.0 2 AY164656 |AY164656.1 Dictyostelium discoideum RTNLC (RTNLC) gene, complete cds. 565 0.0 3 AL71386

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC280 (Link to dictyBase) - - - Contig-U16349-1 VFC280Z (Link... to Original site) - - VFC280Z 627 - - - - Show VFC280 Library VF (Link to library) Clone ID VFC280 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AJ315489 |AJ315489.1 Dict...: vacuolar 4.0 %: Golgi 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for VFC280 is end 5

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB645 (Link to dictyBase) - - - Contig-U16382-1 VFB645P (Link... to Original site) VFB645F 619 VFB645Z 413 VFB645P 1032 - - Show VFB645 Library VF (Link to library) Clone ID VFB645 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostel...ium discoideum gene for actin A8. 1174 0.0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC187 (Link to dictyBase) - - - Contig-U12289-1 VFC187P (Link... to Original site) VFC187F 411 VFC187Z 678 VFC187P 1089 - - Show VFC187 Library VF (Link to library) Clone ID VFC187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12289-1 Original site URL http://dict... N AC117176 |AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947... strain AX4, complete sequence. 36 0.008 12 AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 map 2

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC212 (Link to dictyBase) - - - Contig-U16455-1 VFC212P (Link... to Original site) VFC212F 260 VFC212Z 343 VFC212P 603 - - Show VFC212 Library VF (Link to library) Clone ID VFC212 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...actor 1 alpha. 394 0.0 3 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 347 0.0 3...4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB837 (Link to dictyBase) - - - Contig-U14985-1 VFB837P (Link... to Original site) VFB837F 606 VFB837Z 689 VFB837P 1295 - - Show VFB837 Library VF (Link to library) Clone ID VFB837 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14985-1 Original site URL http://dict... 13 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-256737...0 strain AX4, complete sequence. 38 2e-05 15 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB733 (Link to dictyBase) - - - Contig-U16279-1 VFB733P (Link... to Original site) VFB733F 608 VFB733Z 663 VFB733P 1271 - - Show VFB733 Library VF (Link to library) Clone ID VFB733 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16279-1 Original site URL http://dict...es producing significant alignments: (bits) Value N U23957 |U23957.1 Dictyostelium discoideum P52D mRNA, com...15 e-114 U23957_1( U23957 |pid:none) Dictyostelium discoideum P52D mRNA, co... 41

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB862 (Link to dictyBase) - - - Contig-U16311-1 VFB862P (Link... to Original site) VFB862F 624 VFB862Z 720 VFB862P 1344 - - Show VFB862 Library VF (Link to library) Clone ID VFB862 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16311-1 Original site URL http://dict...s) Value N U72746 |U72746.1 Dictyostelium discoideum cysteine proteinase (cprG) m...RNA, complete cds. 1209 0.0 5 U72745 |U72745.1 Dictyostelium discoideum cysteine proteinase (cprF) mRNA, com

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB736 (Link to dictyBase) - - - Contig-U16272-1 VFB736F (Link... to Original site) VFB736F 628 - - - - - - Show VFB736 Library VF (Link to library) Clone ID VFB736 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict....12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...0.00 m_ : 1.00 68.0 %: nuclear 16.0 %: cytoplasmic 8.0 %: cytoskeletal 4.0 %: mitochondrial 4.0 %: plasma membrane >> predict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB574 (Link to dictyBase) - - - Contig-U16382-1 VFB574P (Link... to Original site) VFB574F 508 VFB574Z 686 VFB574P 1194 - - Show VFB574 Library VF (Link to library) Clone ID VFB574 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromo...some 2 map 1685067-2090751 strain AX4, complete sequence. 1352 0.0 4 AC116986 |AC116986.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC255 (Link to dictyBase) - - - Contig-U16272-1 VFC255P (Link... to Original site) VFC255F 198 VFC255Z 525 VFC255P 723 - - Show VFC255 Library VF (Link to library) Clone ID VFC255 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...oducing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (...ic 32.0 %: nuclear 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for VFC255 is cyt 5' end seq. ID VFC255F

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB559 (Link to dictyBase) - - - Contig-U16272-1 VFB559P (Link... to Original site) VFB559F 307 VFB559Z 624 VFB559P 931 - - Show VFB559 Library VF (Link to library) Clone ID VFB559 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal pr...toplasmic 16.0 %: mitochondrial 4.0 %: nuclear >> prediction for VFB559 is cyt 5' end seq. ID VFB559F 5' end

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB769 (Link to dictyBase) - - - Contig-U15456-1 VFB769P (Link... to Original site) VFB769F 625 VFB769Z 690 VFB769P 1315 - - Show VFB769 Library VF (Link to library) Clone ID VFB769 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...roducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin... D. 1257 0.0 3 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathep

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB524 (Link to dictyBase) - - - Contig-U14169-1 VFB524Z (Link... to Original site) - - VFB524Z 233 - - - - Show VFB524 Library VF (Link to library) Clone ID VFB524 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14169-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116305 |AC116305.2 Dict... cds. 40 0.81 2 Z70204 |Z70204.1 Caenorhabditis elegans cosmid C11G6. 40 2.7 2 AC117176 |AC117176.2 Dictyost

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB702 (Link to dictyBase) - - - Contig-U12284-1 VFB702P (Link... to Original site) VFB702F 478 VFB702Z 615 VFB702P 1093 - - Show VFB702 Library VF (Link to library) Clone ID VFB702 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12284-1 Original site URL http://dict... N G65021 |G65021.1 DH0281 Dictyostelium discoideum ( P.Dear ) Dictyostelium disc...8.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: Golgi >> prediction for VFB702 is nuc 5' end seq. ID VFB702F 5'

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB741 (Link to dictyBase) - - - Contig-U16382-1 VFB741P (Link... to Original site) VFB741F 545 VFB741Z 675 VFB741P 1220 - - Show VFB741 Library VF (Link to library) Clone ID VFB741 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 1166 0....0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2090751 strain AX4, complete seq

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB710 (Link to dictyBase) - - - Contig-U16382-1 VFB710P (Link... to Original site) VFB710F 123 VFB710Z 689 VFB710P 812 - - Show VFB710 Library VF (Link to library) Clone ID VFB710 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict... significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum... gene for actin A8. 1308 0.0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-209075

High-fidelity polarization storage in a gigahertz bandwidth quantum memory

International Nuclear Information System (INIS)

England, D G; Michelberger, P S; Champion, T F M; Reim, K F; Lee, K C; Sprague, M R; Jin, X-M; Langford, N K; Kolthammer, W S; Nunn, J; Walmsley, I A

2012-01-01

We demonstrate a dual-rail optical Raman memory inside a polarization interferometer; this enables us to store polarization-encoded information at GHz bandwidths in a room-temperature atomic ensemble. By performing full process tomography on the system, we measure up to 97 ± 1% process fidelity for the storage and retrieval process. At longer storage times, the process fidelity remains high, despite a loss of efficiency. The fidelity is 86 ± 4% for 1.5 μs storage time, which is 5000 times the pulse duration. Hence, high fidelity is combined with a large time-bandwidth product. This high performance, with an experimentally simple setup, demonstrates the suitability of the Raman memory for integration into large-scale quantum networks. (paper)

Multi-fidelity machine learning models for accurate bandgap predictions of solids

International Nuclear Information System (INIS)

Pilania, Ghanshyam; Gubernatis, James E.; Lookman, Turab

2016-01-01

Here, we present a multi-fidelity co-kriging statistical learning framework that combines variable-fidelity quantum mechanical calculations of bandgaps to generate a machine-learned model that enables low-cost accurate predictions of the bandgaps at the highest fidelity level. Additionally, the adopted Gaussian process regression formulation allows us to predict the underlying uncertainties as a measure of our confidence in the predictions. In using a set of 600 elpasolite compounds as an example dataset and using semi-local and hybrid exchange correlation functionals within density functional theory as two levels of fidelities, we demonstrate the excellent learning performance of the method against actual high fidelity quantum mechanical calculations of the bandgaps. The presented statistical learning method is not restricted to bandgaps or electronic structure methods and extends the utility of high throughput property predictions in a significant way.

Dicty_cDB: FC-AI08 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

Dicty_cDB: VSF490 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSF490 (Link to dictyBase) - G21390 DDB0186133 Contig-U10099-1 VSF4...90E (Link to Original site) VSF490F 504 VSF490Z 674 VSF490P 1178 VSF490E 917 Show VSF490 Library VS (Li...nk to library) Clone ID VSF490 (Link to dictyBase) Atlas ID - NBRP ID G21390 dictyBase ID DDB0186133 Link to... Contig Contig-U10099-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSF4-D/VSF4...90Q.Seq.d/ Representative seq. ID VSF490E (Link to Original site) Representative DNA sequence >VSF490 (VSF4

Dicty_cDB: SLF442 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLF442 (Link to dictyBase) slf442 - - Contig-U16022-1 SLF442P ...(Link to Original site) SLF442F 294 SLF442Z 570 SLF442P 864 - - Show SLF442 Library SL (Link to library) Clone ID SLF4...42 (Link to dictyBase) Atlas ID slf442 NBRP ID - dictyBase ID - Link to Contig Contig-U16022-1 Ori...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF4-B/SLF442Q.Seq.d/ Re...presentative seq. ID SLF442P (Link to Original site) Representative DNA sequence >SLF442 (SLF442Q) /CSM/SL/SLF4-B/SLF4

Dicty_cDB: SLC418 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLC418 (Link to dictyBase) - G01921 DDB0191271 Contig-U15820-1 SLC4...18E (Link to Original site) SLC418F 604 SLC418Z 554 SLC418P 1158 SLC418E 1076 Show SLC418 Library SL (L...ink to library) Clone ID SLC418 (Link to dictyBase) Atlas ID - NBRP ID G01921 dictyBase ID DDB0191271 Link t...o Contig Contig-U15820-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-A/SLC4...18Q.Seq.d/ Representative seq. ID SLC418E (Link to Original site) Representative DNA sequence >SLC418 (SLC4

Investigating variations in implementation fidelity of an organizational-level occupational health intervention.

Science.gov (United States)

Augustsson, Hanna; von Thiele Schwarz, Ulrica; Stenfors-Hayes, Terese; Hasson, Henna

2015-06-01

The workplace has been suggested as an important arena for health promotion, but little is known about how the organizational setting influences the implementation of interventions. The aims of this study are to evaluate implementation fidelity in an organizational-level occupational health intervention and to investigate possible explanations for variations in fidelity between intervention units. The intervention consisted of an integration of health promotion, occupational health and safety, and a system for continuous improvements (Kaizen) and was conducted in a quasi-experimental design at a Swedish hospital. Implementation fidelity was evaluated with the Conceptual Framework for Implementation Fidelity and implementation factors used to investigate variations in fidelity with the Framework for Evaluating Organizational-level Interventions. A multi-method approach including interviews, Kaizen notes, and questionnaires was applied. Implementation fidelity differed between units even though the intervention was introduced and supported in the same way. Important differences in all elements proposed in the model for evaluating organizational-level interventions, i.e., context, intervention, and mental models, were found to explain the differences in fidelity. Implementation strategies may need to be adapted depending on the local context. Implementation fidelity, as well as pre-intervention implementation elements, is likely to affect the implementation success and needs to be assessed in intervention research. The high variation in fidelity across the units indicates the need for adjustments to the type of designs used to assess the effects of interventions. Thus, rather than using designs that aim to control variation, it may be necessary to use those that aim at exploring and explaining variation, such as adapted study designs.

Fidelity susceptibility as holographic PV-criticality

Energy Technology Data Exchange (ETDEWEB)

Momeni, Davood, E-mail: davoodmomeni78@gmail.com [Eurasian International Center for Theoretical Physics and Department of General & Theoretical Physics, Eurasian National University, Astana 010008 (Kazakhstan); Faizal, Mir, E-mail: mirfaizalmir@googlemail.com [Department of Physics and Astronomy, University of Lethbridge, Lethbridge, Alberta T1K 3M4 (Canada); Irving K. Barber School of Arts and Sciences, University of British Columbia – Okanagan, 3333 University Way, Kelowna, British Columbia V1V 1V7 (Canada); Myrzakulov, Kairat, E-mail: kairatmyrzakul@gmail.com [Eurasian International Center for Theoretical Physics and Department of General & Theoretical Physics, Eurasian National University, Astana 010008 (Kazakhstan); Myrzakulov, Ratbay, E-mail: rmyrzakulov@gmail.com [Eurasian International Center for Theoretical Physics and Department of General & Theoretical Physics, Eurasian National University, Astana 010008 (Kazakhstan)

2017-02-10

It is well known that entropy can be used to holographically establish a connection among geometry, thermodynamics and information theory. In this paper, we will use complexity to holographically establish a connection among geometry, thermodynamics and information theory. Thus, we will analyze the relation among holographic complexity, fidelity susceptibility, and thermodynamics in extended phase space. We will demonstrate that fidelity susceptibility (which is the informational complexity dual to a maximum volume in AdS) can be related to the thermodynamical volume (which is conjugate to the cosmological constant in the extended thermodynamic phase space). Thus, this letter establishes a relation among geometry, thermodynamics, and information theory, using complexity.

A 2-megabase physical contig incorporating 43 DNA markers on the human X chromosome at p11.23-p11.22 from ZNF21 to DXS255

Energy Technology Data Exchange (ETDEWEB)

Boycott, K.M.; Bech-Hansen, N.T. [Univ. of Calgary, Alberta (Canada); Halley, G.R.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States)

1996-05-01

A comprehensive physical contig of yeast artificial chromosomes (YACs) and cosmid clones between ZNF21 and DXS255 has been constructed, spanning 2 Mb within the region Xp11.23-p11.22. As a portion of the region was found to be particularly unstable in yeast, the integrity of the contig is dependent on additional information provided by the sequence-tagged site (STS) content of cosmid clones and DNA marker retention in conventional and radiation hybrids. The contig was formatted with 43 DNA markers, including 19 new STSs from YAC insert ends and an internal Alu-PCR product. The density of STSs across the contig ranges from one marker every 20 kb to one every 60 kb, with an average density of one marker every 50 kb. The relative order of previously known gene and expressed sequence tags in this region is predicted to be Xpter-ZNF21-DXS7465E (MG66)-DXS7927E (MG81)-WASP, DXS1011E, DXS7467E (MG21)-DXS-7466E (MG44)-GATA1-DXS7469E (Xp664)-TFE3-SYP (DXS1007E)-Xcen. This contig extends the coverage in Xp11 and provides a framework for the future identification and mapping of new genes, as well as the resources for developing DNA sequencing templates. 47 refs., 1 fig., 4 tabs.