WorldWideScience

Sample records for fidelity contig linking

  1. High-fidelity angle-modulated analog optical link.

    Science.gov (United States)

    Che, Di; Yuan, Feng; Shieh, William

    2016-07-25

    There has long existed a debate over whether analog or digital optical link is more suitable for wireless convergence applications. Digital link achieves the highest fidelity, with the sacrifice of huge bandwidth due to the high resolution of digitization, and large power consumption due to the exhaustive digital data recovery. Analog link avoids these drawbacks, but it inevitably suffers from the SNR degradation. In this paper, we propose the angle modulation for analog optical link, which successfully breaks the SNR ceiling of amplitude modulation, and achieves ultrahigh link fidelity. Using the digital link (CPRI) equivalent bandwidth, angle modulation exhibits around 30-dB SNR advantage over the conventional amplitude modulation. Combined with its high tolerance on link nonlinearity, angle modulation has great potential in the future SNR-hungry analog optical applications.

  2. AcEST: CL1404Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1404Contig1 1301 3 Adiantum capillus-veneris contig: CL1404contig1 sequence. Link... to clone list Show CL1404Contig1 Contig ID CL1404Contig1 Length 1301 Number of clones 3 Definition Adiantum... capillus-veneris contig: CL1404contig1 sequence. Link to clone list Link to clone list Clone ID DK959777 DK

  3. AcEST: CL2584Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2584Contig1 1164 2 Adiantum capillus-veneris contig: CL2584contig1 sequence. Link... to clone list Show CL2584Contig1 Contig ID CL2584Contig1 Length 1164 Number of clones 2 Definition Adiantum... capillus-veneris contig: CL2584contig1 sequence. Link to clone list Link to clone list Clone ID DK948731 DK

  4. AcEST: CL1714Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1714Contig1 1002 3 Adiantum capillus-veneris contig: CL1714contig1 sequence. Link... to clone list Show CL1714Contig1 Contig ID CL1714Contig1 Length 1002 Number of clones 3 Definition Adiantum... capillus-veneris contig: CL1714contig1 sequence. Link to clone list Link to clone list Clone ID BP911909 DK

  5. Link between statistical equilibrium fidelity and forecasting skill for complex systems with model error.

    Science.gov (United States)

    Majda, Andrew J; Gershgorin, Boris

    2011-08-02

    Understanding and improving the predictive skill of imperfect models for complex systems in their response to external forcing is a crucial issue in diverse applications such as for example climate change science. Equilibrium statistical fidelity of the imperfect model on suitable coarse-grained variables is a necessary but not sufficient condition for this predictive skill, and elementary examples are given here demonstrating this. Here, with equilibrium statistical fidelity of the imperfect model, a direct link is developed between the predictive fidelity of specific test problems in the training phase where the perfect natural system is observed and the predictive skill for the forced response of the imperfect model by combining appropriate concepts from information theory with other concepts based on the fluctuation dissipation theorem. Here a suite of mathematically tractable models with nontrivial eddy diffusivity, variance, and intermittent non-Gaussian statistics mimicking crucial features of atmospheric tracers together with stochastically forced standard eddy diffusivity approximation with model error are utilized to illustrate this link.

  6. AcEST: CL106Contig2 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL106Contig2 955 6 Adiantum capillus-veneris contig: CL106contig2 sequence. Link to clone list Show CL10...6Contig2 Contig ID CL106Contig2 Length 955 Number of clones 6 Definition Adiantum capillus-veneris contig: CL10

  7. AcEST: CL2030Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2030Contig1 559 2 Adiantum capillus-veneris contig: CL2030contig1 sequence. Link to clone list Show CL2030...Contig1 Contig ID CL2030Contig1 Length 559 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2030contig1 sequence. Link to clone list Link to clone list Clone ID BP913053 BP91

  8. AcEST: CL1707Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1707Contig1 774 3 Adiantum capillus-veneris contig: CL1707contig1 sequence. Link to clone list Show CL1707...Contig1 Contig ID CL1707Contig1 Length 774 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1707contig1 sequence. Link to clone list Link to clone list Clone ID DK950158 DK95

  9. AcEST: CL2000Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2000Contig1 573 2 Adiantum capillus-veneris contig: CL2000contig1 sequence. Link to clone list Show CL2000...Contig1 Contig ID CL2000Contig1 Length 573 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2000contig1 sequence. Link to clone list Link to clone list Clone ID DK961207 DK95

  10. AcEST: CL2016Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2016Contig1 715 2 Adiantum capillus-veneris contig: CL2016contig1 sequence. Link to clone list Show CL2016...Contig1 Contig ID CL2016Contig1 Length 715 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2016contig1 sequence. Link to clone list Link to clone list Clone ID DK957912 DK95

  11. AcEST: CL1915Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1915Contig1 488 2 Adiantum capillus-veneris contig: CL1915contig1 sequence. Link to clone list Show CL1915...Contig1 Contig ID CL1915Contig1 Length 488 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1915contig1 sequence. Link to clone list Link to clone list Clone ID BP914725 BP92

  12. AcEST: CL1069Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1069Contig1 591 3 Adiantum capillus-veneris contig: CL1069contig1 sequence. Link to clone list Show CL10...69Contig1 Contig ID CL1069Contig1 Length 591 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1069contig1 sequence. Link to clone list Link to clone list Clone ID BP917473 BP92

  13. AcEST: CL1026Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1026Contig1 673 2 Adiantum capillus-veneris contig: CL1026contig1 sequence. Link to clone list Show CL10...26Contig1 Contig ID CL1026Contig1 Length 673 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1026contig1 sequence. Link to clone list Link to clone list Clone ID DK957514 DK96

  14. AcEST: CL1013Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1013Contig1 734 3 Adiantum capillus-veneris contig: CL1013contig1 sequence. Link to clone list Show CL10...13Contig1 Contig ID CL1013Contig1 Length 734 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1013contig1 sequence. Link to clone list Link to clone list Clone ID DK948774 DK94

  15. AcEST: CL1048Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1048Contig1 770 3 Adiantum capillus-veneris contig: CL1048contig1 sequence. Link to clone list Show CL10...48Contig1 Contig ID CL1048Contig1 Length 770 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1048contig1 sequence. Link to clone list Link to clone list Clone ID BP917101 BP91

  16. AcEST: CL1072Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1072Contig1 777 3 Adiantum capillus-veneris contig: CL1072contig1 sequence. Link to clone list Show CL10...72Contig1 Contig ID CL1072Contig1 Length 777 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1072contig1 sequence. Link to clone list Link to clone list Clone ID DK951675 DK96

  17. AcEST: CL1005Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1005Contig1 900 3 Adiantum capillus-veneris contig: CL1005contig1 sequence. Link to clone list Show CL10...05Contig1 Contig ID CL1005Contig1 Length 900 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1005contig1 sequence. Link to clone list Link to clone list Clone ID DK944233 DK95

  18. AcEST: CL1064Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1064Contig1 652 3 Adiantum capillus-veneris contig: CL1064contig1 sequence. Link to clone list Show CL10...64Contig1 Contig ID CL1064Contig1 Length 652 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1064contig1 sequence. Link to clone list Link to clone list Clone ID DK957247 DK96

  19. AcEST: CL1043Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1043Contig1 878 3 Adiantum capillus-veneris contig: CL1043contig1 sequence. Link to clone list Show CL10...43Contig1 Contig ID CL1043Contig1 Length 878 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1043contig1 sequence. Link to clone list Link to clone list Clone ID DK959077 DK95

  20. AcEST: CL1081Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1081Contig1 708 3 Adiantum capillus-veneris contig: CL1081contig1 sequence. Link to clone list Show CL10...81Contig1 Contig ID CL1081Contig1 Length 708 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1081contig1 sequence. Link to clone list Link to clone list Clone ID DK947974 DK96

  1. AcEST: CL1034Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1034Contig1 1474 3 Adiantum capillus-veneris contig: CL1034contig1 sequence. Link to clone list Show CL10...34Contig1 Contig ID CL1034Contig1 Length 1474 Number of clones 3 Definition Adiantum... capillus-veneris contig: CL1034contig1 sequence. Link to clone list Link to clone list Clone ID DK958212 DK

  2. AcEST: CL1086Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1086Contig1 736 3 Adiantum capillus-veneris contig: CL1086contig1 sequence. Link to clone list Show CL10...86Contig1 Contig ID CL1086Contig1 Length 736 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1086contig1 sequence. Link to clone list Link to clone list Clone ID BP916608 DK96

  3. AcEST: CL1078Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1078Contig1 774 3 Adiantum capillus-veneris contig: CL1078contig1 sequence. Link to clone list Show CL10...78Contig1 Contig ID CL1078Contig1 Length 774 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1078contig1 sequence. Link to clone list Link to clone list Clone ID DK949412 DK96

  4. AcEST: CL1938Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1938Contig1 1158 2 Adiantum capillus-veneris contig: CL1938contig1 sequence. Link to clone list Show CL193...8Contig1 Contig ID CL1938Contig1 Length 1158 Number of clones 2 Definition Adiantum... capillus-veneris contig: CL1938contig1 sequence. Link to clone list Link to clone list Clone ID DK947527 DK

  5. AcEST: CL3333Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3333Contig1 668 2 Adiantum capillus-veneris contig: CL3333contig1 sequence. Link to clone list Show CL333...3Contig1 Contig ID CL3333Contig1 Length 668 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3333contig1 sequence. Link to clone list Link to clone list Clone ID DK944202 DK95

  6. AcEST: CL2015Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2015Contig1 803 2 Adiantum capillus-veneris contig: CL2015contig1 sequence. Link to clone list Show CL2015...Contig1 Contig ID CL2015Contig1 Length 803 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2015contig1 sequence. Link to clone list Link to clone list Clone ID DK945591 DK94

  7. AcEST: CL407Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL407Contig1 1401 6 Adiantum capillus-veneris contig: CL407contig1 sequence. Link t...illus-veneris contig: CL407contig1 sequence. Link to clone list Link to clone list Clone ID DK949437 DK95228...o clone list Show CL407Contig1 Contig ID CL407Contig1 Length 1401 Number of clones 6 Definition Adiantum cap

  8. AcEST: CL1011Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1011Contig1 773 3 Adiantum capillus-veneris contig: CL1011contig1 sequence. Link to clone list Show CL1011...Contig1 Contig ID CL1011Contig1 Length 773 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1011contig1 sequence. Link to clone list Link to clone list Clone ID BP911446 BP91

  9. AcEST: CL1984Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1984Contig1 553 2 Adiantum capillus-veneris contig: CL1984contig1 sequence. Link to clone list Show CL1984...Contig1 Contig ID CL1984Contig1 Length 553 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1984contig1 sequence. Link to clone list Link to clone list Clone ID BP919579 DK94

  10. AcEST: CL2904Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2904Contig1 681 2 Adiantum capillus-veneris contig: CL2904contig1 sequence. Link ...to clone list Show CL2904Contig1 Contig ID CL2904Contig1 Length 681 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2904contig1 sequence. Link to clone list Link to clone list Clone ID BP912040 BP91

  11. AcEST: CL2344Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2344Contig1 739 2 Adiantum capillus-veneris contig: CL2344contig1 sequence. Link ...to clone list Show CL2344Contig1 Contig ID CL2344Contig1 Length 739 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2344contig1 sequence. Link to clone list Link to clone list Clone ID DK952121 DK96

  12. AcEST: CL3014Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3014Contig1 702 2 Adiantum capillus-veneris contig: CL3014contig1 sequence. Link ...to clone list Show CL3014Contig1 Contig ID CL3014Contig1 Length 702 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3014contig1 sequence. Link to clone list Link to clone list Clone ID DK949230 DK96

  13. AcEST: CL3884Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3884Contig1 500 2 Adiantum capillus-veneris contig: CL3884contig1 sequence. Link ...to clone list Show CL3884Contig1 Contig ID CL3884Contig1 Length 500 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3884contig1 sequence. Link to clone list Link to clone list Clone ID BP915289 BP91

  14. AcEST: CL3804Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3804Contig1 479 2 Adiantum capillus-veneris contig: CL3804contig1 sequence. Link ...to clone list Show CL3804Contig1 Contig ID CL3804Contig1 Length 479 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3804contig1 sequence. Link to clone list Link to clone list Clone ID BP920197 BP92

  15. AcEST: CL3144Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3144Contig1 915 2 Adiantum capillus-veneris contig: CL3144contig1 sequence. Link ...to clone list Show CL3144Contig1 Contig ID CL3144Contig1 Length 915 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3144contig1 sequence. Link to clone list Link to clone list Clone ID BP918197 DK94

  16. AcEST: CL3824Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3824Contig1 502 2 Adiantum capillus-veneris contig: CL3824contig1 sequence. Link ...to clone list Show CL3824Contig1 Contig ID CL3824Contig1 Length 502 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3824contig1 sequence. Link to clone list Link to clone list Clone ID BP914362 BP91

  17. AcEST: CL1824Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1824Contig1 517 3 Adiantum capillus-veneris contig: CL1824contig1 sequence. Link ...to clone list Show CL1824Contig1 Contig ID CL1824Contig1 Length 517 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1824contig1 sequence. Link to clone list Link to clone list Clone ID BP917421 BP91

  18. AcEST: CL3914Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3914Contig1 551 2 Adiantum capillus-veneris contig: CL3914contig1 sequence. Link ...to clone list Show CL3914Contig1 Contig ID CL3914Contig1 Length 551 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3914contig1 sequence. Link to clone list Link to clone list Clone ID DK945967 DK95

  19. AcEST: CL4114Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4114Contig1 565 2 Adiantum capillus-veneris contig: CL4114contig1 sequence. Link ...to clone list Show CL4114Contig1 Contig ID CL4114Contig1 Length 565 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4114contig1 sequence. Link to clone list Link to clone list Clone ID BP913130 BP92

  20. AcEST: CL3284Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3284Contig1 713 2 Adiantum capillus-veneris contig: CL3284contig1 sequence. Link ...to clone list Show CL3284Contig1 Contig ID CL3284Contig1 Length 713 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3284contig1 sequence. Link to clone list Link to clone list Clone ID DK949414 DK95

  1. AcEST: CL884Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL884Contig1 1163 4 Adiantum capillus-veneris contig: CL884contig1 sequence. Link to clone list Show CL884C...ontig1 Contig ID CL884Contig1 Length 1163 Number of clones 4 Definition Adiantum cap...illus-veneris contig: CL884contig1 sequence. Link to clone list Link to clone list Clone ID BP914973 BP91531

  2. AcEST: CL1394Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1394Contig1 558 3 Adiantum capillus-veneris contig: CL1394contig1 sequence. Link ...to clone list Show CL1394Contig1 Contig ID CL1394Contig1 Length 558 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1394contig1 sequence. Link to clone list Link to clone list Clone ID BP920453 BP91

  3. AcEST: CL4014Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4014Contig1 714 2 Adiantum capillus-veneris contig: CL4014contig1 sequence. Link ...to clone list Show CL4014Contig1 Contig ID CL4014Contig1 Length 714 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4014contig1 sequence. Link to clone list Link to clone list Clone ID DK947404 DK95

  4. AcEST: CL3114Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3114Contig1 525 2 Adiantum capillus-veneris contig: CL3114contig1 sequence. Link ...to clone list Show CL3114Contig1 Contig ID CL3114Contig1 Length 525 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3114contig1 sequence. Link to clone list Link to clone list Clone ID BP912968 BP92

  5. AcEST: CL1574Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1574Contig1 763 3 Adiantum capillus-veneris contig: CL1574contig1 sequence. Link ...to clone list Show CL1574Contig1 Contig ID CL1574Contig1 Length 763 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1574contig1 sequence. Link to clone list Link to clone list Clone ID DK950051 DK96

  6. AcEST: CL4054Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4054Contig1 560 2 Adiantum capillus-veneris contig: CL4054contig1 sequence. Link ...to clone list Show CL4054Contig1 Contig ID CL4054Contig1 Length 560 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4054contig1 sequence. Link to clone list Link to clone list Clone ID BP912674 BP91

  7. AcEST: CL2544Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2544Contig1 560 2 Adiantum capillus-veneris contig: CL2544contig1 sequence. Link ...to clone list Show CL2544Contig1 Contig ID CL2544Contig1 Length 560 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2544contig1 sequence. Link to clone list Link to clone list Clone ID BP916245 DK94

  8. AcEST: CL1084Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1084Contig1 520 3 Adiantum capillus-veneris contig: CL1084contig1 sequence. Link ...to clone list Show CL1084Contig1 Contig ID CL1084Contig1 Length 520 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1084contig1 sequence. Link to clone list Link to clone list Clone ID DK945364 DK94

  9. AcEST: CL2024Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2024Contig1 637 2 Adiantum capillus-veneris contig: CL2024contig1 sequence. Link ...to clone list Show CL2024Contig1 Contig ID CL2024Contig1 Length 637 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2024contig1 sequence. Link to clone list Link to clone list Clone ID BP913935 DK95

  10. AcEST: CL1464Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1464Contig1 685 3 Adiantum capillus-veneris contig: CL1464contig1 sequence. Link ...to clone list Show CL1464Contig1 Contig ID CL1464Contig1 Length 685 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1464contig1 sequence. Link to clone list Link to clone list Clone ID DK949355 DK95

  11. AcEST: CL1934Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1934Contig1 519 2 Adiantum capillus-veneris contig: CL1934contig1 sequence. Link ...to clone list Show CL1934Contig1 Contig ID CL1934Contig1 Length 519 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1934contig1 sequence. Link to clone list Link to clone list Clone ID BP920422 BP92

  12. AcEST: CL2764Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2764Contig1 603 2 Adiantum capillus-veneris contig: CL2764contig1 sequence. Link ...to clone list Show CL2764Contig1 Contig ID CL2764Contig1 Length 603 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2764contig1 sequence. Link to clone list Link to clone list Clone ID BP913002 BP92

  13. AcEST: CL3424Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3424Contig1 648 2 Adiantum capillus-veneris contig: CL3424contig1 sequence. Link ...to clone list Show CL3424Contig1 Contig ID CL3424Contig1 Length 648 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3424contig1 sequence. Link to clone list Link to clone list Clone ID DK954761 DK95

  14. AcEST: CL1974Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1974Contig1 518 2 Adiantum capillus-veneris contig: CL1974contig1 sequence. Link ...to clone list Show CL1974Contig1 Contig ID CL1974Contig1 Length 518 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1974contig1 sequence. Link to clone list Link to clone list Clone ID BP921289 BP92

  15. AcEST: CL2234Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2234Contig1 492 2 Adiantum capillus-veneris contig: CL2234contig1 sequence. Link ...to clone list Show CL2234Contig1 Contig ID CL2234Contig1 Length 492 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2234contig1 sequence. Link to clone list Link to clone list Clone ID BP915336 BP91

  16. AcEST: CL3034Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3034Contig1 636 2 Adiantum capillus-veneris contig: CL3034contig1 sequence. Link ...to clone list Show CL3034Contig1 Contig ID CL3034Contig1 Length 636 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3034contig1 sequence. Link to clone list Link to clone list Clone ID DK954689 DK95

  17. AcEST: CL1284Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1284Contig1 438 3 Adiantum capillus-veneris contig: CL1284contig1 sequence. Link ...to clone list Show CL1284Contig1 Contig ID CL1284Contig1 Length 438 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1284contig1 sequence. Link to clone list Link to clone list Clone ID BP914601 BP91

  18. AcEST: CL4224Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4224Contig1 552 2 Adiantum capillus-veneris contig: CL4224contig1 sequence. Link ...to clone list Show CL4224Contig1 Contig ID CL4224Contig1 Length 552 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4224contig1 sequence. Link to clone list Link to clone list Clone ID BP914201 BP91

  19. AcEST: CL3174Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3174Contig1 676 2 Adiantum capillus-veneris contig: CL3174contig1 sequence. Link ...to clone list Show CL3174Contig1 Contig ID CL3174Contig1 Length 676 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3174contig1 sequence. Link to clone list Link to clone list Clone ID DK953976 DK95

  20. AcEST: CL1964Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1964Contig1 560 2 Adiantum capillus-veneris contig: CL1964contig1 sequence. Link ...to clone list Show CL1964Contig1 Contig ID CL1964Contig1 Length 560 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1964contig1 sequence. Link to clone list Link to clone list Clone ID BP918751 BP92

  1. AcEST: CL1334Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1334Contig1 575 3 Adiantum capillus-veneris contig: CL1334contig1 sequence. Link ...to clone list Show CL1334Contig1 Contig ID CL1334Contig1 Length 575 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1334contig1 sequence. Link to clone list Link to clone list Clone ID DK947672 DK94

  2. AcEST: CL1044Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1044Contig1 597 3 Adiantum capillus-veneris contig: CL1044contig1 sequence. Link ...to clone list Show CL1044Contig1 Contig ID CL1044Contig1 Length 597 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1044contig1 sequence. Link to clone list Link to clone list Clone ID BP915321 BP91

  3. AcEST: CL3774Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3774Contig1 541 2 Adiantum capillus-veneris contig: CL3774contig1 sequence. Link ...to clone list Show CL3774Contig1 Contig ID CL3774Contig1 Length 541 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3774contig1 sequence. Link to clone list Link to clone list Clone ID BP918618 DK95

  4. AcEST: CL2694Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2694Contig1 508 2 Adiantum capillus-veneris contig: CL2694contig1 sequence. Link ...to clone list Show CL2694Contig1 Contig ID CL2694Contig1 Length 508 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2694contig1 sequence. Link to clone list Link to clone list Clone ID BP913050 BP91

  5. AcEST: CL494Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL494Contig1 1020 5 Adiantum capillus-veneris contig: CL494contig1 sequence. Link to clone list Show CL494C...ontig1 Contig ID CL494Contig1 Length 1020 Number of clones 5 Definition Adiantum cap...illus-veneris contig: CL494contig1 sequence. Link to clone list Link to clone list Clone ID BP917437 DK95122

  6. AcEST: CL3844Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3844Contig1 539 2 Adiantum capillus-veneris contig: CL3844contig1 sequence. Link ...to clone list Show CL3844Contig1 Contig ID CL3844Contig1 Length 539 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3844contig1 sequence. Link to clone list Link to clone list Clone ID BP919996 BP91

  7. AcEST: CL2654Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2654Contig1 401 2 Adiantum capillus-veneris contig: CL2654contig1 sequence. Link ...to clone list Show CL2654Contig1 Contig ID CL2654Contig1 Length 401 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2654contig1 sequence. Link to clone list Link to clone list Clone ID BP914911 BP92

  8. AcEST: CL1894Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1894Contig1 513 2 Adiantum capillus-veneris contig: CL1894contig1 sequence. Link ...to clone list Show CL1894Contig1 Contig ID CL1894Contig1 Length 513 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1894contig1 sequence. Link to clone list Link to clone list Clone ID BP912406 BP91

  9. AcEST: CL3004Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3004Contig1 575 2 Adiantum capillus-veneris contig: CL3004contig1 sequence. Link ...to clone list Show CL3004Contig1 Contig ID CL3004Contig1 Length 575 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3004contig1 sequence. Link to clone list Link to clone list Clone ID DK957195 DK95

  10. AcEST: CL4144Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4144Contig1 522 2 Adiantum capillus-veneris contig: CL4144contig1 sequence. Link ...to clone list Show CL4144Contig1 Contig ID CL4144Contig1 Length 522 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4144contig1 sequence. Link to clone list Link to clone list Clone ID BP911500 BP91

  11. AcEST: CL3754Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3754Contig1 502 2 Adiantum capillus-veneris contig: CL3754contig1 sequence. Link ...to clone list Show CL3754Contig1 Contig ID CL3754Contig1 Length 502 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3754contig1 sequence. Link to clone list Link to clone list Clone ID BP911704 BP91

  12. AcEST: CL3734Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3734Contig1 435 2 Adiantum capillus-veneris contig: CL3734contig1 sequence. Link ...to clone list Show CL3734Contig1 Contig ID CL3734Contig1 Length 435 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3734contig1 sequence. Link to clone list Link to clone list Clone ID BP915370 BP91

  13. AcEST: CL2794Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2794Contig1 875 2 Adiantum capillus-veneris contig: CL2794contig1 sequence. Link ...to clone list Show CL2794Contig1 Contig ID CL2794Contig1 Length 875 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2794contig1 sequence. Link to clone list Link to clone list Clone ID BP912545 DK94

  14. AcEST: CL2364Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2364Contig1 544 2 Adiantum capillus-veneris contig: CL2364contig1 sequence. Link ...to clone list Show CL2364Contig1 Contig ID CL2364Contig1 Length 544 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2364contig1 sequence. Link to clone list Link to clone list Clone ID DK958446 DK94

  15. AcEST: CL4234Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4234Contig1 527 2 Adiantum capillus-veneris contig: CL4234contig1 sequence. Link ...to clone list Show CL4234Contig1 Contig ID CL4234Contig1 Length 527 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4234contig1 sequence. Link to clone list Link to clone list Clone ID BP916636 BP91

  16. AcEST: CL3594Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3594Contig1 715 2 Adiantum capillus-veneris contig: CL3594contig1 sequence. Link ...to clone list Show CL3594Contig1 Contig ID CL3594Contig1 Length 715 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3594contig1 sequence. Link to clone list Link to clone list Clone ID DK954618 DK96

  17. AcEST: CL4124Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4124Contig1 508 2 Adiantum capillus-veneris contig: CL4124contig1 sequence. Link ...to clone list Show CL4124Contig1 Contig ID CL4124Contig1 Length 508 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4124contig1 sequence. Link to clone list Link to clone list Clone ID BP912126 BP91

  18. AcEST: CL114Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL114Contig1 1085 16 Adiantum capillus-veneris contig: CL114contig1 sequence. Link ...to clone list Show CL114Contig1 Contig ID CL114Contig1 Length 1085 Number of clones 16 Definition Adiantum c...apillus-veneris contig: CL114contig1 sequence. Link to clone list Link to clone list Clone ID DK952446 DK951

  19. AcEST: CL2414Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2414Contig1 676 2 Adiantum capillus-veneris contig: CL2414contig1 sequence. Link ...to clone list Show CL2414Contig1 Contig ID CL2414Contig1 Length 676 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2414contig1 sequence. Link to clone list Link to clone list Clone ID BP918455 DK95

  20. AcEST: CL1534Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1534Contig1 749 3 Adiantum capillus-veneris contig: CL1534contig1 sequence. Link ...to clone list Show CL1534Contig1 Contig ID CL1534Contig1 Length 749 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1534contig1 sequence. Link to clone list Link to clone list Clone ID DK946474 DK95

  1. AcEST: CL3954Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3954Contig1 638 2 Adiantum capillus-veneris contig: CL3954contig1 sequence. Link ...to clone list Show CL3954Contig1 Contig ID CL3954Contig1 Length 638 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3954contig1 sequence. Link to clone list Link to clone list Clone ID DK955379 DK95

  2. AcEST: CL3604Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3604Contig1 661 2 Adiantum capillus-veneris contig: CL3604contig1 sequence. Link ...to clone list Show CL3604Contig1 Contig ID CL3604Contig1 Length 661 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3604contig1 sequence. Link to clone list Link to clone list Clone ID DK959814 DK96

  3. AcEST: CL3464Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3464Contig1 356 2 Adiantum capillus-veneris contig: CL3464contig1 sequence. Link ...to clone list Show CL3464Contig1 Contig ID CL3464Contig1 Length 356 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3464contig1 sequence. Link to clone list Link to clone list Clone ID BP917276 BP91

  4. AcEST: CL4154Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4154Contig1 568 2 Adiantum capillus-veneris contig: CL4154contig1 sequence. Link ...to clone list Show CL4154Contig1 Contig ID CL4154Contig1 Length 568 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4154contig1 sequence. Link to clone list Link to clone list Clone ID BP919307 DK95

  5. AcEST: CL1954Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1954Contig1 556 2 Adiantum capillus-veneris contig: CL1954contig1 sequence. Link ...to clone list Show CL1954Contig1 Contig ID CL1954Contig1 Length 556 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1954contig1 sequence. Link to clone list Link to clone list Clone ID BP917469 BP91

  6. AcEST: CL2634Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2634Contig1 518 2 Adiantum capillus-veneris contig: CL2634contig1 sequence. Link ...to clone list Show CL2634Contig1 Contig ID CL2634Contig1 Length 518 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2634contig1 sequence. Link to clone list Link to clone list Clone ID BP920343 DK96

  7. AcEST: CL3354Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3354Contig1 666 2 Adiantum capillus-veneris contig: CL3354contig1 sequence. Link ...to clone list Show CL3354Contig1 Contig ID CL3354Contig1 Length 666 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3354contig1 sequence. Link to clone list Link to clone list Clone ID DK959005 DK94

  8. AcEST: CL3244Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3244Contig1 517 2 Adiantum capillus-veneris contig: CL3244contig1 sequence. Link ...to clone list Show CL3244Contig1 Contig ID CL3244Contig1 Length 517 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3244contig1 sequence. Link to clone list Link to clone list Clone ID BP916391 BP91

  9. AcEST: CL2834Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2834Contig1 590 2 Adiantum capillus-veneris contig: CL2834contig1 sequence. Link ...to clone list Show CL2834Contig1 Contig ID CL2834Contig1 Length 590 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2834contig1 sequence. Link to clone list Link to clone list Clone ID BP917112 BP92

  10. AcEST: CL1854Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1854Contig1 957 2 Adiantum capillus-veneris contig: CL1854contig1 sequence. Link ...to clone list Show CL1854Contig1 Contig ID CL1854Contig1 Length 957 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1854contig1 sequence. Link to clone list Link to clone list Clone ID DK950878 DK95

  11. AcEST: CL1644Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1644Contig1 704 3 Adiantum capillus-veneris contig: CL1644contig1 sequence. Link ...to clone list Show CL1644Contig1 Contig ID CL1644Contig1 Length 704 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1644contig1 sequence. Link to clone list Link to clone list Clone ID DK953903 DK95

  12. AcEST: CL2974Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2974Contig1 795 2 Adiantum capillus-veneris contig: CL2974contig1 sequence. Link ...to clone list Show CL2974Contig1 Contig ID CL2974Contig1 Length 795 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2974contig1 sequence. Link to clone list Link to clone list Clone ID DK956785 DK95

  13. AcEST: CL1994Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1994Contig1 423 2 Adiantum capillus-veneris contig: CL1994contig1 sequence. Link ...to clone list Show CL1994Contig1 Contig ID CL1994Contig1 Length 423 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1994contig1 sequence. Link to clone list Link to clone list Clone ID BP914351 BP91

  14. AcEST: CL3534Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3534Contig1 649 2 Adiantum capillus-veneris contig: CL3534contig1 sequence. Link ...to clone list Show CL3534Contig1 Contig ID CL3534Contig1 Length 649 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3534contig1 sequence. Link to clone list Link to clone list Clone ID DK961062 DK96

  15. AcEST: CL2164Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2164Contig1 578 2 Adiantum capillus-veneris contig: CL2164contig1 sequence. Link ...to clone list Show CL2164Contig1 Contig ID CL2164Contig1 Length 578 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2164contig1 sequence. Link to clone list Link to clone list Clone ID BP913905 BP91

  16. AcEST: CL4184Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4184Contig1 497 2 Adiantum capillus-veneris contig: CL4184contig1 sequence. Link ...to clone list Show CL4184Contig1 Contig ID CL4184Contig1 Length 497 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4184contig1 sequence. Link to clone list Link to clone list Clone ID BP921440 BP92

  17. AcEST: CL1784Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1784Contig1 751 3 Adiantum capillus-veneris contig: CL1784contig1 sequence. Link ...to clone list Show CL1784Contig1 Contig ID CL1784Contig1 Length 751 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1784contig1 sequence. Link to clone list Link to clone list Clone ID DK963428 DK95

  18. AcEST: CL4044Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4044Contig1 720 2 Adiantum capillus-veneris contig: CL4044contig1 sequence. Link ...to clone list Show CL4044Contig1 Contig ID CL4044Contig1 Length 720 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4044contig1 sequence. Link to clone list Link to clone list Clone ID DK949249 DK96

  19. AcEST: CL2094Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2094Contig1 919 2 Adiantum capillus-veneris contig: CL2094contig1 sequence. Link ...to clone list Show CL2094Contig1 Contig ID CL2094Contig1 Length 919 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2094contig1 sequence. Link to clone list Link to clone list Clone ID DK950845 DK95

  20. AcEST: CL4134Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4134Contig1 750 2 Adiantum capillus-veneris contig: CL4134contig1 sequence. Link ...to clone list Show CL4134Contig1 Contig ID CL4134Contig1 Length 750 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4134contig1 sequence. Link to clone list Link to clone list Clone ID DK955452 DK95

  1. AcEST: CL3104Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3104Contig1 570 2 Adiantum capillus-veneris contig: CL3104contig1 sequence. Link ...to clone list Show CL3104Contig1 Contig ID CL3104Contig1 Length 570 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3104contig1 sequence. Link to clone list Link to clone list Clone ID BP919102 BP91

  2. AcEST: CL1154Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1154Contig1 540 3 Adiantum capillus-veneris contig: CL1154contig1 sequence. Link ...to clone list Show CL1154Contig1 Contig ID CL1154Contig1 Length 540 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1154contig1 sequence. Link to clone list Link to clone list Clone ID BP912509 BP91

  3. AcEST: CL1884Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1884Contig1 844 2 Adiantum capillus-veneris contig: CL1884contig1 sequence. Link ...to clone list Show CL1884Contig1 Contig ID CL1884Contig1 Length 844 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1884contig1 sequence. Link to clone list Link to clone list Clone ID DK950217 DK95

  4. AcEST: CL4084Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4084Contig1 645 2 Adiantum capillus-veneris contig: CL4084contig1 sequence. Link ...to clone list Show CL4084Contig1 Contig ID CL4084Contig1 Length 645 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4084contig1 sequence. Link to clone list Link to clone list Clone ID DK954011 DK95

  5. AcEST: CL1224Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1224Contig1 575 3 Adiantum capillus-veneris contig: CL1224contig1 sequence. Link ...to clone list Show CL1224Contig1 Contig ID CL1224Contig1 Length 575 Number of clones 3 Definition Adiantum c...apillus-veneris contig: CL1224contig1 sequence. Link to clone list Link to clone list Clone ID BP914718 BP91

  6. AcEST: CL1864Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1864Contig1 575 2 Adiantum capillus-veneris contig: CL1864contig1 sequence. Link ...to clone list Show CL1864Contig1 Contig ID CL1864Contig1 Length 575 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1864contig1 sequence. Link to clone list Link to clone list Clone ID DK961644 DK96

  7. AcEST: CL3214Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3214Contig1 888 2 Adiantum capillus-veneris contig: CL3214contig1 sequence. Link ...to clone list Show CL3214Contig1 Contig ID CL3214Contig1 Length 888 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL3214contig1 sequence. Link to clone list Link to clone list Clone ID DK950230 DK96

  8. AcEST: CL184Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL184Contig1 600 12 Adiantum capillus-veneris contig: CL184contig1 sequence. Link to clone list Show CL184C...ontig1 Contig ID CL184Contig1 Length 600 Number of clones 12 Definition Adiantum cap...illus-veneris contig: CL184contig1 sequence. Link to clone list Link to clone list Clone ID DK947517 DK94434

  9. AcEST: CL4074Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL4074Contig1 512 2 Adiantum capillus-veneris contig: CL4074contig1 sequence. Link ...to clone list Show CL4074Contig1 Contig ID CL4074Contig1 Length 512 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL4074contig1 sequence. Link to clone list Link to clone list Clone ID BP915482 BP92

  10. AcEST: CL2704Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2704Contig1 551 2 Adiantum capillus-veneris contig: CL2704contig1 sequence. Link ...to clone list Show CL2704Contig1 Contig ID CL2704Contig1 Length 551 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL2704contig1 sequence. Link to clone list Link to clone list Clone ID BP917117 BP92

  11. AcEST: CL1873Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1873Contig1 641 2 Adiantum capillus-veneris contig: CL1873contig1 sequence. Link to clone list Show CL1873...Contig1 Contig ID CL1873Contig1 Length 641 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1873contig1 sequence. Link to clone list Link to clone list Clone ID BP912694 BP92

  12. AcEST: CL1941Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1941Contig1 803 2 Adiantum capillus-veneris contig: CL1941contig1 sequence. Link to clone list Show CL1941...Contig1 Contig ID CL1941Contig1 Length 803 Number of clones 2 Definition Adiantum c...apillus-veneris contig: CL1941contig1 sequence. Link to clone list Link to clone list Clone ID DK952552 DK95

  13. AcEST: CL105Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL105Contig1 747 18 Adiantum capillus-veneris contig: CL105contig1 sequence. Link to clone list Show CL10...5Contig1 Contig ID CL105Contig1 Length 747 Number of clones 18 Definition Adiantum cap

  14. AcEST: CL434Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL434Contig1 697 6 Adiantum capillus-veneris contig: CL434contig1 sequence. Link to clone list Show CL434C...ontig1 Contig ID CL434Contig1 Length 697 Number of clones 6 Definition Adiantum capil

  15. AcEST: CL674Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL674Contig1 641 4 Adiantum capillus-veneris contig: CL674contig1 sequence. Link to clone list Show CL674C...ontig1 Contig ID CL674Contig1 Length 641 Number of clones 4 Definition Adiantum capil

  16. AcEST: CL814Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL814Contig1 558 4 Adiantum capillus-veneris contig: CL814contig1 sequence. Link to clone list Show CL814C...ontig1 Contig ID CL814Contig1 Length 558 Number of clones 4 Definition Adiantum capil

  17. AcEST: CL994Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL994Contig1 682 3 Adiantum capillus-veneris contig: CL994contig1 sequence. Link to clone list Show CL994C...ontig1 Contig ID CL994Contig1 Length 682 Number of clones 3 Definition Adiantum capil

  18. AcEST: CL894Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL894Contig1 555 4 Adiantum capillus-veneris contig: CL894contig1 sequence. Link to clone list Show CL894C...ontig1 Contig ID CL894Contig1 Length 555 Number of clones 4 Definition Adiantum capil

  19. AcEST: CL744Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL744Contig1 831 4 Adiantum capillus-veneris contig: CL744contig1 sequence. Link to clone list Show CL744C...ontig1 Contig ID CL744Contig1 Length 831 Number of clones 4 Definition Adiantum capil

  20. AcEST: CL324Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL324Contig1 723 7 Adiantum capillus-veneris contig: CL324contig1 sequence. Link to clone list Show CL324C...ontig1 Contig ID CL324Contig1 Length 723 Number of clones 7 Definition Adiantum capil

  1. AcEST: CL474Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL474Contig1 551 6 Adiantum capillus-veneris contig: CL474contig1 sequence. Link to clone list Show CL474C...ontig1 Contig ID CL474Contig1 Length 551 Number of clones 6 Definition Adiantum capil

  2. AcEST: CL984Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL984Contig1 627 3 Adiantum capillus-veneris contig: CL984contig1 sequence. Link to clone list Show CL984C...ontig1 Contig ID CL984Contig1 Length 627 Number of clones 3 Definition Adiantum capil

  3. AcEST: CL94Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL94Contig1 1752 20 Adiantum capillus-veneris contig: CL94contig1 sequence. Link to clone list Show CL94C...ontig1 Contig ID CL94Contig1 Length 1752 Number of clones 20 Definition Adiantum capil

  4. AcEST: CL504Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL504Contig1 794 5 Adiantum capillus-veneris contig: CL504contig1 sequence. Link to clone list Show CL504C...ontig1 Contig ID CL504Contig1 Length 794 Number of clones 5 Definition Adiantum capil

  5. AcEST: CL854Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL854Contig1 560 4 Adiantum capillus-veneris contig: CL854contig1 sequence. Link to clone list Show CL854C...ontig1 Contig ID CL854Contig1 Length 560 Number of clones 4 Definition Adiantum capil

  6. AcEST: CL924Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL924Contig1 673 4 Adiantum capillus-veneris contig: CL924contig1 sequence. Link to clone list Show CL924C...ontig1 Contig ID CL924Contig1 Length 673 Number of clones 4 Definition Adiantum capil

  7. AcEST: CL254Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL254Contig1 968 9 Adiantum capillus-veneris contig: CL254contig1 sequence. Link to clone list Show CL254C...ontig1 Contig ID CL254Contig1 Length 968 Number of clones 9 Definition Adiantum capil

  8. AcEST: CL64Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL64Contig1 1228 25 Adiantum capillus-veneris contig: CL64contig1 sequence. Link to clone list Show CL64C...ontig1 Contig ID CL64Contig1 Length 1228 Number of clones 25 Definition Adiantum capil

  9. AcEST: CL1407Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1407Contig1 711 3 Adiantum capillus-veneris contig: CL1407contig1 sequence. Link ...apillus-veneris contig: CL1407contig1 sequence. Link to clone list Link to clone list Clone ID DK945957 DK94

  10. AcEST: CL2407Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2407Contig1 855 2 Adiantum capillus-veneris contig: CL2407contig1 sequence. Link ...apillus-veneris contig: CL2407contig1 sequence. Link to clone list Link to clone list Clone ID BP917544 DK95

  11. AcEST: CL3407Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL3407Contig1 615 2 Adiantum capillus-veneris contig: CL3407contig1 sequence. Link ...apillus-veneris contig: CL3407contig1 sequence. Link to clone list Link to clone list Clone ID DK943946 DK95

  12. Construction of two YAC contigs in human xp11.23-p11.22, one encompassing the loci OATL1, GATA, TFE3, and SYP, the other linking DXS255 to DXS146

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, S.E.; Hatchwell, E.; Chand, A.; Ockenden, N.; Craig, I.W. [Univ. of Oxford, Oxford (United Kingdom)] [and others

    1995-09-20

    We have constructed two YAC contigs in the Xp11.23-p11.22 interval of the human X chromosome, a region that was previously poorly characterized. One contig, of at least 1.4 Mb, links the pseudogene OATL1 to the genes GATA1, TFE3, and SYP and also contains loci implicated in Wiskott-Aldrich syndrome and synovial sarcoma. A second contig, mapping proximal to the first, is estimated to be over 2.1 Mb and links the hypervariable locus DXS255 to DXS146, and also contains a chloride channel gene that is responsible for hereditary nephrolithiasis. We have used plasmid rescue, inverse PCR, and Alu-PCR to generate 20 novel markers from this region, 1 of which is polymorphic, and have positioned these relative to one another on the basis of YAC analysis. The order of previously known markers within our contigs, Xpter-OATL1-GATA-TFE3-SYP-DXS255-DXS146-Xcen, agrees with genomic pulsed-field maps of the region. In addition, we have constructed a rare-cutter restriction map for a 710-kb region of the DXS255-DXS146 contig and have identified three CpG islands. These contigs and new markers will provide a useful resource for more detailed analysis of Xp11.23-p11.22, a region implicated in several genetic diseases. 32 refs., 2 figs., 2 tabs.

  13. Construction of a YAC contig and STS map spanning 2.5 Mbp in Xq25, the critical region for the X-linked lymphoproliferative (XLP) gene

    Energy Technology Data Exchange (ETDEWEB)

    Lanyi, A.; Li, B.F.; Li, S. [Univ. of Nebraska Medical Center, Omaha, NE (United States)] [and others

    1994-09-01

    X-linked lymphoproliferative disease (XLP) is characterized by a marked vulnerability in Epstein-Barr virus (EBV) infection. Infection of XLP patients with EBV invariably results in fatal mononucleosis, agammaglobulinemia or B-cell lymphoma. The XLP gene lies within a 10 cM region in Xq25 between DXS42 and DXS10. Initial chromosome studies revealed an interstitial, cytogenetically visible deletion in Xq25 in one XLP family (43-004). We estimated the size of the Xq25 deletion by dual laser flow karyotyping to involve 2% of the X chromosome, or approximately 3 Mbp of DNA sequences. To further delineate the deletion we performed a series of pulsed field gel electrophoresis (PFGE) analyses which showed that DXS6 and DXS100, two Xq25-specific markers, are missing from 45-004 DNA. Five yeast artificial chromosomes (YACs) from a chromosome X specific YAC library containing sequences deleted in patient`s 43-004 DNA were isolated. These five YACs did not overlap, and their end fragments were used to screen the CEPH MegaYAC library. Seven YACs were isolated from the CEPH MegaYAC library. They could be arranged into a contig which spans between DXS6 and DXS100. The contig contains a minimum of 2.5 Mbp of human DNA. A total of 12 YAC end clone, lambda subclones and STS probes have been used to order clones within the contig. These reagents were also used in Southern blot and patients showed interstitial deletions in Xq25. The size of these deletions range between 0.5 and 2.5 Mbp. The shortest deletion probably represents the critical region for the XLP gene.

  14. Maximum Fidelity

    CERN Document Server

    Kinkhabwala, Ali

    2013-01-01

    The most fundamental problem in statistics is the inference of an unknown probability distribution from a finite number of samples. For a specific observed data set, answers to the following questions would be desirable: (1) Estimation: Which candidate distribution provides the best fit to the observed data?, (2) Goodness-of-fit: How concordant is this distribution with the observed data?, and (3) Uncertainty: How concordant are other candidate distributions with the observed data? A simple unified approach for univariate data that addresses these traditionally distinct statistical notions is presented called "maximum fidelity". Maximum fidelity is a strict frequentist approach that is fundamentally based on model concordance with the observed data. The fidelity statistic is a general information measure based on the coordinate-independent cumulative distribution and critical yet previously neglected symmetry considerations. An approximation for the null distribution of the fidelity allows its direct conversi...

  15. Development of the MCNPX depletion capability: A Monte Carlo linked depletion method that automates the coupling between MCNPX and CINDER90 for high fidelity burnup calculations

    Science.gov (United States)

    Fensin, Michael Lorne

    Monte Carlo-linked depletion methods have gained recent interest due to the ability to more accurately model complex 3-dimesional geometries and better track the evolution of temporal nuclide inventory by simulating the actual physical process utilizing continuous energy coefficients. The integration of CINDER90 into the MCNPX Monte Carlo radiation transport code provides a high-fidelity completely self-contained Monte-Carlo-linked depletion capability in a well established, widely accepted Monte Carlo radiation transport code that is compatible with most nuclear criticality (KCODE) particle tracking features in MCNPX. MCNPX depletion tracks all necessary reaction rates and follows as many isotopes as cross section data permits in order to achieve a highly accurate temporal nuclide inventory solution. This work chronicles relevant nuclear history, surveys current methodologies of depletion theory, details the methodology in applied MCNPX and provides benchmark results for three independent OECD/NEA benchmarks. Relevant nuclear history, from the Oklo reactor two billion years ago to the current major United States nuclear fuel cycle development programs, is addressed in order to supply the motivation for the development of this technology. A survey of current reaction rate and temporal nuclide inventory techniques is then provided to offer justification for the depletion strategy applied within MCNPX. The MCNPX depletion strategy is then dissected and each code feature is detailed chronicling the methodology development from the original linking of MONTEBURNS and MCNP to the most recent public release of the integrated capability (MCNPX 2.6.F). Calculation results of the OECD/NEA Phase IB benchmark, H. B. Robinson benchmark and OECD/NEA Phase IVB are then provided. The acceptable results of these calculations offer sufficient confidence in the predictive capability of the MCNPX depletion method. This capability sets up a significant foundation, in a well established

  16. Cuba after Fidel Castro.

    Science.gov (United States)

    1986-04-07

    domestic policies, and implications for U.S. policies posed by a post-Fidel Castro Cuban government. Born August 13, 1926, Fidel Castro Ruz is no longer...an area important to U.S.* interests. * The most probable successor to Fidel Castro is his * younger brother Raul Castro Ruz . Born June 3, 1931, Raul...Raul Castro Ruz was elected second secretary."I While Raul appears to be the mostly likely successor to his brother Fidel, he is not the only

  17. A 4.5-megabase YAC contig and physical map over the hemochromatosis gene region

    Energy Technology Data Exchange (ETDEWEB)

    Burt, M.J.; Smit, D.J.; Pyper, W.R.; Powell, L.W.; Jazwinska, E.C. [Univ. of Queensland, Brisbane (Australia)

    1996-04-15

    We have constructed a yeast artificial chromosome (YAC) contig over the candidate hemochromatosis gene region. This contig comprises hemochromatosis gene region. This contig comprises 16 YACs from the CEPH, Washington University, and ICI YAC libraries and covers 4.5 Mb at 6p21.3-6p22. The complete contig has been restriction mapped, enabling the precise relationship between the YACs to be determined and the mapping of a total of 12 STSs. Nine of these are highly polymorphic STSs that are closely linked to hemochromatosis; this series includes D6S265 and D6S1260, which comprise the most proximal and distal markers linked to HC. This is the first YAC contig that spans the hemochromatosis candidate region, and it provides valuable resource material for the cloning of this and other genes in the region distal to the MHC class I complex. 33 refs., 1 fig., 1 tab.

  18. Scattering fidelity in elastodynamics

    Science.gov (United States)

    Gorin, T.; Seligman, T. H.; Weaver, R. L.

    2006-01-01

    The recent introduction of the concept of scattering fidelity causes us to revisit the experiment by Lobkis and Weaver [Phys. Rev. Lett. 90, 254302 (2003)]. There, the “distortion” of the coda of an acoustic signal is measured under temperature changes. This quantity is, in fact, the negative logarithm of scattering fidelity. We reanalyze their experimental data for two samples, and we find good agreement with random matrix predictions for the standard fidelity. Usually, one may expect such an agreement for chaotic systems, only. While the first sample may indeed be assumed chaotic, for the second sample, a perfect cuboid, such an agreement is surprising. For the first sample, the random matrix analysis yields perturbation strengths compatible with semiclassical predictions. For the cuboid, the measured perturbation strengths are by a common factor of (5)/(3) too large. Apart from that, the experimental curves for the distortion are well reproduced.

  19. Fidelity in clinical simulation

    DEFF Research Database (Denmark)

    Jensen, Sanne; Nøhr, Christian; Rasmussen, Stine Loft

    2013-01-01

    Clinical simulation may be used to identify user needs for context sensitive functionalities in e-Health. The objective with this paper is to describe how user requirements and use cases in a large EHR-platform procurement may be validated by clinical simulation using a very low-fidelity prototype...... without any existing test data. Instead of using test scenarios and use cases, the healthcare professionals who are participating in the clinical simulation are generating both scenario and patient data themselves. We found that this approach allows for an imaginative discussion, not restricted by known...... functionalities and limitations, of the ideal EHR-platform. Subsequently, we discuss benefits and challenges of using an extremely low fidelity environment and discuss the degree of fidelity necessary for conducting clinical simulation....

  20. Generation of Physical Map Contig-Specific Sequences Useful for Whole Genome Sequence Scaffolding

    Science.gov (United States)

    Jiang, Yanliang; Ninwichian, Parichart; Liu, Shikai; Zhang, Jiaren; Kucuktas, Huseyin; Sun, Fanyue; Kaltenboeck, Ludmilla; Sun, Luyang; Bao, Lisui; Liu, Zhanjiang

    2013-01-01

    Along with the rapid advances of the nextgen sequencing technologies, more and more species are added to the list of organisms whose whole genomes are sequenced. However, the assembled draft genome of many organisms consists of numerous small contigs, due to the short length of the reads generated by nextgen sequencing platforms. In order to improve the assembly and bring the genome contigs together, more genome resources are needed. In this study, we developed a strategy to generate a valuable genome resource, physical map contig-specific sequences, which are randomly distributed genome sequences in each physical contig. Two-dimensional tagging method was used to create specific tags for 1,824 physical contigs, in which the cost was dramatically reduced. A total of 94,111,841 100-bp reads and 315,277 assembled contigs are identified containing physical map contig-specific tags. The physical map contig-specific sequences along with the currently available BAC end sequences were then used to anchor the catfish draft genome contigs. A total of 156,457 genome contigs (~79% of whole genome sequencing assembly) were anchored and grouped into 1,824 pools, in which 16,680 unique genes were annotated. The physical map contig-specific sequences are valuable resources to link physical map, genetic linkage map and draft whole genome sequences, consequently have the capability to improve the whole genome sequences assembly and scaffolding, and improve the genome-wide comparative analysis as well. The strategy developed in this study could also be adopted in other species whose whole genome assembly is still facing a challenge. PMID:24205335

  1. Generation of physical map contig-specific sequences useful for whole genome sequence scaffolding.

    Directory of Open Access Journals (Sweden)

    Yanliang Jiang

    Full Text Available Along with the rapid advances of the nextgen sequencing technologies, more and more species are added to the list of organisms whose whole genomes are sequenced. However, the assembled draft genome of many organisms consists of numerous small contigs, due to the short length of the reads generated by nextgen sequencing platforms. In order to improve the assembly and bring the genome contigs together, more genome resources are needed. In this study, we developed a strategy to generate a valuable genome resource, physical map contig-specific sequences, which are randomly distributed genome sequences in each physical contig. Two-dimensional tagging method was used to create specific tags for 1,824 physical contigs, in which the cost was dramatically reduced. A total of 94,111,841 100-bp reads and 315,277 assembled contigs are identified containing physical map contig-specific tags. The physical map contig-specific sequences along with the currently available BAC end sequences were then used to anchor the catfish draft genome contigs. A total of 156,457 genome contigs (~79% of whole genome sequencing assembly were anchored and grouped into 1,824 pools, in which 16,680 unique genes were annotated. The physical map contig-specific sequences are valuable resources to link physical map, genetic linkage map and draft whole genome sequences, consequently have the capability to improve the whole genome sequences assembly and scaffolding, and improve the genome-wide comparative analysis as well. The strategy developed in this study could also be adopted in other species whose whole genome assembly is still facing a challenge.

  2. A Blumeria graminis f.sp. hordei BAC library - contig building and microsynteny studies

    DEFF Research Database (Denmark)

    Pedersen, C.; Wu, B.; Giese, H.

    2002-01-01

    A bacterial artificial chromosome (BAC) library of Blumeria graminis f.sp. hordei, containing 12,000 clones with an average insert size of 41 kb, was constructed. The library represents about three genome equivalents and BAC-end sequencing showed a high content of repetitive sequences, making...... contigs, at or close to avirulence loci, were constructed. Single nucleotide polymorphism (SNP) markers were developed from BAC-end sequences to link the contigs to the genetic maps. Two other BAC contigs were used to study microsynteny between B. graminis and two other ascomycetes, Neurospora crassa...

  3. RTI Fidelity of Implementation Rubric

    Science.gov (United States)

    National Center on Response to Intervention, 2014

    2014-01-01

    The Response to Intervention (RTI) Fidelity Rubric is for use by individuals who are responsible for monitoring school-level fidelity of RTI implementation. The rubric is aligned with the essential components of RTI and the infrastructure that is necessary for successful implementation. It is accompanied by a worksheet with guiding questions and…

  4. Fidelity in Archaeal Information Processing

    Directory of Open Access Journals (Sweden)

    Bart de Koning

    2010-01-01

    Full Text Available A key element during the flow of genetic information in living systems is fidelity. The accuracy of DNA replication influences the genome size as well as the rate of genome evolution. The large amount of energy invested in gene expression implies that fidelity plays a major role in fitness. On the other hand, an increase in fidelity generally coincides with a decrease in velocity. Hence, an important determinant of the evolution of life has been the establishment of a delicate balance between fidelity and variability. This paper reviews the current knowledge on quality control in archaeal information processing. While the majority of these processes are homologous in Archaea, Bacteria, and Eukaryotes, examples are provided of nonorthologous factors and processes operating in the archaeal domain. In some instances, evidence for the existence of certain fidelity mechanisms has been provided, but the factors involved still remain to be identified.

  5. Norovirus Polymerase Fidelity Contributes to Viral Transmission In Vivo

    DEFF Research Database (Denmark)

    Arias Esteban, Armando; Thorne, Lucy; Ghurburrun, Elsa

    2016-01-01

    Intrahost genetic diversity and replication error rates are intricately linked to RNA virus pathogenesis, with alterations in viral polymerase fidelity typically leading to attenuation during infections in vivo. We have previously shown that norovirus intrahost genetic diversity also influences...... viral pathogenesis using the murine norovirus model, as increasing viral mutation frequency using a mutagenic nucleoside resulted in clearance of a persistent infection in mice. Given the role of replication fidelity and genetic diversity in pathogenesis, we have now investigated whether polymerase...... fidelity can also impact virus transmission between susceptible hosts. We have identified a high-fidelity norovirus RNA-dependent RNA polymerase mutant (I391L) which displays delayed replication kinetics in vivo but not in cell culture. The I391L polymerase mutant also exhibited lower transmission rates...

  6. High-fidelity quantum driving

    DEFF Research Database (Denmark)

    Bason, Mark George; Viteau, Matthieu; Malossi, Nicola

    2011-01-01

    Accurately controlling a quantum system is a fundamental requirement in quantum information processing and the coherent manipulation of molecular systems. The ultimate goal in quantum control is to prepare a desired state with the highest fidelity allowed by the available resources and the experi......Accurately controlling a quantum system is a fundamental requirement in quantum information processing and the coherent manipulation of molecular systems. The ultimate goal in quantum control is to prepare a desired state with the highest fidelity allowed by the available resources...

  7. High-fidelity quantum driving

    DEFF Research Database (Denmark)

    Bason, Mark George; Viteau, Matthieu; Malossi, Nicola

    2011-01-01

    Accurately controlling a quantum system is a fundamental requirement in quantum information processing and the coherent manipulation of molecular systems. The ultimate goal in quantum control is to prepare a desired state with the highest fidelity allowed by the available resources...... and the experimental constraints. Here we experimentally implement two optimal high-fidelity control protocols using a two-level quantum system comprising Bose–Einstein condensates in optical lattices. The first is a short-cut protocol that reaches the maximum quantum-transformation speed compatible...

  8. Curriculum Fidelity and Factors Affecting Fidelity in the Turkish Context

    Science.gov (United States)

    Bumen, Nilay T.; Cakar, Esra; Yildiz, Derya G.

    2014-01-01

    Although a centralist education system is in place in Turkey, studies show that while implementing the curriculum developed by the Ministry of Education, teachers make changes based on their own preferences or depending on students. Curriculum fidelity can be defined as the degree to which teachers or stakeholders abide by a curriculum's original…

  9. Fiscal loss and program fidelity: impact of the economic downturn on HIV/STI prevention program fidelity.

    Science.gov (United States)

    Catania, Joseph A; Dolcini, M Margaret; Gandelman, Alice A; Narayanan, Vasudha; McKay, Virginia R

    2014-03-01

    The economic downturn of 2007 created significant fiscal losses for public and private agencies conducting behavioral prevention. Such macro-economic changes may influence program implementation and sustainability. We examined how public and private agencies conducting RESPECT, a brief HIV/STI (sexually transmitted infection) counseling and testing intervention, adapted to fiscal loss and how these adaptations impacted program fidelity. We collected qualitative and quantitative data in a national sample of 15 agencies experiencing fiscal loss. Using qualitative analyses, we examined how program fidelity varied with different types of adaptations. Agencies reported three levels of adaptation: agency-level, program-level, and direct fiscal remedies. Private agencies tended to use direct fiscal remedies, which were associated with higher fidelity. Some agency-level adaptations contributed to reductions in procedural fit, leading to negative staff morale and decreased confidence in program effectiveness, which in turn, contributed to poor fidelity. Findings describe a "work stress pathway" that links program fiscal losses to poor staff morale and low program fidelity.

  10. Visual communication - Information and fidelity. [of images

    Science.gov (United States)

    Huck, Freidrich O.; Fales, Carl L.; Alter-Gartenberg, Rachel; Rahman, Zia-Ur; Reichenbach, Stephen E.

    1993-01-01

    This assessment of visual communication deals with image gathering, coding, and restoration as a whole rather than as separate and independent tasks. The approach focuses on two mathematical criteria, information and fidelity, and on their relationships to the entropy of the encoded data and to the visual quality of the restored image. Past applications of these criteria to the assessment of image coding and restoration have been limited to the link that connects the output of the image-gathering device to the input of the image-display device. By contrast, the approach presented in this paper explicitly includes the critical limiting factors that constrain image gathering and display. This extension leads to an end-to-end assessment theory of visual communication that combines optical design with digital processing.

  11. Stepwise mechanism for transcription fidelity

    Directory of Open Access Journals (Sweden)

    Zorov Savva

    2010-05-01

    Full Text Available Abstract Background Transcription is the first step of gene expression and is characterized by a high fidelity of RNA synthesis. During transcription, the RNA polymerase active centre discriminates against not just non-complementary ribo NTP substrates but also against complementary 2'- and 3'-deoxy NTPs. A flexible domain of the RNA polymerase active centre, the Trigger Loop, was shown to play an important role in this process, but the mechanisms of this participation remained elusive. Results Here we show that transcription fidelity is achieved through a multi-step process. The initial binding in the active centre is the major discrimination step for some non-complementary substrates, although for the rest of misincorporation events discrimination at this step is very poor. During the second step, non-complementary and 2'-deoxy NTPs are discriminated against based on differences in reaction transition state stabilization and partly in general base catalysis, for correct versus non-correct substrates. This step is determined by two residues of the Trigger Loop that participate in catalysis. In the following step, non-complementary and 2'-deoxy NTPs are actively removed from the active centre through a rearrangement of the Trigger Loop. The only step of discrimination against 3'-deoxy substrates, distinct from the ones above, is based on failure to orient the Trigger Loop catalytic residues in the absence of 3'OH. Conclusions We demonstrate that fidelity of transcription by multi-subunit RNA polymerases is achieved through a stepwise process. We show that individual steps contribute differently to discrimination against various erroneous substrates. We define the mechanisms and contributions of each of these steps to the overall fidelity of transcription.

  12. Differences in observers' and teachers' fidelity assessments.

    Science.gov (United States)

    Hansen, William B; Pankratz, Melinda M; Bishop, Dana C

    2014-10-01

    As evidence-based programs become disseminated, understanding the degree to which they are implemented with fidelity is crucial. This study tested the validity of fidelity ratings made by observers versus those made by teachers. We hypothesized that teachers' reports about fidelity would have a positivity bias when compared to observers' reports. Further, we hypothesized that there would generally be low correspondence between teachers' and observers' ratings of fidelity. We examined teachers' and observers' ratings as they were related to mediating variables targeted for change by the intervention. Finally, we examined the role that years of teaching experience played in achieving fidelity. Eighteen teachers and four research assistants participated in this project as raters. Teachers made video recordings of their implementation of All Stars and completed fidelity assessment forms. Trained observers independently completed parallel forms for 215 sampled classroom sessions. Both teachers and observers rated adherence, quality of delivery, attendance, and participant engagement. Teachers made more positive fidelity ratings than did observers. With the exception of ratings for attendance, teachers and observers failed to agree on fidelity ratings. Observers' ratings were significantly related to students' pretest assessments of targeted program mediators. That observers' ratings were related to students' pretest scores, suggests it is easier to teach well when students are predisposed to program success. Teachers' ratings were infrequently related to mediators, but when they were, the relationship was counterintuitive. Experienced teachers taught with greater fidelity than novice teachers. While possibly inflated and inaccurate, gathering fidelity assessments from teachers may sensitize them to issues of fidelity as a result of requiring form completion. Assessing fidelity through observers' ratings of video recordings has significant merit. As a longterm investment

  13. High Fidelity BWR Fuel Simulations

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Su Jong [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-08-01

    This report describes the Consortium for Advanced Simulation of Light Water Reactors (CASL) work conducted for completion of the Thermal Hydraulics Methods (THM) Level 3 milestone THM.CFD.P13.03: High Fidelity BWR Fuel Simulation. High fidelity computational fluid dynamics (CFD) simulation for Boiling Water Reactor (BWR) was conducted to investigate the applicability and robustness performance of BWR closures. As a preliminary study, a CFD model with simplified Ferrule spacer grid geometry of NUPEC BWR Full-size Fine-mesh Bundle Test (BFBT) benchmark has been implemented. Performance of multiphase segregated solver with baseline boiling closures has been evaluated. Although the mean values of void fraction and exit quality of CFD result for BFBT case 4101-61 agreed with experimental data, the local void distribution was not predicted accurately. The mesh quality was one of the critical factors to obtain converged result. The stability and robustness of the simulation was mainly affected by the mesh quality, combination of BWR closure models. In addition, the CFD modeling of fully-detailed spacer grid geometry with mixing vane is necessary for improving the accuracy of CFD simulation.

  14. Integrated Variable Fidelity Conceptual Design Project

    Data.gov (United States)

    National Aeronautics and Space Administration — CADNexus proposes to develop an Integrated Variable Fidelity Conceptual Design tool. The application will enable design and analysis of unconventional and advanced...

  15. Variable Fidelity Aeroelastic Toolkit - Structural Model Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed innovation is a methodology to incorporate variable fidelity structural models into steady and unsteady aeroelastic and aeroservoelastic analyses in...

  16. High fidelity quantum gates with vibrational qubits.

    Science.gov (United States)

    Berrios, Eduardo; Gruebele, Martin; Shyshlov, Dmytro; Wang, Lei; Babikov, Dmitri

    2012-11-26

    Physical implementation of quantum gates acting on qubits does not achieve a perfect fidelity of 1. The actual output qubit may not match the targeted output of the desired gate. According to theoretical estimates, intrinsic gate fidelities >99.99% are necessary so that error correction codes can be used to achieve perfect fidelity. Here we test what fidelity can be accomplished for a CNOT gate executed by a shaped ultrafast laser pulse interacting with vibrational states of the molecule SCCl(2). This molecule has been used as a test system for low-fidelity calculations before. To make our test more stringent, we include vibrational levels that do not encode the desired qubits but are close enough in energy to interfere with population transfer by the laser pulse. We use two complementary approaches: optimal control theory determines what the best possible pulse can do; a more constrained physical model calculates what an experiment likely can do. Optimal control theory finds pulses with fidelity >0.9999, in excess of the quantum error correction threshold with 8 × 10(4) iterations. On the other hand, the physical model achieves only 0.9992 after 8 × 10(4) iterations. Both calculations converge as an inverse power law toward unit fidelity after >10(2) iterations/generations. In principle, the fidelities necessary for quantum error correction are reachable with qubits encoded by molecular vibrations. In practice, it will be challenging with current laboratory instrumentation because of slow convergence past fidelities of 0.99.

  17. Beyond teacher training: the critical role of professional development in maintaining curriculum fidelity.

    Science.gov (United States)

    LaChausse, Robert G; Clark, Kim R; Chapple, Sabrina

    2014-03-01

    To examine how teacher characteristics affected program fidelity in an impact evaluation study of the Positive Prevention PLUS program, and to propose a comprehensive teacher training and professional development structure to increase program fidelity. Curriculum fidelity logs, lesson observations, and teacher surveys were used to measure teacher characteristics and implementation fidelity including adherence, adaptation, and lesson quality. Compared with non-health credentialed teachers, credential health education teachers had greater comfort and self-efficacy regarding sex-related instruction. Teacher self-efficacy and comfort were significant predictors of adherence. Implementation fidelity may be linked to teacher characteristics that can be enhanced during curriculum training. A 2-day teacher training may not adequately address teacher facilitation skills or the maintenance of institutional supports for implementing a program with fidelity and quality. A new model of comprehensive teacher training and support is offered. This new training infrastructure is intended to contribute to the school district's institutionalization of higher-quality comprehensive sexual health education and increase program fidelity. Copyright © 2014 Society for Adolescent Health and Medicine. All rights reserved.

  18. Average fidelity between random quantum states

    CERN Document Server

    Zyczkowski, K; Zyczkowski, Karol; Sommers, Hans-Jurgen

    2003-01-01

    We analyze mean fidelity between random density matrices of size N, generated with respect to various probability measures in the space of mixed quantum states: Hilbert-Schmidt measure, Bures (statistical) measure, the measures induced by partial trace and the natural measure on the space of pure states. In certain cases explicit probability distributions for fidelity are derived.

  19. A 6. 5-Mb yeast artificial chromosome contig incorporating 33 DNA markers on the human X chromosome at Xq22

    Energy Technology Data Exchange (ETDEWEB)

    Vetrie, D.; Kendall, E.; Coffey, A.; Hassock, S.; Collins, J.; Todd, C.; Bobrow, M.; Bentley, D.R. (Paediatric Research Unit, London (United Kingdom)); Lehrach, H. (Imperial Cancer Research Fund, London (United Kingdom)); Harris, A. (John Radcliffe Hospital, Oxford (United Kingdom))

    1994-01-01

    The Xq22 region of the human X chromosome contains genes for a number of inherited disorders. Sixty-nine yeast artificial chromosome clones have been isolated and assembled into a 6.5-Mb contig that contains 33 DNA markers localized to this region. This contig extends distally from DXS366 to beyond DXS87 and includes the genes involved in X-linked agammaglobulinemia (btk), Fabry disease (GLA), and Pelizaeus-Merzbacher disease (PLP). The order of markers in this contig is consistent with the known genetic and physical mapping information of Xq22. This cloned material provides a source from which to isolate other genes located in this part of the X chromosome. 45 refs., 2 figs., 2 tabs.

  20. High Reproduction Rate versus Sexual Fidelity

    OpenAIRE

    Sousa, A. O.; de Oliveira, S. Moss

    2000-01-01

    We introduce fidelity into the bit-string Penna model for biological ageing and study the advantage of this fidelity when it produces a higher survival probability of the offspring due to paternal care. We attribute a lower reproduction rate to the faithful males but a higher death probability to the offspring of non-faithful males that abandon the pups to mate other females. The fidelity is considered as a genetic trait which is transmitted to the male offspring (with or without error). We s...

  1. Use of simulated data sets to evaluate the fidelity of Metagenomicprocessing methods

    Energy Technology Data Exchange (ETDEWEB)

    Mavromatis, Konstantinos; Ivanova, Natalia; Barry, Kerri; Shapiro, Harris; Goltsman, Eugene; McHardy, Alice C.; Rigoutsos, Isidore; Salamov, Asaf; Korzeniewski, Frank; Land, Miriam; Lapidus, Alla; Grigoriev, Igor; Richardson, Paul; Hugenholtz, Philip; Kyrpides, Nikos C.

    2006-12-01

    Metagenomics is a rapidly emerging field of research for studying microbial communities. To evaluate methods presently used to process metagenomic sequences, we constructed three simulated data sets of varying complexity by combining sequencing reads randomly selected from 113 isolate genomes. These data sets were designed to model real metagenomes in terms of complexity and phylogenetic composition. We assembled sampled reads using three commonly used genome assemblers (Phrap, Arachne and JAZZ), and predicted genes using two popular gene finding pipelines (fgenesb and CRITICA/GLIMMER). The phylogenetic origins of the assembled contigs were predicted using one sequence similarity--based (blast hit distribution) and two sequence composition--based (PhyloPythia, oligonucleotide frequencies) binning methods. We explored the effects of the simulated community structure and method combinations on the fidelity of each processing step by comparison to the corresponding isolate genomes. The simulated data sets are available online to facilitate standardized benchmarking of tools for metagenomic analysis.

  2. Use of simulated data sets to evaluate the fidelity of metagenomic processing methods

    Energy Technology Data Exchange (ETDEWEB)

    Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Barry, Kerrie [U.S. Department of Energy, Joint Genome Institute; Shapiro, Harris [U.S. Department of Energy, Joint Genome Institute; Goltsman, Eugene [U.S. Department of Energy, Joint Genome Institute; McHardy, Alice C. [IBM T. J. Watson Research Center; Rigoutsos, Isidore [IBM T. J. Watson Research Center; Salamov, Asaf [U.S. Department of Energy, Joint Genome Institute; Korzeniewski, Frank [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Grigoriev, Igor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute

    2007-01-01

    Metagenomics is a rapidly emerging field of research for studying microbial communities. To evaluate methods presently used to process metagenomic sequences, we constructed three simulated data sets of varying complexity by combining sequencing reads randomly selected from 113 isolate genomes. These data sets were designed to model real metagenomes in terms of complexity and phylogenetic composition. We assembled sampled reads using three commonly used genome assemblers (Phrap, Arachne and JAZZ), and predicted genes using two popular gene-finding pipelines (fgenesb and CRITICA/GLIMMER). The phylogenetic origins of the assembled contigs were predicted using one sequence similarity-based ( blast hit distribution) and two sequence composition-based (PhyloPythia, oligonucleotide frequencies) binning methods. We explored the effects of the simulated community structure and method combinations on the fidelity of each processing step by comparison to the corresponding isolate genomes. The simulated data sets are available online to facilitate standardized benchmarking of tools for metagenomic analysis.

  3. A conceptual framework for implementation fidelity

    Directory of Open Access Journals (Sweden)

    Booth Andrew

    2007-11-01

    Full Text Available Abstract Background Implementation fidelity refers to the degree to which an intervention or programme is delivered as intended. Only by understanding and measuring whether an intervention has been implemented with fidelity can researchers and practitioners gain a better understanding of how and why an intervention works, and the extent to which outcomes can be improved. Discussion The authors undertook a critical review of existing conceptualisations of implementation fidelity and developed a new conceptual framework for understanding and measuring the process. The resulting theoretical framework requires testing by empirical research. Summary Implementation fidelity is an important source of variation affecting the credibility and utility of research. The conceptual framework presented here offers a means for measuring this variable and understanding its place in the process of intervention implementation.

  4. Hybrid High-Fidelity Auscultation Scope Project

    Data.gov (United States)

    National Aeronautics and Space Administration — To address the NASA Johnson Space Center's need for a space auscultation capability, Physical Optics Corporation proposes to develop a Hybrid High-Fidelity...

  5. Construction of Oryza Sativa genome contigs by fingerprint strategy

    Institute of Scientific and Technical Information of China (English)

    TAOQUAZHOU; GUOFANHONG; 等

    1995-01-01

    We described the construction of BAC contigs of the genome of a indica variety of Oryza sativa.Guang Lu Ai 4. An entire representative(Sixfold coverage of rice chromosomes)and genetically stable BAC library of rice genome constructed in this lab has been systematically analysed by restriction enzyme fragmentation and polyacrylamide gel electrophoresis.And all the images thus obtained were subject to image-processing,which consisted of preliminary location of bands,cooperative tracking of lanes by correlation of adjacent bads.a precise densitometric pass,alignment at the marker bands with the standard,optional interactive editing,and normalization of the accepted bands.The contigs were generated based on the Computer Software specially designed for genome mapping.The number of contigs with 600 kb in length on average was 464.of contigs with 1000kb in length on average was 107; of contigs with 1500 kb in length on average was Construction of Oryza Sativa genome contigs.23.Therefor,all the contigs we have obtained ampunted up to 420 megabases in length.Considering the size of rice genome(430 megabased),the contigs generated in this lab have covered nearly 98% of the rice genome.We are now in the process of mapping the contigs to chromosomes.

  6. Fidelity of an electron in one-dimensional determined potentials

    Institute of Scientific and Technical Information of China (English)

    Song Wen-Guang; Tong Pei-Qing

    2009-01-01

    We numerically study the fidelity of an electron in the one-dimensional Harper model and in the one-dimensional slowly varying potential model. Our results show that many properties of the two models can be well reflected by the fidelity: (i) the mobility edge and metal-insulator transition can be characterized by the static fidelity; (ii) the extended state and localized state can be identified by the dynamic fidelity. Therefore, it may broaden the applied areas of the fidelity.

  7. Measuring Fidelity in Preschool Interventions: A Microanalysis of Fidelity Instruments Used in Curriculum Interventions

    Science.gov (United States)

    Darrow, Catherine L.

    2010-01-01

    This paper examines measures used by studies associated with Preschool Curriculum Evaluation Research Initiative (PCER) funded by the Institute of Education Sciences. Analysis of 17 measures of fidelity used by 13 curriculum interventions highlights how research in preschools is and is not measuring fidelity of implementation. The following…

  8. An information theoretic approach to use high-fidelity codes to calibrate low-fidelity codes

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Allison, E-mail: lewis.allison10@gmail.com [Department of Mathematics, North Carolina State University, Raleigh, NC 27695 (United States); Smith, Ralph [Department of Mathematics, North Carolina State University, Raleigh, NC 27695 (United States); Williams, Brian [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Figueroa, Victor [Sandia National Laboratories, Albuquerque, NM 87185 (United States)

    2016-11-01

    For many simulation models, it can be prohibitively expensive or physically infeasible to obtain a complete set of experimental data to calibrate model parameters. In such cases, one can alternatively employ validated higher-fidelity codes to generate simulated data, which can be used to calibrate the lower-fidelity code. In this paper, we employ an information-theoretic framework to determine the reduction in parameter uncertainty that is obtained by evaluating the high-fidelity code at a specific set of design conditions. These conditions are chosen sequentially, based on the amount of information that they contribute to the low-fidelity model parameters. The goal is to employ Bayesian experimental design techniques to minimize the number of high-fidelity code evaluations required to accurately calibrate the low-fidelity model. We illustrate the performance of this framework using heat and diffusion examples, a 1-D kinetic neutron diffusion equation, and a particle transport model, and include initial results from the integration of the high-fidelity thermal-hydraulics code Hydra-TH with a low-fidelity exponential model for the friction correlation factor.

  9. Reconsidering fidelity in simulation-based training.

    Science.gov (United States)

    Hamstra, Stanley J; Brydges, Ryan; Hatala, Rose; Zendejas, Benjamin; Cook, David A

    2014-03-01

    In simulation-based health professions education, the concept of simulator fidelity is usually understood as the degree to which a simulator looks, feels, and acts like a human patient. Although this can be a useful guide in designing simulators, this definition emphasizes technological advances and physical resemblance over principles of educational effectiveness. In fact, several empirical studies have shown that the degree of fidelity appears to be independent of educational effectiveness. The authors confronted these issues while conducting a recent systematic review of simulation-based health professions education, and in this Perspective they use their experience in conducting that review to examine key concepts and assumptions surrounding the topic of fidelity in simulation.Several concepts typically associated with fidelity are more useful in explaining educational effectiveness, such as transfer of learning, learner engagement, and suspension of disbelief. Given that these concepts more directly influence properties of the learning experience, the authors make the following recommendations: (1) abandon the term fidelity in simulation-based health professions education and replace it with terms reflecting the underlying primary concepts of physical resemblance and functional task alignment; (2) make a shift away from the current emphasis on physical resemblance to a focus on functional correspondence between the simulator and the applied context; and (3) focus on methods to enhance educational effectiveness using principles of transfer of learning, learner engagement, and suspension of disbelief. These recommendations clarify underlying concepts for researchers in simulation-based health professions education and will help advance this burgeoning field.

  10. Fidelity approach in topological superconductors with disorders

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Wen-Chuan; Huang, Guang-Yao; Wang, Zhi, E-mail: physicswangzhi@gmail.com; Yao, Dao-Xin, E-mail: yaodaox@mail.sysu.edu.cn

    2015-03-20

    We apply the fidelity approach to study the topological superconductivity in spin–orbit coupling nanowire system. The wire is modeled as a one layer lattice chain with Zeeman energy and spin–orbit coupling, which is in proximity to a multi-layer superconductor. In particular, we study the effects of disorders and find that the fidelity susceptibility has multiple peaks. It is revealed that one peak indicates the topological quantum phase transition, while other peaks are signaling the pinning of the Majorana bound states by disorders. - Highlights: • We introduce fidelity approach to study the topological superconducting nanowire with disorders. • We study the quantum phase transition in the wire. • We investigate the disorder pinning of the Majorana bound states in the wire.

  11. Aircrew Training Devices: Fidelity Features.

    Science.gov (United States)

    1981-01-01

    Computer generat Waag; 1978b (13-80 hrs) For Pilot Training (6df) Seven CRT displa ( ASPT ) full infinity op; T-37 Smith, Waters Novice Visual pre- T-37 No...4 line Jacobs and No flight Singer Link Piper Yes Not discussed Roscoe; 1975 experience GAT-2 Cherokee Piper Arrow Cherokee Martin and Novice ASPT T...Smith; 1974 experience T-37 (2df) FOV = 440 x 280 Woodruff, et Less than ASPT T-37 Yes Computer genera al; 1976 50 hrs T-37 (6df) 36" diameter CRT

  12. Fidelity enhancement by logical qubit encoding.

    Science.gov (United States)

    Henry, Michael K; Ramanathan, Chandrasekhar; Hodges, Jonathan S; Ryan, Colm A; Ditty, Michael J; Laflamme, Raymond; Cory, David G

    2007-11-30

    We demonstrate coherent control of two logical qubits encoded in a decoherence free subspace (DFS) of four dipolar-coupled protons in an NMR quantum information processor. A pseudopure fiducial state is created in the DFS, and a unitary logical qubit entangling operator evolves the system to a logical Bell state. The four-spin molecule is partially aligned by a liquid crystal solvent, which introduces strong dipolar couplings among the spins. Although the system Hamiltonian is never fully specified, we demonstrate high fidelity control over the logical degrees of freedom. In fact, the DFS encoding leads to higher fidelity control than is available in the full four-spin Hilbert space.

  13. Quantum phase transition, quantum fidelity and fidelity susceptibility in the Yang-Baxter system

    Science.gov (United States)

    Hu, Taotao; Yang, Qi; Xue, Kang; Wang, Gangcheng; Zhang, Yan; Li, Xiaodan; Ren, Hang

    2017-01-01

    In this paper, we investigate the ground-state fidelity and fidelity susceptibility in the many-body Yang-Baxter system and analyze their connections with quantum phase transition. The Yang-Baxter system was perturbed by a twist of e^{iφ} at each bond, where the parameter φ originates from the q-deformation of the braiding operator U with q = e^{-iφ} (Jimbo in Yang-Baxter equations in integrable systems, World Scientific, Singapore, 1990), and φ has a physical significance of magnetic flux (Badurek et al. in Phys. Rev. D 14:1177, 1976). We test the ground-state fidelity related by a small parameter variation φ which is a different term from the one used for driving the system toward a quantum phase transition. It shows that ground-state fidelity develops a sharp drop at the transition. The drop gets sharper as system size N increases. It has been verified that a sufficiently small value of φ used has no effect on the location of the critical point, but affects the value of F(gc,φ) . The smaller the twist φ, the more the value of F(gc,φ) is close to 0. In order to avoid the effect of the finite value of φ, we also calculate the fidelity susceptibility. Our results demonstrate that in the Yang-Baxter system, the quantum phase transition can be well characterized by the ground-state fidelity and fidelity susceptibility in a special way.

  14. Dicty_cDB: Contig-U14893-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ), Expect = 3e-15 Identities = 48/48 (100%) Strand = Plus / Plus Query: 26 attttcctctaaccccccaaattaaaactanatcntttcan...ttcctctaaccccccaaattaaaactanatcntttcanttttcac 73 >Contig-U11657-1 (Contig-U11657-1Q) /CSM_Contig/Contig-U116...entities = 48/48 (100%) Strand = Plus / Minus Query: 26 attttcctctaaccccccaaattaaaactanatcntttcan...ttttcac 73 |||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 116 attttcctctaaccccccaaattaaaactanatcntttcan

  15. Dicty_cDB: Contig-U12850-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tcncttnattantttcgtttaaaaatttgtnnnaaacatgntnttgga 133 Query: 134 atcgccnaacntta 14...7 |||||||||||||| Sbjct: 134 atcgccnaacntta 147 >Contig-U13258-1 (Contig-U13258-1Q) /CSM_Contig/Contig-U13258...ttgtnnnaaacatgntnttgga 27 Query: 134 atcgccnaacntta 147 |||||||||||||| Sbjct: 26 atcgccnaacntta 13 Lambda K

  16. YAC cosmid contigs spanning the Batten disease (CLN3) region at 16p12.1-p11.2

    Energy Technology Data Exchange (ETDEWEB)

    Jaervelae, I.E.; Mitchison, H.M.; O`Rawe, A.M.; Munroe, P.B. [Rayne Institute, London (United Kingdom)] [and others

    1995-09-20

    A yeast artificial chromosome (YAC) contig has been constructed in 16p12.1-p11.2 that encompasses three loci (D16S288, D16S299, and D16S298) closely linked to the gene causing Batten disease or juvenile-onset neuronal ceroid lipofuscinosis (CLN3). The physical map has been ordered using 42 sequence tagged sites. Four genes, interleukin-4 receptor (ILA4R), phenol-preferring phenol sulfotransferase (STP), monoamine preferring phenol sulfotransferase (STM), and sialophorin (SPN), have been mapped to the YAC contig. A partial genomic restriction map has been constructed to confirm the order and distances between D16S288 and STM. This part of the YAC contig is represented in eight cosmid contigs. One of these contains D16S298, predicted to be the locus closest to CLN3. The overlapping genomic clones are a valuable resource for cloning the Batten gene (CLN3) and other genes in the region. 45 refs., 2 figs., 5 tabs.

  17. Information, entropy and fidelity in visual communication

    Science.gov (United States)

    Huck, Friedrich O.; Fales, Carl L.; Alter-Gartenberg, Rachel; Rahman, Zia-Ur

    1992-01-01

    This paper presents an assessment of visual communication that integrates the critical limiting factors of image gathering and display with the digital processing that is used to code and restore images. The approach focuses on two mathematical criteria, information and fidelity, and on their relationships to the entropy of the encoded data and to the visual quality of the restored image.

  18. A new universal colour image fidelity metric

    NARCIS (Netherlands)

    Toet, A.; Lucassen, M.P.

    2003-01-01

    We extend a recently introduced universal grayscale image quality index to a newly developed perceptually decorrelated colour space. The resulting colour image fidelity metric quantifies the distortion of a processed colour image relative to its original version. We evaluated the new colour image fi

  19. Dicty_cDB: Contig-U15995-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nnqllppppppplplvahkll*pmkpiqphvhsvvvlsqpwifqiitq lvn*skimisqkelklhsihyvllkllnmislkkslkninhllnyqtqsmkfqnlqkllv klsknskmilk...2416 ) RPCI44_377O10.f RPCI-44 Sus scrofa genomic clone ... 46 3.8 1 ( DW488282 ) GH_RMIRS_068_G03_R Cotton ...Contig-U15995-1 gap included 1478 2 3965902 3964425 MINUS 5 8 U15995 1 0 2 0 0 1 0 ...int 3964425 Strand (PLUS/MINUS) MINUS Number of clones 5 Number of EST 8 Link to ...3.8 1 ( CP000576 ) Prochlorococcus marinus str. MIT 9301, complete g... 46 3.8 1

  20. Enhancing Fidelity in Adventure Education and Adventure Therapy

    Science.gov (United States)

    Tucker, Anita R.; Rheingold, Alison

    2010-01-01

    Although the importance of addressing and evaluating treatment and program fidelity is clearly emphasized in the literature on psychology, education, and health, little attention has been given to fidelity in adventure literature or research. Program fidelity refers to whether or not, and how well, a specific intervention or program was…

  1. Fidelity Susceptibility as Holographic PV criticality

    CERN Document Server

    Momeni, Davood; Myrzakulov, Ratbay

    2016-01-01

    Motivated by the fact that the quantum entanglement entropy is dual to an area in AdS, quantities dual to a volume in the AdS have also been recently proposed. These include the holographic complexity and fidelity susceptibility of a quantum system. Even though both of them are dual to an volume in the bulk, there are some interesting difference between them. In this letter, we will explicitly compare them for an $ AdS _4$ solution, and clarify the main differences between them from thermodynamic point of the view. We will also obtain the correct and appropriate holographic dual of the thermodynamic volume of AdS blackhole, and demonstrate that to explain therodynamic in extended phase PV picture, from the AdS/CFT point of view,fidelity susceptibility is the preferred quantity in comparison to holographic complexity.

  2. Dynamics of Loschmidt echoes and fidelity decay

    Energy Technology Data Exchange (ETDEWEB)

    Gorin, Thomas [Max-Planck-Institut fuer Physik komplexer Systeme, Noethnitzer Street 38, D-01187 Dresden (Germany)]. E-mail: gorin@mpipks-dresden.mpg.de; Prosen, Tomaz [Physics Department, Faculty of Mathematics and Physics, University of Ljubljana, Jadranska 19, SI-1000 Ljubljana (Slovenia)]. E-mail: tomaz.prosen@fmf.uni-lj.si; Seligman, Thomas H. [Centro Internacional de Ciencias, Apartado postal 6-101, C.P.62132 Cuernavaca, Morelos (Mexico) and Instituto de Ciencias Fisicas, University of Mexico - UNAM, C.P.62132 Cuernavaca, Morelos (Mexico)]. E-mail: seligman@fis.unam.mx; Znidaric, Marko [Physics Department, Faculty of Mathematics and Physics, University of Ljubljana, Jadranska 19, SI-1000 Ljubljana (Slovenia)]. E-mail: marko.znidaric@fmf.uni-lj.si

    2006-11-15

    Fidelity serves as a benchmark for the reliability in quantum information processes, and has recently attracted much interest as a measure of the susceptibility of dynamics to perturbations. A rich variety of regimes for fidelity decay have emerged. The purpose of the present review is to describe these regimes, to give the theory that supports them, and to show some important applications and experiments. While we mention several approaches we use time correlation functions as a backbone for the discussion. Vanicek's uniform approach to semiclassics and random matrix theory provides important alternatives or complementary aspects. Other methods will be mentioned as we go along. Recent experiments in micro-wave cavities and in elastodynamic systems as well as suggestions for experiments in quantum optics shall be discussed.

  3. Dynamics of Loschmidt echoes and fidelity decay

    CERN Document Server

    Gorin, T; Seligman, T H; Znidaric, M; Gorin, Thomas; Prosen, Tomaz; Seligman, Thomas H.; Znidaric, Marko

    2006-01-01

    Fidelity serves as a benchmark for the relieability in quantum information processes, and has recently atracted much interest as a measure of the susceptibility of dynamics to perturbations. A rich variety of regimes for fidelity decay have emerged. The purpose of the present review is to describe these regimes, to give the theory that supports them, and to show some important applications and experiments. While we mention several approaches we use time correlation functions as a backbone for the discussion. Vanicek's uniform approach to semiclassics and random matrix theory provides an important alternative or complementary aspects. Other methods will be mentioned as we go along. Recent experiments in micro-wave cavities and in elastodynamic systems as well as suggestions for experiments in quantum optics shall be discussed.

  4. Subjective Information Measure and Rate Fidelity Theory

    CERN Document Server

    Lu, Chenguang

    2007-01-01

    Using fish-covering model, this paper intuitively explains how to extend Hartley's information formula to the generalized information formula step by step for measuring subjective information: metrical information (such as conveyed by thermometers), sensory information (such as conveyed by color vision), and semantic information (such as conveyed by weather forecasts). The pivotal step is to differentiate condition probability and logical condition probability of a message. The paper illustrates the rationality of the formula, discusses the coherence of the generalized information formula and Popper's knowledge evolution theory. For optimizing data compression, the paper discusses rate-of-limiting-errors and its similarity to complexity-distortion based on Kolmogorov's complexity theory, and improves the rate-distortion theory into the rate-fidelity theory by replacing Shannon's distortion with subjective mutual information. It is proved that both the rate-distortion function and the rate-fidelity function ar...

  5. Quantum fidelity for arbitrary Gaussian states

    CERN Document Server

    Banchi, Leonardo; Pirandola, Stefano

    2015-01-01

    We derive a computable analytical formula for the quantum fidelity between two arbitrary multimode Gaussian states which is simply expressed in terms of their first- and second-order statistical moments. We also show how such a formula can be written in terms of symplectic invariants and used to derive closed forms for a variety of basic quantities and tools, such as the Bures metric, the quantum Fisher information and various fidelity-based bounds. Our result can be used to extend the study of continuous-variable protocols, such as quantum teleportation and cloning, beyond the current one-mode or two-mode analyses, and paves the way to solve general problems in quantum metrology and quantum hypothesis testing with arbitrary multimode Gaussian resources.

  6. A random matrix formulation of fidelity decay

    Energy Technology Data Exchange (ETDEWEB)

    Gorin, T [Theoretische Quantendynamik, Albert-Ludwigs-Universitaet, Hermann-Herder-Str. 3, D-79104 Freiburg (Germany); Prosen, T [Physics Department, Faculty of Mathematics and Physics, University of Ljubljana, Jadranska 19, SI-1000 Ljubljana (Slovenia); Seligman, T H [Centro Internacional de Ciencias, C.P. 62131 Cuernavaca, Morelos (Mexico)

    2004-02-01

    We propose to study echo dynamics in a random-matrix framework, where we assume that the perturbation is time-independent, random and orthogonally invariant. This allows us to use a basis in which the unperturbed Hamiltonian is diagonal and its properties are thus largely determined by its spectral statistics. We concentrate on the effect of spectral correlations usually associated with chaos and disregard secular variations in spectral density. We obtain analytical results for the fidelity decay in the linear-response regime. To extend the domain of validity, we heuristically exponentiate the linear-response result. The resulting expressions, exact in the perturbative limit, are accurate approximations in the transition region between the 'Fermi golden rule' and the perturbative regimes, as verified by example for a deterministic chaotic system. To sense the effect of spectral stiffness, we apply our model also to the extreme cases of random spectra and equidistant spectra. In our analytical approximations as well as in extensive Monte Carlo calculations, we find that fidelity decay is fastest for random spectra and slowest for equidistant ones, while the classical ensembles lie in between. We conclude that spectral stiffness systematically enhances fidelity.

  7. A random matrix formulation of fidelity decay

    Science.gov (United States)

    Gorin, T.; Prosen, T.; Seligman, T. H.

    2004-02-01

    We propose to study echo dynamics in a random-matrix framework, where we assume that the perturbation is time-independent, random and orthogonally invariant. This allows us to use a basis in which the unperturbed Hamiltonian is diagonal and its properties are thus largely determined by its spectral statistics. We concentrate on the effect of spectral correlations usually associated with chaos and disregard secular variations in spectral density. We obtain analytical results for the fidelity decay in the linear-response regime. To extend the domain of validity, we heuristically exponentiate the linear-response result. The resulting expressions, exact in the perturbative limit, are accurate approximations in the transition region between the 'Fermi golden rule' and the perturbative regimes, as verified by example for a deterministic chaotic system. To sense the effect of spectral stiffness, we apply our model also to the extreme cases of random spectra and equidistant spectra. In our analytical approximations as well as in extensive Monte Carlo calculations, we find that fidelity decay is fastest for random spectra and slowest for equidistant ones, while the classical ensembles lie in between. We conclude that spectral stiffness systematically enhances fidelity.

  8. Fidelity susceptibility and geometric phase in critical phenomenon

    Institute of Scientific and Technical Information of China (English)

    Tian Li-Jun; Zhu Chang-Qing; Zhang Hong-Biao; Qin Li-Guo

    2011-01-01

    Motivated by recent developments in quantum fidelity and fidelity susceptibility, we study relations among Lie algebra, fidelity susceptibility and quantum phase transition for a two-state system and the Lipkin-Meshkov-click model. We obtain the fidelity susceptibilities for SU(2)and SU(1, 1)algebraic structure models. From this relation,the validity of the fidelity susceptibility to signal for the quantum phase transition is also verified in these two systems.At the same time, we obtain the geometric phases in these two systems by calculating the fidelity susceptibility. In addition, the new method of calculating fidelity susceptibility is used to explore the two-dimensional XXZ model and the Bose-Einstein condensate(BEC).

  9. Dicty_cDB: Contig-U13113-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ig-U13113-1 Contig ID Contig-U13113-1 Contig update 2002.12.18 Contig sequence >Contig-U13113-1 (Contig-U131...******* Frame C: xxxxxnnnxnnnnnnnnnnnnnnnnnnnnnnnnnnnnn own update ---------- Homology vs CSM-cDNA - dna update...arch space: 8947161656352 Effective search space used: 8947161656352 X1: 11 (21.8 bits) S2: 20 (40.1 bits) protein update...H + PRF protein sequence database [Last update Jun/09/2006] 3,762,210 sequences; 1,237,044,461 total letters... Searchingdone ***** No hits found ****** sequence database [Last update Jun/09/2

  10. Dicty_cDB: Contig-U10478-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nces; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U10478...-U10495-1Q) /CSM_Contig/Conti... 32 1.1 >Contig-U10478-1 (Contig-U10478-1Q) /CSM_Contig/Contig-U10478-1Q.Seq.d Length = 1022 Score... Query: 943 gtgaaattccctctcctt 960 |||||||||||||||||| Sbjct: 943 gtgaaattccctctcctt 960 Score = 412 bits (20...|||||||||||||||||||||||||| Sbjct: 322 atcaagngaaagtcaaagngcctcaggtcaaaacactgccagc 364 Score = 75.8 bits (38)...|||||| Sbjct: 362 agccaaagttcaagtcaaagtgcaagtcaaagtgcaagtcaaagtgcaagtcaaagtg 419 Score = 61.9 bits (31), Exp

  11. Dicty_cDB: Contig-U04993-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SM_Contig/Contig-U04993-1Q.Seq.d (339 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E... 0.001 >Contig-U04993-1 (Contig-U04993-1Q) /CSM_Contig/Contig-U04993-1Q.Seq.d Length = 339 Score...|||||||||||||||||||||||||||||| Sbjct: 286 taactttaatagaaacacataatttattagacaatagtaaattatcatatgacc 339 Score =...: 54 taaattgatttttcaaataataataataccacacccaaacacact 98 Score = 48.1 bits (24), Expect = 6e-06 Identities = 24...tggaacatctttgtagaattaact 186 Score = 42.1 bits (21), Expect = 4e-04 Identities =

  12. Dicty_cDB: Contig-U13336-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g/Contig-U13336-1Q.Seq.d (630 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequenc...Q) /CSM_Contig/Conti... 32 0.69 >Contig-U13336-1 (Contig-U13336-1Q) /CSM_Contig/Contig-U13336-1Q.Seq.d Length = 630 Score...tgaacaaccaactgaatcatcaaatg 388 |||||||||||||||||||||||||||| Sbjct: 361 gctgaacaaccaactgaatcatcaaatg 388 Score...|||||||||| Sbjct: 580 gctgaacaaccaactgattcacaacaaccaccagcagaatcatcatcagcc 630 Score = 60.0 bits (30), Expect...|||||||||| Sbjct: 365 aacaaccaactgaatcatcaaatgctgaacaacaacaaactgactcacaacaacca 420 Score = 50.1 bits (25), E

  13. Fidelity of adiabatic holonomic quantum gates

    Science.gov (United States)

    Malinovsky, Vladimir; Rudin, Sergey

    2016-05-01

    During last few years non-Abelian geometric phases are attracting increasing interest due to possible experimental applications in quantum computation. Here we discuss universal set of holonomic quantum gates using the geometric phase that the qubit wave function acquires after a cyclic evolution. The proposed scheme utilizes ultrafast pulses and provides a possibility to substantially suppress transient population of the ancillary states. Fidelity of the holonomic quantum gates in the presence of dephasing and dissipation is discussed. Example of electron spin qubit system in the InGaN/GaN, GaN/AlN quantum dot is considered in details.

  14. Direct competition assay for transcription fidelity.

    Science.gov (United States)

    Lubkowska, Lucyna; Kireeva, Maria L

    2015-01-01

    Accurate transcription is essential for faithful information flow from DNA to RNA and to the protein. Mechanisms of cognate substrate selection by RNA polymerases are currently elucidated by structural, genetic, and biochemical approaches. Here, we describe a fast and reliable approach to quantitative analyses of transcription fidelity, applicable to analyses of RNA polymerase selectivity against misincorporation, incorporation of dNMPs, and chemically modified rNMP analogues. The method is based on different electrophoretic mobility of RNA oligomers of the same length but differing in sequence.

  15. Chemical fidelity of an RNA polymerase ribozyme

    DEFF Research Database (Denmark)

    Attwater, J.; Tagami, S.; Kimoto, M.

    2013-01-01

    The emergence of catalytically active RNA enzymes (ribozymes) is widely believed to have been an important transition in the origin of life. In the context of a likely heterogeneous chemical environment, substrate specificity and selectivity of these primordial enzymes would have been critical...... for function. Here we have explored the chemical fidelity, i.e. substrate selectivity and specificity for both single and multiple catalytic steps of the Z RNA polymerase ribozyme-a modern day analogue of the primordial RNA replicase. Using a wide range of nucleotide analogues and ionic conditions, we observe...

  16. Dicty_cDB: Contig-U12624-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 24-1Q) /CSM_Contig/Contig-U12624-1Q.Seq.d NNNNNNNNNNGTCATTATANTTCAGAATNNGTAGCTTGCCGTAANTGTNA NAGTNCAAACNCTGTN...NTGGAAANAAACNACCGTTTAAACTTTTTANGTT GTAATGCTTGNAACTNTCAAAAATCCGTNNCNGTCATTAANAAAG...ttcagaatnngtagcttgccgtaantgtnanagtncaaacnctgtnntgg 70 |||||||||||||||||||||||||||...||||||||||||||||||||||||||||||||| Sbjct: 11 gtcattatanttcagaatnngtagcttgccgtaantgtnanagtncaaacnctgtnntgg 70 ...Query: 71 aaanaaacnaccgtttaaactttttangttgtaatgcttgnaactntcaaaaatccgtnn 130 |||||||||||||||||||||||||||||||||

  17. Dicty_cDB: Contig-U00819-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||||||||| Sbjct: 61 acaaaatnnacnagntnnacaaaatnnacnagntcnacaaaatnnacnagntcnacaaaa 120 Query: 121 tnnacnagnncaacaaaatccccna...||||||||||||| Sbjct: 121 tnnacnagnncaacaaaatccccnagntcnacnagntcnacaaaacc 167 >Contig-U16510-1 (Contig-U16510...aagctcaacaaaatcaacaagctcaacaaaatcaacaagctcaacaaa 2335 Query: 102 atnnacnagntcnacaaaatnnacnagnncaacaaaatccccna...uery: 102 atnnacnagntcnacaaaatnnacnagnncaacaaaatccccnagntcnacnagntcnac 161 || || || || ||||||| || || |||||||...173 acaaaatnnacnagntnnacaaaatnnacnagntcnacaaaatnnacnagntcnacaaaa 114 Query: 121 tnnacnagnncaacaaaatccccna

  18. High Fidelity Single Qubit Operations using Pulsed EPR

    CERN Document Server

    Morton, J J L; Ardavan, A; Porfyrakis, K; Lyon, S A; Briggs, G A D; Morton, John J. L.; Tyryshkin, Alexei M.; Ardavan, Arzhang; Porfyrakis, Kyriakos

    2005-01-01

    The fidelity of quantum logic operations performed on electron spin qubits using simple RF pulses falls well below the threshold for the application of quantum algorithms. Using three independent techniques, we demonstrate the use of composite pulses to improve this fidelity by several orders of magnitude. The observed high-fidelity operations are limited by pulse phase errors, but nevertheless fall within the limits required for the application of quantum error correction algorithms.

  19. Equation of motion for estimation fidelity of monitored oscillating qubits

    Science.gov (United States)

    Bassa, Humairah; Konrad, Thomas; Diósi, Lajos; Uys, Hermann

    2017-08-01

    We study the convergence properties of state estimates of an oscillating qubit being monitored by a sequence of discrete, unsharp measurements. Our method derives a differential equation determining the evolution of the estimation fidelity from a single incremental step. If the oscillation frequency Ω is precisely known, the estimation fidelity converges exponentially fast to unity. For imprecise knowledge of Ω we derive the asymptotic estimation fidelity.

  20. Fidelity in planar cell polarity signalling.

    Science.gov (United States)

    Ma, Dali; Yang, Chung-hui; McNeill, Helen; Simon, Michael A; Axelrod, Jeffrey D

    2003-01-30

    The polarity of Drosophila wing hairs displays remarkable fidelity. Each of the approximately 30,000 wing epithelial cells constructs an actin-rich prehair that protrudes from its distal vertex and points distally. The distal location and orientation of the hairs is virtually error free, thus forming a nearly perfect parallel array. This process is controlled by the planar cell polarity signalling pathway. Here we show that interaction between two tiers of the planar cell polarity signalling mechanism results in the observed high fidelity. The first tier, mediated by the cadherin Fat, dictates global orientation by transducing a directional signal to individual cells. The second tier, orchestrated by the 7-pass transmembrane receptor Frizzled, aligns each cell's polarity with that of its neighbours through the action of an intercellular feedback loop, enabling polarity to propagate from cell to cell. We show that all cells need not respond correctly to the presumably subtle signal transmitted by Fat. Subsequent action of the Frizzled feedback loop is sufficient to align all the cells cooperatively. This economical system is therefore highly robust, and produces virtually error-free arrays.

  1. How Fidelity invests in service professionals.

    Science.gov (United States)

    McColgan, E A

    1997-01-01

    If you're in the business of service delivery, investment in the training and development of your staff is one of the keys to your company's success. But what's the best way to design and implement your investment? In 1994, Fidelity Institutional Retirement Services Company (FIRSCo) needed to ensure that its rapidly expanding staff maintained the company's high levels of customer satisfaction. The solution, according to Ellyn McColgan, formerly an executive vice president of FIRSCo and now the president of Fidelity Investments Tax-Exempt Services Company, was to reach out to its service associates with a powerful new model for training and development called Service Delivery University. SDU is a virtual university with a content-based core curriculum and five colleges that focus on business concepts and skills. It is driven by three principles. First, all training must be directly aligned with the company's strategic and financial objectives and focused on customer needs. Second, service delivery is a profession and should be taught as such. And finally, professional development should be the primary responsibility of line managers rather than the human resources department. McColgan explains how FIRSCo overcame resistance to this sweeping change in employee education. (Time was one obstacle: each associate receives 80 hours of training per year.) In addition, the author discusses the fine art of measuring the success of a program like SDU. She finds that the company's investment has paid dividends to the staff, to the organization as a whole, and to FIRSCo's customers.

  2. High-fidelity flash lidar model development

    Science.gov (United States)

    Hines, Glenn D.; Pierrottet, Diego F.; Amzajerdian, Farzin

    2014-06-01

    NASA's Autonomous Landing and Hazard Avoidance Technologies (ALHAT) project is currently developing the critical technologies to safely and precisely navigate and land crew, cargo and robotic spacecraft vehicles on and around planetary bodies. One key element of this project is a high-fidelity Flash Lidar sensor that can generate three-dimensional (3-D) images of the planetary surface. These images are processed with hazard detection and avoidance and hazard relative navigation algorithms, and then are subsequently used by the Guidance, Navigation and Control subsystem to generate an optimal navigation solution. A complex, high-fidelity model of the Flash Lidar was developed in order to evaluate the performance of the sensor and its interaction with the interfacing ALHAT components on vehicles with different configurations and under different flight trajectories. The model contains a parameterized, general approach to Flash Lidar detection and reflects physical attributes such as range and electronic noise sources, and laser pulse temporal and spatial profiles. It also provides the realistic interaction of the laser pulse with terrain features that include varying albedo, boulders, craters slopes and shadows. This paper gives a description of the Flash Lidar model and presents results from the Lidar operating under different scenarios.

  3. Study fidelity spatial contours of industrial robots

    Directory of Open Access Journals (Sweden)

    A. V. Ivanova

    2014-01-01

    Full Text Available The purpose of this paper to identify deviations fidelity spatial contours of industrial robots, determine the error pattern detected, and define the ways to solve the problem.The paper presents the research results of fidelity spatial contours done by Fanuc M- 710iC/50 industrial robot when moving along a predetermined path. The proposed method uses a QC20-W ballbar wireless system of Renishaw company, designed to diagnose the state of the measurement and playback linear and angular displacements of the CNC.The solutions to adapt the QC20-W ballbar system to the constructive peculiarities of industrial robots with five or more independently controlled axes are given. The stages of the preparation of diagnostic systems and software robot movements are described.According to study results of errors that arise while playing back the programmed motions of a fixed point of robot capture in three mutually perpendicular planes its practical accuracy has been defined when performing movements in a given region of the working area, thereby allowing us, eventually, to draw a conclusion on the possibility to use a robot in one technological process or another.The study has resulted in emerging the guidelines for the operation of industrial robots with five or more independently controlled axes. Using these guidelines enables us to increase the playback accuracy of the industrial robot to 0.01 mm.

  4. Variable-fidelity optimization with design space reduction

    Institute of Scientific and Technical Information of China (English)

    Mohammad Kashif Zahir; Gao Zhenghong

    2013-01-01

    Advanced engineering systems,like aircraft,are defined by tens or even hundreds of design variables.Building an accurate surrogate model for use in such high-dimensional optimization problems is a difficult task owing to the curse of dimensionality.This paper presents a new algorithm to reduce the size of a design space to a smaller region of interest allowing a more accurate surrogate model to be generated.The framework requires a set of models of different physical or numerical fidelities.The low-fidelity (LF) model provides physics-based approximation of the high-fidelity (HF) model at a fraction of the computational cost.It is also instrumental in identifying the small region of interest in the design space that encloses the high-fidelity optimum.A surrogate model is then constructed to match the low-fidelity model to the high-fidelity model in the identified region of interest.The optimization process is managed by an update strategy to prevent convergence to false optima.The algorithm is applied on mathematical problems and a two-dimensional aerodynamic shape optimization problem in a variable-fidelity context.Results obtained are in excellent agreement with high-fidelity results,even with lower-fidelity flow solvers,while showing up to 39% time savings.

  5. Mate fidelity and breeding site tenacity in a monogamous sandpiper, the black turnstone

    Science.gov (United States)

    Handel, C.M.; Gill, R.E.

    2000-01-01

    We examined the relationship between mate fidelity and breeding site tenacity during a 5-year study of the black turnstone, Arenaria melanocephala, a socially monogamous sandpiper breeding in subarctic Alaska. We tested the predictions of several hypotheses regarding the incidence of divorce and the benefits of fidelity to mate and breeding site. Interannual return rates to the breeding grounds (88% for males, 79% for females) were among the highest yet recorded for any scolopacid sandpiper, and 88% of returning birds nested on their previous year's territory. The annual divorce rate was only 11%, and mate fidelity was significantly linked to fidelity to territory but independent of sex and year. Males arrived in spring significantly earlier than their mates and interannual fidelity was influenced by the relative timing of arrival of pair members. Reunited pairs had significantly higher fledging success than new pairs formed after death or divorce. The incidence of divorce was unrelated to reproductive success the previous year, although birds nested significantly further away after failure than after a successful nesting attempt. Sightings of marked individuals suggested that members of pairs do not winter together, and breeding site tenacity provides a mechanism through which pair members can reunite. We reject the 'incompatibility' hypothesis for divorce in turnstones, and our data contradict predictions of the 'better option' hypothesis. Alternatively, we propose the 'bet-hedging' hypothesis to explain the occurrence of divorce, which transpires when an individual pairs with a new mate to avoid the cost of waiting for a previous mate to return. Such costs can include remaining unmated, if the former mate has died, or experiencing lower reproductive success because of delayed breeding.

  6. The trajectory of fidelity in a multiyear trial of the family check-up predicts change in child problem behavior.

    Science.gov (United States)

    Chiapa, Amanda; Smith, Justin D; Kim, Hanjoe; Dishion, Thomas J; Shaw, Daniel S; Wilson, Melvin N

    2015-10-01

    Therapist fidelity to evidence-based family interventions has consistently been linked to child and family outcomes. However, few studies have evaluated the potential ebb and flow of fidelity of therapists over time. We examined therapist drift in fidelity over 4 years in the context of a Family Check-Up prevention services in early childhood (ages 2-5 years). At age 2, families engaging in Women, Infants, and Children Nutritional Supplement Program services were randomized and offered annual Family Check-Ups. Seventy-nine families with a child in the clinical range of problem behaviors at age 2 years were included in this analysis. Latent growth modeling revealed a significant linear decline in fidelity over time (M = -0.35, SD = 0.35) and that steeper declines were related to less improvement in caregiver-reported problem behaviors assessed at ages 7.5/8.5 years (b = -.69, p = .003; β = -.95, 95% CI [-2.11, -0.22]). These findings add to the literature concerning the need to continually monitor therapist fidelity to an evidence-based practice over time to optimize family benefits. Limitations and directions for future research are discussed. (c) 2015 APA, all rights reserved).

  7. Dicty_cDB: Contig-U08438-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 05 sequences; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Conti...757-1Q) /CSM_Contig/Conti... 28 1.7 >Contig-U14622-1 (Contig-U14622-1Q) /CSM_Contig/Contig-U14622-1Q.Seq.d Length = 149 Score...aagntttttttttttnttttt 32 |||||||||||||||| ||||| Sbjct: 87 aaagntttttttttttattttt 66 Score...nttttt 32 ||||||||||| ||||| Sbjct: 136 ttttttttttttttttt 120 Score = 28.2 bits (14), Expect = 1.7 Identities... = 16/17 (94%) Strand = Plus / Plus Query: 16 tttttttttttnttttt 32 ||||||||||| ||||| Sbjct: 85 ttttttttttttttttt 101 Score

  8. Dicty_cDB: Contig-U06756-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ontig/Contig-U06756-1Q.Seq.d (336 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Seq... >Contig-U06756-1 (Contig-U06756-1Q) /CSM_Contig/Contig-U06756-1Q.Seq.d Length = 336 Score...125 Query: 126 at 127 || Sbjct: 126 at 127 Score = 69.9 bits (35), Expect = 2e-12 Identities = 35/35 (100%) ...ct: 1 caaaataatgataaatcaaattaaattatttattt 35 Score = 65.9 bits (33), Expect = 3e-11 Identities = 36/36 (100%...|||||||||||||||||||||||||||||| Sbjct: 253 ttaaaaatnccttttttttttttttggggaaatttt 288 Score = 28.2 bits (14), E

  9. Research on multi-fidelity aerodynamic optimization methods

    Institute of Scientific and Technical Information of China (English)

    Huang Likeng; Gao Zhenghong; Zhang Dehu

    2013-01-01

    Constructing high approximation accuracy surrogate model with lower computational cost has great engineering significance.In this paper,using co-Kriging method,an efficient multifidelity surrogate model is constructed based on two independent high and low fidelity samples.Co-Kriging method can use a greater quantity of low-fidelity information to enhance the accuracy of a surrogate of the high-fidelity model by modeling the correlation between high and low fidelity model,thus computational cost of building surrogate model can be greatly reduced.A wing-body problem is taken as an example to compare characteristics of co-Kriging multi-fidelity (CKMF)model with traditional Kriging based multi-fidelity (KMF) model.A sampling convergence of the CKMF model and the KMF model is conducted,and an appropriate sampling design is selected through the sampling convergence analysis.The results indicate that CKMF model has higher approximation accuracy with the same high-fidelity samples,and converges at less high-fidelity samples.A wing-body drag reduction optimization design using genetic algorithm is implemented.Satisfying design results are obtained,which validate the feasibility of CKMF model in engineering design.

  10. Fidelity of states in infinite dimensional quantum systems

    CERN Document Server

    Hou, Jinchuan

    2011-01-01

    In this paper we discuss the fidelity of states in infinite dimensional systems, give an elementary proof of the infinite dimensional version of Uhlmann's theorem, and then, apply it to generalize several properties of the fidelity from finite dimensional case to infinite dimensional case. Some of them are somewhat different from those for finite dimensional case.

  11. Multifractality in fidelity sequences of optimized Toffoli gates

    Science.gov (United States)

    Moqadam, Jalil Khatibi; Welter, Guilherme S.; Esquef, Paulo A. A.

    2016-11-01

    We analyze the multifractality in the fidelity sequences of several engineered Toffoli gates. Using quantum control methods, we consider several optimization problems whose global solutions realize the gate in a chain of three qubits with XY Heisenberg interaction. Applying a minimum number of control pulses assuring a fidelity above 99 % in the ideal case, we design stable gates that are less sensitive to variations in the interqubits couplings. The most stable gate has the fidelity above 91 % with variations about 0.1 %, for up to 10 % variation in the nominal couplings. We perturb the system by introducing a single source of 1 / f noise that affects all the couplings. In order to quantify the performance of the proposed optimized gates, we calculate the fidelity of a large set of optimized gates under prescribed levels of coupling perturbation. Then, we run multifractal analysis on the sequence of attained fidelities. This way, gate performance can be assessed beyond mere average results, since the chosen multifractality measure (the width of the multifractal spectrum) encapsulates into a single performance indicator the spread of fidelity values around the mean and the presence of outliers. The higher the value of the performance indicator the more concentrated around the mean the fidelity values are and rarer is the occurrence of outliers. The results of the multifractal analysis on the fidelity sequences demonstrate the effectiveness of the proposed optimized gate implementations, in the sense they are rendered less sensitive to variations in the interqubits coupling strengths.

  12. Decay of fidelity in terms of correlation functions

    Science.gov (United States)

    Alicki, R.; Fannes, M.

    2009-01-01

    We consider, within the algebraic formalism, the time dependence of fidelity for qubits encoded in an open physical system. We relate the decay of fidelity to the evolution of correlation functions and, in the particular case of a Markovian dynamics, to the spectral gap of the generator of the semigroup. The results are applicable to the analysis of models of quantum memories.

  13. AFFECT: Altered-Fidelity Framework for Enhancing Cognition and Training

    Directory of Open Access Journals (Sweden)

    Ryan Patrick McMahan

    2016-11-01

    Full Text Available In this paper, we present a new framework for analyzing and designing virtual reality (VR techniques. This framework is based on two concepts—system fidelity (i.e., the degree with which real-world experiences are reproduced by a system and memory (i.e., the formation and activation of perceptual, cognitive, and motor networks of neurons. The premise of the framework is to manipulate an aspect of system fidelity in order to assist a stage of memory. We call it the Altered-Fidelity Framework for Enhancing Cognition and Training (AFFECT. AFFECT provides nine categories of approaches to altering system fidelity to positively affect learning or training. These categories are based on the intersections of three aspects of system fidelity (interaction fidelity, scenario fidelity, and display fidelity and three stages of memory (encoding, implicit retrieval, and explicit retrieval. In addition to discussing the details of our new framework, we show how AFFECT can be used as a tool for analyzing and categorizing VR techniques designed to facilitate learning or training. We also demonstrate how AFFECT can be used as a design space for creating new VR techniques intended for educational and training systems.

  14. Intervention Fidelity in Special and General Education Research Journals

    Science.gov (United States)

    Swanson, Elizabeth; Wanzek, Jeanne; Haring, Christa; Ciullo, Stephen; McCulley, Lisa

    2013-01-01

    Treatment fidelity reporting practices are described for journals that published general and special education intervention research with high impact factors from 2005 through 2009. The authors reviewed research articles, reported the proportion of intervention studies that described fidelity measurement, detailed the components of fidelity…

  15. Entanglement fidelity of the standard quantum teleportation channel

    Energy Technology Data Exchange (ETDEWEB)

    Li, Gang; Ye, Ming-Yong, E-mail: myye@fjnu.edu.cn; Lin, Xiu-Min

    2013-09-16

    We consider the standard quantum teleportation protocol where a general bipartite state is used as entanglement resource. We use the entanglement fidelity to describe how well the standard quantum teleportation channel transmits quantum entanglement and give a simple expression for the entanglement fidelity when it is averaged on all input states.

  16. Fidelity amplitude of the scattering matrix in microwave cavities

    Science.gov (United States)

    Schäfer, R.; Gorin, T.; Seligman, T. H.; Stöckmann, H.-J.

    2005-06-01

    The concept of fidelity decay is discussed from the point of view of the scattering matrix, and the 'scattering fidelity' is introduced as the parametric cross-correlation of a given S-matrix element, taken in the time domain, normalized by the corresponding autocorrelation function. We show that for chaotic systems, this quantity represents the usual fidelity amplitude, if appropriate ensemble and/or energy averages are taken. We present a microwave experiment where the scattering fidelity is measured for an ensemble of chaotic systems. The results are in excellent agreement with random matrix theory for the standard fidelity amplitude. The only parameter, namely the perturbation strength, could be determined independently from level dynamics of the system, thus providing agreement between theory and experiment without any free fit parameter.

  17. Fidelity amplitude of the scattering matrix in microwave cavities

    Energy Technology Data Exchange (ETDEWEB)

    Schaefer, R [Fachbereich Physik, Philipps-Universitaet Marburg, Renthof 5, D-35032 Marburg (Germany); Gorin, T [Max-Planck-Institut fuer Physik komplexer Systeme, Noethnitzer Str. 38, D-01187 Dresden (Germany); Seligman, T H [Centro de Ciencias FIsicas, Universidad Nacional Autonoma de Mexico, Campus Morelos, C. P. 62251, Cuernavaca, Morelos (Mexico); Stoeckmann, H-J [Fachbereich Physik, Philipps-Universitaet Marburg, Renthof 5, D-35032 Marburg (Germany)

    2005-06-01

    The concept of fidelity decay is discussed from the point of view of the scattering matrix, and the 'scattering fidelity' is introduced as the parametric cross-correlation of a given S-matrix element, taken in the time domain, normalized by the corresponding autocorrelation function. We show that for chaotic systems, this quantity represents the usual fidelity amplitude, if appropriate ensemble and/or energy averages are taken. We present a microwave experiment where the scattering fidelity is measured for an ensemble of chaotic systems. The results are in excellent agreement with random matrix theory for the standard fidelity amplitude. The only parameter, namely the perturbation strength, could be determined independently from level dynamics of the system, thus providing agreement between theory and experiment without any free fit parameter.

  18. Objective Fidelity Evaluation in Multisensory Virtual Environments: Auditory Cue Fidelity in Flight Simulation

    Science.gov (United States)

    Meyer, Georg F.; Wong, Li Ting; Timson, Emma; Perfect, Philip; White, Mark D.

    2012-01-01

    We argue that objective fidelity evaluation of virtual environments, such as flight simulation, should be human-performance-centred and task-specific rather than measure the match between simulation and physical reality. We show how principled experimental paradigms and behavioural models to quantify human performance in simulated environments that have emerged from research in multisensory perception provide a framework for the objective evaluation of the contribution of individual cues to human performance measures of fidelity. We present three examples in a flight simulation environment as a case study: Experiment 1: Detection and categorisation of auditory and kinematic motion cues; Experiment 2: Performance evaluation in a target-tracking task; Experiment 3: Transferrable learning of auditory motion cues. We show how the contribution of individual cues to human performance can be robustly evaluated for each task and that the contribution is highly task dependent. The same auditory cues that can be discriminated and are optimally integrated in experiment 1, do not contribute to target-tracking performance in an in-flight refuelling simulation without training, experiment 2. In experiment 3, however, we demonstrate that the auditory cue leads to significant, transferrable, performance improvements with training. We conclude that objective fidelity evaluation requires a task-specific analysis of the contribution of individual cues. PMID:22957068

  19. Simplifier: a web tool to eliminate redundant NGS contigs.

    Science.gov (United States)

    Ramos, Rommel Thiago Jucá; Carneiro, Adriana Ribeiro; Azevedo, Vasco; Schneider, Maria Paula; Barh, Debmalya; Silva, Artur

    2012-01-01

    Modern genomic sequencing technologies produce a large amount of data with reduced cost per base; however, this data consists of short reads. This reduction in the size of the reads, compared to those obtained with previous methodologies, presents new challenges, including a need for efficient algorithms for the assembly of genomes from short reads and for resolving repetitions. Additionally after abinitio assembly, curation of the hundreds or thousands of contigs generated by assemblers demands considerable time and computational resources. We developed Simplifier, a stand-alone software that selectively eliminates redundant sequences from the collection of contigs generated by ab initio assembly of genomes. Application of Simplifier to data generated by assembly of the genome of Corynebacterium pseudotuberculosis strain 258 reduced the number of contigs generated by ab initio methods from 8,004 to 5,272, a reduction of 34.14%; in addition, N50 increased from 1 kb to 1.5 kb. Processing the contigs of Escherichia coli DH10B with Simplifier reduced the mate-paired library 17.47% and the fragment library 23.91%. Simplifier removed redundant sequences from datasets produced by assemblers, thereby reducing the effort required for finalization of genome assembly in tests with data from Prokaryotic organisms. Simplifier is available at http://www.genoma.ufpa.br/rramos/softwares/simplifier.xhtmlIt requires Sun jdk 6 or higher.

  20. The fidelity of dynamic signaling by noisy biomolecular networks.

    Directory of Open Access Journals (Sweden)

    Clive G Bowsher

    Full Text Available Cells live in changing, dynamic environments. To understand cellular decision-making, we must therefore understand how fluctuating inputs are processed by noisy biomolecular networks. Here we present a general methodology for analyzing the fidelity with which different statistics of a fluctuating input are represented, or encoded, in the output of a signaling system over time. We identify two orthogonal sources of error that corrupt perfect representation of the signal: dynamical error, which occurs when the network responds on average to other features of the input trajectory as well as to the signal of interest, and mechanistic error, which occurs because biochemical reactions comprising the signaling mechanism are stochastic. Trade-offs between these two errors can determine the system's fidelity. By developing mathematical approaches to derive dynamics conditional on input trajectories we can show, for example, that increased biochemical noise (mechanistic error can improve fidelity and that both negative and positive feedback degrade fidelity, for standard models of genetic autoregulation. For a group of cells, the fidelity of the collective output exceeds that of an individual cell and negative feedback then typically becomes beneficial. We can also predict the dynamic signal for which a given system has highest fidelity and, conversely, how to modify the network design to maximize fidelity for a given dynamic signal. Our approach is general, has applications to both systems and synthetic biology, and will help underpin studies of cellular behavior in natural, dynamic environments.

  1. Quantum state tomography and fidelity estimation via Phaselift

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Yiping; Liu, Huan; Zhao, Qing, E-mail: qzhaoyuping@bit.edu.cn

    2015-09-15

    Experiments of multi-photon entanglement have been performed by several groups. Obviously, an increase on the photon number for fidelity estimation and quantum state tomography causes a dramatic increase in the elements of the positive operator valued measures (POVMs), which results in a great consumption of time in measurements. In practice, we wish to obtain a good estimation of fidelity and quantum states through as few measurements as possible for multi-photon entanglement. Phaselift provides such a chance to estimate fidelity for entangling states based on less data. In this paper, we would like to show how the Phaselift works for six qubits in comparison to the data given by Pan’s group, i.e., we use a fraction of the data as input to estimate the rest of the data through the obtained density matrix, and thus goes beyond the simple fidelity analysis. The fidelity bound is also provided for general Schrödinger Cat state. Based on the fidelity bound, we propose an optimal measurement approach which could both reduce the copies and keep the fidelity bound gap small. The results demonstrate that the Phaselift can help decrease the measured elements of POVMs for six qubits. Our conclusion is based on the prior knowledge that a pure state is the target state prepared by experiments.

  2. Physiological fidelity or model parsimony? The relative performance of reverse-toxicokinetic modeling approaches.

    Science.gov (United States)

    Rowland, Michael A; Perkins, Edward J; Mayo, Michael L

    2017-03-11

    Physiologically-based toxicokinetic (PBTK) models are often developed to facilitate in vitro to in vivo extrapolation (IVIVE) using a top-down, compartmental approach, favoring architectural simplicity over physiological fidelity despite the lack of general guidelines relating model design to dynamical predictions. Here we explore the impact of design choice (high vs. low fidelity) on chemical distribution throughout an animal's organ system. We contrast transient dynamics and steady states of three previously proposed PBTK models of varying complexity in response to chemical exposure. The steady states for each model were determined analytically to predict exposure conditions from tissue measurements. Steady state whole-body concentrations differ between models, despite identical environmental conditions, which originates from varying levels of physiological fidelity captured by the models. These differences affect the relative predictive accuracy of the inverted models used in exposure reconstruction to link effects-based exposure data with whole-organism response thresholds obtained from in vitro assay measurements. Our results demonstrate how disregarding physiological fideltiy in favor of simpler models affects the internal dynamics and steady state estimates for chemical accumulation within tissues, which, in turn, poses significant challenges for the exposure reconstruction efforts that underlie many IVIVE methods. Developing standardized systems-level models for ecological organisms would not only ensure predictive consistency among future modeling studies, but also ensure pragmatic extrapolation of in vivo effects from in vitro data or modeling exposure-response relationships.

  3. Recommendations on Model Fidelity for Wind Turbine Gearbox Simulations: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Y.; Keller, J.; La Cava, W.; Austin, J.; Nejad, A. R.; Halse, C.; Bastard, L.; Helsen, J.

    2015-01-01

    This work investigates the minimum level of fidelity required to accurately simulate wind turbine gearboxes using state-of-the-art design tools. Excessive model fidelity including drivetrain complexity, gearbox complexity, excitation sources, and imperfections, significantly increases computational time, but may not provide a commensurate increase in the value of the results. Essential design parameters are evaluated, including the planetary load-sharing factor, gear tooth load distribution, and sun orbit motion. Based on the sensitivity study results, recommendations for the minimum model fidelities are provided.

  4. Quantum simulation using fidelity-profile optimization

    Science.gov (United States)

    Manu, V. S.; Kumar, Anil

    2014-05-01

    Experimental quantum simulation of a Hamiltonian H requires unitary operator decomposition (UOD) of its evolution unitary U =exp(-iHt) in terms of native unitary operators of the experimental system. Here, using a genetic algorithm, we numerically evaluate the most generic UOD (valid over a continuous range of Hamiltonian parameters) of the unitary operator U , termed fidelity-profile optimization. The optimization is obtained by systematically evaluating the functional dependence of experimental unitary operators (such as single-qubit rotations and time-evolution unitaries of the system interactions) to the Hamiltonian (H) parameters. Using this technique, we have solved the experimental unitary decomposition of a controlled-phase gate (for any phase value), the evolution unitary of the Heisenberg XY interaction, and simulation of the Dzyaloshinskii-Moriya (DM) interaction in the presence of the Heisenberg XY interaction. Using these decompositions, we studied the entanglement dynamics of a Bell state in the DM interaction and experimentally verified the entanglement preservation procedure of Hou et al. [Ann. Phys. (N.Y.) 327, 292 (2012), 10.1016/j.aop.2011.08.004] in a nuclear magnetic resonance quantum information processor.

  5. High-fidelity coding with correlated neurons.

    Directory of Open Access Journals (Sweden)

    Rava Azeredo da Silveira

    2014-11-01

    Full Text Available Positive correlations in the activity of neurons are widely observed in the brain. Previous studies have shown these correlations to be detrimental to the fidelity of population codes, or at best marginally favorable compared to independent codes. Here, we show that positive correlations can enhance coding performance by astronomical factors. Specifically, the probability of discrimination error can be suppressed by many orders of magnitude. Likewise, the number of stimuli encoded--the capacity--can be enhanced more than tenfold. These effects do not necessitate unrealistic correlation values, and can occur for populations with a few tens of neurons. We further show that both effects benefit from heterogeneity commonly seen in population activity. Error suppression and capacity enhancement rest upon a pattern of correlation. Tuning of one or several effective parameters can yield a limit of perfect coding: the corresponding pattern of positive correlation leads to a 'lock-in' of response probabilities that eliminates variability in the subspace relevant for stimulus discrimination. We discuss the nature of this pattern and we suggest experimental tests to identify it.

  6. A generalized fidelity amplitude for open systems.

    Science.gov (United States)

    Gorin, T; Moreno, H J; Seligman, T H

    2016-06-13

    We consider a central system which is coupled via dephasing to an open system, i.e. an intermediate system which in turn is coupled to another environment. Considering the intermediate and far environment as one composite system, the coherences in the central system are given in the form of fidelity amplitudes for a certain perturbed echo dynamics in the composite environment. On the basis of the Born-Markov approximation, we derive a master equation for the reduction of that dynamics to the intermediate system alone. In distinction to an earlier paper (Moreno et al 2015 Phys. Rev. A 92, 030104. (doi:10.1103/PhysRevA.92.030104)), where we discussed the stabilizing effect of the far environment on the decoherence in the central system, we focus here on the possibility of using the measurable coherences in the central system for probing the open quantum dynamics in the intermediate system. We illustrate our results for the case of chaotic dynamics in the near environment, where we compare random matrix simulations with our analytical result.

  7. Paleomagnetic recording fidelity of nonideal magnetic systems.

    Science.gov (United States)

    Muxworthy, Adrian R; Krása, David; Williams, Wyn; Almeida, Trevor P

    2014-06-01

    A suite of near-identical magnetite nanodot samples produced by electron-beam lithography have been used to test the thermomagnetic recording fidelity of particles in the 74-333 nm size range; the grain size range most commonly found in rocks. In addition to controlled grain size, the samples had identical particle spacings, meaning that intergrain magnetostatic interactions could be controlled. Their magnetic hysteresis parameters were indicative of particles thought not to be ideal magnetic recorders; however, the samples were found to be excellent thermomagnetic recorders of the magnetic field direction. They were also found to be relatively good recorders of the field intensity in a standard paleointensity experiment. The samples' intensities were all within ∼15% of the expected answer and the mean of the samples within 3% of the actual field. These nonideal magnetic systems have been shown to be reliable records of the geomagnetic field in terms of both direction and intensity even though their magnetic hysteresis characteristics indicate less than ideal magnetic grains. Nonideal magnetic systems accurately record field directionWeak-field remanences more stable than strong-field remanences.

  8. Finding Fidelity: Advancing Audiovisual Analysis Using Software

    Directory of Open Access Journals (Sweden)

    Christina Silver

    2011-01-01

    Full Text Available Specialised software for the analysis of qualitative data has been in development for the last thirty years. However, its adoption is far from widespread. Additionally, qualitative research itself is evolving, from projects that utilised small, text-based data sets to those which involve the collection, management, and analysis of enormous quantities of multimedia data or data of multiple types. Software has struggled to keep up with these changes for several reasons: 1. meeting the needs of researchers is complicated by the lack of documentation and critique by those who are implementing software use and 2. audiovisual data is particularly challenging due to the multidimensionality of data and substantial variety in research project aims and output requirements. This article discusses the history of Computer Assisted Qualitative Data AnalysiS (CAQDAS as it relates to audiovisual data, and introduces the term "fidelity" as a conceptual mechanism to match software tools and researcher needs. Currently available software tools are examined and areas found lacking are highlighted. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs1101372

  9. Fidelity for kicked atoms with gravity near a quantum resonance

    CERN Document Server

    Dubertrand, Rémy; Wimberger, Sandro

    2012-01-01

    Kicked atoms under a constant Stark or gravity field are investigated for experimental setups with cold and ultra cold atoms. The parametric stability of the quantum dynamics is studied using the fidelity. In the case of a quantum resonance, it is shown that the behavior of the fidelity depends on arithmetic properties of the gravity parameter. Close to a quantum resonance, the long time asymptotics of the fidelity is studied by means of a {\\em pseudo-classical} approximation first introduced by Fishman {\\em et al.} [J. Stat. Phys. {\\bf 110}, 911 (2003)]. The long-time decay of fidelity arises from the tunneling out of pseudo-classical stable islands, and a simple ansatz is proposed which satisfactorily reproduces the main features observed in numerical simulations.

  10. USA luure : Fidel Castro on suremas / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2006-01-01

    Kuuba president Fidel Castro, Haiti president Rene Preval, Filipiinide president Gloria Macapagal-Arroyo, Türkmenistani president Saparmurat Nijazov, Guinea president Lansana Conte ja Itaalia ekspeaminister Silvio Berlusconi, Sambia ekspresident Frederick Chilubaga võitlevad terviseprobleemidega

  11. USA luure : Fidel Castro on suremas / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2006-01-01

    Kuuba president Fidel Castro, Haiti president Rene Preval, Filipiinide president Gloria Macapagal-Arroyo, Türkmenistani president Saparmurat Nijazov, Guinea president Lansana Conte ja Itaalia ekspeaminister Silvio Berlusconi, Sambia ekspresident Frederick Chilubaga võitlevad terviseprobleemidega

  12. Measurement fidelity in the presence of coherent dynamics or dissipation

    Science.gov (United States)

    You, Jian-Qiang; Ashhab, S.; Nori, Franco

    2011-03-01

    We analyze the problem of a charge qubit probed by a quantum point contact when the measurement is concurrent with Hamiltonian-induced coherent dynamics or dissipation. This additional dynamics changes the state of the qubit before the measurement is completed. As a result, the measurement fidelity is reduced. We calculate the reduction in measurement fidelity in these cases. References: S. Ashhab, J. Q. You, and F. Nori, New J. Phys. 11, 083017 (2009); Phys. Scr. T137, 014005 (2009).

  13. A Parallel, High-Fidelity Radar Model

    Science.gov (United States)

    Horsley, M.; Fasenfest, B.

    2010-09-01

    Accurate modeling of Space Surveillance sensors is necessary for a variety of applications. Accurate models can be used to perform trade studies on sensor designs, locations, and scheduling. In addition, they can be used to predict system-level performance of the Space Surveillance Network to a collision or satellite break-up event. A high fidelity physics-based radar simulator has been developed for Space Surveillance applications. This simulator is designed in a modular fashion, where each module describes a particular physical process or radar function (radio wave propagation & scattering, waveform generation, noise sources, etc.) involved in simulating the radar and its environment. For each of these modules, multiple versions are available in order to meet the end-users needs and requirements. For instance, the radar simulator supports different atmospheric models in order to facilitate different methods of simulating refraction of the radar beam. The radar model also has the capability to use highly accurate radar cross sections generated by the method of moments, accelerated by the fast multipole method. To accelerate this computationally expensive model, it is parallelized using MPI. As a testing framework for the radar model, it is incorporated into the Testbed Environment for Space Situational Awareness (TESSA). TESSA is based on a flexible, scalable architecture, designed to exploit high-performance computing resources and allow physics-based simulation of the SSA enterprise. In addition to the radar models, TESSA includes hydrodynamic models of satellite intercept and debris generation, orbital propagation algorithms, optical brightness calculations, optical system models, object detection algorithms, orbit determination algorithms, simulation analysis and visualization tools. Within this framework, observations and tracks generated by the new radar model are compared to results from a phenomenological radar model. In particular, the new model will be

  14. High-fidelity simulation enhances ACLS training.

    Science.gov (United States)

    Langdorf, Mark I; Strom, Suzanne L; Yang, Luanna; Canales, Cecilia; Anderson, Craig L; Amin, Alpesh; Lotfipour, Shahram

    2014-01-01

    Medical student training and experience in cardiac arrest situations is limited. Traditional Advanced Cardiac Life Support (ACLS) teaching methods are largely unrealistic with rare personal experience as team leader. Yet Postgraduate Year 1 residents may perform this role shortly after graduation. We expanded our ACLS teaching to a "Resuscitation Boot Camp" where we taught 2010 ACLS to 19 pregraduation students in didactic (12 hours) and experiential (8 hours) format. Immediately before the course, we recorded students performing an acute coronary syndrome/ventricular fibrillation (VF) scenario. As a final test, we recorded the same scenario for each student. Primary outcomes were time to cardiopulmonary resuscitation (CPR) and defibrillation (DF). Secondary measures were total scenario score, dangerous actions, proportion of students voicing "ventricular fibrillation," 12-lead ST-elevation myocardial infarction (STEMI) interpretation, and care necessary for return of spontaneous circulation (ROSC). Two expert ACLS instructors scored both performances on a 121-point scale, with each student serving as their own control. We used t tests and McNemar tests for paired data with statistical significance at pmask ventilation before DF. After instruction, students scored 97±4/121 points (ptraining, only 4 of 19 (21%) students performed both CPR and DF within 2 minutes, and 3 of these had ROSC. After training, 14 of 19 (74%) achieved CPR+DF≤2 minutes (p=.002), and all had ROSC. Before training, 5 of 19 (26%) students said "VF" and 4 of 19 obtained an ECG, but none identified STEMI. After training, corresponding performance was 13 of 19 "VF" (68%, p=021) and 100% ECG and STEMI identification (ptraining. ACLS training including high-fidelity simulation decreases time to CPR and DF and improves performance during resuscitation.

  15. Fidelity and Game-based Technology in Management Education

    Directory of Open Access Journals (Sweden)

    Edgard B. Cornacchione Jr.

    2012-04-01

    Full Text Available This study explores educational technology and management education by analyzing fidelity in game-basedmanagement education interventions. A sample of 31 MBA students was selected to help answer the researchquestion: To what extent do MBA students tend to recognize specific game-based academic experiences, interms of fidelity, as relevant to their managerial performance? Two distinct game-based interventions (BG1 andBG2 with key differences in fidelity levels were explored: BG1 presented higher physical and functional fidelitylevels and lower psychological fidelity levels. Hypotheses were tested with data from the participants, collectedshortly after their experiences, related to the overall perceived quality of game-based interventions. The findingsreveal a higher overall perception of quality towards BG1: (a better for testing strategies, (b offering betterbusiness and market models, (c based on a pace that better stimulates learning, and (d presenting a fidelity levelthat better supports real world performance. This study fosters the conclusion that MBA students tend torecognize, to a large extent, that specific game-based academic experiences are relevant and meaningful to theirmanagerial development, mostly with heightened fidelity levels of adopted artifacts. Agents must be ready andmotivated to explore the new, to try and err, and to learn collaboratively in order to perform.

  16. Incorporating medium fidelity simulation in a practical nurse education program.

    Science.gov (United States)

    Cunningham, Donna D

    2010-01-01

    We frequently hear the word simulation in nursing educatioh. Research has been done on the use of high fidelity simulation in registered nursing programs. High fidelity simulators are expensive and require more than one faculty to facilitate. The question remains: Does every nursing program require a high fidelity simulation laboratory? This article will define the three levels of fidelity and describe the incorporation of a medium fidelity simulation into a practical nursing program and will describe the benefits of simulation use. The article will assist the faculty and students new to simulation, and allow them to choose the equipment and scenarios that will be most advantageous for their individual programs. The choice of equipment, scenarios, and fidelity often depends upon the space, time, funds, and faculty available. Simulation adds an important component to nursing education. Using simulation wisely helps students practice in a controlled environment without danger to living patients. The lessons learned will someday play into a "life or death" scenario, and the patient will not be a simulation mannequin.

  17. Testing the Feasibility of Fidelity Evaluation in a Multisite, Multiprogram Initiative

    Science.gov (United States)

    Cornish, Disa Lubker; Losch, Mary E.; Avery, Mitchell

    2016-01-01

    Monitoring fidelity of implementation is a critical task when initiating evidence-based programs. This pilot study sought to identify best practices in a fidelity monitoring process and determine the feasibility of continuing a fidelity monitoring process with a multisite, multiprogram initiative. A fidelity log was created for each of 11…

  18. Dicty_cDB: Contig-U05779-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tig/Contig-U05779-1Q.Seq.d (181 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Seque...-U05779-1 (Contig-U05779-1Q) /CSM_Contig/Contig-U05779-1Q.Seq.d Length = 181 Score...||| Sbjct: 99 tttttaatttttttt 113 Score = 28.2 bits (14), Expect = 2.9 Identities... = 14/14 (100%) Strand = Plus / Minus Query: 1 tttttttttttttt 14 |||||||||||||| Sbjct: 175 tttttttttttttt 162 Score...tt 14 |||||||||||||| Sbjct: 174 tttttttttttttt 161 Score = 28.2 bits (14), Expect

  19. ClEST cluster :Clmt_contig0033 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Clmt_contig0033 graves disease carrier mitochondrial gene 709 TCGCCCCCTCGCTTTCTTCAG...TATTTCAGCATGAAGGAGGGATTAAAGGGTTGTACAGAGGTTTCGTGCCTACTCTGTGTGGAATGATTCCATATGCAGGCCTATCATTCTATTG fb09024 fs17058 2 PREDICTED: graves

  20. YAC contig information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us RGP physical...ents YAC contigs on the rice chromosomes Data file File name: rgp_physicalmap_yac_contigs.zip File URL: ftp:...//ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physicalmap_yac_contigs....zip File size: 1 KB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/rgp_physicalmap_yac_contig...gion number Physical map image The file name of rice physical map First marker First DNA marker Distance of

  1. Generation of physical map contig-specific sequences

    Directory of Open Access Journals (Sweden)

    Yanliang eJiang

    2014-07-01

    Full Text Available Rapid advances of the next-generation sequencing technologies have allowed whole genome sequencing of many species. However, with the current sequencing technologies, the whole genome sequence assemblies often fall in short in one of the four quality measurements: accuracy, contiguity, connectivity, and completeness. In particular, small-sized contigs and scaffolds limit the applicability of whole genome sequences for genetic analysis. To enhance the quality of whole genome sequence assemblies, particularly the scaffolding capabilities, additional genomic resources are required. Among these, sequences derived from known physical locations offer great powers for scaffolding. In this mini-review, we will describe the principles, procedures and applications of physical-map-derived sequences, with the focus on physical map contig-specific sequences.

  2. Adherence to hand hygiene guidelines - significance of measuring fidelity.

    Science.gov (United States)

    Korhonen, Anne; Ojanperä, Helena; Puhto, Teija; Järvinen, Raija; Kejonen, Pirjo; Holopainen, Arja

    2015-11-01

    The aim was to evaluate the usability of fidelity measures in compliance evaluation of hand hygiene. Adherence to hand hygiene guidelines is important in terms of patient safety. Compliance measures seldom describe how exactly the guidelines are followed. A cross-sectional observation study in a university hospital setting was conducted. Direct observation by trained staff was performed using a standardised observation form supplemented by fidelity criteria. A total of 830 occasions were observed in 13 units. Descriptive statistics (frequency, mean, percentages and range) were used as well as compliance rate by using a standard web-based tool. In addition, the binomial standard normal deviate test was conducted for comparing different methods used in evaluation of hand hygiene and in comparison between professional groups. Measuring fidelity to guidelines was revealed to be useful in uncovering gaps in hand hygiene practices. The main gap related to too short duration of hand rubbing. Thus, although compliance with hand hygiene guidelines measured using a standard web-based tool was satisfactory, the degree of how exactly the guidelines were followed seemed to be critical. Combining the measurement of fidelity to guidelines with the compliance rate is beneficial in revealing inconsistency between optimal and actual hand hygiene behaviour. Evaluating fidelity measures is useful in terms of revealing the gaps between optimal and actual performance in hand hygiene. Fidelity measures are suitable in different healthcare contexts and easy to measure according to the relevant indicators of fidelity, such as the length of hand rubbing. Knowing the gap facilitates improvements in clinical practice. © 2015 John Wiley & Sons Ltd.

  3. State-independent purity and fidelity of quantum operations

    Science.gov (United States)

    Kong, Fan-Zhen; Zong, Xiao-Lan; Yang, Ming; Cao, Zhuo-Liang

    2016-04-01

    The purity and fidelity of quantum operations are of great importance in characterizing the quality of quantum operations. The currently available definitions of the purity and fidelity of quantum operations are based on the average over all possible input pure quantum states, i.e. they are state-dependent (SD). In this paper, without resorting to quantum states, we define the state-independent (SI) purity and fidelity of a general quantum operation (evolution) in virtue of a new density matrix formalism for quantum operations, which is extended from the quantum state level to quantum operation level. The SI purity and fidelity gain more intrinsic physical properties of quantum operations than state-dependent ones, such as the purity of a one-qubit amplitude damping channel (with damping rate 1) is 1/2, which is in line with the fact that the channel is still a nonunitary operation described by two Kraus operators rather than a unitary one. But the state-dependent Haar average purity is 1 in this case. So the SI purity and fidelity proposed here can help the experimentalists to exactly quantify the implementation quality of an operation. As a byproduct, a new measure of the operator entanglement is proposed for a quantum evolution (unitary or nonunitary) in terms of the linear entropy of its density matrix on the orthonormal operator bases (OOBs) in Hilbert-Schmidt space.

  4. Multi-fidelity design optimization of Francis turbine runner blades

    Science.gov (United States)

    Bahrami, S.; Tribes, C.; von Fellenberg, S.; Vu, T. C.; Guibault, F.

    2014-03-01

    A robust multi-fidelity design algorithm has been developed, focusing to efficiently handle industrial hydraulic runner design considerations. The computational task is split between low- and high-fidelity phases in order to properly balance the CFD cost and required accuracy in different design stages. In the low-fidelity phase, a derivative-free optimization method employs an inviscid flow solver to obtain the major desired characteristics of a good design in a relatively fast iterative process. A limited number of candidates are selected among feasible optimization solutions by a newly developed filtering process. The main function of the filtering process is to select some promising candidates to be sent into the high-fidelity phase, which have significantly different geometries, and also are dominant in their own territories. The high-fidelity phase aims to accurately evaluate those promising candidates in order to select the one which is closest to design targets. A low-head runner case study has shown the ability of this methodology to identify an optimized blade through a relatively low computational effort, which is significantly different from the base geometry.

  5. Path integral approach to the quantum fidelity amplitude.

    Science.gov (United States)

    Vaníček, Jiří; Cohen, Doron

    2016-06-13

    The Loschmidt echo is a measure of quantum irreversibility and is determined by the fidelity amplitude of an imperfect time-reversal protocol. Fidelity amplitude plays an important role both in the foundations of quantum mechanics and in its applications, such as time-resolved electronic spectroscopy. We derive an exact path integral formula for the fidelity amplitude and use it to obtain a series of increasingly accurate semiclassical approximations by truncating an exact expansion of the path integral exponent. While the zeroth-order expansion results in a remarkably simple, yet non-trivial approximation for the fidelity amplitude, the first-order expansion yields an alternative derivation of the so-called 'dephasing representation,' circumventing the use of a semiclassical propagator as in the original derivation. We also obtain an approximate expression for fidelity based on the second-order expansion, which resolves several shortcomings of the dephasing representation. The rigorous derivation from the path integral permits the identification of sufficient conditions under which various approximations obtained become exact. © 2016 The Authors.

  6. Toward Right-Fidelity Rotorcraft Conceptual Design

    Science.gov (United States)

    Sinsay, Jeffrey D.; Johnson, Wayne

    2010-01-01

    utilized are driven by the timeline in which questions must be answered. This can range from quick "back-of-the-envelope" assessments of a configuration made in an afternoon, to more detailed tradespace explorations that can take upwards of a year to complete. A variety of spreadsheet based tools and conceptual design codes are currently in use. The in-house developed conceptual sizing code RC (Rotorcraft) has been the preferred tool of choice for CD activity for a number of years. Figure 2 illustrates the long standing coupling between RC and solid modeling tools for layout, as well as a number of ad-hoc interfaces with external analyses. RC contains a sizing routine that is built around the use of momentum theory for rotors, classic finite wing theory, a referred parameter engine model, and semi-emperical weight estimation techniques. These methods lend themselves to rapid solutions, measured in seconds and minutes. The successful use of RC, however requires careful consideration of model input parameters and judicious comparison with existing aircraft to avoid unjustified extrapolation of results. RC is in fact a legacy of a series of codes whose development started in the early 1970s, and is best suited to the study of conventional helicopters and XV-15 style tiltrotors. Other concepts have been analyzed with RC, but typically it became necessary to modify the source code and methods for each unique configuration. Recent activity has lead to the development of a new code, NASA Design and Analysis of Rotorcraft (NDARC). NDARC uses a similar level of analytical fidelity as RC, but is built on a new framework intended to improve modularity and ability to rapidly model a wider array of concepts. Critical to achieving this capability is the decomposition of the aircraft system into a series of fundamental components which can then be assembled to form a wide-array of configurations. The paper will provide an overview of NDARC and its capabilities.

  7. A methodology for the assessment of manned flight simulator fidelity

    Science.gov (United States)

    Hess, Ronald A.; Malsbury, Terry N.

    1989-01-01

    A relatively simple analytical methodology for assessing the fidelity of manned flight simulators for specific vehicles and tasks is offered. The methodology is based upon an application of a structural model of the human pilot, including motion cue effects. In particular, predicted pilot/vehicle dynamic characteristics are obtained with and without simulator limitations. A procedure for selecting model parameters can be implemented, given a probable pilot control strategy. In analyzing a pair of piloting tasks for which flight and simulation data are available, the methodology correctly predicted the existence of simulator fidelity problems. The methodology permitted the analytical evaluation of a change in simulator characteristics and indicated that a major source of the fidelity problems was a visual time delay in the simulation.

  8. Image-gathering system design for information and fidelity

    Science.gov (United States)

    Huck, Friedrich O.; Fales, Carl L.; Mccormick, Judith A.; Park, Stephen K.

    1988-01-01

    Image gathering and processing are assessed in terms of information and fidelity, and the relationship between these two figures of merit is examined. It is assumed that the system is linear and isoplanatic and that the signal and noise amplitudes are Gaussian, wide-sense stationary, and statistically independent. Within these constraints, it is found that the combined process of image gathering and reconstruction (which is intended to reproduce the output of the image-gathering system) behaves as optical, or photographic, image formation in that the informationally optimized design of the image-gathering system ordinarily does not maximize the fidelity of the reconstructed image. The combined process of image gathering and restoration (which is intended to reproduce the input of the image-gathering system) behaves more as a communication channel in that the informationally optimized design of the image-gathering system tends to maximize the fidelity of optimally restored representations of the input.

  9. Fidelity and processivity of Saccharomyces cerevisiae DNA polymerase eta.

    Science.gov (United States)

    Washington, M T; Johnson, R E; Prakash, S; Prakash, L

    1999-12-24

    The yeast RAD30 gene functions in error-free replication of UV-damaged DNA, and RAD30 encodes a DNA polymerase, pol eta, that has the ability to efficiently and correctly replicate past a cis-syn-thymine-thymine dimer in template DNA. To better understand the role of pol eta in damage bypass, we examined its fidelity and processivity on nondamaged DNA templates. Steady-state kinetic analyses of deoxynucleotide incorporation indicate that pol eta has a low fidelity, misincorporating deoxynucleotides with a frequency of about 10(-2) to 10(-3). Also pol eta has a low processivity, incorporating only a few nucleotides before dissociating. We suggest that pol eta's low fidelity reflects a flexibility in its active site rendering it more tolerant of DNA damage, while its low processivity limits its activity to reduce errors.

  10. Influence of imaging resolution on color fidelity in digital archiving.

    Science.gov (United States)

    Zhang, Pengchang; Toque, Jay Arre; Ide-Ektessabi, Ari

    2015-11-01

    Color fidelity is of paramount importance in digital archiving. In this paper, the relationship between color fidelity and imaging resolution was explored by calculating the color difference of an IT8.7/2 color chart with a CIELAB color difference formula for scanning and simulation images. Microscopic spatial sampling was used in selecting the image pixels for the calculations to highlight the loss of color information. A ratio, called the relative imaging definition (RID), was defined to express the correlation between image resolution and color fidelity. The results show that in order for color differences to remain unrecognizable, the imaging resolution should be at least 10 times higher than the physical dimension of the smallest feature in the object being studied.

  11. Beyond Fidelity: Deconstructing the Seductive Simplicity of Fidelity in Simulator-Based Education in the Health Care Professions.

    Science.gov (United States)

    Schoenherr, Jordan Richard; Hamstra, Stanley J

    2017-04-01

    Fidelity has become a ubiquitous feature of discourse in simulation studies. Recent studies have highlighted the often ambiguous and contradictory manner in which fidelity has been defined, with each definition emphasizing different physical and functional features of simulation. We suggest that regarding fidelity as an objective property of a simulation obscures the interactive nature of the educator-learner relationship and should be abandoned. Rather than conceiving training as tasks performed by an individual in isolation, we suggest that it is more accurately understood as the social learning of affordances. Affordances represent the functional features of a simulator, which are taken as relevant in a specific learning context by means of analogy. Training is successful to the extent that educators and learners share an understanding of those affordances. Even when explicitly formulated, the concept of fidelity has greater difficulty accounting for the complex, interactional features of the training situation in comparison with accounts based on social learning. We conclude that continued attempts to redefine and use fidelity in the context of training will likely yield little benefit to the field compared with an interactive social learning framework.

  12. Dicty_cDB: Contig-U04080-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 80-1Q) /CSM_Contig/Contig-U04080-1Q.Seq.d CCCGTCACNGATTTTCGTNTTGGGNCAAATNGTNTCNCTTTNGANGANGG TAACTTGGATTTCNCNGNTAAGGAAAANCCCAANTTGGAN...GGGAANCAAN GGGANGNCAAANGCCAANGGNTTNTTGAAANCAANGANTGGGAAA...NTGCN CAATTTAAAAAAGTNGNTGNTGCTAAATTTGGTTNCNGNTGGAATTNTTG TGGTAATTNTTGGGAAGAANGGGANGAANGGNTTAAANCCNCNGCTTCAA ...36/336 (100%) Strand = Plus / Plus Query: 1 cccgtcacngattttcgtnttgggncaaatngtntcnctttngangang...ttttcgtnttgggncaaatngtntcnctttnganganggtaacttggat 60 Query: 61 ttcncngntaaggaaaancccaanttggangggaancaangggang

  13. Dicty_cDB: Contig-U02755-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .d Length = 113 Score = 83.8 bits (42), Expect = 3e-17 Identities = 45/45 (100%) Strand = Plus / Plus Query: 1 cactctacatan...|||||||||||||||| Sbjct: 1 cactctacatanacaacacacattgataaaataatagtttctttc 45 >Contig-U11697-1 (Contig-U11697-1...ct = 1e-12 Identities = 44/45 (97%) Strand = Plus / Minus Query: 1 cactctacatanacaacacacattgataaaataatagtttc

  14. Dicty_cDB: Contig-U02496-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cattcaatgcaaattttggtagtttatttagaactcatacaaacgcaacaatatt 1020 Query: 1021 tgcttcan...cccaanaaa 1037 ||||||||||||||||| Sbjct: 1021 tgcttcancccaanaaa 1037 >Contig-U09887-1 (Contig-U09887-1Q) /CSM...tcaatgcaaattttggtagtttatttagaactcatacaaacg 32 Query: 1011 caacaatatttgcttcancccaanaaa 1037 |||||||||||||||||...|||||||||| Sbjct: 31 caacaatatttgcttcancccaanaaa 5 Lambda K H 1.37 0.711 1.31 Mat

  15. Dicty_cDB: Contig-U10506-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 06-1Q) /CSM_Contig/Contig-U10506-1Q.Seq.d NNNNNNNNNNATNTCCAAANAAAATCCNANAACCATATTTNTTAATATTN CCAAAATCGGANATCATCNT...TNCCAATTTNGANAAAACCNTTGGNAAAAC TTGGNTTATTGATTTTGAAAAANAAACAACTAAAATCCNANATGGNAGNT TCNT...TNCNAATATTNAAAANACNTTNATTCNTTGGAANAGACANACNACN ATTGTTGNAAATAATAATAATAATAATGNAATATCCCNTCNTTATTTNAA ...= 9e-54 Identities = 194/194 (100%) Strand = Plus / Plus Query: 14 tccaaanaaaatccnanaaccatatttnttaatattnccaaaatcgganatcatcnt...nanaaccatatttnttaatattnccaaaatcgganatcatcnttnc 73 Query: 74 caatttnganaaaaccnttgg

  16. Dicty_cDB: Contig-U14318-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aaacnann 109 Query: 110 caaggngntncaaaggncncatnaaaagccnancccctttaagaaaac 157 |||||||||||||||||||||||||||||||...||||||||||||||||| Sbjct: 110 caaggngntncaaaggncncatnaaaagccnancccctttaagaaaac 157 >Contig-U11143-1 (Contig-U...ttanttttggtggnaaaaaaggntangantantggaaancaanncaaggngn 337 Query: 118 tncaaaggncncatnaaaagccna...ncccctttaagaaa 155 |||||||| ||||| |||||||||||||||||| |||| Sbjct: 338 tncaaaggccncatcaaaagccnanccc...inus Query: 120 caaaggncncatnaaaagccnancccctttaagaaaac 157 |||||||||||||||||||||||||||||||||||||| Sbjct: 42 caaaggncncatnaaaagccna

  17. Dicty_cDB: Contig-U08421-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Plus / Plus Query: 11 tgatgaatgngntcnatcancaaanaattttccngaaccccnaaaaagnttattagattg 70 |||||||||||||||||||||...||||||||||||||||||||||||||||||||||||||| Sbjct: 11 tgatgaatgngntcnatcancaaanaattttccngaaccccna...gatgncnataaaacgncagcnca 130 Query: 131 aaatttagccatcgntgntgcnccnaattta 161 ||||||...||||||||||||||||||||||||| Sbjct: 131 aaatttagccatcgntgntgcnccnaattta 161 >Contig-U13983-1 (Contig-U13983-1Q)... (82%) Strand = Plus / Plus Query: 11 tgatgaatgngntcnatcancaaanaattttccngaaccccnaaaaagnttattagattg 70 ||||||

  18. Dicty_cDB: Contig-U14610-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ttttangccngnanggaantgttanttttgctttaaaaantgnggaattccnngan 66 Query: 67 cnctnttggccnactggaatagt 89 |||||||||||...|||||||||||| Sbjct: 67 cnctnttggccnactggaatagt 89 >Contig-U12363-1 (Contig-U12363...cngnanggaantgttanttttgctttaaaaantgnggaattccnngan 132 Query: 67 cnctnttggccnactgga...atagt 89 ||||||||||||||||||||||| Sbjct: 131 cnctnttggccnactggaatagt 109 Lambda K H 1.37 0.711 1.31 Matrix: b

  19. Dicty_cDB: Contig-U06096-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||||| Sbjct: 64 gaaatngatgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 123 Query: 124 ggnaatgttggngatgntacaacnccna...ctt 154 ||||||||||||||||||||||||||||||| Sbjct: 124 ggnaatgttggngatgntacaacnccnactt 154 Sc...us Query: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 |||||||||||||||||||||||||||||||||||||||...||||||||||| Sbjct: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 >Contig-U11917-1 (Contig-U1191...atgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 147 Query: 124 ggnaatgttggngatgntacaacnccnacttnaaaanaa

  20. Dicty_cDB: Contig-U13193-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 (97%) Strand = Plus / Plus Query: 13 aatagaggnacccnacatggtgaacttggncaaagaaatcatagatttnaattgaaaatc 72 |||||...||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 aatagaggnacccnacatggtgaacttggncaaagaaatcat...| Sbjct: 313 gatgaaaaanaagaagatcnagatgctgatgaagaagaaaatgaagaagatagagcntgg 372 Query: 373 attgatgatattggnttgaatgatgatgatganacccna...||||||||||||| Sbjct: 373 attgatgatattggnttgaatgatgatgatganacccnagttgataattccacc 426 >Contig-U08437-1 (Contig...trand = Plus / Minus Query: 13 aatagaggnacccnacatggtgaacttggncaaagaaatcatagatttnaattgaaaatc 72 |||||||||||||

  1. Beyond habitat requirements: individual fine-scale site fidelity in a colony of the Galapagos sea lion (Zalophus wollebaeki) creates conditions for social structuring.

    Science.gov (United States)

    Wolf, Jochen B W; Trillmich, Fritz

    2007-06-01

    Site fidelity has been widely discussed, but rarely been related explicitly to a species' social context. This is surprising, as fine-scale site fidelity constitutes an important structural component in animal societies by setting limits to an individual's social interaction space. The study of fine-scale site fidelity is complicated by the fact that it is inextricably linked to patterns of habitat use. We here document fine-scale site fidelity in the Galapagos sea lion (Zalophus wollebaeki) striving to disentangle these two aspects of spatial behaviour. Regardless of sex and age, all individuals used small, cohesive home ranges, which were stable in size across the reproductive and non-reproductive season. Home ranges showed a large individual component and did not primarily reflect age- or sex-specific habitat requirements. Site specificity could be illustrated up to a resolution of several metres. Long-term site fidelity was indicated by home range persistence over 3 years and the degree of site fidelity was unaffected by habitat, but showed seasonal differences: it was lower between reproductive and non-reproductive periods than between reproductive seasons. We further examined static and social interaction within mother-offspring pairs, which constitute a central social unit in most mammalian societies. Regardless of the occupied habitat type, adult females with offspring had smaller home range sizes than non-breeding females, demonstrating the importance of spatial predictability for mother-offspring pairs that recurrently have to reunite after females' foraging sojourns. While social interaction with the mother dropped to naught in both sexes after weaning, analysis of static interaction suggested female-biased home range inheritance. Dispersal decisions were apparently not based on habitat quality, but determined by the offspring's sex. We discuss the implication of observed fine-scale site fidelity patterns on habitat use, dispersal decisions and social

  2. Development and physical analysis of YAC contigs covering 7 Mb of Xp22.3-p22.2

    Energy Technology Data Exchange (ETDEWEB)

    Herrell, S.; Novo, F.J.; Charlton, R. [Univ. of Cambridge (United Kingdom)] [and others

    1995-01-20

    A total of YAC clones have been isolated from the region of Xp22.2-p22.3 extending from the amelogenin gene locus to DXS31. Restriction analysis of these clones in association with STS contenting and end clone analysis has facilitated the construction of 6 contigs covering a total of 7 Mb in which 20 potential CpG islands have been located. Thirty new STSs have been developed from probe and YAC end clone sequences, and these have been used in the analysis of patients suffering from different combinations of chondrodysplasia punctata, mental retardation, X-linked ichthyosis, and Kallmann syndrome. The results suggest that (1) the gene for chondrodysplasia punctata must lie between the X chromosome pseudoautosomal boundary (PABX) and DXS1145; (2) a gene for mental retardation lies between DXS1145 and the sequence tagged site GS1; and (3) the gene for ocular albinism type 1 lies proximal to the STS G13. The CpG islands within the YAC contigs constitute valuable markers for the potential positions of genes. Genes found associated with any of these potential CpG islands would be possible candidates for the disease genes mentioned above. 47 refs., 3 figs., 5 tabs.

  3. Scandinavian links

    DEFF Research Database (Denmark)

    Matthiessen, Christian Wichmann; Knowles, Richard D.

    2014-01-01

    centres, one joins more thinly populated regions, and the last one links peripheral areas. Two of them (The Great Belt Link and the Oresund Link) have been constructed and are in full operation. The third (the Fehmarnbelt Link) has been decided 2008 on bilateral government level. The three links...

  4. Developing and Gathering Psychometric Evidence for a Fidelity Instrument: The Teaching Pyramid Observation Tool--Pilot Version

    Science.gov (United States)

    Snyder, Patricia A.; Hemmeter, Mary Louise; Fox, Lise; Bishop, Crystal Crowe; Miller, M. David

    2013-01-01

    Fidelity assessment has received renewed attention in recent years, particularly as distinctions have been made in implementation science between intervention fidelity and implementation fidelity. Considering both types of fidelity has been recommended when developing fidelity instruments. In the present article, we describe development of the…

  5. Multi-fidelity stochastic collocation method for computation of statistical moments

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Xueyu, E-mail: xueyu-zhu@uiowa.edu [Department of Mathematics, University of Iowa, Iowa City, IA 52242 (United States); Linebarger, Erin M., E-mail: aerinline@sci.utah.edu [Department of Mathematics, University of Utah, Salt Lake City, UT 84112 (United States); Xiu, Dongbin, E-mail: xiu.16@osu.edu [Department of Mathematics, The Ohio State University, Columbus, OH 43210 (United States)

    2017-07-15

    We present an efficient numerical algorithm to approximate the statistical moments of stochastic problems, in the presence of models with different fidelities. The method extends the multi-fidelity approximation method developed in . By combining the efficiency of low-fidelity models and the accuracy of high-fidelity models, our method exhibits fast convergence with a limited number of high-fidelity simulations. We establish an error bound of the method and present several numerical examples to demonstrate the efficiency and applicability of the multi-fidelity algorithm.

  6. The link in Linking

    Science.gov (United States)

    Caldwell, Jane C; Chiale, Pablo A; Gonzalez, Mario D; Baranchuk, Adrian

    2013-01-01

    We present 2 cases of the slow-fast form of AVNRT with initially narrow QRS complexes followed by sudden unexpected transition to persistently wide QRS complexes due to aberrant intraventricular conduction. Introduction of a properly timed extrastimulus in one case and critical oscillations in cycle length due to short-long coupling in the second case set the stage for the initial bundle branch block. However, persistence of the aberrancy pattern once the initial event abated was maintained by the "linking" phenomenon. Delayed, retrograde concealed activation from the contralateral bundle branch perpetuated the initial bundle branch block. PMID:23840106

  7. The KiVa antibullying curriculum and outcome: does fidelity matter?

    Science.gov (United States)

    Haataja, Anne; Voeten, Marinus; Boulton, Aaron J; Ahtola, Annarilla; Poskiparta, Elisa; Salmivalli, Christina

    2014-10-01

    Research on school-based prevention suggests that the success of prevention programs depends on whether they are implemented as intended. In antibullying program evaluations, however, limited attention has been paid to implementation fidelity. The present study fills in this gap by examining the link between the implementation of the KiVa antibullying program and outcome. With a large sample of 7413 students (7-12years) from 417 classrooms within 76 elementary schools, we tested whether the degree of implementation of the student lessons in the KiVa curriculum was related to the effectiveness of the program in reducing bullying problems in classrooms. Results of multilevel structural equation modeling revealed that after nine months of implementation, lesson adherence as well as lesson preparation time (but not duration of lessons) were associated with reductions in victimization at the classroom level. No statistically significant effects, however, were found for classroom-level bullying. The different outcomes for victimization and bullying as well as the importance of documenting program fidelity are discussed.

  8. Fidel Castro andis võimu vennale / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2006-01-01

    Kuuba juht Fidel Castro andis haiglassemineku tõttu riigi juhtimise ajutiselt üle oma vennale Raulile. Teade on kutsunud esile mitmeid spekulatsioone Castro tervisliku seisundi üle. Vaatlejate hinnangul peavad tõenäoliselt pettuma need, kes loodavad, et koos Castroga kaob Kuubast kiirelt ka kommunistlik riigikord. Lisa: Isegi diktaator pole surematu

  9. Fidel Castro annab teatepulga üle / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2008-01-01

    Kuuba riigipea Fidel Castro teatas, et ei taotle riiginõukogu ega vägede ülemjuhataja ametikohta. F. Castro järglane on tõenäoliselt tema vend Raul Castro. Lisad: Riik pole muutusteks valmis; Võimuletõus ja tuumasõja lävele jõudmine

  10. Measuring the Fidelity of Re-ED Programs.

    Science.gov (United States)

    Meadowcroft, Pamela; Cantrell, Mary Lynn; Cantrell, Robert P.

    2002-01-01

    The effectiveness of a comprehensive intervention like Re-ED (Reeducation of Emotional Disturbed Children) requires a clear definition of the essential components of the model. This article describes an ongoing process to create a program assessment tool for Re-ED. Program fidelity requires being able to specify precisely what is meant by certain…

  11. Learning Intercultural Communication Skills with Virtual Humans: Feedback and Fidelity

    Science.gov (United States)

    Lane, H. Chad; Hays, Matthew Jensen; Core, Mark G.; Auerbach, Daniel

    2013-01-01

    In the context of practicing intercultural communication skills, we investigated the role of fidelity in a game-based, virtual learning environment as well as the role of feedback delivered by an intelligent tutoring system. In 2 experiments, we compared variations on the game interface, use of the tutoring system, and the form of the feedback.…

  12. Principles of Fidelity in Dynamic Equivalence Translation for Trainee Translators

    Institute of Scientific and Technical Information of China (English)

    刘屹

    2011-01-01

    For trainee translators,the question of to what extent equivalence can be achieved between the source text and the target text is always one of the most challenging parts to deal with.The paper tries to provide core principles of fidelity in dynamic equiv

  13. High Fidelity Adiabatic Quantum Computation via Dynamical Decoupling

    CERN Document Server

    Quiroz, Gregory

    2012-01-01

    We introduce high-order dynamical decoupling strategies for open system adiabatic quantum computation. Our numerical results demonstrate that a judicious choice of high-order dynamical decoupling method, in conjunction with an encoding which allows computation to proceed alongside decoupling, can dramatically enhance the fidelity of adiabatic quantum computation in spite of decoherence.

  14. Fidel Castro annab teatepulga üle / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2008-01-01

    Kuuba riigipea Fidel Castro teatas, et ei taotle riiginõukogu ega vägede ülemjuhataja ametikohta. F. Castro järglane on tõenäoliselt tema vend Raul Castro. Lisad: Riik pole muutusteks valmis; Võimuletõus ja tuumasõja lävele jõudmine

  15. Experiential Fidelity: Leveraging the Mind to Improve the VR Experience

    Science.gov (United States)

    Beckhaus, Steffi; Lindeman, Robert W.

    Much of Virtual Reality (VR) is about creating environments that are believable. But though the visual and audio experiences we provide today are already of a rather high sensory fidelity, there is still something lacking; something hinders us from fully buying into the worlds we experience through VR technology. We introduce the notion of Experiential Fidelity, which is an attempt to create a deeper sense of presence by carefully designing the user experience. We suggest to guide the users' frame of mind in a way that their expectations, attitude, and attention are aligned with the actual VR experience, and that the user's own imagination is stimulated to complete the experience. This work was inspired by a collection of personal magic moments and factors that were named by leading researchers in VR. We present those magic moments and some thoughts on how we can tap into experiential fidelity. We propose to do this not through technological means, but rather through the careful use of suggestion and allusion. By priming the user's mind prior to exposure to our virtual worlds, we can assist her in entering a mental state that is more willing to believe, even using the limited actual fidelity available today.

  16. Fidel Castro andis võimu vennale / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2006-01-01

    Kuuba juht Fidel Castro andis haiglassemineku tõttu riigi juhtimise ajutiselt üle oma vennale Raulile. Teade on kutsunud esile mitmeid spekulatsioone Castro tervisliku seisundi üle. Vaatlejate hinnangul peavad tõenäoliselt pettuma need, kes loodavad, et koos Castroga kaob Kuubast kiirelt ka kommunistlik riigikord. Lisa: Isegi diktaator pole surematu

  17. Simulation Learning PC Screen-Based vs. High Fidelity

    Science.gov (United States)

    2011-08-01

    conceptualization to evaluation. New York; National league for Nursing. 31 Smith, S. and Roehrs, C. (2009). High fidelity simulation: factors...PMH: healthy male, history of fracture right humerus playing rugby in high-school. No known allergies. Last medical clinic VS: 120/78, HR

  18. First verification of generic fidelity recovery in a dynamical system

    CERN Document Server

    Pineda, C; Schäfer, R; Seligman, T H; Pineda, Carlos; Prosen, Tomaz; Schaefer, Rudi; Seligman, Thomas H.

    2006-01-01

    We study the time evolution of fidelity in a dynamical many body system, namely a kicked Ising model, modified to allow for a time reversal invariance breaking. We find good agreement with the random matrix predictions in the realm of strong perturbations. In particular for the time-reversal symmetry breaking case the predicted revival at Heisenberg time is clearly seen.

  19. Fidelity of the representation of value in decision-making.

    Science.gov (United States)

    Bays, Paul M; Dowding, Ben A

    2017-03-01

    The ability to make optimal decisions depends on evaluating the expected rewards associated with different potential actions. This process is critically dependent on the fidelity with which reward value information can be maintained in the nervous system. Here we directly probe the fidelity of value representation following a standard reinforcement learning task. The results demonstrate a previously-unrecognized bias in the representation of value: extreme reward values, both low and high, are stored significantly more accurately and precisely than intermediate rewards. The symmetry between low and high rewards pertained despite substantially higher frequency of exposure to high rewards, resulting from preferential exploitation of more rewarding options. The observed variation in fidelity of value representation retrospectively predicted performance on the reinforcement learning task, demonstrating that the bias in representation has an impact on decision-making. A second experiment in which one or other extreme-valued option was omitted from the learning sequence showed that representational fidelity is primarily determined by the relative position of an encoded value on the scale of rewards experienced during learning. Both variability and guessing decreased with the reduction in the number of options, consistent with allocation of a limited representational resource. These findings have implications for existing models of reward-based learning, which typically assume defectless representation of reward value.

  20. Demonstration of deterministic and high fidelity squeezing of quantum information

    DEFF Research Database (Denmark)

    Yoshikawa, J-I.; Hayashi, T-; Akiyama, T.

    2007-01-01

    By employing a recent proposal [R. Filip, P. Marek, and U.L. Andersen, Phys. Rev. A 71, 042308 (2005)] we experimentally demonstrate a universal, deterministic, and high-fidelity squeezing transformation of an optical field. It relies only on linear optics, homodyne detection, feedforward, and an...

  1. Modeling movement and fidelity of American black ducks

    Science.gov (United States)

    Zimpfer, N.L.; Conroy, M.J.

    2006-01-01

    Spatial relationships among stocks of breeding waterfowl can be an important component of harvest management. Prediction and optimal harvest management under adaptive harvest management (AHM) requires information on the spatial relationships among breeding populations (fidelity and inter-year exchange), as well as rates of movements from breeding to harvest regions. We used band-recovery data to develop a model to estimate probabilities of movement for American black ducks (Anas rubripes) among 3 Canadian breeding strata and 6 harvest regions (3 in Canada, and 3 in the United States) over the period 1965-1998. Model selection criteria suggested that models containing area-, year-, and age-specific recovery rates with area- and sex-specific movement rates were the best for modeling movement. Movement by males to southern harvest areas was variable depending on the originating area. Males from the western breeding area predominantly moved to the Mississippi Flyway or southern Atlantic Flyway (??ij = 0.353, SE = 0.0187 and ??ij = 0.473, SE = 0.037, respectively), whereas males that originated in the eastern and central breeding strata moved to the northern Atlantic flyway (??ij = 0.842, SE = 0.010 and ??ij = 0.578, SE = 0.0222, respectively). We used combined recoveries and recaptures in Program MARK to estimate fidelity to the 3 Canadian breeding strata. Information criteria identified a model containing sex- and age-specific fidelity for black ducks. Estimates of fidelity were 0.9695 (SE = 0.0249) and 0.9554 (SE = 0.0434) for adult males and females, respectively. Estimates of fidelity for juveniles were slightly lower at 0.9210 (SE = 0.0931) and 0.8870 (SE = 0.0475) for males and females, respectively. These models have application to the development of spatially stratified black duck harvest management models for use in AHM.

  2. Examining the Fidelity of Climate model via Shadowing Time

    Science.gov (United States)

    Du, H.; Smith, L. A.

    2015-12-01

    Fully fledged climate models provide the best available simulations for reflecting the future, yet we have scant insight into their fidelity, in particular as to the duration into the future at which the real world should be expected to evolve in a manner today's models cannot foresee. We know now that our best available models are not adequate for many sought after purposes. To throw some light on the maximum fidelity expected from a given generation of models, and thereby aid both policy making and model development, we can test the weaknesses of a model as a dynamical system to get an informed idea of its potential applicability at various lead times. Shadowing times reflect the duration on which a GCM reflects the observations; extracting the shortcomings of the model which limit shadowing times allows informed speculation regarding the fidelity of the model in the future. More specifically, the relevant phenomena limiting model fidelity can be learned by identifying the reasons models cannot shadow; the time scales on which feedbacks on the system (which are not active in the model) are likely to result in model irrelevance can be discerned. The methodology is developed in the "low dimensional laboratory" of relatively simple dynamical systems, for example Lorenz 95 systems. The results are presented in Lorenz 95 systems, high dimensional fluid dynamical simulations of rotating annulus and GCMs. There are severe limits on the light shadowing experiments can shine on GCM predictions. Never the less, they appear to be one of the brightest lights we can shine to illuminate the likely fidelity of GCM extrapolations into the future.

  3. 78 FR 23793 - Fidelity Merrimack Street Trust, et al.; Notice of Application

    Science.gov (United States)

    2013-04-22

    ... of security in its primary market. \\12\\ A TBA Transaction is a method of trading mortgage-backed... Trust (the ``Trust''), Fidelity Management & Research Company (the ``Adviser'') and Fidelity... (``Shares'') redeemable in large aggregations only (``Creation Units''); (b) secondary market...

  4. Validation of the Standard Mobility Application Programming Interface Fidelity 1 and 2

    Science.gov (United States)

    2006-07-01

    Cross-Country, Dry) 16000-fl 14000 12000- O- U 00 - ielt 0 0 Fidelity2 %0 10000 8000- 4000-zo-- Over Even Under N Fidelity 1 8151 14224 4553 0...Road, Snow) 90% 70% -j S60% > 50% ~40% E 30% S20% 1 0% - ielt 0% 0 5 10 15 20 STNDMob - NRMM (rriph) Figure 57. M923/M200A1 Fidelity 1 vs. Fidelity 2

  5. A Comprehensive Examination of Preschool Teachers' Implementation Fidelity When Using a Supplemental Language and Literacy Curriculum

    Science.gov (United States)

    Piasta, Shayne B.; Justice, Laura M.; McGinty, Anita; Mashburn, Andrew; Slocum, Laura

    2015-01-01

    Background: Recent curriculum studies raise a number of questions concerning teachers' implementation fidelity, including the extent to which fidelity to multiple curriculum components is achieved and measured and the extent to which fidelity serves as a mechanism for impacting children's learning. Objective: Within the context of a language and…

  6. Multi-fidelity wake modelling based on Co-Kriging method

    DEFF Research Database (Denmark)

    Wang, Y. M.; Réthoré, Pierre-Elouan; van der Laan, Paul

    2016-01-01

    The article presents an approach to combine wake models of multiple levels of fidelity, which is capable of giving accurate predictions with only a small number of high fidelity samples. The G. C. Larsen and k-ε-fP based RANS models are adopted as ensemble members of low fidelity and high fidelit...

  7. Dicty_cDB: Contig-U14424-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 424-1Q.Seq.d (129 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing... (Contig-U14424-1Q) /CSM_Contig/Contig-U14424-1Q.Seq.d Length = 129 Score = 58.0 bits (29), Expect = 2e-09 I...ttttttttt 35 ||||||||||||||||||||||||||||||||||| Sbjct: 1 aaaaaaaccccnaaaaaaaantttttttttttttt 35 Score = 34....35 |||||||| ||||||||||||| Sbjct: 88 aaaaaaaacnttttttttttttt 110 Score = 34.2 bits (17), Expect = 0.033 Ident...||||| |||||||||||||| Sbjct: 104 aaaaaaangtttttttttttttt 82 Score = 32.2 bits (16), Expect = 0.13 Identities

  8. Dicty_cDB: Contig-U16573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U16573-1Q.Seq.d (1612 letters) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences produ...-U16575-1 (Contig-U16575-1Q) /CSM_Contig/Contig-U16575-1Q.Seq.d Length = 1462 Score...||||||||||||| Sbjct: 350 ttcatcaacttcattattatcagcacaagcaatttcagcc 389 Score = 109 bits (55), Expect = 1e-23 ...aagaaaaagagttggctgagaaatta 869 Score = 67.9 bits (34), Expect = 5e-11 Identities ...|||||||||||||| Sbjct: 752 attggctgataaacttgaaaaggaacgtttagat 785 Score = 67.9 bits (34), Expect = 5e-11 Iden

  9. Migration phenology and seasonal fidelity of an Arctic marine predator in relation to sea ice dynamics.

    Science.gov (United States)

    Cherry, Seth G; Derocher, Andrew E; Thiemann, Gregory W; Lunn, Nicholas J

    2013-07-01

    Understanding how seasonal environmental conditions affect the timing and distribution of synchronized animal movement patterns is a central issue in animal ecology. Migration, a behavioural adaptation to seasonal environmental fluctuations, is a fundamental part of the life history of numerous species. However, global climate change can alter the spatiotemporal distribution of resources and thus affect the seasonal movement patterns of migratory animals. We examined sea ice dynamics relative to migration patterns and seasonal geographical fidelity of an Arctic marine predator, the polar bear (Ursus maritimus). Polar bear movement patterns were quantified using satellite-linked telemetry data collected from collars deployed between 1991-1997 and 2004-2009. We showed that specific sea ice characteristics can predict the timing of seasonal polar bear migration on and off terrestrial refugia. In addition, fidelity to specific onshore regions during the ice-free period was predicted by the spatial pattern of sea ice break-up but not by the timing of break-up. The timing of migration showed a trend towards earlier arrival of polar bears on shore and later departure from land, which has been driven by climate-induced declines in the availability of sea ice. Changes to the timing of migration have resulted in polar bears spending progressively longer periods of time on land without access to sea ice and their marine mammal prey. The links between increased atmospheric temperatures, sea ice dynamics, and the migratory behaviour of an ice-dependent species emphasizes the importance of quantifying and monitoring relationships between migratory wildlife and environmental cues that may be altered by climate change.

  10. Enhancing the fidelity of two-qubit gates by measurements

    Science.gov (United States)

    Gefen, Tuvia; Cohen, Daniel; Cohen, Itsik; Retzker, Alex

    2017-03-01

    Dynamical decoupling techniques are the method of choice for increasing gate fidelities. While these methods have produced very impressive results in terms of decreasing local noise and increasing the fidelities of single-qubit operations, dealing with the noise of two-qubit gates has proven more challenging. The main obstacle is that the noise time scale is shorter than the two-qubit gate itself, so that refocusing methods do not work. We present a measurement- and feedback-based method to suppress two-qubit-gate noise, which cannot be suppressed by conventional methods. We analyze in detail this method for an error model, which is relevant for trapped-ion quantum information.

  11. A high-fidelity noiseless amplifier for quantum light states

    CERN Document Server

    Zavatta, A; Bellini, M

    2010-01-01

    Noise is the price to pay when trying to clone or amplify arbitrary quantum states. The quantum noise associated to linear phase-insensitive amplifiers can only be avoided by relaxing the requirement of a deterministic operation. Here we present the experimental realization of a probabilistic noiseless linear amplifier that is able to amplify coherent states at the highest level of effective gain and final state fidelity ever reached. Based on a sequence of photon addition and subtraction, and characterized by a significant amplification and low distortions, this high-fidelity amplification scheme may become an essential tool for quantum communications and metrology, by enhancing the discrimination between partially overlapping quantum states or by recovering the information transmitted over lossy channels.

  12. Improving fidelity in atomic state teleportation via cavity decay

    CERN Document Server

    Chimczak, G; Chimczak, Grzegorz; Tana\\'s, Ryszard

    2007-01-01

    We propose a modified protocol of atomic state teleportation for the scheme proposed by Bose et al. (Phys. Rev. Lett. 83, 5158 (1999)). The modified protocol involves an additional stage in which quantum information distorted during the first stage is fully recovered by a compensation of the damping factor. The modification makes it possible to obtain a high fidelity of teleported state for cavities that are much worse than that required in the original protocol, i.e., their decay rates can be over 25 times larger. The improvement in the fidelity is possible at the expense of lowering the probability of success. We show that the modified protocol is robust against dark counts.

  13. Fidelity decay as an efficient indicator of quantum chaos.

    Science.gov (United States)

    Emerson, Joseph; Weinstein, Yaakov S; Lloyd, Seth; Cory, D G

    2002-12-31

    We demonstrate that a system's rate of fidelity decay under repeated perturbations may be measured efficiently on a quantum information processor, and analyze the conditions under which this indicator is a reliable probe of quantum chaos. The type and rate of the decay are not dependent on the eigenvalue statistics of the unperturbed system, but depend on the system's eigenvector statistics in the eigenbasis of the perturbation. For random eigenvector statistics, the decay is exponential with a rate fixed by the variance of the perturbation's energy spectrum. Hence, even classically regular models can exhibit an exponential fidelity decay under generic quantum perturbations. These results clarify which perturbations can distinguish classically regular and chaotic quantum systems.

  14. Multi-fidelity construction of explicit boundaries: Application to aeroelasticity

    Science.gov (United States)

    Dribusch, Christoph

    SVM only requires classification of training samples as feasible or infeasible, the presence of discontinuities in the simulation results does not affect the proposed algorithm. For the same reason, multiple failure modes such as aeroelastic stability, maximum stress or geometric constraints, may be represented by a single SVM predictor. Often, multiple models are available to simulate a given design at different levels of fidelity and small improvements in accuracy may increase simulation cost by an order of magnitude. In many cases, a lower-fidelity model will classify a case correctly as feasible or infeasible. Therefore a multi-fidelity algorithm is proposed that takes advantage of lower-fidelity models when appropriate to minimize the overall computational burden of training the SVM. To this end, the algorithm combines the concepts of adaptive sampling and multi-fidelity analysis to iteratively select not only the training samples, but also the appropriate level of fidelity for evaluation. The proposed algorithm, referred to as multi-fidelity explicit design space decomposition (MF-EDSD), is demonstrated on various models of aeroelastic stability to either build the stability boundary and/or to perform design optimization. The aeroelastic models range from linear and nonlinear analytical models to commercial software (ZAERO) and represent divergence, flutter, and limit cycle oscillation instabilities. Additional analytical test problems have the advantage that the accuracy of the SVM predictor and the convergence to optimal designs are more easily verified. On the other hand the more sophisticated models demonstrate the applicability to real aerospace applications where the solutions are not known a priori. In conclusion, the presented MF-EDSD algorithm is well suited for approximating stability boundaries associated with aeroelastic instabilities in high-dimensional parameter spaces. The adaptive selection of training samples and use of multi-fidelity models

  15. Sequential kriging optimization using multiple-fidelity evaluations

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Deng; Allen, T. T.; Notz, W. I.; Miller, R. A.

    2006-05-23

    When cost per evaluation on a system of interest is high, surrogate systems can provide cheaper but lower-fidelity information. In the proposed extension of the sequential kriging optimization method, surrogate systems are exploited to reduce the total evaluation cost. The method utilizes data on all systems to build a kriging metamodel that provides a global prediction of the objective function and a measure of prediction uncertainty. The location and fidelity level of the next evaluation are selected by maximizing an augmented expected improvement function, which is connected with the evaluation costs. The proposed method was applied to test functions from the literature and a metal-forming process design problem via finite element simulations. The method manifests sensible search patterns, robust performance, and appreciable reduction in total evaluation cost as compared to the original method.

  16. Sequential kriging optimization using multiple-fidelity evaluations

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Deng; Allen, T. T.; Notz, W. I.; Miller, R. A.

    2006-11-01

    When cost per evaluation on a system of interest is high, surrogate systems can provide cheaper but lower-fidelity information. In the proposed extension of the sequential kriging optimization method, surrogate systems are exploited to reduce the total evaluation cost. The method utilizes data on all systems to build a kriging metamodel that provides a global prediction of the objective function and a measure of prediction uncertainty. The location and fidelity level of the next evaluation are selected by maximizing an augmented expected improvement function, which is connected with the evaluation costs. The proposed method was applied to test functions from the literature and a metal-forming process design problem via finite element simulations. The method manifests sensible search patterns, robust performance, and appreciable reduction in total evaluation cost as compared to the original method.

  17. Proofreading genotyping assays mediated by high fidelity exo+ DNA polymerases.

    Science.gov (United States)

    Zhang, Jia; Li, Kai; Pardinas, Jose R; Sommer, Steve S; Yao, Kai-Tai

    2005-02-01

    DNA polymerases with 3'-5' proofreading function mediate high fidelity DNA replication but their application for mutation detection was almost completely neglected before 1998. The obstacle facing the use of exo(+) polymerases for mutation detection could be overcome by primer-3'-termini modification, which has been tested using allele-specific primers with 3' labeling, 3' exonuclease-resistance and 3' dehydroxylation modifications. Accordingly, three new types of single nucleotide polymorphism (SNP) assays have been developed to carry out genome-wide genotyping making use of the fidelity advantage of exo(+) polymerases. Such SNP assays might also provide a novel approach for re-sequencing and de novo sequencing. These new mutation detection assays are widely adaptable to a variety of platforms, including real-time PCR, multi-well plate and microarray technologies. Application of exo(+) polymerases to genetic analysis could accelerate the pace of personalized medicine.

  18. Efficient fidelity control by stepwise nucleotide selection in polymerase elongation

    CERN Document Server

    Yu, Jin

    2014-01-01

    Polymerases select nucleotides before incorporating them for chemical synthesis during gene replication or transcription. How the selection proceeds stepwise efficiently to achieve sufficiently high fidelity and speed is essential for polymerase function. We examined step-by-step selections that have conformational transition rates tuned one at time in the polymerase elongation cycle, with a controlled differentiation free energy at each checkpoint. The elongation is sustained at non-equilibrium steady state with constant free energy input and heat dissipation. It is found that error reduction capability does not improve for selection checkpoints down the reaction path. Hence, it is essential to select early to achieve an efficient fidelity control. In particular, for two consecutive selections that reject the wrong substrate back and inhibit it forward from a same kinetic state, the same error rates are obtained at the same free energy differentiation. The initial screening is indispensible for maintaining t...

  19. Saliency-Based Fidelity Adaptation Preprocessing for Video Coding

    Institute of Scientific and Technical Information of China (English)

    Shao-Ping Lu; Song-Hai Zhang

    2011-01-01

    In this paper, we present a video coding scheme which applies the technique of visual saliency computation to adjust image fidelity before compression. To extract visually salient features, we construct a spatio-temporal saliency map by analyzing the video using a combined bottom-up and top-down visual saliency model. We then use an extended bilateral filter, in which the local intensity and spatial scales are adjusted according to visual saliency, to adaptively alter the image fidelity. Our implementation is based on the H.264 video encoder JM12.0. Besides evaluating our scheme with the H.264 reference software, we also compare it to a more traditional foreground-background segmentation-based method and a foveation-based approach which employs Gaussian blurring. Our results show that the proposed algorithm can improve the compression ratio significantly while effectively preserving perceptual visual quality.

  20. Producing high fidelity single photons with optimal brightness

    CERN Document Server

    Laiho, K; Silberhorn, Ch

    2009-01-01

    Parametric down-conversion (PDC) offers the possibility to control the fabrication of non-Gaussian states such as Fock states. However, in conventional PDC sources energy and momentum conservation introduce strict frequency and photon number correlations, which impact the fidelity of the prepared state. In our work we optimize the preparation of single-photon Fock state from the emission of waveguided PDC via spectral filtering. We study the effect of correlations via photon number resolving detection and quantum interference. Our measurements show how the reduction of mixness due to filtering can be evaluated. Interfering the prepared photon with a coherent state we establish an experimentally measured fidelity of the produced target state of 78%.

  1. Enhancing teleportation fidelity by means of weak measurements or reversal

    Energy Technology Data Exchange (ETDEWEB)

    Qiu, Liang, E-mail: lqiu@cumt.edu.cn [College of Sciences, China University of Mining and Technology, Xuzhou 221116 (China); Tang, Gang; Yang, Xianqing [College of Sciences, China University of Mining and Technology, Xuzhou 221116 (China); Wang, Anmin [Department of Modern Physics, University of Science and Technology of China, Hefei 230026 (China)

    2014-11-15

    The enhancement of teleportation fidelity by weak measurement or quantum measurement reversal is investigated. One qubit of a maximally entangled state undergoes the amplitude damping, and the subsequent application of weak measurement or quantum measurement reversal could improve the teleportation fidelity beyond the classical region. The improvement could not be attributed to the increasing of entanglement, quantum discord, classical correlation or total correlation. We declare that it should be owed to the probabilistic nature of the method. - Highlights: • The method’s probabilistic nature should be responsible for the improvement. • Quantum or classical correlation cannot explain the improvement. • The receiver cannot apply weak measurements. • The sender’s quantum measurement reversal is only useful for |Ψ{sup ±}〉.

  2. High-Fidelity Entangled Bell States via Shortcuts to Adiabaticity

    CERN Document Server

    Paul, Koushik

    2016-01-01

    We present a couple of protocols based on shortcut to adiabaticity techniques for rapid generation of robust entangled Bell states in a system of two two-state systems. Our protocols rely on the so-called transitionless quantum driving (TQD) algorithm and Lewis-Riesenfeld invariant (LRI) method. Both TQD and LRI methods result in high fidelity in population transfer.Our study shows that it is possible to prepare an entangled state in infinitely short time without losing robustness and efficiency.

  3. Fidel Castro : maailma värvikaim diktaator / Toomas Verrev

    Index Scriptorium Estoniae

    Verrev, Toomas

    2007-01-01

    Järg. nr. 113 lk. 40-42, nr. 112 lk. 36-38, nr. 111 lk. 40-42, nr. 110 lk. 48-50, nr. 109 lk. 42-44, nr. 108 lk. 46-48, nr. 107 lk. 40-42, nr. 106 lk. 48-50, nr. 104 lk. 46-48, nr. 103 lk. 34-36, nr. 102 lk. 48-50. Kuuba diktaatori Fidel Castro elukäigust

  4. Towards robust dynamical decoupling and high fidelity adiabatic quantum computation

    Science.gov (United States)

    Quiroz, Gregory

    Quantum computation (QC) relies on the ability to implement high-fidelity quantum gate operations and successfully preserve quantum state coherence. One of the most challenging obstacles for reliable QC is overcoming the inevitable interaction between a quantum system and its environment. Unwanted interactions result in decoherence processes that cause quantum states to deviate from a desired evolution, consequently leading to computational errors and loss of coherence. Dynamical decoupling (DD) is one such method, which seeks to attenuate the effects of decoherence by applying strong and expeditious control pulses solely to the system. Provided the pulses are applied over a time duration sufficiently shorter than the correlation time associated with the environment dynamics, DD effectively averages out undesirable interactions and preserves quantum states with a low probability of error, or fidelity loss. In this study various aspects of this approach are studied from sequence construction to applications of DD to protecting QC. First, a comprehensive examination of the error suppression properties of a near-optimal DD approach is given to understand the relationship between error suppression capabilities and the number of required DD control pulses in the case of ideal, instantaneous pulses. While such considerations are instructive for examining DD efficiency, i.e., performance vs the number of control pulses, high-fidelity DD in realizable systems is difficult to achieve due to intrinsic pulse imperfections which further contribute to decoherence. As a second consideration, it is shown how one can overcome this hurdle and achieve robustness and recover high-fidelity DD in the presence of faulty control pulses using Genetic Algorithm optimization and sequence symmetrization. Thirdly, to illustrate the implementation of DD in conjunction with QC, the utilization of DD and quantum error correction codes (QECCs) as a protection method for adiabatic quantum

  5. Fidel Castro : maailma värvikaim diktaator / Toomas Verrev

    Index Scriptorium Estoniae

    Verrev, Toomas

    2007-01-01

    Järg. nr. 113 lk. 40-42, nr. 112 lk. 36-38, nr. 111 lk. 40-42, nr. 110 lk. 48-50, nr. 109 lk. 42-44, nr. 108 lk. 46-48, nr. 107 lk. 40-42, nr. 106 lk. 48-50, nr. 104 lk. 46-48, nr. 103 lk. 34-36, nr. 102 lk. 48-50. Kuuba diktaatori Fidel Castro elukäigust

  6. Improving fidelity in atomic state teleportation via cavity decay

    OpenAIRE

    Chimczak, Grzegorz; Tanaś, Ryszard

    2007-01-01

    We propose a modified protocol of atomic state teleportation for the scheme proposed by Bose et al. (Phys. Rev. Lett. 83, 5158 (1999)). The modified protocol involves an additional stage in which quantum information distorted during the first stage is fully recovered by a compensation of the damping factor. The modification makes it possible to obtain a high fidelity of teleported state for cavities that are much worse than that required in the original protocol, i.e., their decay rates can b...

  7. Retinex Image Processing: Improved Fidelity To Direct Visual Observation

    Science.gov (United States)

    Jobson, Daniel J.; Rahman, Zia-Ur; Woodell, Glenn A.

    1996-01-01

    Recorded color images differ from direct human viewing by the lack of dynamic range compression and color constancy. Research is summarized which develops the center/surround retinex concept originated by Edwin Land through a single scale design to a multi-scale design with color restoration (MSRCR). The MSRCR synthesizes dynamic range compression, color constancy, and color rendition and, thereby, approaches fidelity to direct observation.

  8. Wet season range fidelity in a tropical migratory ungulate.

    Science.gov (United States)

    Morrison, Thomas A; Bolger, Douglas T

    2012-05-01

    1. In migratory populations, the degree of fidelity and dispersal among seasonal ranges is an important population process with consequences for demography, management, sensitivity to habitat change and adaptation to local environmental conditions. 2. Characterizing patterns of range fidelity in ungulates, however, has remained challenging because of the difficulties of following large numbers of marked individuals across multiple migratory cycles and of identifying the appropriate scale of analysis. 3. We examined fidelity to wet season (i.e. breeding) ranges in a recently declining population of wildebeest Connochaetes taurinus Burchell in northern Tanzania across 3 years. We used computer-assisted photographic identification and capture-recapture to characterize return patterns to three wet season ranges that were ecologically discrete and topographically isolated from one another. 4. Among 2557 uniquely identified adult wildebeest, we observed 150 recaptures across consecutive wet seasons. Between the two migratory subpopulations, the probability of remaining faithful to wet season areas ranged between 0·82 and 1·00. Animals from a non-migratory segment of the population (near Lake Manyara National Park) were rarely observed in other wet season ranges, despite proximity to one of the migratory pathways. 5. We found no effect of sex on an individuals' probability of switching wet season ranges. However, the breeding status of females in year i had a strong influence on patterns of range selection in year i + 1, with surviving breeders over three times as likely to switch ranges as non-breeders. 6. Social-group associations between pairs of recaptured animals were random with respect to an individual's wet season range during the previous or forthcoming wet seasons, suggesting that an individual's herd identity during the dry season does not predict wet season range selection. 7. Examining fidelity and dispersal in terrestrial migrations improves

  9. Minimal measurements of the gate fidelity of a qudit map

    CERN Document Server

    Bagán, E; Muñoz-Tàpia, R

    2003-01-01

    We obtain a simple formula for the average gate fidelity of a linear map acting on qudits. It is given in terms of minimal sets of pure state preparations alone, which may be interesting from the experimental point of view. These preparations can be seen as the outcomes of certain minimal positive operator valued measures. The connection of our results with these generalized measurements is briefly discussed.

  10. Single High Fidelity Geometric Data Sets for LCM - Model Requirements

    Science.gov (United States)

    2006-11-01

    material name (example, an HY80 steel ) plus additional material requirements (heat treatment, etc.) Creation of a more detailed description of the data...57 Figure 2.22. Typical Stress-Strain Curve for Steel (adapted from Ref 59) .............................. 60 Figure...structures are steel , aluminum and composites. The structural components that make up a global FEA model drive the fidelity of the model. For example

  11. Surgical fidelity: comparing the microscope and the endoscope.

    Science.gov (United States)

    Cote, Martin; Kalra, Ricky; Wilson, Taylor; Orlandi, Richard R; Couldwell, William T

    2013-12-01

    Both the microscope and the endoscope are widely used as visualization tools in neurosurgery; however, surgical dexterity when operating with each may differ. The aim of this study was to compare the surgical fidelity when using each of these visualization tools. Junior residents and expert surgeons performed standardized motor tasks under microscopic and endoscopic visualization. Demerits for inaccuracy and time needed to complete the tasks were used to compare the surgeons' performance with the microscope and the endoscope. The participants also performed a motor task under direct vision using different instruments to evaluate whether the shape of the instrument had any impact on the surgical fidelity. For the junior residents, the number of demerits accrued was lower with the microscope than with the endoscope, and the time needed to complete the tasks was also lower with the microscope. There was no difference in the number of demerits between the microscopic and the endoscopic experts, but the microscopic expert completed the task in a shorter time. There was no difference in demerits or performance time when comparing a short, straight instrument and a longer, bayoneted one. For junior residents, surgical fidelity is higher with the microscope than with the endoscope. This difference vanishes with experience, but a slower speed of execution is observed with endoscopic visualization, both in junior and expert surgeons.

  12. Exploring the Relationship between Classroom Type and Teacher Intervention Fidelity

    Directory of Open Access Journals (Sweden)

    Jessica SUHRHEINRICH

    2016-12-01

    Full Text Available As special education enrollment for children with autism spectrum disorders (ASD has increased, school-based programs and providers have been challenged to expand the scope and quality of services. Researchers and school-based providers are aligned in the goal of providing high-quality services to students with ASD, however current literature does not address how training and implementation needs may differ by the age of children served. The current study evaluates variability in teacher fidelity of Classroom Pivotal Response Teaching (CPRT, an evidence-based naturalistic behavioral intervention based on the principals of applied behavior analysis. Data included 479 individual video units collected from 101 teacher and 221 student participants. Videos were coded using behavioral coding definitions and student demographic information was collected from parents of participating children. Analyses explored differences in fidelity of CPRT by age of students. Results indicate a significant relationship between classroom type (preschool/elementary and teachers’ fidelity of CPRT, suggesting the possibility of targeted training based on student age.

  13. Reduced Protein Synthesis Fidelity Inhibits Flagellar Biosynthesis and Motility.

    Science.gov (United States)

    Fan, Yongqiang; Evans, Christopher R; Ling, Jiqiang

    2016-07-29

    Accurate translation of the genetic information from DNA to protein is maintained by multiple quality control steps from bacteria to mammals. Genetic and environmental alterations have been shown to compromise translational quality control and reduce fidelity during protein synthesis. The physiological impact of increased translational errors is not fully understood. While generally considered harmful, translational errors have recently been shown to benefit cells under certain stress conditions. In this work, we describe a novel regulatory pathway in which reduced translational fidelity downregulates expression of flagellar genes and suppresses bacterial motility. Electron microscopy imaging shows that the error-prone Escherichia coli strain lacks mature flagella. Further genetic analyses reveal that translational errors upregulate expression of a small RNA DsrA through enhancing its transcription, and deleting DsrA from the error-prone strain restores motility. DsrA regulates expression of H-NS and RpoS, both of which regulate flagellar genes. We demonstrate that an increased level of DsrA in the error-prone strain suppresses motility through the H-NS pathway. Our work suggests that bacteria are capable of switching on and off the flagellar system by altering translational fidelity, which may serve as a previously unknown mechanism to improve fitness in response to environmental cues.

  14. Multi-fidelity wake modelling based on Co-Kriging method

    Science.gov (United States)

    Wang, Y. M.; Réthoré, P.-E.; van der Laan, M. P.; Murcia Leon, J. P.; Liu, Y. Q.; Li, L.

    2016-09-01

    The article presents an approach to combine wake models of multiple levels of fidelity, which is capable of giving accurate predictions with only a small number of high fidelity samples. The G. C. Larsen and k-ε-fP based RANS models are adopted as ensemble members of low fidelity and high fidelity models, respectively. Both the univariate and multivariate based surrogate models are established by taking the local wind speed and wind direction as variables of the wind farm power efficiency function. Various multi-fidelity surrogate models are compared and different sampling schemes are discussed. The analysis shows that the multi-fidelity wake models could tremendously reduce the high fidelity model evaluations needed in building an accurate surrogate.

  15. ClEST cluster :Cl_contig0243 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_contig0243 barrier-to-autointegration factor Cimex lectularius nuclear gene 428 ...TAATAAATACAGTATGATGTGCG fb29038 fs25084 mb23031 3 barrier to autointegration factor [Rhodnius prolixus] AEL79235 5.9E-56 GO:0003677 ...

  16. Dicty_cDB: Contig-U14847-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available : 409 ataaatataatcaatttaaaattaccngttggaccatcaatttaatgattattatacagg 468 Query: 469 tactggcgacttgttaagttcantan...tattaggttggtc 507 ||||||||||||||||||||||||||||||||||||||| Sbjct: 469 tactggcgacttgttaagttcantantattaggttggtc...us / Plus Query: 14 attatacacatgtattaactggtnataataactctgttcangctttacacacagtt 69 ||||||||||||||||||||||||||||...|||||||||||||||||||||||||||| Sbjct: 14 attatacacatgtattaactggtnataataactctgttcangctttacacacagtt 69 >Contig-U...ctggcgact 30 Query: 480 tgttaagttcantantattaggttggtc 507 |||||||||||||||||||||||||||| Sbjct: 29 tgttaagttcan

  17. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  18. Dicty_cDB: Contig-U13686-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nnacctttgaaaaaccnntnncngn 70 Query: 71 tgangntttananaaaanggantntntctanggnttcnccnangtcggt 119 |||||||||||||||...|||||||||||||||||||||||||||||||||| Sbjct: 71 tgangntttananaaaanggantntntctanggnttcnccnangtcggt 119 >Contig-U...uery: 71 tgangntttananaaaanggantntntctanggnttcnccnangtcggt 119 ||||||||||||||||||...||||||||||||||||||||||||||||||| Sbjct: 50 tgangntttananaaaanggantntntctanggnttcnccnangtcggt 2 Lambda K H 1.3

  19. Dicty_cDB: Contig-U16185-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available letters) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences producing significant alig...-1Q) /CSM_Contig/Contig-U16185-1Q.Seq.d Length = 3297 Score = 1782 bits (899), Ex...||||||||||| Sbjct: 1673 aactagtggtggattatttggagcaacccacaccatcaactacaggaggattatttgga 1731 Score = 1281 bits (...caaa 3297 ||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 3249 gtaatagaaagtacttctttaccnaaacttcaagtaagataaatacaaa 3297 Score...atttgg 1730 ||||||||||||||| Sbjct: 727 aggaggattatttgg 741 Score = 763 bits (385)

  20. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  1. A multidimensional approach to assessing intervention fidelity in a process evaluation of audit and feedback interventions to reduce unnecessary blood transfusions: a study protocol.

    Science.gov (United States)

    Lorencatto, Fabiana; Gould, Natalie J; McIntyre, Stephen A; During, Camilla; Bird, Jon; Walwyn, Rebecca; Cicero, Robert; Glidewell, Liz; Hartley, Suzanne; Stanworth, Simon J; Foy, Robbie; Grimshaw, Jeremy M; Michie, Susan; Francis, Jill J

    2016-12-12

    In England, NHS Blood and Transplant conducts national audits of transfusion and provides feedback to hospitals to promote evidence-based practice. Audits demonstrate 20% of transfusions fall outside guidelines. The AFFINITIE programme (Development & Evaluation of Audit and Feedback INterventions to Increase evidence-based Transfusion practIcE) involves two linked, 2×2 factorial, cluster-randomised trials, each evaluating two theoretically-enhanced audit and feedback interventions to reduce unnecessary blood transfusions in UK hospitals. The first intervention concerns the content/format of feedback reports. The second aims to support hospital transfusion staff to plan their response to feedback and includes a web-based toolkit and telephone support. Interpretation of trials is enhanced by comprehensively assessing intervention fidelity. However, reviews demonstrate fidelity evaluations are often limited, typically only assessing whether interventions were delivered as intended. This protocol presents methods for assessing fidelity across five dimensions proposed by the Behaviour Change Consortium fidelity framework, including intervention designer-, provider- and recipient-levels. (1) Design: Intervention content will be specified in intervention manuals in terms of component behaviour change techniques (BCTs). Treatment differentiation will be examined by comparing BCTs across intervention/standard practice, noting the proportion of unique/convergent BCTs. (2) Training: draft feedback reports and audio-recorded role-play telephone support scenarios will be content analysed to assess intervention providers' competence to deliver manual-specified BCTs. (3) Delivery: intervention materials (feedback reports, toolkit) and audio-recorded telephone support session transcripts will be content analysed to assess actual delivery of manual-specified BCTs during the intervention period. (4) Receipt and (5) enactment: questionnaires, semi-structured interviews based on the

  2. The FiDel model at 7 TeV

    CERN Document Server

    Aquilina, N; Hagen, P; Lamont, M; Langner, A S; Todesco, E; Tomas, R; Wenninger, J; Sammut, N

    2014-01-01

    After the long shut down of 2013-2014, the LHC energy will be pushed toward 7 TeV. In this range of energy, the main magnets will enter a new regime. For this reason, this paper will present a detailed study of the performance of the FiDeL model that could be critical for the operation in 2015. In particular this paper will study the saturation component and its precision in the model, the errors due to the hysteresis, and an estimate of the dynamic effects for the 7 TeVoperation.

  3. Observation of saturation of fidelity decay with an atom interferometer.

    Science.gov (United States)

    Wu, Saijun; Tonyushkin, Alexey; Prentiss, Mara G

    2009-07-17

    We use an atom interferometer to investigate the dynamics of matter waves in a periodically pulsed optical standing wave: an atom optics realization of the quantum kicked rotor that exhibits chaotic classical dynamics. We experimentally show that a measure of the coherence between the interferometer diffraction orders can revive after a quick initial loss, and can approach a finite asymptote as the number of kicks increases. This observation demonstrates that quantum fidelity of a classically chaotic system can survive strong perturbations over long times without decay.

  4. Connection between decoherence and fidelity decay in echo dynamics

    Science.gov (United States)

    Gorin, T.; Prosen, T.; Seligman, T. H.; Strunz, W. T.

    2004-10-01

    Entanglement between a quantum system and its environment leads to loss of coherence in the former. In general, the temporal fate of coherences is complicated. Here, we establish the connection between decoherence of a central system and fidelity decay in the environment for a variety of situations, including both energy conserving and dissipative couplings. We show how properties of unitary time evolution of the environment can be inferred from the nonunitary evolution of coherences in the central system. This opens up promising ways for measuring Loschmidt echoes in a variety of situations.

  5. Quantum Entanglement: Separability, Measure, Fidelity of Teleportation, and Distillation

    Directory of Open Access Journals (Sweden)

    Ming Li

    2010-01-01

    Full Text Available Quantum entanglement plays crucial roles in quantum information processing. Quantum entangled states have become the key ingredient in the rapidly expanding field of quantum information science. Although the nonclassical nature of entanglement has been recognized for many years, considerable efforts have been taken to understand and characterize its properties recently. In this review, we introduce some recent results in the theory of quantum entanglement. In particular separability criteria based on the Bloch representation, covariance matrix, normal form and entanglement witness, lower bounds, subadditivity property of concurrence and tangle, fully entangled fraction related to the optimal fidelity of quantum teleportation, and entanglement distillation will be discussed in detail.

  6. Communication Links

    OpenAIRE

    2003-01-01

    This interactive tutorial helps learners to: Identify key upward, lateral, downward, and informal communication links in their organizations. , Reflect on the benefits, control, satisfaction, information filters, and feedback mechanism of various communication links in the organizations. OCL1000 Communicating Change in Complex Organizations

  7. Operative links

    DEFF Research Database (Denmark)

    Wistoft, Karen

    2010-01-01

    as networks: second, a semantic perspective on discourses and concepts of health, and, third, a health pedagogical perspective on participation, intervention, and roles. This paper argues for the importance of 'operative links' between different levels in health strategies. It is proposed that such links...

  8. Entanglement Fidelity as a Measure of Preservation of Entanglement in Local Noisy Process

    Institute of Scientific and Technical Information of China (English)

    XIANG Yang; XIONG Shi-Jie

    2011-01-01

    A new formula of entanglement fidelity has been introduced, which can serve as a measure of the preservation of entanglement between two initially entangled subsystems exposed to local noisy environments. For a simple model we derive analytic expressions of concurrence and entanglement fidelity and draw the relationship between them. We find that such entanglement fidelity exhibits the behavior similar to that of the concurrence in quantum evolutions.

  9. High Fidelity Simulation of Primary Atomization in Diesel Engine Sprays

    Science.gov (United States)

    Ivey, Christopher; Bravo, Luis; Kim, Dokyun

    2014-11-01

    A high-fidelity numerical simulation of jet breakup and spray formation from a complex diesel fuel injector at ambient conditions has been performed. A full understanding of the primary atomization process in fuel injection of diesel has not been achieved for several reasons including the difficulties accessing the optically dense region. Due to the recent advances in numerical methods and computing resources, high fidelity simulations of atomizing flows are becoming available to provide new insights of the process. In the present study, an unstructured un-split Volume-of-Fluid (VoF) method coupled to a stochastic Lagrangian spray model is employed to simulate the atomization process. A common rail fuel injector is simulated by using a nozzle geometry available through the Engine Combustion Network. The working conditions correspond to a single orifice (90 μm) JP-8 fueled injector operating at an injection pressure of 90 bar, ambient condition at 29 bar, 300 K filled with 100% nitrogen with Rel = 16,071, Wel = 75,334 setting the spray in the full atomization mode. The experimental dataset from Army Research Lab is used for validation in terms of spray global parameters and local droplet distributions. The quantitative comparison will be presented and discussed. Supported by Oak Ridge Associated Universities and the Army Research Laboratory.

  10. Patterns of communication in high-fidelity simulation.

    Science.gov (United States)

    Anderson, Judy K; Nelson, Kimberly

    2015-01-01

    High-fidelity simulation is commonplace in nursing education. However, critical thinking, decision making, and psychomotor skills scenarios are emphasized. Scenarios involving communication occur in interprofessional or intraprofessional settings. The importance of effective nurse-patient communication is reflected in statements from the American Nurses Association and Quality and Safety Education for Nurses, and in the graduate outcomes of most nursing programs. This qualitative study examined the patterns of communication observed in video recordings of a medical-surgical scenario with 71 senior students in a baccalaureate program. Thematic analysis revealed patterns of (a) focusing on tasks, (b) communicating-in-action, and (c) being therapeutic. Additional categories under the patterns included missing opportunities, viewing the "small picture," relying on informing, speaking in "medical tongues," offering choices…okay?, feeling uncomfortable, and using therapeutic techniques. The findings suggest the importance of using high-fidelity simulation to develop expertise in communication. In addition, the findings reinforce the recommendation to prioritize communication aspects of scenarios and debriefing for all simulations.

  11. Geographical variation in mutualistic networks: similarity, turnover and partner fidelity.

    Science.gov (United States)

    Trøjelsgaard, Kristian; Jordano, Pedro; Carstensen, Daniel W; Olesen, Jens M

    2015-03-07

    Although species and their interactions in unison represent biodiversity and all the ecological and evolutionary processes associated with life, biotic interactions have, contrary to species, rarely been integrated into the concepts of spatial β-diversity. Here, we examine β-diversity of ecological networks by using pollination networks sampled across the Canary Islands. We show that adjacent and distant communities are more and less similar, respectively, in their composition of plants, pollinators and interactions than expected from random distributions. We further show that replacement of species is the major driver of interaction turnover and that this contribution increases with distance. Finally, we quantify that species-specific partner compositions (here called partner fidelity) deviate from random partner use, but vary as a result of ecological and geographical variables. In particular, breakdown of partner fidelity was facilitated by increasing geographical distance, changing abundances and changing linkage levels, but was not related to the geographical distribution of the species. This highlights the importance of space when comparing communities of interacting species and may stimulate a rethinking of the spatial interpretation of interaction networks. Moreover, geographical interaction dynamics and its causes are important in our efforts to anticipate effects of large-scale changes, such as anthropogenic disturbances.

  12. Innate Immune and Chemically Triggered Oxidative Stress Modifies Translational Fidelity

    Science.gov (United States)

    Netzer, Nir; Goodenbour, Jeffrey M.; David, Alexandre; Dittmar, Kimberly A.; Jones, Richard B.; Schneider, Jeffrey R.; Boone, David; Eves, Eva M.; Rosner, Marsha R.; Gibbs, James S.; Embry, Alan; Dolan, Brian; Das, Suman; Hickman, Heather; Berglund, Peter; Bennink, Jack R.; Yewdell, Jonathan W.; Pan, Tao

    2009-01-01

    Translational fidelity, essential for protein and cell function, requires accurate tRNA aminoacylation. Purified aminoacyl-tRNA synthetases exhibit a fidelity of 1 error per 10,000 to 100,000 couplings 1, 2. The accuracy of tRNA aminoacylation in vivo is uncertain, however, and might be considerably lower 3–6. Here, we show that in mammalian cells, approximately 1% of methionine (Met) residues used in protein synthesis are aminoacylated to non-methionyl-tRNAs. Remarkably, Met-misacylation increases up to 10-fold upon exposing cells to live or non-infectious viruses, toll-like receptor ligands, or chemically induced oxidative stress. Met is misacylated to specific non-methionyl-tRNA families, and these Met-misacylated tRNAs are used in translation. Met-misacylation is blocked by an inhibitor of cellular oxidases, implicating reactive oxygen species (ROS) as the misacylation trigger. Among six amino acids tested, tRNA misacylation occurs exclusively with Met. As Met residues are known to protect proteins against ROS-mediated damage 7, we propose that Met-misacylation functions adaptively to increase Met incorporation into proteins to protect cells against oxidative stress. In demonstrating an unexpected conditional aspect of decoding mRNA, our findings illustrate the importance of considering alternative iterations of the genetic code. PMID:19940929

  13. A feedback control system for high-fidelity digital microfluidics.

    Science.gov (United States)

    Shih, Steve C C; Fobel, Ryan; Kumar, Paresh; Wheeler, Aaron R

    2011-02-07

    Digital microfluidics (DMF) is a technique in which discrete droplets are manipulated by applying electrical fields to an array of electrodes. In an ideal DMF system, each application of driving potential would cause a targeted droplet to move onto an energized electrode (i.e., perfect fidelity between driving voltage and actuation); however, in real systems, droplets are sometimes observed to resist movement onto particular electrodes. Here, we implement a sensing and feedback control system in which all droplet movements are monitored, such that when a movement failure is observed, additional driving voltages can be applied until the droplet completes the desired operation. The new system was evaluated for a series of liquids including water, methanol, and cell culture medium containing fetal bovine serum, and feedback control was observed to result in dramatic improvements in droplet actuation fidelity and velocity. The utility of the new system was validated by implementing an enzyme kinetics assay with continuous mixing. The new platform for digital microfluidics is simple and inexpensive and thus should be useful for scientists and engineers who are developing automated analysis platforms.

  14. High-fidelity geometric modeling for biomedical applications

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Zeyun [Univ. of California, San Diego, CA (United States). Dept. of Mathematics; Holst, Michael J. [Univ. of California, San Diego, CA (United States). Dept. of Mathematics; Andrew McCammon, J. [Univ. of California, San Diego, CA (United States). Dept. of Chemistry and Biochemistry; Univ. of California, San Diego, CA (United States). Dept. of Pharmacology

    2008-05-19

    In this paper, we describe a combination of algorithms for high-fidelity geometric modeling and mesh generation. Although our methods and implementations are application-neutral, our primary target application is multiscale biomedical models that range in scales across the molecular, cellular, and organ levels. Our software toolchain implementing these algorithms is general in the sense that it can take as input a molecule in PDB/PQR forms, a 3D scalar volume, or a user-defined triangular surface mesh that may have very low quality. The main goal of our work presented is to generate high quality and smooth surface triangulations from the aforementioned inputs, and to reduce the mesh sizes by mesh coarsening. Tetrahedral meshes are also generated for finite element analysis in biomedical applications. Experiments on a number of bio-structures are demonstrated, showing that our approach possesses several desirable properties: feature-preservation, local adaptivity, high quality, and smoothness (for surface meshes). Finally, the availability of this software toolchain will give researchers in computational biomedicine and other modeling areas access to higher-fidelity geometric models.

  15. Administrator and Fidelity Based Secure Routing (AFSR Protocol in MANET

    Directory of Open Access Journals (Sweden)

    Rohit Singh

    2016-03-01

    Full Text Available The proliferation of mobile computing and communication devices are driving a revolutionary change in our information society. Among all the applications and services run by mobile devices, network connections and corresponding data services are without doubt the most demanded services by mobile users. A MANET is a continuously self-configuring, infrastructure-less network of mobile devices connected without wires, which makes it ideal for the present scenario. But, due to lack of any centralized infrastructure and access to trusted authorities, the security in MANET poses a huge threat. The prominent routing protocols we know are generally designed for environments where the nodes within a network are non-malicious. Due to the vulnerable nature of the mobile ad hoc network, there are numerous security threats that disturb its development. We propose a protocol for MANETs named “Administrator and Fidelity Based Secure Routing Protocol” (AFSR, which ensures secure routing through the network: by electing an Administrator node on the basis of Willingness and Fidelity, after which a node only communicates to that secure Admin node. This selection of secured admin nodes results in mitigation of various threats. We have evaluated our proposed protocol by simulating and comparing in GloMoSim.

  16. Designing Struts for the Low-Fidelity Orion Cockpit Mockup

    Science.gov (United States)

    Lucienne, Runa A.

    2009-01-01

    The objective of the project was to design and construct nine struts to be installed in the low-fidelity Orion cockpit mockup (Rev F; located at NASA s Johnson Space Center in Houston, TX) as simplified representations of the existing flight designed struts designed by engineers at Lockheed Martin (the primary contractor of the Orion). The project design included: researching the existing flight designs, brainstorming design upgrades, developing three unrelated three-dimensional (3D) strut designs using Pro/Engineer Wildfire 3.0, choosing the best fit design, locating materials and their sources, implementing the chosen design, and making design modifications. The project resulted in making simple modifications to the existing struts used in the last Orion cockpit mockup. The project is relevant to NASA, because upgrades to the low-fidelity Orion cockpit mockup progresses NASA s goals of developing and testing a new spacecraft, conducting the spacecraft's first crewed mission by 2015, returning to the moon by 2020, and exploring Mars and other planets in the future.

  17. Physics Of Eclipsing Binaries. II. Toward the Increased Model Fidelity

    Science.gov (United States)

    Prša, A.; Conroy, K. E.; Horvat, M.; Pablo, H.; Kochoska, A.; Bloemen, S.; Giammarco, J.; Hambleton, K. M.; Degroote, P.

    2016-12-01

    The precision of photometric and spectroscopic observations has been systematically improved in the last decade, mostly thanks to space-borne photometric missions and ground-based spectrographs dedicated to finding exoplanets. The field of eclipsing binary stars strongly benefited from this development. Eclipsing binaries serve as critical tools for determining fundamental stellar properties (masses, radii, temperatures, and luminosities), yet the models are not capable of reproducing observed data well, either because of the missing physics or because of insufficient precision. This led to a predicament where radiative and dynamical effects, insofar buried in noise, started showing up routinely in the data, but were not accounted for in the models. PHOEBE (PHysics Of Eclipsing BinariEs; http://phoebe-project.org) is an open source modeling code for computing theoretical light and radial velocity curves that addresses both problems by incorporating missing physics and by increasing the computational fidelity. In particular, we discuss triangulation as a superior surface discretization algorithm, meshing of rotating single stars, light travel time effects, advanced phase computation, volume conservation in eccentric orbits, and improved computation of local intensity across the stellar surfaces that includes the photon-weighted mode, the enhanced limb darkening treatment, the better reflection treatment, and Doppler boosting. Here we present the concepts on which PHOEBE is built and proofs of concept that demonstrate the increased model fidelity.

  18. Importance of debriefing in high-fidelity simulations

    Directory of Open Access Journals (Sweden)

    Igor Karnjuš

    2014-04-01

    Full Text Available Debriefing has been identified as one of the most important parts of a high-fidelity simulation learning process. During debriefing, the mentor invites learners to critically assess the knowledge and skills used during the execution of a scenario. Regardless of the abundance of studies that have examined simulation-based education, debriefing is still poorly defined.The present article examines the essential features of debriefing, its phases, techniques and methods with a systematic review of recent publications. It emphasizes the mentor’s role, since the effectiveness of debriefing largely depends on the mentor’s skills to conduct it. The guidelines that allow the mentor to evaluate his performance in conducting debriefing are also presented. We underline the importance of debriefing in clinical settings as part of continuous learning process. Debriefing allows the medical teams to assess their performance and develop new strategies to achieve higher competencies.Although the debriefing is the cornerstone of high-fidelity simulation learning process, it also represents an important learning strategy in the clinical setting. Many important aspects of debriefing are still poorly explored and understood, therefore this part of the learning process should be given greater attention in the future.

  19. Total fidelity management in self-aligned multiple patterning process

    Science.gov (United States)

    Yamato, Masatoshi; Okabe, Noriaki; Hara, Arisa; Natori, Sakurako; Yamauchi, Shouhei; Koike, Kyohei; Oyama, Kenichi; Yaegashi, Hidetami

    2015-03-01

    Through the continuous scaling with extension of 193-immersion lithography, the multi-patterning process with the grid-based design has become nominal process for fine fabrication to relax tight pitch designs[1]. In self-aligned type multiple patterning, 7 nm node gate pattern was reported[2],[3] and it was become a focal point LER on core-pattern is essential category to control pattern placement variations. Though CD uniformity (CDU) on line pattern in self-aligned double patterning (SADP) is relatively stable caused in high thickness controllability of spacer deposition films, the variations of CDU and LER on first core pattern impinge the CDU on space and pitch pattern. In previous study, pattern fidelity of single exposure patterning was improved through photoresist smoothing process using direct-current superposition technique[4],[5]. In this paper, we will report that photoresist smoothing work in an efficient way to pattern fidelity control in self-aligned type multiple patterning.

  20. FIDELITY TOWARDS FORMS: AN ONTOLOGICAL APPROACH – PART I

    Directory of Open Access Journals (Sweden)

    ANA BAZAC

    2014-11-01

    Full Text Available The paper opposes to a common attitude towards forms – as being something non-important, superficial, “formal” – Plato and Aristotle’s philosophy, according to which things exist because of forms. From the inquiry of their logic that mixes the epistemological and the ontological standpoint, the analysis goes on to the problem of the understanding of forms as events: as mirrors of the manner we see the world/as mirrors of the way of thinking. I contrast the event to the situation – in Alain Badiou’s manner – and I show that there is a logic of continuity between Aristotle’s insistence on the concrete face of form (σύνoλoν and Badiou’s concept of fidelity: because this concept always relates to the concrete which deserves to be faithful towards. The value of things we support gives their “forms”. If so, fidelity towards forms is something more complete and suggestive than to follow essences: forms are as important as essences; this is obvious when the forms change but the essence do not; in fact, it is not a real change. The real change is when the form changes bringing also the change of the essence.

  1. Quantum Monte Carlo simulations of fidelity at magnetic quantum phase transitions.

    Science.gov (United States)

    Schwandt, David; Alet, Fabien; Capponi, Sylvain

    2009-10-23

    When a system undergoes a quantum phase transition, the ground-state wave function shows a change of nature, which can be monitored using the fidelity concept. We introduce two quantum Monte Carlo schemes that allow the computation of fidelity and its susceptibility for large interacting many-body systems. These methods are illustrated on a two-dimensional Heisenberg model, where fidelity estimators show marked behavior at two successive quantum phase transitions. We also develop a scaling theory which relates the divergence of the fidelity susceptibility to the critical exponent of the correlation length. A good agreement is found with the numerical results.

  2. Is high fidelity to supported employment equally attainable in small and large communities?

    Science.gov (United States)

    Luciano, Alison; Bond, Gary R; Drake, Robert E; Becker, Deborah R

    2014-01-01

    Individual Placement and Support (IPS) is an evidence-based model to help people with serious mental illness achieve employment. This study examined variation in model adherence in small and large communities. We compared program-level ratings on a standardized 25-item IPS fidelity scale (range = 25-125) for 79 sites in eight states categorized by local community size. Programs in large and small communities achieved comparable fidelity scores (mean = 100 and 104, respectively). Fidelity-outcome correlations within the two groups were both of moderate size. As a practical guide, the IPS fidelity scale is suitable for use in both small and large communities.

  3. [The development and current status of high-fidelity patient simulation teaching].

    Science.gov (United States)

    Chen, Shiah-Lian; Lee, Mei-Li; Liao, I-Chen; Liang, Tienli

    2013-04-01

    High-fidelity patient simulation teaching represents one of the most important innovations in healthcare education in the past two decades. In Taiwan, many medical centers and medical colleges now have clinical skill centers equipped with a high-fidelity patient simulator. Practicing clinical scenarios in this simulated environment can help strengthen students' professional essentials and competencies outside of classroom and clinical teaching settings. High-fidelity simulation teaching is an integrated teaching strategy that is continuing to receive greater attention. This article describes the historical development of high-fidelity patient simulation teaching, its current status, and applications in nursing education as a reference for nursing educators.

  4. The central role of heat shock factor 1 in synaptic fidelity and memory consolidation

    National Research Council Canada - National Science Library

    Hooper, Philip L; Durham, Heather D; Török, Zsolt; Hooper, Paul L; Crul, Tim; Vígh, László

    2016-01-01

    ...), the major transcription factor regulating expression of heat shock genes, plays a central role in proteostasis, in establishing and sustaining synaptic fidelity and function, and in memory consolidation...

  5. The dependence of fidelity on the squeezing parameter in teleportation of the squeezed coherent states

    Institute of Scientific and Technical Information of China (English)

    Zhang Jing-Tao; He Guang-Qiang; Ren Li-Jie; Zeng Gui-Hua

    2011-01-01

    This paper investigates an analytical expression of teleportation fidelity in the teleportation scheme of a single mode of electromagnetic field. The fidelity between the original squeezed coherent state and the teleported one is expressed in terms of the squeezing parameter r and the quantum channel parameter (two-mode squeezed state) p. The results of analysis show that the fidelity increases with the increase of the quantum channel parameter p, while the fidelity decreases with the increase of the squeezing parameter r of the squeezed state. Thus the coherent state (r = 0)is the best quantum signal for continuous variable quantum teleportation once the quantum channel is built.

  6. Contig-Layout-Authenticator (CLA): A Combinatorial Approach to Ordering and Scaffolding of Bacterial Contigs for Comparative Genomics and Molecular Epidemiology.

    Science.gov (United States)

    Shaik, Sabiha; Kumar, Narender; Lankapalli, Aditya K; Tiwari, Sumeet K; Baddam, Ramani; Ahmed, Niyaz

    2016-01-01

    A wide variety of genome sequencing platforms have emerged in the recent past. High-throughput platforms like Illumina and 454 are essentially adaptations of the shotgun approach generating millions of fragmented single or paired sequencing reads. To reconstruct whole genomes, the reads have to be assembled into contigs, which often require further downstream processing. The contigs can be directly ordered according to a reference, scaffolded based on paired read information, or assembled using a combination of the two approaches. While the reference-based approach appears to mask strain-specific information, scaffolding based on paired-end information suffers when repetitive elements longer than the size of the sequencing reads are present in the genome. Sequencing technologies that produce long reads can solve the problems associated with repetitive elements but are not necessarily easily available to researchers. The most common high-throughput technology currently used is the Illumina short read platform. To improve upon the shortcomings associated with the construction of draft genomes with Illumina paired-end sequencing, we developed Contig-Layout-Authenticator (CLA). The CLA pipeline can scaffold reference-sorted contigs based on paired reads, resulting in better assembled genomes. Moreover, CLA also hints at probable misassemblies and contaminations, for the users to cross-check before constructing the consensus draft. The CLA pipeline was designed and trained extensively on various bacterial genome datasets for the ordering and scaffolding of large repetitive contigs. The tool has been validated and compared favorably with other widely-used scaffolding and ordering tools using both simulated and real sequence datasets. CLA is a user friendly tool that requires a single command line input to generate ordered scaffolds.

  7. Identifying wrong assemblies in de novo short read primary sequence assembly contigs

    Indian Academy of Sciences (India)

    VANDNA CHAWLA; RAJNISH KUMAR; RAVI SHANKAR

    2016-09-01

    With the advent of short-reads-based genome sequencing approaches, large number of organisms are being sequencedall over the world. Most of these assemblies are done using some de novo short read assemblers and other relatedapproaches. However, the contigs produced this way are prone to wrong assembly. So far, there is a conspicuousdearth of reliable tools to identify mis-assembled contigs. Mis-assemblies could result from incorrectly deleted orwrongly arranged genomic sequences. In the present work various factors related to sequence, sequencing andassembling have been assessed for their role in causing mis-assembly by using different genome sequencing data.Finally, some mis-assembly detecting tools have been evaluated for their ability to detect the wrongly assembledprimary contigs, suggesting a lot of scope for improvement in this area. The present work also proposes a simpleunsupervised learning-based novel approach to identify mis-assemblies in the contigs which was found performingreasonably well when compared to the already existing tools to report mis-assembled contigs. It was observed that theproposed methodology may work as a complementary system to the existing tools to enhance their accuracy.

  8. Link Analysis

    Science.gov (United States)

    Donoho, Steve

    Link analysis is a collection of techniques that operate on data that can be represented as nodes and links. This chapter surveys a variety of techniques including subgraph matching, finding cliques and K-plexes, maximizing spread of influence, visualization, finding hubs and authorities, and combining with traditional techniques (classification, clustering, etc). It also surveys applications including social network analysis, viral marketing, Internet search, fraud detection, and crime prevention.

  9. Light fidelity (Li-Fi): towards all-optical networking

    Science.gov (United States)

    Tsonev, Dobroslav; Videv, Stefan; Haas, Harald

    2013-12-01

    Motivated by the looming radio frequency (RF) spectrum crisis, this paper aims at demonstrating that optical wireless communication (OWC) has now reached a state where it can demonstrate that it is a viable and matured solution to this fundamental problem. In particular, for indoor communications where most mobile data traffic is consumed, light fidelity (Li-Fi) which is related to visible light communication (VLC) offers many key advantages, and effective solutions to the issues that have been posed in the last decade. This paper discusses all key component technologies required to realize optical cellular communication systems referred to here as optical attocell networks. Optical attocells are the next step in the progression towards ever smaller cells, a progression which is known to be the most significant contributor to the improvements in network spectral efficiencies in RF wireless networks.

  10. TET1 and hydroxymethylcytosine in transcription and DNA methylation fidelity

    DEFF Research Database (Denmark)

    Williams, Kristine; Christensen, Jesper; Pedersen, Marianne Terndrup;

    2011-01-01

    throughout the genome of embryonic stem cells, with the majority of binding sites located at transcription start sites (TSSs) of CpG-rich promoters and within genes. The hmC modification is found in gene bodies and in contrast to mC is also enriched at CpG-rich TSSs. We provide evidence further that TET1 has...... a role in transcriptional repression. TET1 binds a significant proportion of Polycomb group target genes. Furthermore, TET1 associates and colocalizes with the SIN3A co-repressor complex. We propose that TET1 fine-tunes transcription, opposes aberrant DNA methylation at CpG-rich sequences and thereby...... contributes to the regulation of DNA methylation fidelity....

  11. High-fidelity plasma codes for burn physics

    Energy Technology Data Exchange (ETDEWEB)

    Cooley, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Graziani, Frank [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Marinak, Marty [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Murillo, Michael [Michigan State Univ., East Lansing, MI (United States)

    2016-10-19

    Accurate predictions of equation of state (EOS), ionic and electronic transport properties are of critical importance for high-energy-density plasma science. Transport coefficients inform radiation-hydrodynamic codes and impact diagnostic interpretation, which in turn impacts our understanding of the development of instabilities, the overall energy balance of burning plasmas, and the efficacy of self-heating from charged-particle stopping. Important processes include thermal and electrical conduction, electron-ion coupling, inter-diffusion, ion viscosity, and charged particle stopping. However, uncertainties in these coefficients are not well established. Fundamental plasma science codes, also called high-fidelity plasma codes, are a relatively recent computational tool that augments both experimental data and theoretical foundations of transport coefficients. This paper addresses the current status of HFPC codes and their future development, and the potential impact they play in improving the predictive capability of the multi-physics hydrodynamic codes used in HED design.

  12. High-fidelity plasma codes for burn physics

    Energy Technology Data Exchange (ETDEWEB)

    Cooley, James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Graziani, Frank [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Marinak, Marty [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Murillo, Michael [Michigan State Univ., East Lansing, MI (United States)

    2016-10-19

    Accurate predictions of equation of state (EOS), ionic and electronic transport properties are of critical importance for high-energy-density plasma science. Transport coefficients inform radiationhydrodynamic codes and impact diagnostic interpretation, which in turn impacts our understanding of the development of instabilities, the overall energy balance of burning plasmas, and the efficacy of selfheating from charged-particle stopping. Important processes include thermal and electrical conduction, electron-ion coupling, inter-diffusion, ion viscosity, and charged particle stopping. However, uncertainties in these coefficients are not well established. Fundamental plasma science codes, also called high-fidelity plasma codes are a relatively recent computational tool that augments both experimental data and theoretical foundations of transport coefficients. This paper addresses the current status of HFPC codes and their future development, and the potential impact they play in improving the predictive capability of the multi-physics hydrodynamic codes used in HED design.

  13. The theatre of high-fidelity simulation education.

    Science.gov (United States)

    Roberts, Debbie; Greene, Leah

    2011-10-01

    High-fidelity simulation is a useful mechanism to aid progression, development and skill acquisition in nurse education. However, nurse lecturers are daunted by sophisticated simulation technology. This paper presents a new method of introducing human patient simulation to students and educators, whilst seeking to demystify the roles, responsibilities and underpinning pedagogy. The analogy of simulation as theatre outlines the concepts of the theatre and stage (simulation laboratory); the play itself (Simulated Clinical Experience, SCE); the actors (nursing students); audience (peer review panel); director (session facilitator); and the production team (technical coordinators). Performing in front of people in a safe environment, repeated practice and taking on a new role teaches students to act, think and be like a nurse. This in turn supports student learning and enhances self confidence.

  14. Model-implementation fidelity in cyber physical system design

    CERN Document Server

    Fabre, Christian

    2017-01-01

    This book puts in focus various techniques for checking modeling fidelity of Cyber Physical Systems (CPS), with respect to the physical world they represent. The authors' present modeling and analysis techniques representing different communities, from very different angles, discuss their possible interactions, and discuss the commonalities and differences between their practices. Coverage includes model driven development, resource-driven development, statistical analysis, proofs of simulator implementation, compiler construction, power/temperature modeling of digital devices, high-level performance analysis, and code/device certification. Several industrial contexts are covered, including modeling of computing and communication, proof architectures models and statistical based validation techniques. Addresses CPS design problems such as cross-application interference, parsimonious modeling, and trustful code production Describes solutions, such as simulation for extra-functional properties, extension of cod...

  15. Evaluating Implementation Fidelity in Health Information Technology Interventions

    Science.gov (United States)

    Eisenstein, Eric L.; Lobach, David F.; Montgomery, Paul; Kawamoto, Kensaku; Anstrom, Kevin J.

    2007-01-01

    Health information technology evaluators need to distinguish between intervention efficacy as assessed in the ideal circumstances of clinical trials and intervention effectiveness as assessed in the real world circumstances of actual practice. Because current evaluation study designs do not routinely allow for this distinction, we have developed a framework for evaluation of implementation fidelity that considers health information technologies as complex interventions and makes use of common intervention components as defined in the Oxford Implementation Index. We also propose statistical methods for the evaluation of interventions at the system and component level using the Rubin Causal Model. We then describe how to apply this framework to evaluate an ongoing clinical trial of three health information technology interventions currently implemented in a 17,000 patient community-based health network caring for Medicaid beneficiaries in Durham County, North Carolina. PMID:18693828

  16. Fidelity under isospectral perturbations: a random matrix study

    Science.gov (United States)

    Leyvraz, F.; García, A.; Kohler, H.; Seligman, T. H.

    2013-07-01

    The set of Hamiltonians generated by all unitary transformations from a single Hamiltonian is the largest set of isospectral Hamiltonians we can form. Taking advantage of the fact that the unitary group can be generated from Hermitian matrices we can take the ones generated by the Gaussian unitary ensemble with a small parameter as small perturbations. Similarly, the transformations generated by Hermitian antisymmetric matrices from orthogonal matrices form isospectral transformations among symmetric matrices. Based on this concept we can obtain the fidelity decay of a system that decays under a random isospectral perturbation with well-defined properties regarding time-reversal invariance. If we choose the Hamiltonian itself also from a classical random matrix ensemble, then we obtain solutions in terms of form factors in the limit of large matrices.

  17. Automating Initial Guess Generation for High Fidelity Trajectory Optimization Tools

    Science.gov (United States)

    Villa, Benjamin; Lantoine, Gregory; Sims, Jon; Whiffen, Gregory

    2013-01-01

    Many academic studies in spaceflight dynamics rely on simplified dynamical models, such as restricted three-body models or averaged forms of the equations of motion of an orbiter. In practice, the end result of these preliminary orbit studies needs to be transformed into more realistic models, in particular to generate good initial guesses for high-fidelity trajectory optimization tools like Mystic. This paper reviews and extends some of the approaches used in the literature to perform such a task, and explores the inherent trade-offs of such a transformation with a view toward automating it for the case of ballistic arcs. Sample test cases in the libration point regimes and small body orbiter transfers are presented.

  18. Derivation Of Probabilistic Damage Definitions From High Fidelity Deterministic Computations

    Energy Technology Data Exchange (ETDEWEB)

    Leininger, L D

    2004-10-26

    This paper summarizes a methodology used by the Underground Analysis and Planning System (UGAPS) at Lawrence Livermore National Laboratory (LLNL) for the derivation of probabilistic damage curves for US Strategic Command (USSTRATCOM). UGAPS uses high fidelity finite element and discrete element codes on the massively parallel supercomputers to predict damage to underground structures from military interdiction scenarios. These deterministic calculations can be riddled with uncertainty, especially when intelligence, the basis for this modeling, is uncertain. The technique presented here attempts to account for this uncertainty by bounding the problem with reasonable cases and using those bounding cases as a statistical sample. Probability of damage curves are computed and represented that account for uncertainty within the sample and enable the war planner to make informed decisions. This work is flexible enough to incorporate any desired damage mechanism and can utilize the variety of finite element and discrete element codes within the national laboratory and government contractor community.

  19. Computer-Based versus High-Fidelity Mannequin Simulation in Developing Clinical Judgment in Nursing Education

    Science.gov (United States)

    Howard, Beverly J.

    2013-01-01

    The purpose of this study was to determine if students learn clinical judgment as effectively using computer-based simulations as when using high-fidelity mannequin simulations. There was a single research questions for this study: What is the difference in clinical judgment between participants completing high-fidelity human simulator mannequin…

  20. Blending Qualitative and Computational Linguistics Methods for Fidelity Assessment: Experience with the Familias Unidas Preventive Intervention.

    Science.gov (United States)

    Gallo, Carlos; Pantin, Hilda; Villamar, Juan; Prado, Guillermo; Tapia, Maria; Ogihara, Mitsunori; Cruden, Gracelyn; Brown, C Hendricks

    2015-09-01

    Careful fidelity monitoring and feedback are critical to implementing effective interventions. A wide range of procedures exist to assess fidelity; most are derived from observational assessments (Schoenwald and Garland, Psycholog Assess 25:146-156, 2013). However, these fidelity measures are resource intensive for research teams in efficacy/effectiveness trials, and are often unattainable or unmanageable for the host organization to rate when the program is implemented on a large scale. We present a first step towards automated processing of linguistic patterns in fidelity monitoring of a behavioral intervention using an innovative mixed methods approach to fidelity assessment that uses rule-based, computational linguistics to overcome major resource burdens. Data come from an effectiveness trial of the Familias Unidas intervention, an evidence-based, family-centered preventive intervention found to be efficacious in reducing conduct problems, substance use and HIV sexual risk behaviors among Hispanic youth. This computational approach focuses on "joining," which measures the quality of the working alliance of the facilitator with the family. Quantitative assessments of reliability are provided. Kappa scores between a human rater and a machine rater for the new method for measuring joining reached 0.83. Early findings suggest that this approach can reduce the high cost of fidelity measurement and the time delay between fidelity assessment and feedback to facilitators; it also has the potential for improving the quality of intervention fidelity ratings.

  1. Sequence-Specific Fidelity Alterations Associated with West Nile Virus Attenuation in Mosquitoes.

    Directory of Open Access Journals (Sweden)

    Greta A Van Slyke

    2015-06-01

    Full Text Available High rates of error-prone replication result in the rapid accumulation of genetic diversity of RNA viruses. Recent studies suggest that mutation rates are selected for optimal viral fitness and that modest variations in replicase fidelity may be associated with viral attenuation. Arthropod-borne viruses (arboviruses are unique in their requirement for host cycling and may necessitate substantial genetic and phenotypic plasticity. In order to more thoroughly investigate the correlates, mechanisms and consequences of arbovirus fidelity, we selected fidelity variants of West Nile virus (WNV; Flaviviridae, Flavivirus utilizing selection in the presence of a mutagen. We identified two mutations in the WNV RNA-dependent RNA polymerase associated with increased fidelity, V793I and G806R, and a single mutation in the WNV methyltransferase, T248I, associated with decreased fidelity. Both deep-sequencing and in vitro biochemical assays confirmed strain-specific differences in both fidelity and mutational bias. WNV fidelity variants demonstrated host-specific alterations to replicative fitness in vitro, with modest attenuation in mosquito but not vertebrate cell culture. Experimental infections of colonized and field populations of Cx. quinquefaciatus demonstrated that WNV fidelity alterations are associated with a significantly impaired capacity to establish viable infections in mosquitoes. Taken together, these studies (i demonstrate the importance of allosteric interactions in regulating mutation rates, (ii establish that mutational spectra can be both sequence and strain-dependent, and (iii display the profound phenotypic consequences associated with altered replication complex function of flaviviruses.

  2. Assessment of Fidelity in Interventions to Improve Hand Hygiene of Healthcare Workers: A Systematic Review

    Science.gov (United States)

    Musuuza, Jackson S.; Barker, Anna; Ngam, Caitlyn; Vellardita, Lia; Safdar, Nasia

    2016-01-01

    OBJECTIVE Compliance with hand hygiene in healthcare workers is fundamental to infection prevention yet remains a challenge to sustain. We examined fidelity reporting in interventions to improve hand hygiene compliance, and we assessed 5 measures of intervention fidelity: (1) adherence, (2) exposure or dose, (3) quality of intervention delivery, (4) participant responsiveness, and (5) program differentiation. DESIGN Systematic review METHODS A librarian performed searches of the literature in PubMed, Cumulative Index to Nursing and Allied Health (CINAHL), Cochrane Library, and Web of Science of material published prior to June 19, 2015. The review protocol was registered in PROSPERO International Prospective Register of Systematic Reviews, and assessment of study quality was conducted for each study reviewed. RESULTS A total of 100 studies met the inclusion criteria. Only 8 of these 100 studies reported all 5 measures of intervention fidelity. In addition, 39 of 100 (39%) failed to include at least 3 fidelity measures; 20 of 100 (20%) failed to include 4 measures; 17 of 100 (17%) failed to include 2 measures, while 16 of 100 (16%) of the studies failed to include at least 1 measure of fidelity. Participant responsiveness and adherence to the intervention were the most frequently unreported fidelity measures, while quality of the delivery was the most frequently reported measure. CONCLUSIONS Almost all hand hygiene intervention studies failed to report at least 1 fidelity measurement. To facilitate replication and effective implementation, reporting fidelity should be standard practice when describing results of complex behavioral interventions such as hand hygiene. PMID:26861117

  3. Using Indices of Fidelity to Intervention Core Components to Identify Program Active Ingredients

    Science.gov (United States)

    Abry, Tashia; Hulleman, Chris S.; Rimm-Kaufman, Sara E.

    2015-01-01

    Identifying the active ingredients of an intervention--intervention-specific components serving as key levers of change--is crucial for unpacking the intervention black box. Measures of intervention fidelity can be used to identify specific active ingredients, yet such applications are rare. We illustrate how fidelity measures can be used to…

  4. A Fidelity Rating Instrument for Consumer-Run Drop-In Centers (FRI-CRDI)

    Science.gov (United States)

    Mowbray, Carol T.; Holter, Mark C.; Stark, Lori; Pfeffer, Carla; Bybee, Deborah

    2005-01-01

    Objective: Given the present emphasis on accountability and maintaining quality, the objective of this study was to develop, apply, and assess the reliability of a fidelity rating instrument for consumer-operated services--a promising model, but one for which fidelity criteria are not yet established. Method: Based on observations, documents, and…

  5. Fidelity of quantum state for interacting system of light field and atomic Bose-Einstein condensate

    Institute of Scientific and Technical Information of China (English)

    Chunjia Huang; Ming Zhou; Fanzhi Kong; Jiayuan Fang; Kewei Mo

    2005-01-01

    @@ The evolution characteristics of quantum state fidelity in an interacting system of single-mode light field and atomic Bose-Einstein condensate have been studied and the influence of the initial light field intensity and the interaction among atoms of Bose-Einstein condensate on the quantum state fidelity respectively have been discussed.

  6. The Effectiveness and Precision of Intervention Fidelity Measures in Preschool Intervention Research

    Science.gov (United States)

    Darrow, Catherine L.

    2013-01-01

    A quantifiable measure of teachers' intervention fidelity when delivering curriculum-based interventions allows researchers to interpret the effectiveness of the curricula under scrutiny. Fidelity measures, however, must accurately represent the critical components of an intervention to confirm that the intervention was delivered as intended and…

  7. Implementation Fidelity in Adolescent Family-Based Prevention Programs: Relationship to Family Engagement

    Science.gov (United States)

    Byrnes, Hilary F.; Miller, Brenda A.; Aalborg, Annette E.; Plasencia, Ana V.; Keagy, Carolyn D.

    2010-01-01

    Reliability and validity of intervention studies are impossible without adequate program fidelity, as it ensures that the intervention was implemented as designed and allows for accurate conclusions about effectiveness (Bellg AJ, Borrelli B, Resnick B "et al." Enhancing treatment fidelity in health behavior change studies: best practices…

  8. Fidelity considerations for simulation-based usability assessments of mobile ICT for hospitals

    DEFF Research Database (Denmark)

    Dahl, Yngve; Alsos, Ole A; Svanæs, Dag

    2010-01-01

    training simulation fidelity theories. Based on a review of the training simulation literature, a set of fidelity dimensions through which training simulations are often adjusted to meet specific goals are identified. It is argued that the same mechanisms can be used in usability assessments of mobile ICT...

  9. Sources of variation in breeding-ground fidelity of mallards (Anas platyrhynchos)

    Science.gov (United States)

    Doherty, P.F.; Nichols, J.D.; Tautin, J.; Voelzer, J.E.; Smith, G.W.; Benning, D.S.; Bentley, V.R.; Bidwell, J.K.; Bollinger, K.S.; Brazda, A.R.; Buelna, E.K.; Goldsberry, J.R.; King, R.J.; Roetker, F.H.; Solberg, J.W.; Thorpe, P.P.; Wortham, J.S.

    2002-01-01

    Generalizations used to support hypotheses about the evolution of fidelity to breeding areas in birds include the tendency for fidelity to be greater in adult birds than in yearlings. In ducks, in contrast to most bird species, fidelity is thought to be greater among females than males. Researchers have suggested that fidelity in ducks is positively correlated with pond availability. However, most estimates of fidelity on which these inferences have been based represent functions of survival and recapture-resighting probabilities in addition to fidelity. We applied the modeling approach developed by Burnham to recapture and band recovery data of mallard ducks to test the above hypotheses about fidelity. We found little evidence of sex differences in adult philopatry, with females being slightly more philopatric than males in one study area, but not in a second study area. However, yearling females were more philopatric than yearling males in both study areas. We found that adults were generally more philopatric than yearlings. We could find no relationship between fidelity and pond availability. Our results, while partially supporting current theory concerning sex and age differences in philopatry, suggest that adult male mallards are more philopatric than once thought, and we recommend that other generalizations about philopatry be revisited with proper estimation techniques.

  10. Mismatch repair balances leading and lagging strand DNA replication fidelity.

    Directory of Open Access Journals (Sweden)

    Scott A Lujan

    Full Text Available The two DNA strands of the nuclear genome are replicated asymmetrically using three DNA polymerases, α, δ, and ε. Current evidence suggests that DNA polymerase ε (Pol ε is the primary leading strand replicase, whereas Pols α and δ primarily perform lagging strand replication. The fact that these polymerases differ in fidelity and error specificity is interesting in light of the fact that the stability of the nuclear genome depends in part on the ability of mismatch repair (MMR to correct different mismatches generated in different contexts during replication. Here we provide the first comparison, to our knowledge, of the efficiency of MMR of leading and lagging strand replication errors. We first use the strand-biased ribonucleotide incorporation propensity of a Pol ε mutator variant to confirm that Pol ε is the primary leading strand replicase in Saccharomyces cerevisiae. We then use polymerase-specific error signatures to show that MMR efficiency in vivo strongly depends on the polymerase, the mismatch composition, and the location of the mismatch. An extreme case of variation by location is a T-T mismatch that is refractory to MMR. This mismatch is flanked by an AT-rich triplet repeat sequence that, when interrupted, restores MMR to > 95% efficiency. Thus this natural DNA sequence suppresses MMR, placing a nearby base pair at high risk of mutation due to leading strand replication infidelity. We find that, overall, MMR most efficiently corrects the most potentially deleterious errors (indels and then the most common substitution mismatches. In combination with earlier studies, the results suggest that significant differences exist in the generation and repair of Pol α, δ, and ε replication errors, but in a generally complementary manner that results in high-fidelity replication of both DNA strands of the yeast nuclear genome.

  11. Dicty_cDB: Contig-U09041-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M443227_1( AM443227 |pid:none) Vitis vinifera contig VV79X000254.... 39 0.47 AY497776_1( AY497776 |pid:none) Cyprinodon...A-directed DNA polymerase (EC 2.7.7.49) (clone ... 39 0.47 AY497777_1( AY497777 |pid:none) Cyprinodon varieg... |pid:none) Vitis vinifera contig VV78X074410.... 38 0.80 AY497783_1( AY497783 |pid:none) Cyprinodon variega

  12. Dicty_cDB: Contig-U16021-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available letters) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences producing significant align...Q) /CSM_Contig/Contig-U16021-1Q.Seq.d Length = 907 Score = 531 bits (268), Expect...actgcttcagcttcttcatctgg 519 Score = 131 bits (66), Expect = 2e-30 Identities = 88/96 (91%) Strand = Plus / P...| Sbjct: 633 aaaatcattacagtttccattaattgtacatacatt 668 Score = 115 bits (58), Expect = 1e-25 Identities = 98/...cattatcaataactcaaccaacc 233 Score = 67.9 bits (34), Expect = 3e-11 Identities = 3

  13. Dicty_cDB: Contig-U16575-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 02 sequences; 8,075,542 total letters Score E Sequences producing significant ali...6575-1Q) /CSM_Contig/Contig-U16575-1Q.Seq.d Length = 1462 Score = 329 bits (166), Expect = 7e-90 Identities ...atcaacttcattattatcagcacaagcaatttcagc 388 Score = 121 bits (61), Expect = 3e-27 Identities = 61/61 (100%) Str...agaaattagagaaagagaaagaattggctgataaact 898 Query: 899 t 899 | Sbjct: 899 t 899 Score = 113 bits (57), Expect ...ct: 663 gaattggctgataaattagagaaagaacgtcaagagaaagagttggctgataaactt 719 Score = 91.7 bits (46), Expect = 3e-18

  14. Are All Manikins Created Equal? A Pilot Study of Simulator Upper Airway Anatomic Fidelity.

    Science.gov (United States)

    Woo, Jennifer A; Malekzadeh, Sonya; Malloy, Kelly M; Deutsch, Ellen S

    2017-06-01

    This study evaluates the anatomic fidelity of several commercially available pediatric and adult manikins, including airway task trainers, which could be used in aerodigestive procedure training. Twenty-three experienced otolaryngologists assessed the aerodigestive anatomy of 5 adult and 5 pediatric manikins in a passive state, using rigid and flexible endoscopy. Anatomic fidelity was rated on a 5-point scale for the following: nasal cavity, nasopharynx, oral cavity, oropharynx, larynx, trachea, esophagus, and neck. Mean scores and standard deviations were tabulated for each manikin at each anatomic site. Ratings by survey participants demonstrated variation in the anatomic fidelity of the aerodigestive tract in a range of manikins. Radar chart display of the results allows comparison of manikin fidelity by anatomic site. Differences in scores may allow instructors to select manikins with the best anatomic fidelity for specific educational purposes, and they may contribute to recommendations to improve future manikin design.

  15. Light fidelity (Li-Fi): An effective solution for data transmission

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Vaishali, E-mail: vaishalisharma202@gmail.com; Rajput, Shreya, E-mail: rajputshreya15@gmail.com; Sharma, Praveen Kumar, E-mail: psv.bkbiet@gmail.com [Department of Electronics and Communication Engineering, B.K Birla Institute of Engineering and Technology, Pilani, Rajasthan-333031 (India)

    2016-03-09

    The rapid advancement in the field of science has led to the development of many technologies, gadgets and equipment which in turn has hold pressure on Wi-Fi, modems, board band connections etc., to lessen this stress new revolution in this field has rooted on termed “LI-FI”. Li-Fi stands for light fidelity i.e. light is used for the transmission of data. The concept of Li-Fi is taking the fiber out of fiber optics sending information through an LED that varies in intensity faster than human eye can follow. Li-Fi offers an entirely new paradigm in wireless technology in term of communication, speed, flexibility, usability etc. The idea of data through illumination is similar to radio waves communication difference lies in the use of LED in LI-Fi, which made it superior than Wi-Fi. Hence Li-Fi is linked to the visible light communication network provision transmission which is looked upon as an advancement. Thus a new class of light with high intensity light source of solid state design bringing clean lighting solution to general and specialty lighting. With energy efficiency, long useful lifetime, full spectrum and dimming. Li-Fi is just not only confined to light and LED indeed it is a platform with versatile advantages and facilities. This paper gives a brief idea about the introduction of Li-Fi, its working, advantages, limitations etc.

  16. Analysis of Fiber Clustering in Composite Materials Using High-Fidelity Multiscale Micromechanics

    Science.gov (United States)

    Bednarcyk, Brett A.; Aboudi, Jacob; Arnold, Steven M.

    2015-01-01

    A new multiscale micromechanical approach is developed for the prediction of the behavior of fiber reinforced composites in presence of fiber clustering. The developed method is based on a coupled two-scale implementation of the High-Fidelity Generalized Method of Cells theory, wherein both the local and global scales are represented using this micromechanical method. Concentration tensors and effective constitutive equations are established on both scales and linked to establish the required coupling, thus providing the local fields throughout the composite as well as the global properties and effective nonlinear response. Two nondimensional parameters, in conjunction with actual composite micrographs, are used to characterize the clustering of fibers in the composite. Based on the predicted local fields, initial yield and damage envelopes are generated for various clustering parameters for a polymer matrix composite with both carbon and glass fibers. Nonlinear epoxy matrix behavior is also considered, with results in the form of effective nonlinear response curves, with varying fiber clustering and for two sets of nonlinear matrix parameters.

  17. Light fidelity (Li-Fi): An effective solution for data transmission

    Science.gov (United States)

    Sharma, Vaishali; Rajput, Shreya; Sharma, Praveen Kumar

    2016-03-01

    The rapid advancement in the field of science has led to the development of many technologies, gadgets and equipment which in turn has hold pressure on Wi-Fi, modems, board band connections etc., to lessen this stress new revolution in this field has rooted on termed "LI-FI". Li-Fi stands for light fidelity i.e. light is used for the transmission of data. The concept of Li-Fi is taking the fiber out of fiber optics sending information through an LED that varies in intensity faster than human eye can follow. Li-Fi offers an entirely new paradigm in wireless technology in term of communication, speed, flexibility, usability etc. The idea of data through illumination is similar to radio waves communication difference lies in the use of LED in LI-Fi, which made it superior than Wi-Fi. Hence Li-Fi is linked to the visible light communication network provision transmission which is looked upon as an advancement. Thus a new class of light with high intensity light source of solid state design bringing clean lighting solution to general and specialty lighting. With energy efficiency, long useful lifetime, full spectrum and dimming. Li-Fi is just not only confined to light and LED indeed it is a platform with versatile advantages and facilities. This paper gives a brief idea about the introduction of Li-Fi, its working, advantages, limitations etc.

  18. Ethnography, fidelity, and the evidence that anthropology adds: supplementing the fidelity process in a clinical trial of supported employment.

    Science.gov (United States)

    Smith-Morris, Carolyn; Lopez, Gilberto; Ottomanelli, Lisa; Goetz, Lance; Dixon-Lawson, Kimberly

    2014-06-01

    This discussion considers the role and findings of ethnographic research within a clinical trial of supported employment for veterans with spinal cord injury. Contributing to qualitative evaluation research and to debates over anthropological evidence vis-à-vis clinical trials, we demonstrate how enactors of a randomized controlled trial can simultaneously attend to both the trial's evidentiary and procedural requirements and to the lived experiences and needs of patients and clinicians. Three major findings are described: (1) contextual information essential to fidelity efforts within the trial; (2) the role of human interrelationships and idiosyncratic networks in the trial's success; and (3) a mapping of the power and authority structures relevant to the staff's ability to perform the protocol. We emphasize strengths of anthropological ethnography in clinical trials that include the provision of complementary, qualitative data, the capture of otherwise unmeasured parts of the trial, and the realization of important information for the translation of the clinical findings into new settings.

  19. High-fidelity simulator technology may not be superior to traditional low-fidelity equipment for neonatal resuscitation training.

    Science.gov (United States)

    Finan, E; Bismilla, Z; Whyte, H E; Leblanc, V; McNamara, P J

    2012-04-01

    Despite completing accredited resuscitation training, neonatal trainees often feel unprepared to deal with real-life clinical emergencies. High-fidelity simulator (HFS) technology offers the potential of recreating a realistic stressful clinical environment to aid training and evaluation. To date, there are limited data examining the physiological impact of this training modality in comparison to less costly alternatives. The objective of this study was to compare the effects of low-fidelity simulator (LFS) versus HFS technology on performance levels, objective and subjective measures of stress in neonatal trainees. Sixteen neonatal fellows were invited to participate in a prospective randomized study. Subjects were divided into pairs and randomized to LFS or HFS for completion of scenario I. After an interval of 1 month, fellow teams crossed over to complete scenario II using the alternative simulator technology. Technical and non-technical skills were assessed using validated resuscitation scoring tools. Participants recorded subjective stress at sequential time points before and after each simulation. Buccal cortisol was measured at each corresponding time point and comparison between HFS and LFS groups was made. The mean overall resuscitation performance score was 75.8%±10, but there was no difference in performance between HFS and LFS groups. There was also no significant difference in non-technical skills performance between groups. Salivary cortisol increased over the duration of the simulated experience, but there were no differences between the two groups (P=0.001, two-way repeated measures analysis of variance). We also identified changes in subjective measures of stress (P<0.001, analysis of variance) over time, but again there were no differences between groups. Simulated neonatal resuscitations induce a significant stress response in neonatal trainees; however, we were unable to identify any difference in stress measures between HFS and LFS. These

  20. Evidence-Based Practice in School Substance Use Prevention: Fidelity of Implementation under Real-World Conditions

    Science.gov (United States)

    Ennett, S. T.; Haws, S.; Ringwalt, C. L.; Vincus, A. A.; Hanley, S.; Bowling, J. M.; Rohrbach, L. A.

    2011-01-01

    Fidelity of program implementation under real-world conditions is a critical issue in the dissemination of evidence-based school substance use prevention curricula. Program effects are diminished when programs are implemented with poor fidelity. We assessed five domains of fidelity--adherence, exposure (dosage), quality of delivery, participant…

  1. First-Order Model Management With Variable-Fidelity Physics Applied to Multi-Element Airfoil Optimization

    Science.gov (United States)

    Alexandrov, N. M.; Nielsen, E. J.; Lewis, R. M.; Anderson, W. K.

    2000-01-01

    First-order approximation and model management is a methodology for a systematic use of variable-fidelity models or approximations in optimization. The intent of model management is to attain convergence to high-fidelity solutions with minimal expense in high-fidelity computations. The savings in terms of computationally intensive evaluations depends on the ability of the available lower-fidelity model or a suite of models to predict the improvement trends for the high-fidelity problem, Variable-fidelity models can be represented by data-fitting approximations, variable-resolution models. variable-convergence models. or variable physical fidelity models. The present work considers the use of variable-fidelity physics models. We demonstrate the performance of model management on an aerodynamic optimization of a multi-element airfoil designed to operate in the transonic regime. Reynolds-averaged Navier-Stokes equations represent the high-fidelity model, while the Euler equations represent the low-fidelity model. An unstructured mesh-based analysis code FUN2D evaluates functions and sensitivity derivatives for both models. Model management for the present demonstration problem yields fivefold savings in terms of high-fidelity evaluations compared to optimization done with high-fidelity computations alone.

  2. Dicty_cDB: Contig-U05126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ng_GS-35-01-01-1... 34 9.4 3 ( DM017669 ) Detection of human papilloma virus. 34 9.4 5 ( DM017668 ) Detect...ion of human papilloma virus. 34 9.4 5 ( AM455845 ) Vitis vinifera contig VV78X2533

  3. Dicty_cDB: Contig-U10711-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lug cDNA, clone SLJ867. 285 3e-72 1 ( EC758640 ) PPE00000863 Agencourt Biosciences Agen-0020 Non-n... 48 5e-...32 Contig6. 36 0.013 6 ( EC758718 ) PPE00003327 Agencourt Biosciences Agen-0020 N

  4. Dicty_cDB: Contig-U09928-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5... 36 0.004 7 ( EC757582 ) PPE00006249 Agencourt Biosciences Agen-0020 Non-n... 54 0.014 1 ( AC116986 ) Di... 8, clone: C0... 50 0.22 1 ( AM437658 ) Vitis vinifera contig VV78X236844.6, whole genome... 50 0.22 1 ( EC762912 ) PPE00002546 Agenc

  5. Dicty_cDB: Contig-U06072-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone:... 44 4.7 1 ( AM460282 ) Vitis vinifera contig VV78X085811.7, whole genome... 44 4.7 1 ( DI095098 ) Methods For Assessing... and Treating Leukemia. 44 4.7 1 ( DD228942 ) Methods For Assessing

  6. Dicty_cDB: Contig-U11045-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qpklklinhq**eenhyyqlil qrsllyllivhlkilcqqiviavmmtmmkiiipimilklkmklkkilgyl*iivtpylk Frame C: ysfetsil*DHINYQQ...QIQQRE KFKQNAPETQKSKQINQNNNNNNNNINNNNNNNNNNNGSTETKADKPSMIRRKSLLPVDP STIAALSSHRSLEDIMSTNSNSGNDDDDENNHTNHDSEIE...QIQQRE KFKQNAPETQKSKQINQNNNNNNNNINNNNNNNNNNNGSTETKADKPSMIRRKSLLPVDP STIAALSSHRSLEDIMSTNSNSGNDDDDENNHTNHDSEIE...Contig-U11045-1 gap included 1898 3 3364214 3362305 MINUS 25 27 U11045 0 1 2 4 3 0 ... Start point 3364214 End point 3362305 Strand (PLUS/MINUS) MINUS Number of clones

  7. Dicty_cDB: Contig-U06184-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DKRKKKDAKYGFGGKKRYA KTNDKGPC Frame C: nslmkmvnyliqkmkwikkkkxkd*xnni*nqivknml*milkv*kvn*eilnyqvvkfh gfih*qlhh...KQTLQSVTECEKLCAQNGLTVRRKPDFFAEM IKSDQQMHKIKTNIQSEKKRVETSEMIRKKREIKKFGKQVQTQKLQERQKQKSDAIESVK KWRKNREKGNVSDEF...FFAEM IKSDQQMHKIKTNIQSEKKRVETSEMIRKKREIKKFGKQVQTQKLQERQKQKSDAIESVK KWRKNREKGNVSDEFNIDLIDDIAAKKDRKKVEKSKLPVKG...AAATQARGLLKKEGIPFTRPGDYF 194 Query: 353 AEMIKSDQQMHKIKTNIQSEKKRVETSEMIRKKREIKKFGKQVQTQKLQERQKQKSDAIE 532 AEM...Contig-U06184-1 no gap 746 4 2523475 2522729 MINUS 1 1 U06184 0 0 1 0 0 0 0 0 0 0 0

  8. Dicty_cDB: Contig-U12500-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ulation... 95 8e-18 CP000820_6355( CP000820 |pid:none) F...328_15( AM270328 |pid:none) Aspergillus niger contig An15c001... 95 8e-18 X16365_1( X16365 |pid:none) Yeast suppressor gene for flocc

  9. Dicty_cDB: Contig-U09249-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ell Park Can... 38 0.22 6 ( AM465390 ) Vitis vinifera contig VV78X107501.4, whole genome... 38 0.27 3 ( CV953984 ) PXrpxc_0341 myceli...um, starved in water Phytophtho... 48 0.32 1 ( EW777467

  10. Dicty_cDB: Contig-U12231-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available inifera contig VV78X268914.11, whole genom... 46 2.5 1 ( DJ051139 ) HIGH EFFICIENCY GENE TRANSFER AND EXPRES...SION IN M... 46 2.5 1 ( DI107068 ) HIGH EFFICIENCY GENE TRANSFER AND EXPRESSION I

  11. Dicty_cDB: Contig-U15566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( AL935140 ) Zebrafish DNA sequence from clone DKEYP-122E7 in ... 48 1.2 1 ( EF555519 ) Marmota himalay...ana clone W41 microsatellite seque... 48 1.2 1 ( AM446059 ) Vitis vinifera contig V

  12. Dicty_cDB: Contig-U09340-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available olanum lycopersicum cv. Heinz 1706, chromosome 0... 44 5.7 1 ( DD147007 ) A method for assaying an inhibitor...31 ) Vitis vinifera contig VV78X115648.4, whole genome... 44 5.7 1 ( AC212306 ) S

  13. Dicty_cDB: Contig-U04727-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s vinifera contig VV78X143029.7, whole genome... 44 5.0 1 ( DD308451 ) NUCLEIC ACID AND POLYPEPTIDE SEQUENCE...S FROM LAWSO... 44 5.0 1 ( DD307082 ) NUCLEIC ACID AND POLYPEPTIDE SEQUENCES FROM LAWSO... 44 5.0 1 ( DD305476 ) NUCLEIC

  14. Dicty_cDB: Contig-U13034-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 44 4.7 1 ( AM483929 ) Vitis vinifera contig VV78X206598.7, whole genome... 44 4.7 1 ( DD293979 ) SUSCEPTIBILITY GENE FOR HUMAN STR...OKE; METHODS OF ... 44 4.7 1 ( AX573240 ) Sequence 86 fr

  15. Dicty_cDB: Contig-U16102-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 6 ( BJ408668 ) Dictyostelium discoideum cDNA clone:dds46g14, 3' ... 44 3.0 2 ( CV162186 ) CS_hyp_01d11_M13Reverse Blue crab hypoder...08_M13Reverse Blue crab hypodermis, nor... 42 3.6 2 ( AM474408 ) Vitis vinifera contig VV78X173370.5, whole

  16. Dicty_cDB: Contig-U12238-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 33460 |pid:none) Rabbit eucaryotic release factor (eRF)... 166 2e-80 FN357616_30(...rom... 144 6e-82 AM270199_44( AM270199 |pid:none) Aspergillus niger contig An09c010... 137 4e-81 M33460_1( M

  17. Dicty_cDB: Contig-U07481-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnttttntgnatnattnnnggaataataaanaaacatttcngt 70 Query: 71 tnntagngccagggncatttcannttttttnttnaccatac 111 |||||...|||||||||||||||||||||||||||||||||||| Sbjct: 71 tnntagngccagggncatttcannttttttnttnaccatac 111 >Contig-U13902-...ngt 60 Query: 71 tnntagngccagggncatttcannttttttnttnaccatac 111 ||||||||||||||||||||||||||||||||||||||||| Sbj...ct: 61 tnntagngccagggncatttcannttttttnttnaccatac 101 Lambda K H 1.37 0.711 1.31 M

  18. Dicty_cDB: Contig-U04026-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 139 |pid:none) Aspergillus niger contig An07c022... 48 1e-04 AJ245813_1( AJ245813 |pid:none) Aphrocallistes vastu...s mRNA for pot... 48 1e-04 AJ249917_1( AJ249917 |pid:none) Aphrocallistes vastu

  19. Dicty_cDB: Contig-U10060-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nt... 49 3e-04 ( Q64127 ) RecName: Full=Transcription intermediary factor 1-alpha... 49 3e-04 S78219_1( S782...:none) Aspergillus niger contig An04c018... 49 4e-04 ( O15164 ) RecName: Full=Transcription intermediary fac

  20. Dicty_cDB: Contig-U05841-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ERENTIALLY EXPRESSED IN CANCERO... 42 6.6 1 ( CS789425 ) Sequence 681 from Patent W..., whole genome... 42 6.6 1 ( AM438855 ) Vitis vinifera contig VV78X154934.6, whole genome... 42 6.6 1 ( DD230941 ) GENE PRODUCTS DIFF

  1. Assembly and sorting of homologous BAC contigs in allotetraploid cotton genomes

    Science.gov (United States)

    Upland cotton (G. hirsutum) is a diploidized allopolyploid species containing At and Dt sub-genomes that have partial homology. Assembly and sorting of homologous BAC contigs into their subgenomes and further to individual chromosomes are of both great interest and great challenge for genome-wide i...

  2. Dicty_cDB: Contig-U12006-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Aspergillus niger contig An06c009... 63 2e-08 DQ251455_1( DQ251455 |pid:none) Cucurbita pepo patel...uyveromyces thermotolerans str... 60 2e-07 EU962184_1( EU962184 |pid:none) Zea mays clone 240809 patellin-5

  3. mHealth interventions for weight loss: a guide for achieving treatment fidelity.

    Science.gov (United States)

    Shaw, Ryan J; Steinberg, Dori M; Zullig, Leah L; Bosworth, Hayden B; Johnson, Constance M; Davis, Linda L

    2014-01-01

    mHealth interventions have shown promise for helping people sustain healthy behaviors such as weight loss. However, few have assessed treatment fidelity, that is, the accurate delivery, receipt, and enactment of the intervention. Treatment fidelity is critical because the valid interpretation and translation of intervention studies depend on treatment fidelity assessments. We describe strategies used to assess treatment fidelity in mobile health (mHealth) interventions aimed at sustaining healthy behaviors in weight loss. We reviewed treatment fidelity recommendations for mHealth-based behavioral interventions and described how these recommendations were applied in three recent weight loss studies. We illustrate how treatment fidelity can be supported during study design, training of providers, treatment delivery, receipt of treatment, and enactment of treatment skills. Pre-planned strategies to ensure the treatment fidelity of mHealth interventions will help counter doubts concerning valid conclusions about their effectiveness and allow investigators and clinicians to implement robustly efficacious mobile health programs. 1F31 NR012599. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  4. Fidelity decay of the two-level bosonic embedded ensembles of random matrices

    Science.gov (United States)

    Benet, Luis; Hernández-Quiroz, Saúl; Seligman, Thomas H.

    2010-12-01

    We study the fidelity decay of the k-body embedded ensembles of random matrices for bosons distributed over two single-particle states. Fidelity is defined in terms of a reference Hamiltonian, which is a purely diagonal matrix consisting of a fixed one-body term and includes the diagonal of the perturbing k-body embedded ensemble matrix, and the perturbed Hamiltonian which includes the residual off-diagonal elements of the k-body interaction. This choice mimics the typical mean-field basis used in many calculations. We study separately the cases k = 2 and 3. We compute the ensemble-averaged fidelity decay as well as the fidelity of typical members with respect to an initial random state. Average fidelity displays a revival at the Heisenberg time, t = tH = 1, and a freeze in the fidelity decay, during which periodic revivals of period tH are observed. We obtain the relevant scaling properties with respect to the number of bosons and the strength of the perturbation. For certain members of the ensemble, we find that the period of the revivals during the freeze of fidelity occurs at fractional times of tH. These fractional periodic revivals are related to the dominance of specific k-body terms in the perturbation.

  5. The effects of teacher fidelity of implementation of pathways to health on student outcomes.

    Science.gov (United States)

    Little, Melissa A; Riggs, Nathaniel R; Shin, Hee-Sung; Tate, Eleanor B; Pentz, Mary Ann

    2015-03-01

    Previous research has demonstrated the importance of ensuring that programs are implemented as intended by program developers in order to achieve desired program effects. The current study examined implementation fidelity of Pathways to Health (Pathways), a newly developed obesity prevention program for fourth- through sixth-grade children. We explored the associations between self-reported and observed implementation fidelity scores and whether implementation fidelity differed across the first 2 years of program implementation. Additionally, we examined whether implementation fidelity affected program outcomes and whether teacher beliefs were associated with implementation fidelity. The program was better received, and implementation fidelity had more effects on program outcomes in fifth grade than in fourth grade. Findings suggest that implementation in school-based obesity programs may affect junk food intake and intentions to eat healthfully and exercise. School support was associated with implementation fidelity, suggesting that prevention programs may benefit from including a component that boosts school-wide support. © The Author(s) 2013.

  6. Investigating variations in implementation fidelity of an organizational-level occupational health intervention.

    Science.gov (United States)

    Augustsson, Hanna; von Thiele Schwarz, Ulrica; Stenfors-Hayes, Terese; Hasson, Henna

    2015-06-01

    The workplace has been suggested as an important arena for health promotion, but little is known about how the organizational setting influences the implementation of interventions. The aims of this study are to evaluate implementation fidelity in an organizational-level occupational health intervention and to investigate possible explanations for variations in fidelity between intervention units. The intervention consisted of an integration of health promotion, occupational health and safety, and a system for continuous improvements (Kaizen) and was conducted in a quasi-experimental design at a Swedish hospital. Implementation fidelity was evaluated with the Conceptual Framework for Implementation Fidelity and implementation factors used to investigate variations in fidelity with the Framework for Evaluating Organizational-level Interventions. A multi-method approach including interviews, Kaizen notes, and questionnaires was applied. Implementation fidelity differed between units even though the intervention was introduced and supported in the same way. Important differences in all elements proposed in the model for evaluating organizational-level interventions, i.e., context, intervention, and mental models, were found to explain the differences in fidelity. Implementation strategies may need to be adapted depending on the local context. Implementation fidelity, as well as pre-intervention implementation elements, is likely to affect the implementation success and needs to be assessed in intervention research. The high variation in fidelity across the units indicates the need for adjustments to the type of designs used to assess the effects of interventions. Thus, rather than using designs that aim to control variation, it may be necessary to use those that aim at exploring and explaining variation, such as adapted study designs.

  7. A 1. 8-Mb YAC contig in Xp11. 23: Identification of Cpg islands and physical mapping of CA repeats in a region of high gene density

    Energy Technology Data Exchange (ETDEWEB)

    Coleman, M.P.; Nemeth, A.H.; Campbell, L.; Raut, C.P.; Davies, K.E. (Institute of Molecular Medicine, Oxford (United Kingdom)); Weissenbach, J. (Unite de Genetique Moleculaire Humaine, Paris (France))

    1994-05-15

    The genes ARAF1, SYN1, TIMP, and PFC are clustered within 70 kb of one another, and, as reported in the accompanying paper, at least four more genes map within 400 kb: a cluster of Krueppel-type zinc finger genes (including ZNF21, ZNF41, and ZNF81) and ELK-1, a member of the ets oncogene superfamily. This gene-rich region is of particular interest because of the large number of disease genes mapping to Xp11.23: At least three eye diseases (retinitis pigmentosa type 2, congenital stationary night blindness CSNB1, and Aland Island eye disease), Wiskott-Aldrich syndrome, X-linked nephrolithiasis, and a translocation breakpoint associated with synovial sarcoma. The authors have constructed a 1.8-Mb YAC contig in this region, confirming the link between TIMP and OATL1 reported by Knight et al. (1994) and extending the map in the distal direction. To investigate the likelihood that more genes are located within this region, they have carried out detailed mapping of rare-cutter restriction sites in these YACs and identified seven CpG islands. At least six of these islands are located over 50 kb from any known gene locations, suggesting that the region contains at least this many as yet unidentified genes. They have also mapped the physical locations of six highly polymorphic CA repeats within the contig, thus integrating the physical, genetic, and transcriptional maps of the region and facilitating the mapping and identification of disease genes. Together with the report by Knight et al., these data indicate the following order of loci: Xpter-DXS1264-DXS1055-DXS1003-DXS1146-DXS1266-(ZNF41, ARAF1)-SYN1 CA repeat-SYN1 (3[prime] end)-TIMP-SYN1 (5[prime] end)-PFC CA repeat-PFC-(DXS426, ELK1)-(DXS1265, ZNF81)-ZNF21-DXS1267-OATL1-Xcen. 40 refs., 4 figs., 3 tabs.

  8. Human protein kinase C lota gene (PRKC1) is closely linked to the BTK gene in Xq21.3

    Energy Technology Data Exchange (ETDEWEB)

    Mazzarella, R.; Jones, C.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States)] [and others

    1995-04-10

    The human X chromosome contains many disease loci, but only a small number of X-linked genes have been cloned and characterized. One approach to finding genes in genomic DNA uses partial sequencing of random cDNAs to develop {open_quotes}expressed sequence tags{close_quotes} (ESTs). Many authors have recently reported chromosomal localization of such ESTs using hybrid panels. Twenty ESTs specific for the X chromosome have been localized to defined regions with somatic cell hybrids, and 12 of them have been physically linked to markers that detect polymorphisms. One of these ESTs, EST02087, was physically linked in a 650-kb contig to the GLA ({alpha}-galactosidase) gene involved in Fabry disease. A comparison of this contig with a 7.5-Mb YAC contig indicated that this gene is also within 250 kb of the src-like protein-tyrosine kinase BTK (X-linked agammaglobulinemia protein-tyrosine kinase) gene in Xq21.3. 14 refs., 1 fig.

  9. Evaluating Fidelity to a Modified NIATx Process Improvement Strategy for Improving HIV Services in Correctional Facilities.

    Science.gov (United States)

    Pankow, Jennifer; Willett, Jennifer; Yang, Yang; Swan, Holly; Dembo, Richard; Burdon, William M; Patterson, Yvonne; Pearson, Frank S; Belenko, Steven; Frisman, Linda K

    2017-04-24

    In a study aimed at improving the quality of HIV services for inmates, an organizational process improvement strategy using change teams was tested in 14 correctional facilities in 8 US states and Puerto Rico. Data to examine fidelity to the process improvement strategy consisted of quantitative ratings of the structural and process components of the strategy and qualitative notes that explicate challenges in maintaining fidelity to the strategy. Fidelity challenges included (1) lack of communication and leadership within change teams, (2) instability in team membership, and (3) issues with data utilization in decision-making to implement improvements to services delivery.

  10. Recommendations on Model Fidelity for Wind Turbine Gearbox Simulations; NREL (National Renewable Energy Laboratory)

    Energy Technology Data Exchange (ETDEWEB)

    Keller, J.; Lacava, W.; Austin, J.; Nejad, A.; Halse, C.; Bastard, L.; Helsen, J.

    2015-02-01

    This work investigates the minimum level of fidelity required to accurately simulate wind turbine gearboxes using state-of-the-art design tools. Excessive model fidelity including drivetrain complexity, gearbox complexity, excitation sources, and imperfections, significantly increases computational time, but may not provide a commensurate increase in the value of the results. Essential designparameters are evaluated, including the planetary load-sharing factor, gear tooth load distribution, and sun orbit motion. Based on the sensitivity study results, recommendations for the minimum model fidelities are provided.

  11. RNA polymerase II transcriptional fidelity control and its functional interplay with DNA modifications

    Science.gov (United States)

    Xu, Liang; Wang, Wei; Chong, Jenny; Shin, Ji Hyun; Xu, Jun; Wang, Dong

    2016-01-01

    Accurate genetic information transfer is essential for life. As a key enzyme involved in the first step of gene expression, RNA polymerase II (Pol II) must maintain high transcriptional fidelity while it reads along DNA template and synthesizes RNA transcript in a stepwise manner during transcription elongation. DNA lesions or modifications may lead to significant changes in transcriptional fidelity or transcription elongation dynamics. In this review, we will summarize recent progress towards understanding the molecular basis of RNA Pol II transcriptional fidelity control and impacts of DNA lesions and modifications on Pol II transcription elongation. PMID:26392149

  12. SPARSE REPRESENTATIONS WITH DATA FIDELITY TERM VIA AN ITERATIVELY REWEIGHTED LEAST SQUARES ALGORITHM

    Energy Technology Data Exchange (ETDEWEB)

    WOHLBERG, BRENDT [Los Alamos National Laboratory; RODRIGUEZ, PAUL [Los Alamos National Laboratory

    2007-01-08

    Basis Pursuit and Basis Pursuit Denoising, well established techniques for computing sparse representations, minimize an {ell}{sup 2} data fidelity term subject to an {ell}{sup 1} sparsity constraint or regularization term on the solution by mapping the problem to a linear or quadratic program. Basis Pursuit Denoising with an {ell}{sup 1} data fidelity term has recently been proposed, also implemented via a mapping to a linear program. They introduce an alternative approach via an iteratively Reweighted Least Squares algorithm, providing greater flexibility in the choice of data fidelity term norm, and computational advantages in certain circumstances.

  13. Holographic complexity and fidelity susceptibility as holographic information dual to different volumes in AdS

    Directory of Open Access Journals (Sweden)

    N.S. Mazhari

    2017-03-01

    Full Text Available The holographic complexity and fidelity susceptibility have been defined as new quantities dual to different volumes in AdS. In this paper, we will use these new proposals to calculate both of these quantities for a variety of interesting deformations of AdS. We obtain the holographic complexity and fidelity susceptibility for an AdS black hole, Janus solution, a solution with cylindrical symmetry, an inhomogeneous background and a hyperscaling violating background. It is observed that the holographic complexity depends on the size of the subsystem for all these solutions and the fidelity susceptibility does not have any such dependence.

  14. Equivalence between entanglement and the optimal fidelity of continuous variable teleportation.

    Science.gov (United States)

    Adesso, Gerardo; Illuminati, Fabrizio

    2005-10-07

    We devise the optimal form of Gaussian resource states enabling continuous-variable teleportation with maximal fidelity. We show that a nonclassical optimal fidelity of N-user teleportation networks is necessary and sufficient for N-party entangled Gaussian resources, yielding an estimator of multipartite entanglement. The entanglement of teleportation is equivalent to the entanglement of formation in a two-user protocol, and to the localizable entanglement in a multiuser one. Finally, we show that the continuous-variable tangle, quantifying entanglement sharing in three-mode Gaussian states, is defined operationally in terms of the optimal fidelity of a tripartite teleportation network.

  15. Random matrix models for decoherence and fidelity decay in quantum information systems

    Science.gov (United States)

    Pineda, Carlos; Seligman, Thomas H.

    2008-03-01

    This course aims to introduce the student to random matrix models for decoherence and fidelity decay. They present a very powerful alternate approach, that emphasizes the disordered character of many environments and uncontrollable perturbations/couplings. The inherent integrability of such models makes analytic studies possible. We limit our considerations to linear response treatment, as high fidelity and small decoherence are the backbone of quantum information processes. For fidelity decay, where experimental results are available, a comparison with experiments shows excellent agreement with random matrix theory predictions.

  16. Statistical properties of fidelity in quantum tomography protocols in Hilbert spaces of different dimensions

    CERN Document Server

    Bogdanov, Yu I; Gavrichenko, A K

    2011-01-01

    A throughout study of statistical characteristics of fidelity in different protocols of quantum tomography is given. We consider protocols based on geometry of platonic solids and other polyhedrons with high degree of symmetry such as fullerene and its dual polyhedron. Characteristics of fidelity in different protocols are compared to the theoretical level of the minimum possible level of fidelity loss. Tomography of pure and mixed states in Hilbert spaces of different dimension is analyzed. Results of this work could be used for a better control of quantum gates and quantum states in quantum information technologies.

  17. Holographic Complexity and Fidelity Susceptibility as Holographic Information Dual to Different Volumes in AdS

    CERN Document Server

    Mazhari, N S; Bahamonde, Sebastian; Faizal, Mir; Myrzakulov, Ratbay

    2016-01-01

    The holographic complexity and fidelity susceptibility have been defined as new quantities dual to different volumes in AdS. In this paper, we will use these new proposals to calculate both of these quantities for a variety of interesting deformations of AdS. We obtain the holographic complexity and fidelity susceptibility for an AdS black hole, Janus solution and a solution with cylindrically symmetry, an inhomogeneous background and a hyperscaling violating background. It is observed that the holographic complexity depends on the size of the subsystem for all these solutions and the fidelity susceptibility does not any such dependence.

  18. EBT Fidelity Trajectories Across Training Cohorts Using the Interagency Collaborative Team Strategy.

    Science.gov (United States)

    Chaffin, Mark; Hecht, Debra; Aarons, Greg; Fettes, Danielle; Hurlburt, Michael; Ledesma, Karla

    2016-03-01

    The Interdisciplinary Collaborative Team (ICT) strategy uses front-line providers as adaptation, training and quality control agents for multi-agency EBT implementation. This study tests whether an ICT transmits fidelity to subsequent provider cohorts. SafeCare was implemented by home visitors from multiple community-based agencies contracting with child welfare. Client-reported fidelity trajectories for 5,769 visits, 957 clients and 45 providers were compared using three-level growth models. Provider cohorts trained and live-coached by the ICT attained benchmark fidelity after 12 weeks, and this was sustained. Hispanic clients reported high cultural competency, supporting a cultural adaptation crafted by the ICT.

  19. Staff turnover in statewide implementation of ACT: relationship with ACT fidelity and other team characteristics.

    Science.gov (United States)

    Rollins, Angela L; Salyers, Michelle P; Tsai, Jack; Lydick, Jennifer M

    2010-09-01

    Staff turnover on assertive community treatment (ACT) teams is a poorly understood phenomenon. This study examined annual turnover and fidelity data collected in a statewide implementation of ACT over a 5-year period. Mean annual staff turnover across all observations was 30.0%. Turnover was negatively correlated with overall fidelity at Year 1 and 3. The team approach fidelity item was negatively correlated with staff turnover at Year 3. For 13 teams with 3 years of follow-up data, turnover rates did not change over time. Most ACT staff turnover rates were comparable or better than other turnover rates reported in the mental health and substance abuse literature.

  20. Improving the fidelity of continuous-variable quantum teleportation by tuning displacement gain

    Institute of Scientific and Technical Information of China (English)

    Jinming Liu(刘金明); Jian Li(李剑); Guangcan Guo(郭光灿)

    2003-01-01

    The fidelity of teleportation of continuous quantum variables can be improved by tuning the local displace-ment gain. We investigate the optimization of the fidelity for the teleportation of Schrodinger cat states,and of coherent states. It is found that the gain corresponding to the maximum fidelity is not equal to onefor the two input states in the case of the small squeezing degree of the entanglement resource, while unitydisplacement gain is the best choice for teleporting arbitrary quantum states in the case of large squeezing.

  1. Development of a Feasible Implementation Fidelity Protocol Within a Complex Physical Therapy-Led Self-Management Intervention.

    Science.gov (United States)

    Toomey, Elaine; Matthews, James; Guerin, Suzanne; Hurley, Deirdre A

    2016-08-01

    Implementation fidelity is poorly addressed within physical therapy interventions, which may be due to limited research on how to develop and implement an implementation fidelity protocol. The purpose of this study was to develop a feasible implementation fidelity protocol within a pilot study of a physical therapy-led intervention to promote self-management for people with chronic low back pain or osteoarthritis. A 2-phase mixed-methods design was used. Phase 1 involved the development of an initial implementation fidelity protocol using qualitative interviews with potential stakeholders to explore the acceptability of proposed strategies to enhance and assess implementation fidelity. Phase 2 involved testing and refining the initial implementation fidelity protocol to develop a finalized implementation fidelity protocol. Specifically, the feasibility of 3 different strategies (physical therapist self-report checklists, independently rated direct observations, and audio-recorded observations) for assessing implementation fidelity of intervention delivery was tested, followed by additional stakeholder interviews that explored the overall feasibility of the implementation fidelity protocol. Phase 1 interviews determined the proposed implementation fidelity strategies to be acceptable to stakeholders. Phase 2 showed that independently rated audio recordings (n=6) and provider self-report checklists (n=12) were easier to implement than independently rated direct observations (n=12) for assessing implementation fidelity of intervention delivery. Good agreement (79.8%-92.8%) was found among all methods. Qualitative stakeholder interviews confirmed the acceptability, practicality, and implementation of the implementation fidelity protocol. The reliability and validity of assessment checklists used in this study have yet to be fully tested, and blinding of independent raters was not possible. A feasible implementation fidelity protocol was developed based on a 2-phase

  2. The Need for High-Fidelity Robotics Sensor Models

    Directory of Open Access Journals (Sweden)

    Phillip J. Durst

    2011-01-01

    Full Text Available Simulations provide a safe, controlled setting for testing and are therefore ideal for rapidly developing and testing autonomous mobile robot behaviors. However, algorithms for mobile robots are notorious for transitioning poorly from simulations to fielded platforms. The difficulty can in part be attributed to the use of simplistic sensor models that do not recreate important phenomena that affect autonomous navigation. The differences between the output of simple sensor models and true sensors are highlighted using results from a field test exercise with the National Robotics Engineering Center's Crusher vehicle. The Crusher was manually driven through an area consisting of a mix of small vegetation, rocks, and hay bales. LIDAR sensor data was collected along the path traveled and used to construct a model of the area. LIDAR data were simulated using a simple point-intersection model for a second, independent path. Cost maps were generated by the Crusher autonomy system using both the real-world and simulated sensor data. The comparison of these cost maps shows consistencies on most solid, large geometry surfaces such as the ground, but discrepancies around vegetation indicate that higher fidelity models are required to truly capture the complex interactions of the sensors with complex objects.

  3. Fidel Castro, cuatro fases de un liderazgo inacabado

    Directory of Open Access Journals (Sweden)

    Joan del Alcàzar

    2013-01-01

    Full Text Available El régimen cubano, liderado por Fidel Castro desde hace más de cincuenta años, ha pasado por diferentes etapas que es necesario conocer para comprender la naturaleza de su régimen político. Hasta cuatro podemos establecer, entendiendo que la última –inacabada aún– solo se cerrará con la desaparición física del ya anciano revolucionario. Cuba es un país que tiene un peso político todavía importante en el continente americano; un peso que va más allá de las dimensiones de su PIB y de su influencia política real. En la actualidad se debate entre un continuismo imposible y la aceptación de cambios que deben favorecer una apertura del país en primer lugar hacia la región latinoamericana. Además, Cuba deberá comenzar a superar los rígidos corsés económicos internos que unidos al embargo norteamericano castigan duramente a su población. La superación de la actual excepcionalidad cubana deberá incluir cambios sustanciales en cuanto a las libertades políticas en particular y los Derechos Humanos en general.

  4. High-Fidelity Micromechanics Model Enhanced for Multiphase Particulate Materials

    Science.gov (United States)

    Pindera, Marek-Jerzy; Arnold, Steven M.

    2003-01-01

    This 3-year effort involves the development of a comprehensive micromechanics model and a related computer code, capable of accurately estimating both the average response and the local stress and strain fields in the individual phases, assuming both elastic and inelastic behavior. During the first year (fiscal year 2001) of the investigation, a version of the model called the High-Fidelity Generalized Method of Cells (HFGMC) was successfully completed for the thermo-inelastic response of continuously reinforced multiphased materials with arbitrary periodic microstructures (refs. 1 and 2). The model s excellent predictive capability for both the macroscopic response and the microlevel stress and strain fields was demonstrated through comparison with exact analytical and finite element solutions. This year, HFGMC was further extended in two technologically significant ways. The first enhancement entailed the incorporation of fiber/matrix debonding capability into the two-dimensional version of HFGMC for modeling the response of unidirectionally reinforced composites such as titanium matrix composites, which exhibit poor fiber/matrix bond. Comparison with experimental data validated the model s predictive capability. The second enhancement entailed further generalization of HFGMC to three dimensions to enable modeling the response of particulate-reinforced (discontinuous) composites in the elastic material behavior domain. Next year, the three-dimensional version will be generalized to encompass inelastic effects due to plasticity, viscoplasticity, and damage, as well as coupled electromagnetothermomechanical (including piezoelectric) effects.

  5. Novel, Synergistic Antifungal Combinations that Target Translation Fidelity

    Science.gov (United States)

    Moreno-Martinez, Elena; Vallieres, Cindy; Holland, Sara L.; Avery, Simon V.

    2015-01-01

    There is an unmet need for new antifungal or fungicide treatments, as resistance to existing treatments grows. Combination treatments help to combat resistance. Here we develop a novel, effective target for combination antifungal therapy. Different aminoglycoside antibiotics combined with different sulphate-transport inhibitors produced strong, synergistic growth-inhibition of several fungi. Combinations decreased the respective MICs by ≥8-fold. Synergy was suppressed in yeast mutants resistant to effects of sulphate-mimetics (like chromate or molybdate) on sulphate transport. By different mechanisms, aminoglycosides and inhibition of sulphate transport cause errors in mRNA translation. The mistranslation rate was stimulated up to 10-fold when the agents were used in combination, consistent with this being the mode of synergistic action. A range of undesirable fungi were susceptible to synergistic inhibition by the combinations, including the human pathogens Candida albicans, C. glabrata and Cryptococcus neoformans, the food spoilage organism Zygosaccharomyces bailii and the phytopathogens Rhizoctonia solani and Zymoseptoria tritici. There was some specificity as certain fungi were unaffected. There was no synergy against bacterial or mammalian cells. The results indicate that translation fidelity is a promising new target for combinatorial treatment of undesirable fungi, the combinations requiring substantially decreased doses of active components compared to each agent alone. PMID:26573415

  6. The Creation of a CPU Timer for High Fidelity Programs

    Science.gov (United States)

    Dick, Aidan A.

    2011-01-01

    Using C and C++ programming languages, a tool was developed that measures the efficiency of a program by recording the amount of CPU time that various functions consume. By inserting the tool between lines of code in the program, one can receive a detailed report of the absolute and relative time consumption associated with each section. After adapting the generic tool for a high-fidelity launch vehicle simulation program called MAVERIC, the components of a frequently used function called "derivatives ( )" were measured. Out of the 34 sub-functions in "derivatives ( )", it was found that the top 8 sub-functions made up 83.1% of the total time spent. In order to decrease the overall run time of MAVERIC, a launch vehicle simulation program, a change was implemented in the sub-function "Event_Controller ( )". Reformatting "Event_Controller ( )" led to a 36.9% decrease in the total CPU time spent by that sub-function, and a 3.2% decrease in the total CPU time spent by the overarching function "derivatives ( )".

  7. Low fidelity, high quality: a model for e-learning.

    Science.gov (United States)

    Gordon, Morris; Chandratilake, Madawa; Baker, Paul

    2013-08-01

    E-learning continues to proliferate as a method to deliver continuing medical education. The effectiveness of e-learning has been widely studied, showing that it is as effective as traditional forms of education. However, most reports focus on whether the e-learning is effective, rather than discussing innovations to allow clinical educators to ask 'how' and 'why' it is effective, and to facilitate local reproduction. Previous work has set out a number of barriers to the introduction of e-learning interventions. Cost, the time to produce interventions, and the training requirements for educators and trainees have all been identified as barriers. We set out to design an e-learning intervention on paediatric prescribing that could address these issues using a low-fidelity approach, and report our methods so as to allow interested readers to use a similar approach. Using low-cost, readily accessible tools and applying appropriate educational theory, the intervention was produced in a short period of time. As part of a randomised controlled trial, long-term retention of prescribing skills was demonstrated, with significantly higher prescribing skill scores in the e-learning group at 4 and 12 weeks (p designing can successfully overcome many of the barriers to the introduction of e-learning. The design model described is simple and can be used by clinical teachers to support local development. Further research could investigate the experiences of these clinicians using this method of instructional design. © 2013 John Wiley & Sons Ltd.

  8. The Fidelity of Ocean Models With Explicit Eddies (Chapter 17)

    Energy Technology Data Exchange (ETDEWEB)

    McClean, J; Jayne, S; Maltrud, M; Ivanova, D

    2007-08-01

    Current practices within the oceanographic community have been reviewed with regard to the use of metrics to assess the realism of the upper-ocean circulation, ventilation processes diagnosed by time-evolving mixed layer depth and mode water formation, and eddy heat fluxes in large-scale fine resolution ocean model simulations. We have striven to understand the fidelity of these simulations in the context of their potential use in future fine-resolution coupled climate system studies. A variety of methodologies are used to assess the veracity of the numerical simulations. Sea surface height variability and the location of western boundary current paths from altimetry have been used routinely as basic indicators of fine-resolution model performance. Drifters and floats have also been used to provide pseudo-Eulerian measures of the mean and variability of surface and sub-surface flows, while statistical comparisons of observed and simulated means have been carried out using James tests. Probability density functions have been used to assess the Gaussian nature of the observed and simulated flows. Length and time scales have been calculated in both Eulerian and Lagrangian frameworks from altimetry and drifters, respectively. Concise measures of multiple model performance have been obtained from Taylor diagrams. The time-evolution of the mixed layer depth at monitoring stations has been compared with simulated time series. Finally, eddy heat fluxes are compared to climatological inferences.

  9. Correcting METIS spectra for telluric absorption to maximize spectral fidelity

    CERN Document Server

    Uttenthaler, Stefan; Seifahrt, Andreas; Kendrew, Sarah; Blommaert, Joris A D L; Pantin, Eric J; Brandl, Bernhard R; Molster, Frank J; Venema, Lars; Lenzen, Rainer; Parr-Burman, Phil; Siebenmorgen, Ralf; 10.1117/12.856697

    2010-01-01

    METIS is a mid-infrared instrument proposed for the European Extremely Large Telescope (E-ELT). It is designed to provide imaging and spectroscopic capabilities in the 3 - 14 micron region up to a spectral resolution of 100000. One of the novel concepts of METIS is that of a high-resolution integral field spectrograph (IFS) for a diffraction-limited mid-IR instrument. While this concept has many scientific and operational advantages over a long-slit spectrograph, one drawback is that the spectral resolution changes over the field of view. This has an impact on the procedures to correct for telluric absorption lines imprinted on the science spectra. They are a major obstacle in the quest to maximize spectral fidelity, the ability to distinguish a weak spectral feature from the continuum. The classical technique of division by a standard star spectrum, observed in a single IFS spaxel, cannot simply be applied to all spaxels, because the spectral resolution changes from spaxel to spaxel. Here we present and disc...

  10. Uma insólita visita: Fidel Castro no Chile de Allende An uncommon visit: Fidel Castro in Allende’s Chile

    Directory of Open Access Journals (Sweden)

    Alberto Aggio

    2003-01-01

    Full Text Available Este artigo busca expor sinteticamente o que foi a viagem que Fidel Castro realizou ao Chile em novembro de 1971, e também refletir a respeito tanto das estratégias políticas evidenciadas por Castro em sua estadia no Chile, quanto sobre as conseqüências que derivaram dessas estratégias para o processo conhecido como a "experiência chilena". Conclui afirmando que, se não se pode atribuir à visita de Fidel toda a confrontação que mais tarde iria se estabelecer no Chile, também não se pode isentar integralmente o dirigente cubano de uma certa responsabilidade quanto à situação que se impôs. Esta viagem de Fidel ao Chile de Allende foi uma viagem incomum, distinta de qualquer padrão diplomático, e abrigou silenciosamente uma profunda disputa política no interior da esquerda latino-americana que permaneceu por muito tempo desconhecida.This paper discusses briefly the meaning of Fidel Castro’s visit to Chile in November 1971; it intends as well to present a reflection on both the political strategies shown by Fidel during his stay in Chile and its consequence for the process known as "the Chilean experience". It takes us to assume that if all confrontation that occurred in Chile late on cannot be attributed to this visit, neither can Fidel be considered completely free from responsibility for it. This visit to Allende’s Chile was uncommon, different from all diplomatic patterns; it resulted in a silent and deep political dispute in the Latin-American Left, which remained unknown for much time.

  11. ModelCenter-Integrated Reduced Order Multi-fidelity Optimization Scheme for NASA MDAO Framework Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this effort, ZONA Technology, Inc aims at developing an innovative multi-fidelity and multi-disciplinary optimization (MDO) sub-framework that can (i) effectively...

  12. 12 CFR 7.2013 - Fidelity bonds covering officers and employees.

    Science.gov (United States)

    2010-01-01

    ... ACTIVITIES AND OPERATIONS Corporate Practices § 7.2013 Fidelity bonds covering officers and employees. (a... failure of directors to require bonds with adequate sureties and in sufficient amount may make the...

  13. Selectivity and proofreading both contribute significantly to the fidelity of RNA polymerase III transcription

    Science.gov (United States)

    Alic, Nazif; Ayoub, Nayla; Landrieux, Emilie; Favry, Emmanuel; Baudouin-Cornu, Peggy; Riva, Michel; Carles, Christophe

    2007-01-01

    We examine here the mechanisms ensuring the fidelity of RNA synthesis by RNA polymerase III (Pol III). Misincorporation could only be observed by using variants of Pol III deficient in the intrinsic RNA cleavage activity. Determination of relative rates of the reactions producing correct and erroneous transcripts at a specific position on a tRNA gene, combined with computational methods, demonstrated that Pol III has a highly efficient proofreading activity increasing its transcriptional fidelity by a factor of 103 over the error rate determined solely by selectivity (1.8 × 10−4). We show that Pol III slows down synthesis past a misincorporation to achieve efficient proofreading. We discuss our findings in the context of transcriptional fidelity studies performed on RNA Pols, proposing that the fidelity of transcription is more crucial for Pol III than Pol II. PMID:17553959

  14. Physics and Psychophysics of High-Fidelity Sound. Part 1: Perception of Sound and Music.

    Science.gov (United States)

    Rossing, Thomas D.

    1979-01-01

    Presents the first of a series of articles that discuss the perception of sound and music. This series of articles is intended to provide an introduction to the broad subject of high-fidelity sound recording and reproduction. (HM)

  15. The effect of sound on visual fidelity perception in stereoscopic 3-D.

    Science.gov (United States)

    Rojas, David; Kapralos, Bill; Hogue, Andrew; Collins, Karen; Nacke, Lennart; Cristancho, Sayra; Conati, Cristina; Dubrowski, Adam

    2013-12-01

    Visual and auditory cues are important facilitators of user engagement in virtual environments and video games. Prior research supports the notion that our perception of visual fidelity (quality) is influenced by auditory stimuli. Understanding exactly how our perception of visual fidelity changes in the presence of multimodal stimuli can potentially impact the design of virtual environments, thus creating more engaging virtual worlds and scenarios. Stereoscopic 3-D display technology provides the users with additional visual information (depth into and out of the screen plane). There have been relatively few studies that have investigated the impact that auditory stimuli have on our perception of visual fidelity in the presence of stereoscopic 3-D. Building on previous work, we examine the effect of auditory stimuli on our perception of visual fidelity within a stereoscopic 3-D environment.

  16. ModelCenter-Integrated Reduced Order Multi-fidelity Optimization Scheme for NASA MDAO Framework Project

    Data.gov (United States)

    National Aeronautics and Space Administration — During Phase I of this effort, ZONA Technology, Inc. significantly improved the medium fidelity design and analysis capability of NASA's MDAO architecture by...

  17. Can you design for Fidelity? How your intervention framework describes intended actions, participation and behavior

    DEFF Research Database (Denmark)

    Poulsen, Signe; Gish, Liv; Ipsen, Christine

    In recent years the term fidelity has been introduced within the field of organizational level interventions. Fidelity describes the extent to which the intervention has been implemented as it was originally intended, and is regarded critical for determining the validity of the research results...... in organizational level interventions. The concept of fidelity stems from clinical interventions although the concept has developed over time (Bellg et al. 2004). Organizational level interventions differ from clinical interventions, as they are more complex regarding both the “dose” given and the number and levels...... of participants involved at the same time. Steering organizational level interventions in every detail and secure full fidelity or treatment integrity can thus seem difficult. Organizational level intervention frameworks are often built on the designer’s experiences with previous interventions as well as what...

  18. A Renúncia De Fidel Castro: Continuidade Na Sucessão Presidencial

    National Research Council Canada - National Science Library

    Isabele Villwock Bachtold

    2008-01-01

    ... de Fidel Castro: continuidade na sucesso presidencial Isabele Villwock Bachtold 26 As crises do dlar e do sistema financeiro internacional Marcella Pontes de Campos 28 A crise energtica argenti...

  19. The sudden Birth and sudden Death of thermal fidelity in a two-qubit XY model

    CERN Document Server

    Qin, Li-Guo; Jiang, Ying; Zhang, Hong-Biao

    2011-01-01

    We study the energy level crossings of the states and thermal fidelity for a two-qubit XY model in the presence of a transverse and inhomogeneous magnetic field. It is shown clearly the effects of the anisotropic factor of the magnetic field through the contour figures of energy level crossing in two subspaces, the isotropy subspace and anisotropy subspace. We calculate the quantum fidelity between the system and the ground state to which the results show the strong effect of the anisotropic factor again. In addition, making use of the transition of Yangian generators in the tensor product space, we study the evolution of the thermal fidelity after the transition. The potential applications of Yangian algebra, as a switch to turn on or off the fidelity, are proposed.

  20. Visual long-term memory has the same limit on fidelity as visual working memory.

    Science.gov (United States)

    Brady, Timothy F; Konkle, Talia; Gill, Jonathan; Oliva, Aude; Alvarez, George A

    2013-06-01

    Visual long-term memory can store thousands of objects with surprising visual detail, but just how detailed are these representations, and how can one quantify this fidelity? Using the property of color as a case study, we estimated the precision of visual information in long-term memory, and compared this with the precision of the same information in working memory. Observers were shown real-world objects in random colors and were asked to recall the colors after a delay. We quantified two parameters of performance: the variability of internal representations of color (fidelity) and the probability of forgetting an object's color altogether. Surprisingly, the fidelity of color information in long-term memory was comparable to the asymptotic precision of working memory. These results suggest that long-term memory and working memory may be constrained by a common limit, such as a bound on the fidelity required to retrieve a memory representation.

  1. Multi-Fidelity Multi-Strategy and Multi-Disciplinary Design Optimization Environment Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Multidisciplinary design and optimization (MDO) tools developed to perform multi-disciplinary analysis based on low fidelity computation methods have been used in...

  2. High-Fidelity Simulation for Neonatal Nursing Education: An Integrative Review of the Literature.

    Science.gov (United States)

    Cooper, Allyson

    2015-01-01

    The lack of safe avenues to develop neonatal nursing competencies using human subjects leads to the notion that simulation education for neonatal nurses might be an ideal form of education. This integrative literature review compares traditional, teacher-centered education with high-fidelity simulation education for neonatal nurses. It examines the theoretical frameworks used in neonatal nursing education and outlines the advantages of this type of training, including improving communication and teamwork; providing an innovative pedagogical approach; and aiding in skill acquisition, confidence, and participant satisfaction. The importance of debriefing is also examined. High-fidelity simulation is not without disadvantages, including its significant cost, the time associated with training, the need for very complex technical equipment, and increased faculty resource requirements. Innovative uses of high-fidelity simulation in neonatal nursing education are suggested. High-fidelity simulation has great potential but requires additional research to fully prove its efficacy.

  3. High Fidelity Imaging Algorithm for the Undique Imaging Monte Carlo Simulator

    Directory of Open Access Journals (Sweden)

    Tremblay Grégoire

    2016-01-01

    Full Text Available The Undique imaging Monte Carlo simulator (Undique hereafter was developed to reproduce the behavior of 3D imaging devices. This paper describes its high fidelity imaging algorithm.

  4. A modified theoretical framework to assess implementation fidelity of adaptive public health interventions.

    Science.gov (United States)

    Pérez, Dennis; Van der Stuyft, Patrick; Zabala, Maríadel Carmen; Castro, Marta; Lefèvre, Pierre

    2016-07-08

    One of the major debates in implementation research turns around fidelity and adaptation. Fidelity is the degree to which an intervention is implemented as intended by its developers. It is meant to ensure that the intervention maintains its intended effects. Adaptation is the process of implementers or users bringing changes to the original design of an intervention. Depending on the nature of the modifications brought, adaptation could either be potentially positive or could carry the risk of threatening the theoretical basis of the intervention, resulting in a negative effect on expected outcomes. Adaptive interventions are those for which adaptation is allowed or even encouraged. Classical fidelity dimensions and conceptual frameworks do not address the issue of how to adapt an intervention while still maintaining its effectiveness. We support the idea that fidelity and adaptation co-exist and that adaptations can impact either positively or negatively on the intervention's effectiveness. For adaptive interventions, research should answer the question how an adequate fidelity-adaptation balance can be reached. One way to address this issue is by looking systematically at the aspects of an intervention that are being adapted. We conducted fidelity research on the implementation of an empowerment strategy for dengue prevention in Cuba. In view of the adaptive nature of the strategy, we anticipated that the classical fidelity dimensions would be of limited use for assessing adaptations. The typology we used in the assessment-implemented, not-implemented, modified, or added components of the strategy-also had limitations. It did not allow us to answer the question which of the modifications introduced in the strategy contributed to or distracted from outcomes. We confronted our empirical research with existing literature on fidelity, and as a result, considered that the framework for implementation fidelity proposed by Carroll et al. in 2007 could potentially meet

  5. Using high-fidelity simulation as a learning strategy in an undergraduate intensive care course.

    Science.gov (United States)

    Badir, Aysel; Zeybekoğlu, Zuhal; Karacay, Pelin; Göktepe, Nilgün; Topcu, Serpil; Yalcin, Begüm; Kebapci, Ayda; Oban, Gül

    2015-01-01

    Using high-fidelity simulations to facilitate student learning is an uncommon practice in Turkish nursing programs. The aim of the present study was to understand students' perceptions of the use of simulation in nursing courses. Subjects included 36 senior nursing students taking an intensive care course. This study revealed that high-fidelity simulation is an ideal method of promoting learning by helping students transfer theory into practice, build confidence and teamwork, and raise professional awareness.

  6. Roseate Tern breeding dispersal and fidelity: Responses to two newly restored colony sites

    Science.gov (United States)

    Spendelow, Jeffrey A.; Monticelli, David; Nichols, James; Hines, James; Nisbet, Ian; Cormons, Grace; Hays, Helen; Hatch, Jeremy; Mostello, Carolyn

    2016-01-01

    We used 22 yr of capture–mark–reencounter (CMR) data collected from 1988 to 2009 on about 12,500 birds at what went from three to five coastal colony sites in Massachusetts, New York, and Connecticut, United States, to examine spatial and temporal variation in breeding dispersal/fidelity rates of adult Roseate Terns (Sterna dougallii). At the start of our study, Roseate Terns nested at only one site (Bird Island) in Buzzards Bay, Massachusetts, but two more sites in this bay (Ram and Penikese Islands) were subsequently recolonized and became incorporated into our CMR metapopulation study. We examined four major hypotheses about factors we thought might influence colony-site fidelity and movement rates in the restructured system. We found some evidence that colony-site fidelity remained higher at long-established sites compared with newer ones and that breeding dispersal was more likely to occur among nearby sites than distant ones. Sustained predation at Falkner Island, Connecticut, did not result in a sustained drop in fidelity rates of breeders. Patterns of breeding dispersal differed substantially at the two restored sites. The fidelity of Roseate Terns at Bird dropped quickly after nearby Ram was recolonized in 1994, and fidelity rates for Ram soon approached those for Bird. After an oil spill in Buzzards Bay in April 2003, hazing (deliberate disturbance) of the terns at Ram prior to the start of egg-laying resulted in lowering of fidelity at this site, a decrease in immigration from Bird, and recolonization of Penikese by Roseate Terns. Annual fidelity rates at Penikese increased somewhat several years after the initial recolonization, but they remained much lower there than at all the other sites throughout the study period. The sustained high annual rates of emigration from Penikese resulted in the eventual failure of the restoration effort there, and in 2013, no Roseate Terns nested at this site.

  7. Biochemical analysis of DNA polymerase η fidelity in the presence of replication protein A.

    Directory of Open Access Journals (Sweden)

    Samuel C Suarez

    Full Text Available DNA polymerase η (pol η synthesizes across from damaged DNA templates in order to prevent deleterious consequences like replication fork collapse and double-strand breaks. This process, termed translesion synthesis (TLS, is an overall positive for the cell, as cells deficient in pol η display higher mutation rates. This outcome occurs despite the fact that the in vitro fidelity of bypass by pol η alone is moderate to low, depending on the lesion being copied. One possible means of increasing the fidelity of pol η is interaction with replication accessory proteins present at the replication fork. We have previously utilized a bacteriophage based screening system to measure the fidelity of bypass using purified proteins. Here we report on the fidelity effects of a single stranded binding protein, replication protein A (RPA, when copying the oxidative lesion 7,8-dihydro-8-oxo-guanine(8-oxoG and the UV-induced cis-syn thymine-thymine cyclobutane pyrimidine dimer (T-T CPD. We observed no change in fidelity dependent on RPA when copying these damaged templates. This result is consistent in multiple position contexts. We previously identified single amino acid substitution mutants of pol η that have specific effects on fidelity when copying both damaged and undamaged templates. In order to confirm our results, we examined the Q38A and Y52E mutants in the same full-length construct. We again observed no difference when RPA was added to the bypass reaction, with the mutant forms of pol η displaying similar fidelity regardless of RPA status. We do, however, observe some slight effects when copying undamaged DNA, similar to those we have described previously. Our results indicate that RPA by itself does not affect pol η dependent lesion bypass fidelity when copying either 8-oxoG or T-T CPD lesions.

  8. A New Fidelity: The Supporting Role of USSOUTHCOM in a Post-Castro Cuba

    Science.gov (United States)

    2008-05-23

    cu.html (accessed 29 March 2008). 4Carlos Alberto Montaner and Ignacio Ramonet , (quote is that of Carlos Montaner) “Was Fidel Good for Cuba...factbook/print/cu.html (accessed 29 March 2008). 10Carlos Alberto Montaner and Ignacio Ramonet , (quote is that of Ignacio Ramonet ) “Was Fidel Good for...http://www.whitehouse.gov/nsc/nss/2006/sectionI.html (accessed 04 April 2008). 17Carlos Alberto Montaner and Ignacio Ramonet , (quote is that of Carlos

  9. New universal rules of eukaryotic translation initiation fidelity.

    Directory of Open Access Journals (Sweden)

    Hadas Zur

    Full Text Available The accepted model of eukaryotic translation initiation begins with the scanning of the transcript by the pre-initiation complex from the 5'end until an ATG codon with a specific nucleotide (nt context surrounding it is recognized (Kozak rule. According to this model, ATG codons upstream to the beginning of the ORF should affect translation. We perform for the first time, a genome-wide statistical analysis, uncovering a new, more comprehensive and quantitative, set of initiation rules for improving the cost of translation and its efficiency. Analyzing dozens of eukaryotic genomes, we find that in all frames there is a universal trend of selection for low numbers of ATG codons; specifically, 16-27 codons upstream, but also 5-11 codons downstream of the START ATG, include less ATG codons than expected. We further suggest that there is selection for anti optimal ATG contexts in the vicinity of the START ATG. Thus, the efficiency and fidelity of translation initiation is encoded in the 5'UTR as required by the scanning model, but also at the beginning of the ORF. The observed nt patterns suggest that in all the analyzed organisms the pre-initiation complex often misses the START ATG of the ORF, and may start translation from an alternative initiation start-site. Thus, to prevent the translation of undesired proteins, there is selection for nucleotide sequences with low affinity to the pre-initiation complex near the beginning of the ORF. With the new suggested rules we were able to obtain a twice higher correlation with ribosomal density and protein levels in comparison to the Kozak rule alone (e.g. for protein levels r=0.7 vs. r=0.31; p<10(-12.

  10. Transatlantic link

    Science.gov (United States)

    (left) European Geophysical Society (EGS) President Rolf Meissner at AGU Headquarters with (center) Executive Director Fred Spilhaus and (right) Foreign Secretary Juan Roederer. Meissner attended the meeting of AGU's Committee on International Participation (CIP) on February 26, 1988. At that meeting, specific ways of fostering close links between AGU and EGS were discussed.A few weeks later, Roederer and AGU staff, working with EGS Secretary-General Arne Richter at the EGS meeting in Bologna, Italy, March 21-25, planned details of the establishment of an AGU office in Europe. The Copernicus Gesellschaft, a new entity located on the premises of the Max Planck Institute for Aeronomy in Lindau, Federal Republic of Germany, will provide the administrative staff and handle logistics.

  11. Adaptation and Fidelity: a Recipe Analogy for Achieving Both in Population Scale Implementation.

    Science.gov (United States)

    Kemp, Lynn

    2016-05-01

    Balancing adherence to fidelity of evidence-based programs and adaptation to local context is one of the key debates in the adoption and implementation of effective programs. Concern about maintaining fidelity to achieve outcomes can result in replication of research-based models that can be a poor fit with the real world. Equally, unplanned adaptation can result in program drift away from the core elements needed to achieve outcomes. To support implementation of the Maternal Early Childhood Sustained Home-visiting (MECSH) program in multiple sites in three countries, an analogy was developed to identify how both fidelity and adaptation can be managed and successfully achieved. This article presents the Commonsense Cookery Book Basic Plain Cake with Variations recipe analogy to articulate the dual requirements of both fidelity and adaptation to achieve quality implementation of the MECSH program. Components classified by the analogy include identification of core ingredients, methods, and equipment that contribute to fundamental outcomes and fidelity to the evidence-based program, and a planned, collaborative approach to identification of needed variations to suit locally sourced capacity, needs, and tastes. Quality is achieved by identifying and measuring the core ingredients and the variations. Sourcing local ingredients and honoring of context support sustainability of quality practice. Using this analogy has assisted adopters of the MECSH program to understand that effective implementation requires uncompromised commitment to expectations of fidelity to the core components and methods; planned, proactive adaptation; systematic monitoring of both core program and agreed variations; and local ownership and sustainability.

  12. The Relationship Between Fidelity and Learning in Aviation Training and Assessment

    Science.gov (United States)

    Noble, Cliff

    2002-01-01

    Flight simulators can be designed to train pilots or assess their flight performance. Low-Fidelity simulators maximize the initial learning rate of novice pilots and minimize initial costs; whereas, expensive, high-fidelity simulators predict the realworld in-flight performance of expert pilots (Fink & Shriver, 1978 Hays & Singer 1989; Kinkade & Wheaton. 1972). Although intuitively appealing and intellectually convenient to generalize concepts of learning and assessment, what holds true for the role of fidelity in assessment may not always hold true for learning, and vice versa. To bring clarity to this issue, the author distinguishes the role of fidelity in learning from its role in assessment as a function of skill level by applying the hypothesis of Alessi (1988) and reviewing the Laughery, Ditzian, and Houtman (1982) study on simulator validity. Alessi hypothesized that there is it point beyond which one additional unit of flight-simulator fidelity results in a diminished rate of learning. The author of this current paper also suggests the existence of an optimal point beyond which one additional unit of flight-simulator fidelity results in a diminished rate of practical assessment of nonexpert pilot performance.

  13. Engagement in Training as a Mechanism to Understanding Fidelity of Implementation of the Responsive Classroom Approach.

    Science.gov (United States)

    Wanless, Shannon B; Rimm-Kaufman, Sara E; Abry, Tashia; Larsen, Ross A; Patton, Christine L

    2015-11-01

    Fidelity of implementation of classroom interventions varies greatly, a reality that is concerning because higher fidelity of implementation relates to greater effectiveness of the intervention. We analyzed 126 fourth and fifth grade teachers from the treatment group of a randomized controlled trial of the Responsive Classroom® (RC) approach. Prior to training in the intervention, we assessed factors that had the potential to represent a teacher's readiness to implement with fidelity. These included teachers' observed emotional support, teacher-rated use of intervention practices, teacher-rated self-efficacy, teacher-rated collective responsibility, education level, and years of experience, and they were not directly related to observed fidelity of implementation 2 years later. Further analyses indicated, however, that RC trainers' ratings of teachers' engagement in the initial weeklong RC training mediated the relation between initial observed emotional support and later observed fidelity of implementation. We discuss these findings as a way to advance understanding of teachers' readiness to implement new interventions with fidelity.

  14. Working alliance and treatment fidelity as predictors of externalizing problem behaviors in parent management training.

    Science.gov (United States)

    Hukkelberg, Silje S; Ogden, Terje

    2013-12-01

    The study investigated treatment fidelity and working alliance in the Parent Management Training-Oregon model (PMTO) and investigated how these relate to children's externalizing problem behaviors, as reported by parents and teachers. Participants were 331 Norwegian parents who rated the client-therapist working alliance at 3 time points (Sessions 3, 12, and 20). Competent adherence to the PMTO treatment protocol was assessed by PMTO specialists from evaluations of videotaped therapy sessions using the Fidelity of Implementation (FIMP) system (Knutson, Forgatch, & Rains, 2003). Parents and teachers reported children's problem behaviors at baseline and at the end of therapy. Structural equation modeling was used to analyze the repeated measures data. Parents reported high and stable levels of alliance and fidelity from Time 1 to Time 3, with no correlational or direct relations between the 2. Treatment fidelity predicted reductions in parent-reported externalizing behavior, whereas working alliance was related to less change in problem behavior. Alliance and fidelity were unrelated to teacher-reported behavior problems. The findings point to treatment fidelity as an active ingredient in PMTO and working alliance as a negative predictor of postassessment parent-reported externalizing behavior. More research is needed to investigate whether these findings can be replicated and extended beyond PMTO.

  15. Fidelity decay of the two-level bosonic embedded ensembles of Random Matrices

    CERN Document Server

    Benet, Luis; Seligman, Thomas H

    2010-01-01

    We study the fidelity decay of the $k$-body embedded ensembles of random matrices for bosons distributed over two single-particle states. Fidelity is defined in terms of a reference Hamiltonian, which is a purely diagonal matrix consisting of a fixed one-body term and includes the diagonal of the perturbing $k$-body embedded ensemble matrix, and the perturbed Hamiltonian which includes the residual off-diagonal elements of the $k$-body interaction. This choice mimics the typical mean-field basis used in many calculations. We study separately the cases $k=2$ and $3$. We compute the ensemble-averaged fidelity decay as well as the fidelity of typical members with respect to an initial random state. Average fidelity displays a revival at the Heisenberg time, $t=t_H=1$, and a freeze in the fidelity decay, during which periodic revivals of period $t_H$ are observed. We obtain the relevant scaling properties with respect to the number of bosons and the strength of the perturbation. For certain members of the ensembl...

  16. Reduced Fidelity of Neural Representation Underlies Episodic Memory Decline in Normal Aging.

    Science.gov (United States)

    Zheng, Li; Gao, Zhiyao; Xiao, Xiaoqian; Ye, Zhifang; Chen, Chuansheng; Xue, Gui

    2017-06-07

    Emerging studies have emphasized the importance of the fidelity of cortical representation in forming enduring episodic memory. No study, however, has examined whether there are age-related reductions in representation fidelity that can explain memory declines in normal aging. Using functional MRI and multivariate pattern analysis, we found that older adults showed reduced representation fidelity in the visual cortex, which accounted for their decreased memory performance even after controlling for the contribution of reduced activation level. This reduced fidelity was specifically due to older adults' poorer item-specific representation, not due to their lower activation level and variance, greater variability in neuro-vascular coupling, or decreased selectivity of categorical representation (i.e., dedifferentiation). Older adults also showed an enhanced subsequent memory effect in the prefrontal cortex based on activation level, and their prefrontal activation was associated with greater fidelity of representation in the visual cortex and better memory performance. The fidelity of cortical representation thus may serve as a promising neural index for better mechanistic understanding of the memory declines and its compensation in normal aging. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  17. High-fidelity simulation capability for virtual testing of seismic and acoustic sensors

    Science.gov (United States)

    Wilson, D. Keith; Moran, Mark L.; Ketcham, Stephen A.; Lacombe, James; Anderson, Thomas S.; Symons, Neill P.; Aldridge, David F.; Marlin, David H.; Collier, Sandra L.; Ostashev, Vladimir E.

    2005-05-01

    This paper describes development and application of a high-fidelity, seismic/acoustic simulation capability for battlefield sensors. The purpose is to provide simulated sensor data so realistic that they cannot be distinguished by experts from actual field data. This emerging capability provides rapid, low-cost trade studies of unattended ground sensor network configurations, data processing and fusion strategies, and signatures emitted by prototype vehicles. There are three essential components to the modeling: (1) detailed mechanical signature models for vehicles and walkers, (2) high-resolution characterization of the subsurface and atmospheric environments, and (3) state-of-the-art seismic/acoustic models for propagating moving-vehicle signatures through realistic, complex environments. With regard to the first of these components, dynamic models of wheeled and tracked vehicles have been developed to generate ground force inputs to seismic propagation models. Vehicle models range from simple, 2D representations to highly detailed, 3D representations of entire linked-track suspension systems. Similarly detailed models of acoustic emissions from vehicle engines are under development. The propagation calculations for both the seismics and acoustics are based on finite-difference, time-domain (FDTD) methodologies capable of handling complex environmental features such as heterogeneous geologies, urban structures, surface vegetation, and dynamic atmospheric turbulence. Any number of dynamic sources and virtual sensors may be incorporated into the FDTD model. The computational demands of 3D FDTD simulation over tactical distances require massively parallel computers. Several example calculations of seismic/acoustic wave propagation through complex atmospheric and terrain environments are shown.

  18. What is the extent and quality of documentation and reporting of fidelity to implementation strategies: a scoping review.

    Science.gov (United States)

    Slaughter, Susan E; Hill, Jennifer N; Snelgrove-Clarke, Erna

    2015-09-07

    Implementation fidelity is critical to the internal and external validity of implementation research. Much of what is written about implementation fidelity addresses fidelity of evidence-informed interventions rather than fidelity of implementation strategies. The documentation and reporting of fidelity to implementation strategies requires attention. Therefore, in this scoping review, we identify the extent and quality of documentation and reporting of fidelity of implementation strategies that were used to implement evidence-informed interventions. A six-stage methodological framework for scoping studies guided our work. Studies were identified from the outputs of the Effective Practice and Organization of Care (EPOC) review group within the Cochrane Database of Systematic Reviews. EPOC's primary focus, implementation strategies influencing provider behavior change, optimized our ability to identify articles for inclusion. We organized the retrieved articles from the systematic reviews by journal and selected the three journals with the largest number of retrieved articles. Using a data extraction tool, we organized retrieved article data from these three journals. In addition, we summarized implementation strategies using the EPOC categories. Data extraction pertaining to the quality of reporting the fidelity of implementation strategies was facilitated with an "Implementation Strategy Fidelity Checklist" based on definitions adapted from Dusenbury et al. We conducted inter-rater reliability checks for all of the independently scored articles. Using linear regression, we assessed the fidelity scores in relation to the publication year. Seventy-two implementation articles were included in the final analysis. Researchers reported neither fidelity definitions nor conceptual frameworks for fidelity in any articles. The most frequently employed implementation strategies included distribution of education materials (n = 35), audit and feedback (n = 32), and

  19. Biochemical characterization of enzyme fidelity of influenza A virus RNA polymerase complex.

    Directory of Open Access Journals (Sweden)

    Shilpa Aggarwal

    Full Text Available BACKGROUND: It is widely accepted that the highly error prone replication process of influenza A virus (IAV, together with viral genome assortment, facilitates the efficient evolutionary capacity of IAV. Therefore, it has been logically assumed that the enzyme responsible for viral RNA replication process, influenza virus type A RNA polymerase (IAV Pol, is a highly error-prone polymerase which provides the genomic mutations necessary for viral evolution and host adaptation. Importantly, however, the actual enzyme fidelity of IAV RNA polymerase has never been characterized. PRINCIPAL FINDINGS: Here we established new biochemical assay conditions that enabled us to assess both polymerase activity with physiological NTP pools and enzyme fidelity of IAV Pol. We report that IAV Pol displays highly active RNA-dependent RNA polymerase activity at unbiased physiological NTP substrate concentrations. With this robust enzyme activity, for the first time, we were able to compare the enzyme fidelity of IAV Pol complex with that of bacterial phage T7 RNA polymerase and the reverse transcriptases (RT of human immunodeficiency virus (HIV-1 and murine leukemia virus (MuLV, which are known to be low and high fidelity enzymes, respectively. We observed that IAV Pol displayed significantly higher fidelity than HIV-1 RT and T7 RNA polymerase and equivalent or higher fidelity than MuLV RT. In addition, the IAV Pol complex showed increased fidelity at lower temperatures. Moreover, upon replacement of Mg(++ with Mn(++, IAV Pol displayed increased polymerase activity, but with significantly reduced processivity, and misincorporation was slightly elevated in the presence of Mn(++. Finally, when the IAV nucleoprotein (NP was included in the reactions, the IAV Pol complex exhibited enhanced polymerase activity with increased fidelity. SIGNIFICANCE: Our study indicates that IAV Pol is a high fidelity enzyme. We envision that the high fidelity nature of IAV Pol may be

  20. Removal of redundant contigs from de novo RNA-Seq assemblies via homology search improves accurate detection of differentially expressed genes.

    Science.gov (United States)

    Ono, Hanako; Ishii, Kazuo; Kozaki, Toshinori; Ogiwara, Isao; Kanekatsu, Motoki; Yamada, Tetsuya

    2015-12-04

    For plant species with unsequenced genomes, cDNA contigs created by de novo assembly of RNA-Seq reads are used as reference sequences for comparative analysis of RNA-Seq datasets and the detection of differentially expressed genes (DEGs). Redundancies in such contigs are evident in previous RNA-Seq studies, and such redundancies can lead to difficulties in subsequent analysis. Nevertheless, the effects of removing redundancy from contig assemblies on comparative RNA-Seq analysis have not been evaluated. Here we describe a method for removing redundancy from raw contigs that were primarily created by de novo assembly of Arabidopsis thaliana RNA-Seq reads. Specifically, the contigs with the highest bit scores were selected from raw contigs by a homology search against the gene dataset in the TAIR10 database. The two existing methods for removal of redundancy based on contig length or clustering analysis used to eliminate redundancies from raw contigs. Contig number was reduced most effectively with the method based on homology search. In a comparative analysis of RNA-Seq datasets, DEGs detected in contigs that underwent redundancy removal via the homology search method showed the highest identity to the DEGs detected when the TAIR10 gene dataset was used as an exact reference. Redundancy in raw contigs could also be removed by a homology search against integrated protein datasets from several plant species other than A. thaliana. DEGs detected using contigs that underwent such redundancy-removed also showed high homology to DEGs detected using the TAIR10 gene dataset. Here we describe a method for removing redundant contigs within raw contigs; this method involves a homology search against a gene or protein database. In principal, this method can be used with unsequenced plant genomes that lack a well-developed gene database. Redundant contigs were not removed adequately via either of two existing methods, but our method allowed for removal of all redundant contigs

  1. Dancing links

    CERN Document Server

    Knuth, Donald E

    2009-01-01

    The author presents two tricks to accelerate depth-first search algorithms for a class of combinatorial puzzle problems, such as tiling a tray by a fixed set of polyominoes. The first trick is to implement each assumption of the search with reversible local operations on doubly linked lists. By this trick, every step of the search affects the data incrementally. The second trick is to add a ghost square that represents the identity of each polyomino. Thus puts the rule that each polyomino be used once on the same footing as the rule that each square be covered once. The coding simplifies to a more abstract form which is equivalent to 0-1 integer programming. More significantly for the total computation time, the search can naturally switch between placing a fixed polyomino or covering a fixed square at different stages, according to a combined heuristic. Finally the author reports excellent performance for his algorithm for some familiar puzzles. These include tiling a hexagon by 19 hexiamonds and the N queen...

  2. Dicty_cDB: Contig-U13627-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qmvynyy*rinkninhqkppqfqrmn*qisln*ikris lnnlnyslni*kiqkllpkf*lflelvmilkmlqklvn*hlqn*nylenikiklkn*mki rny**knv... TE+G+LA + K FR+ K+++ E Sbjct: 214 RNIAIELLRRFQTEIGELATEESKNFRDRNMFIILVPNKEMIRKPQ...no gap Contig length 707 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start point 2139423 End poi...Contig-U13627-1 is nuc VS (DIR, S) 0 VH (FL, L) 2 VF (FL, S) 0 AH (FL, L) 0 AF (FL, S) 0 SL (DIR..., L) 0 SS (DIR, S) 0 SH (FL, L) 0 SF (FL, S) 0 CH (FL, L) 0 CF (FL, S) 0 FCL (DIR, L) 0 FC (DIR, S) 0 FC-IC (SUB) 0 ...

  3. Investigation of the impact of high liquid viscosity on jet atomization in crossflow via high-fidelity simulations

    Science.gov (United States)

    Li, Xiaoyi; Gao, Hui; Soteriou, Marios C.

    2017-08-01

    Atomization of extremely high viscosity liquid can be of interest for many applications in aerospace, automotive, pharmaceutical, and food industries. While detailed atomization measurements usually face grand challenges, high-fidelity numerical simulations offer the advantage to comprehensively explore the atomization details. In this work, a previously validated high-fidelity first-principle simulation code HiMIST is utilized to simulate high-viscosity liquid jet atomization in crossflow. The code is used to perform a parametric study of the atomization process in a wide range of Ohnesorge numbers (Oh = 0.004-2) and Weber numbers (We = 10-160). Direct comparisons between the present study and previously published low-viscosity jet in crossflow results are performed. The effects of viscous damping and slowing on jet penetration, liquid surface instabilities, ligament formation/breakup, and subsequent droplet formation are investigated. Complex variations in near-field and far-field jet penetrations with increasing Oh at different We are observed and linked with the underlying jet deformation and breakup physics. Transition in breakup regimes and increase in droplet size with increasing Oh are observed, mostly consistent with the literature reports. The detailed simulations elucidate a distinctive edge-ligament-breakup dominated process with long surviving ligaments for the higher Oh cases, as opposed to a two-stage edge-stripping/column-fracture process for the lower Oh counterparts. The trend of decreasing column deflection with increasing We is reversed as Oh increases. A predominantly unimodal droplet size distribution is predicted at higher Oh, in contrast to the bimodal distribution at lower Oh. It has been found that both Rayleigh-Taylor and Kelvin-Helmholtz linear stability theories cannot be easily applied to interpret the distinct edge breakup process and further study of the underlying physics is needed.

  4. Dicty_cDB: Contig-U00354-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6 AY497776_1( AY497776 |pid:none) Cyprinodon variegatus isolate Cv_A... 57 2e-06 ... BAC OSJ... 56 3e-06 AY497783_1( AY497783 |pid:none) Cyprinodon variegatus isolate Cv_A... 56 3e-06 AM433325... AM463959 |pid:none) Vitis vinifera contig VV78X194909.... 55 5e-06 AY497777_1( AY497777 |pid:none) Cyprinodon

  5. Dicty_cDB: Contig-U01810-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 ) Vitis vinifera, whole genome shotgun sequence, co... 42 6.3 1 ( DL083629 ) Listeria innocua, genome and applications...32 4.2 2 ( AP010074 ) Lotus japonicus genomic DNA, chromosome 1, clone:... 36 5.5 4 ( DL081580 ) Listeria innocua, genome and applica...tions. 42 5.5 7 ( AM476110 ) Vitis vinifera contig VV78X267385.15, whole genom... 4

  6. Dicty_cDB: Contig-U15761-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AGG AATTATATATACAATAAAAAACAAAAAACAAAA Gap gap included Contig length 4873 Chromosome number (1..6, M) - Chromo...ykw*ctkscein*fnyth fkiiwciwtfw*****ytiidisnysskw*kytnak**wysfikcrwindysrfirftif k... AC116984 ) Dictyostelium discoideum chromosome 2 map 2567470... 1322 0.0 2 ( BJ336402 ) Dictyostelium disco...-50 1 ( AC115683 ) Dictyostelium discoideum chromosome 2 map complem... 40 7e-13 13 ( AC116305 ) Dictyostelium discoideum chromo...some 2 map 1005175... 36 2e-08 17 ( AC116986 ) Dictyostelium discoideum chromo

  7. Dicty_cDB: Contig-U03772-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AM437561 ) Vitis vinifera contig VV78X271076.15, whole genom... 38 0.011 4 ( DB917492 ) Idiosepius parado...11 5 ( DB917153 ) Idiosepius paradoxus cDNA, clone:Ip_aB_028_I04, 5... 40 0.011 2...EQUENCING IN PROGRESS... 38 0.010 6 ( AL356014 ) Arabidopsis thaliana DNA chromosome 3, BAC clone ... 44 0.0

  8. Dicty_cDB: Contig-U14990-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lekhlkkskkinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkil milkq*hhh*sqnplvavlvki...nl*sskyswyfsnsfny**nxik**lk*kktl Frame B: gllekhlkkskkinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkil milkq...qfvqvvqvkmhvnhk liilikrvlkle*kllkiryw*chqrvvlvnqqfhpcyhmvfqreiitppkyly*mlifa vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilk...4 Query: 992 NHDIKVMSVGFLLGTPDAPVIWKGPRKTTMIRRFLKDTFWGKQDYLIIDTPPGTSDEHLS 1171 ++...Contig-U14990-1 no gap 1568 4 3104178 3102621 MINUS 5 8 U14990 0 0 2 0 3 0 0 0 0 0

  9. Dicty_cDB: Contig-U15347-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available inqtk thnlnswl*issmmvfh*kin*ylemilkfqqkl*shfqw*mkpmttnstlklnyqrkrk ksle*lnkrf*iyklkr*qkiinsihhwsrrdwifsleiil...FRDHVTLSPNEAEEFPTHEIMLPEDRVLVTKEDSPMVKAFKDRVIQE GLLNDFQTKIDLVNDQPQYESHLFMEEYKAKLYENEKQLQKDLLETRDPMMIRNFIKYKY...LE NEKERRTMMLGDSFRDHVTLSPNEAEEFPTHEIMLPEDRVLVTKEDSPMVKAFKDRVIQE GLLNDFQTKIDLVNDQPQYESHLFMEEYKAKLYENEKQLQKDLLETRDPMMIR...Contig-U15347-1 no gap 2522 1 3509501 3507860 MINUS 8 10 U15347 1 2 1 0 0 0 0 0 1 2...ome length 4919822 Start point 3509501 End point 3507860 Strand (PLUS/MINUS) MINUS Number of clones 8 Number

  10. Dicty_cDB: Contig-U13549-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s niger contig An07c0240... 61 3e-08 CP001614_189( CP001614 |pid:none) Teredinibacter turnerae T7901, c... 6...d:none) Debaryomyces hansenii strain CBS... 59 8e-08 CP001614_3051( CP001614 |pid:none) Teredinibacter turner...001614_1416( CP001614 |pid:none) Teredinibacter turnerae T7901, ... 53 7e-06 CP000880_590( CP000880 |pid:non

  11. Restriction mapping of a YAC contig in the hemochromatosis gene region

    Energy Technology Data Exchange (ETDEWEB)

    Burt, M.J.; Smit, D.J.; Pyper, W.R. [Univ. of Queensland, Brisbane (Australia)

    1994-09-01

    Hemochromatosis is a common inherited disorder of iron metabolism that can lead to cirrhosis, hepatocellular carcinoma, cardiomyopathy, diabetes and anthropathy. We have mapped the hemochromatosis gene to within 1 cM of HLA-A and the microsatellite D6S105, and our allele association studies have shown that D6S105 is the marker most closely associated with the hemochromatosis gene. We are currently constructing a YAC contig and restriction map of this region as part of a positional cloning strategy to identify the hemochromatosis gene. YACs containing HLA-A or D6S105 were selected, and fluorescent-in-situ-hybridization (FISH) was performed to confirm chromosomal location and exclude chimerism. YAC DNA was digested with a panel of rare cutters, separated by pulsed field gel electrophoresis, Southern blotted and probed with the vector arms to create restriction maps. YAC insert terminal ends were isolated using vectorette methodology. A contig extending 600 kb centromeric and 350 kb telomeric of HLA-A has been established. HLA-A, HLA-F and the microsatellite D6S265 have been positioned on this map. The contig does not yet overlap any D6S105 positive YACs but the telomeric end of the contig has been sequenced and is being used to identify additional YACs to bridge this interval. Restriction mapping of three D6S105 YACs has shown the presence of several CpG islands in this region. As these CpG islands are in close proximity to D6S105, they are being used to isolate coding sequences to determine whether any of these mark the position of the hemochromatosis gene.

  12. A YAC contig of approximately 3 Mb from human chromosome 5q31 [yields] q33

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiang; Wang Jabs, E.; Hawkins, A.L.; Griffin, C.A. (John Hopkins School of Medicine, Baltimore, MD (United States)); Wise, C.A.; Lovett, M. (Univ. of Texas Southwestern Medical Center, Dallas, TX (United States)); Le Paslier, D. (CEPH, Paris (France)); Pittler, S.J. (Univ. of South Alabama College of Medicine, Mobile, AL (United States))

    1994-02-01

    The human chromosome 5q31-q33 region contains an interesting cluster of growth factor and receptor genes. In addition, several genetic disease loci have been localized within this region, but have not as yet been isolated as molecular clones. These include those loci involved in autosomal dominant limb-girdle muscular dystrophy, diastrophic dysplasia, Treacher Collins syndrome, and myeloid disorders associated with the 5q-syndrome. A yeast artificial chromosome (YAC) contig of this region would assist in the further localization and isolation of these genes. The authors have used YACs isolated from the Washington University and Centre d'Etude du Polymorphisme Humain YAC libraries, including YACs from the large insert (mega) YAC library to build a contig greater than 3 Mb in size. An STS content strategy coupled with limited walking from YAC ends was used to isolate 22 overlapping YACs with as much as sixfold coverage. A total of 20 STSs, derived from genes, anonymous sequences, and vector Alu-PCR or inverse PCR products, were used to compile this contig. The order of loci, centromere-GRL-D5S207-D5S70-D5S545-D5S546-D5S547-D5S68-D5S548-D5S210-D5S549-D5S686- ADRB2-D5S559-CSF1R-D5S551-RPS14-D5S519-SPARC-telomere, was derived from the overlapping clones. This contig and clones derived from it will be useful substrates in selecting candidate cDNAs for the disease loci in this interval. 45 refs., 1 fig., 2 tabs.

  13. Dicty_cDB: Contig-U10823-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Leptospira interrogans serovar ... 56 5e-06 Y18740_1( Y18740 |pid:none) Gracilariopsis lemaneiformis Agll4...is vinifera contig VV78X000125.... 47 0.002 Y18738_1( Y18738 |pid:none) Gracilariopsis...000777 |pid:none) Leptospira biflexa serovar Pato... 43 0.032 Y18737_1( Y18737 |pid:none) Gracilariopsis

  14. Fidelity of the diagonal ensemble signals the many-body localization transition

    Science.gov (United States)

    Hu, Taotao; Xue, Kang; Li, Xiaodan; Zhang, Yan; Ren, Hang

    2016-11-01

    In this work, we use exact matrix diagonalization to explore the many-body localization (MBL) transition in a random-field Heisenberg chain. We demonstrate that the fidelity and fidelity susceptibility can be utilized to characterize the interaction-driven many-body localization transition in this closed spin system which is in agreement with previous analytical and numerical results [S. Garnerone, N. T. Jacobson, S. Haas, and P. Zanardi, Phys. Rev. Lett. 102, 057205 (2009), 10.1103/PhysRevLett.102.057205; P. Zanardi and N. Paunkovic, Phys. Rev. E 74, 031123 (2006), 10.1103/PhysRevE.74.031123]. In particular, instead of ground-state fidelity, we test the fidelity between two diagonal ensembles related by a small parameter perturbation δ h , it is special that here the parameter perturbation δ hi for each site are random variables like hi. It shows that fidelity of the diagonal ensemble develop a pronounced drop at the transition. We utilize fidelity to estimate the critical disorder strength hc for different system size, we get hc∈ [2.5,3.9] and get a power-law decay with an exponent of roughly -1.49 (2 ) for system size N , and can extrapolate hcinf of the infinite system is about 2.07 which all agree with a recent work by Huse and Pal, in which the MBL transition in the same model was predicted to be hc [2,4]. We also estimate the scaling of maximum of averaged fidelity susceptibility as a function of system size N , it shows a power law increase with an exponent of about 5.05(1).

  15. An Automatic Medium to High Fidelity Low-Thrust Global Trajectory Toolchain; EMTG-GMAT

    Science.gov (United States)

    Beeson, Ryne T.; Englander, Jacob A.; Hughes, Steven P.; Schadegg, Maximillian

    2015-01-01

    Solving the global optimization, low-thrust, multiple-flyby interplanetary trajectory problem with high-fidelity dynamical models requires an unreasonable amount of computational resources. A better approach, and one that is demonstrated in this paper, is a multi-step process whereby the solution of the aforementioned problem is solved at a lower-fidelity and this solution is used as an initial guess for a higher-fidelity solver. The framework presented in this work uses two tools developed by NASA Goddard Space Flight Center: the Evolutionary Mission Trajectory Generator (EMTG) and the General Mission Analysis Tool (GMAT). EMTG is a medium to medium-high fidelity low-thrust interplanetary global optimization solver, which now has the capability to automatically generate GMAT script files for seeding a high-fidelity solution using GMAT's local optimization capabilities. A discussion of the dynamical models as well as thruster and power modeling for both EMTG and GMAT are given in this paper. Current capabilities are demonstrated with examples that highlight the toolchains ability to efficiently solve the difficult low-thrust global optimization problem with little human intervention.

  16. Empowerment implementation: enhancing fidelity and adaptation in a psycho-educational intervention.

    Science.gov (United States)

    van Daele, Tom; van Audenhove, Chantal; Hermans, Dirk; van den Bergh, Omer; van den Broucke, Stephan

    2014-06-01

    Implementation is an emerging research topic in the field of health promotion. Most of the implementation research adheres to one of two paradigms: implementing interventions with maximum fidelity or designing interventions that are responsive to the needs of a local community. While fidelity and adaptation are often considered as contradictory, they are both essential elements of preventive interventions. An innovative program design strategy is therefore to develop hybrid programs that 'build in' adaptation to enhance program fit, while also maximizing the implementation fidelity. The present article presents guidelines for this hybrid approach to program implementation and illustrates them with a concrete psycho-educational group intervention. The approach, which is referred to as 'empowerment implementation' on the analogy of empowerment evaluation, builds on theory of implementation fidelity and community-based participatory research. To demonstrate the use of these guidelines, a psycho-educational course aimed at stress reduction and the prevention of depression and anxiety was implemented according to these guidelines. The main focus lies on how an intervention can benefit from adaptations guided by local expertise, while maintaining the core program components and still respecting the implementation fidelity.

  17. A high-throughput assay for the comprehensive profiling of DNA ligase fidelity.

    Science.gov (United States)

    Lohman, Gregory J S; Bauer, Robert J; Nichols, Nicole M; Mazzola, Laurie; Bybee, Joanna; Rivizzigno, Danielle; Cantin, Elizabeth; Evans, Thomas C

    2016-01-29

    DNA ligases have broad application in molecular biology, from traditional cloning methods to modern synthetic biology and molecular diagnostics protocols. Ligation-based detection of polynucleotide sequences can be achieved by the ligation of probe oligonucleotides when annealed to a complementary target sequence. In order to achieve a high sensitivity and low background, the ligase must efficiently join correctly base-paired substrates, while discriminating against the ligation of substrates containing even one mismatched base pair. In the current study, we report the use of capillary electrophoresis to rapidly generate mismatch fidelity profiles that interrogate all 256 possible base-pair combinations at a ligation junction in a single experiment. Rapid screening of ligase fidelity in a 96-well plate format has allowed the study of ligase fidelity in unprecedented depth. As an example of this new method, herein we report the ligation fidelity of Thermus thermophilus DNA ligase at a range of temperatures, buffer pH and monovalent cation strength. This screen allows the selection of reaction conditions that maximize fidelity without sacrificing activity, while generating a profile of specific mismatches that ligate detectably under each set of conditions.

  18. Spawning site fidelity of wild and hatchery lake trout (Salvelinus namaycush) in northern Lake Huron

    Science.gov (United States)

    Binder, Thomas; Riley, Stephen C.; Holbrook, Christopher; Hansen, Michael J.; Bergstedt, Roger A.; Bronte, Charles R.; He, Ji; Krueger, Charles C.

    2016-01-01

    Fidelity to high-quality spawning sites helps ensure that adults repeatedly spawn at sites that maximize reproductive success. Fidelity is also an important behavioural characteristic to consider when hatchery-reared individuals are stocked for species restoration, because artificial rearing environments may interfere with cues that guide appropriate spawning site selection. Acoustic telemetry was used in conjunction with Cormack–Jolly–Seber capture–recapture models to compare degree of spawning site fidelity of wild and hatchery-reared lake trout (Salvelinus namaycush) in northern Lake Huron. Annual survival was estimated to be between 77% and 81% and did not differ among wild and hatchery males and females. Site fidelity estimates were high in both wild and hatchery-reared lake trout (ranging from 0.78 to 0.94, depending on group and time filter), but were slightly lower in hatchery-reared fish than in wild fish. The ecological implication of the small difference in site fidelity between wild and hatchery-reared lake trout is unclear, but similarities in estimates suggest that many hatchery-reared fish use similar spawning sites to wild fish and that most return to those sites annually for spawning.

  19. A new paradigm for variable-fidelity stochastic simulation and information fusion in fluid mechanics

    Science.gov (United States)

    Venturi, Daniele; Parussini, Lucia; Perdikaris, Paris; Karniadakis, George

    2015-11-01

    Predicting the statistical properties of fluid systems based on stochastic simulations and experimental data is a problem of major interest across many disciplines. Even with recent theoretical and computational advancements, no broadly applicable techniques exist that could deal effectively with uncertainty propagation and model inadequacy in high-dimensions. To address these problems, we propose a new paradigm for variable-fidelity stochastic modeling, simulation and information fusion in fluid mechanics. The key idea relies in employing recursive Bayesian networks and multi-fidelity information sources (e.g., stochastic simulations at different resolution) to construct optimal predictors for quantities of interest, e.g., the random temperature field in stochastic Rayleigh-Bénard convection. The object of inference is the quantity of interest at the highest possible level of fidelity, for which we can usually afford only few simulations. To compute the optimal predictors, we developed a multivariate recursive co-kriging approach that simultaneously takes into account variable fidelity in the space of models (e.g., DNS vs. potential flow solvers), as well as variable-fidelity in probability space. Numerical applications are presented and discussed. This research was supported by AFOSR and DARPA.

  20. Evaluating the implementation fidelity of a multicomponent intervention for oral health promotion in preschool children.

    Science.gov (United States)

    Van den Branden, S; Van den Broucke, S; Leroy, R; Declerck, D; Hoppenbrouwers, K

    2015-01-01

    This study evaluates the process of implementation of a longitudinal intervention program to promote oral health in preschool children in Flanders, Belgium. As the program was implemented in an existing preventive health care organization, the study also evaluates this setting as the context for implementation. Qualitative and quantitative methods were used to evaluate implementation fidelity, based on Carroll's theoretical framework of implementation fidelity (Carroll et al., Implementation Science 2:40, 2007). Questionnaire data from participants and health workers were analyzed, and document analyses were performed to compare registrations of the actions with the planning manual. Results were mixed. Whereas more than 88 % of all parents attended all home visits, only 57 % received at least 9 of the 11 planned consultations. Fifty-two percent of the families received all supporting materials, and on average, 73 % of all attending families received all information at a contact as described in the manual. Moderating factors such as the adequate use of facilitators and high participant responsiveness had a positive impact on implementation fidelity, whereas the quality of delivery differed to a great extent between the nurses who were involved during the entire intervention period and those who gave only a few sessions. Implementing an intervention in an existing well-baby program has many advantages, although lack of time presents a challenge to implementation fidelity. The results of this process evaluation allow a better understanding of the contribution of implementation fidelity to the effectiveness of health promotion programs.

  1. Fidelity decay in interacting two-level boson systems: Freezing and revivals

    Science.gov (United States)

    Benet, Luis; Hernández-Quiroz, Saúl; Seligman, Thomas H.

    2011-05-01

    We study the fidelity decay in the k-body embedded ensembles of random matrices for bosons distributed in two single-particle states, considering the reference or unperturbed Hamiltonian as the one-body terms and the diagonal part of the k-body embedded ensemble of random matrices and the perturbation as the residual off-diagonal part of the interaction. We calculate the ensemble-averaged fidelity with respect to an initial random state within linear response theory to second order on the perturbation strength and demonstrate that it displays the freeze of the fidelity. During the freeze, the average fidelity exhibits periodic revivals at integer values of the Heisenberg time tH. By selecting specific k-body terms of the residual interaction, we find that the periodicity of the revivals during the freeze of fidelity is an integer fraction of tH, thus relating the period of the revivals with the range of the interaction k of the perturbing terms. Numerical calculations confirm the analytical results.

  2. Fidelity decay in interacting two-level boson systems: Freezing and revivals

    CERN Document Server

    Benet, Luis; Seligman, Thomas H

    2011-01-01

    We study the fidelity decay in the $k$-body embedded ensembles of random matrices for bosons distributed in two single-particle states, considering the reference or unperturbed Hamiltonian as the one-body terms and the diagonal part of the $k$-body embedded ensemble of random matrices, and the perturbation as the residual off-diagonal part of the interaction. We calculate the ensemble-averaged fidelity with respect to an initial random state within linear response theory to second order on the perturbation strength, and demonstrate that it displays the freeze of the fidelity. During the freeze, the average fidelity exhibits periodic revivals at integer values of the Heisenberg time $t_H$. By selecting specific $k$-body terms of the residual interaction, we find that the periodicity of the revivals during the freeze of fidelity is an integer fraction of $t_H$, thus relating the period of the revivals with the range of the interaction $k$ of the perturbing terms. Numerical calculations confirm the analytical re...

  3. Sex-linked dominant

    Science.gov (United States)

    Inheritance - sex-linked dominant; Genetics - sex-linked dominant; X-linked dominant; Y-linked dominant ... can be either an autosomal chromosome or a sex chromosome. It also depends on whether the trait ...

  4. LTC: a novel algorithm to improve the efficiency of contig assembly for physical mapping in complex genomes

    Directory of Open Access Journals (Sweden)

    Feuillet Catherine

    2010-11-01

    Full Text Available Abstract Background Physical maps are the substrate of genome sequencing and map-based cloning and their construction relies on the accurate assembly of BAC clones into large contigs that are then anchored to genetic maps with molecular markers. High Information Content Fingerprinting has become the method of choice for large and repetitive genomes such as those of maize, barley, and wheat. However, the high level of repeated DNA present in these genomes requires the application of very stringent criteria to ensure a reliable assembly with the FingerPrinted Contig (FPC software, which often results in short contig lengths (of 3-5 clones before merging as well as an unreliable assembly in some difficult regions. Difficulties can originate from a non-linear topological structure of clone overlaps, low power of clone ordering algorithms, and the absence of tools to identify sources of gaps in Minimal Tiling Paths (MTPs. Results To address these problems, we propose a novel approach that: (i reduces the rate of false connections and Q-clones by using a new cutoff calculation method; (ii obtains reliable clusters robust to the exclusion of single clone or clone overlap; (iii explores the topological contig structure by considering contigs as networks of clones connected by significant overlaps; (iv performs iterative clone clustering combined with ordering and order verification using re-sampling methods; and (v uses global optimization methods for clone ordering and Band Map construction. The elements of this new analytical framework called Linear Topological Contig (LTC were applied on datasets used previously for the construction of the physical map of wheat chromosome 3B with FPC. The performance of LTC vs. FPC was compared also on the simulated BAC libraries based on the known genome sequences for chromosome 1 of rice and chromosome 1 of maize. Conclusions The results show that compared to other methods, LTC enables the construction of highly

  5. Intermittent Transcription Dynamics for the Rapid Production of Long Transcripts of High Fidelity

    Directory of Open Access Journals (Sweden)

    Martin Depken

    2013-10-01

    Full Text Available Normal cellular function relies on the efficient and accurate readout of the genetic code. Single-molecule experiments show that transcription and replication are highly intermittent processes that are frequently interrupted by polymerases pausing and reversing directions. Although intermittent dynamics in replication are known to result from proofreading, their origin and significance during transcription remain controversial. Here, we theoretically investigate transcriptional fidelity and show that the kinetic scheme provided by the RNA-polymerase backtracking and transcript-cleavage pathway can account for measured error rates. Importantly, we find that intermittent dynamics provide an enormous increase in the rate of producing long transcripts of high fidelity. Our results imply that intermittent dynamics during transcription may have evolved as a way to mitigate the competing demands of speed and fidelity in the transcription of extended sequences.

  6. Role of technology in supporting quality control and treatment fidelity in a family caregiver clinical trial.

    Science.gov (United States)

    Farran, Carol J; Etkin, Caryn D; McCann, Judith J; Paun, Olimpia; Eisenstein, Amy R; Wilbur, Joellen

    2011-11-01

    This article describes how a family caregiver lifestyle physical activity clinical trial uses research technology to enhance quality control and treatment fidelity. This trial uses a range of Internet, Blaise(®) Windows-based software and Echo Server technologies to support quality control issues, such as data collection, data entry, and study management advocated by the clinical trials literature, and to ensure treatment fidelity concerning intervention implementation (i.e., design, training, delivery, receipt, and enactment) as proposed by the National Institutes of Health Behavior Change Consortium. All research staff are trained to use these technologies. Strengths of this technological approach to support quality control and treatment fidelity include the comprehensive plan, involvement of all staff, and ability to maintain accurate and timely data. Limitations include the upfront time and costs for developing and testing these technological methods, and having support staff readily available to address technological issues if they occur.

  7. Optimal Control of High-Fidelity Quantum Gates in the Presence of Decoherence

    CERN Document Server

    Grace, M; Kosut, R; Lidar, D A; Rabitz, H; Walmsley, I; Brif, Constantin; Grace, Matthew; Kosut, Robert; Lidar, Daniel A.; Rabitz, Herschel; Walmsley, Ian

    2006-01-01

    This work studies the feasibility of optimal control of high-fidelity quantum gates in a model of interacting two-level particles. One set of particles serves as the quantum information processor, whose evolution is controlled by a time-dependent external field. The other particles are not directly controlled and serve as an effective environment, coupling to which is the source of decoherence. The control objective is to generate target one- and two-qubit gates in the presence of strong environmentally-induced decoherence and physically motivated restrictions on the control field. The quantum-gate fidelity, expressed in terms of a state-independent distance measure, is maximized with respect to the control field using combined genetic and gradient algorithms. The resulting high-fidelity gates demonstrate the utility of optimal control for precise management of quantum dynamics, especially when the system complexity is exacerbated by environmental coupling.

  8. Optimal estimate of a pure qubit state from Uhlmann-Josza fidelity

    Energy Technology Data Exchange (ETDEWEB)

    Aoki, Manuel Avila, E-mail: manvlk@yahoo.com [Centro Universitario UAEM Valle de Chalco, UAEMex, Edo. de Mexico (Mexico)

    2012-04-15

    In the framework of collective measurements, efforts have been made to reconstruct one-qubit states. Such schemes find an obstacle in the no-cloning theorem, which prevents full reconstruction of a quantum state. Quantum Mechanics thus restricts to obtain estimates of the reconstruction of a pure qubit. We discuss the optimal estimate on the basis of the Uhlmann-Josza fidelity, respecting the limitations imposed by the no-cloning theorem. We derive a realistic optimal expression for the average fidelity. Our formalism also introduces an optimization parameter L. Values close to zero imply full reconstruction of the qubit (i. e., the classical limit), while larger L's represent good quantum optimization of the qubit estimate. The parameter L is interpreted as the degree of quantumness of the average fidelity associated with the reconstruction. (author)

  9. Technical Basis for Physical Fidelity of NRC Control Room Training Simulators for Advanced Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Minsk, Brian S.; Branch, Kristi M.; Bates, Edward K.; Mitchell, Mark R.; Gore, Bryan F.; Faris, Drury K.

    2009-10-09

    The objective of this study is to determine how simulator physical fidelity influences the effectiveness of training the regulatory personnel responsible for examination and oversight of operating personnel and inspection of technical systems at nuclear power reactors. It seeks to contribute to the U.S. Nuclear Regulatory Commission’s (NRC’s) understanding of the physical fidelity requirements of training simulators. The goal of the study is to provide an analytic framework, data, and analyses that inform NRC decisions about the physical fidelity requirements of the simulators it will need to train its staff for assignment at advanced reactors. These staff are expected to come from increasingly diverse educational and experiential backgrounds.

  10. Matrices of fidelities for ensembles of quantum states and the Holevo quantity

    CERN Document Server

    Fannes, Mark; Roga, Wojciech; Zyczkowski, Karol

    2011-01-01

    The entropy of the Gram matrix of a joint purification of an ensemble of K mixed states yields an upper bound for the Holevo information Chi of the ensemble. In this work we combine geometrical and probabilistic aspects of the ensemble in order to obtain useful bounds for Chi. This is done by constructing various correlation matrices involving fidelities between every pair of states from the ensemble. For K=3 quantum states we design a matrix of root fidelities that is positive and the entropy of which is conjectured to upper bound Chi. Slightly weaker bounds are established for arbitrary ensembles. Finally, we investigate correlation matrices involving multi-state fidelities in relation to the Holevo quantity.

  11. High Fidelity Tape Transfer Printing Based On Chemically Induced Adhesive Strength Modulation

    Science.gov (United States)

    Sim, Kyoseung; Chen, Song; Li, Yuhang; Kammoun, Mejdi; Peng, Yun; Xu, Minwei; Gao, Yang; Song, Jizhou; Zhang, Yingchun; Ardebili, Haleh; Yu, Cunjiang

    2015-11-01

    Transfer printing, a two-step process (i.e. picking up and printing) for heterogeneous integration, has been widely exploited for the fabrication of functional electronics system. To ensure a reliable process, strong adhesion for picking up and weak or no adhesion for printing are required. However, it is challenging to meet the requirements of switchable stamp adhesion. Here we introduce a simple, high fidelity process, namely tape transfer printing(TTP), enabled by chemically induced dramatic modulation in tape adhesive strength. We describe the working mechanism of the adhesion modulation that governs this process and demonstrate the method by high fidelity tape transfer printing several types of materials and devices, including Si pellets arrays, photodetector arrays, and electromyography (EMG) sensors, from their preparation substrates to various alien substrates. High fidelity tape transfer printing of components onto curvilinear surfaces is also illustrated.

  12. Scattering approach to fidelity decay in closed systems and parametric level correlations.

    Science.gov (United States)

    Gorin, T; López Vázquez, P C

    2013-07-01

    Based on an exact analytical approach to describe scattering fidelity experiments [Köber et al., Phys. Rev. E 82, 036207 (2010)], we obtain an expression for the fidelity amplitude decay of quantum chaotic or diffusive systems under arbitrary Hermitian perturbations. This allows us to rederive previous separately obtained results in a simpler and unified manner, as is shown explicitly for the case of a global perturbation. The general expression is also used to derive a so far unpublished exact analytical formula for the case of a moving S-wave scatterer. In the second part of the paper, we extend a relation between fidelity decay and parametric level correlations from the universal case of global perturbations to an arbitrary combination of global and local perturbations. Thereby, the relation becomes a versatile tool for the analysis of unknown perturbations.

  13. A critical examination of high-fidelity human patient simulation within the context of nursing pedagogy.

    Science.gov (United States)

    Parker, Brian C; Myrick, Florence

    2009-04-01

    The use of high-fidelity human patient simulators (HPS) have been embraced by nursing education programs in the development of immersive clinical simulations despite the lack of research into a pedagogy or educational philosophy appropriate to guide this technology-based learning tool. In this article, we explore this approach to clinical teaching through a critical examination of the application of behaviorist and constructivist pedagogy to high-fidelity scenario-based simulation sessions. Practical guidelines for developing simulation-based learning sessions that reflect both philosophical paradigms are provided. Consideration is also given to societal trends such as the digital revolution and the incoming millennial generation who represent the aptitude of the modern nursing student to utilize high-fidelity realistic and immersive simulation. Depending on the desired goal of simulator utilization, the nurse educator may want to draw on constructivism or behaviorism or a blend of both educational philosophies to best meet the needs of the adult learner.

  14. Illustrating the multiple facets and levels of fidelity of implementation to a teacher classroom management intervention.

    Science.gov (United States)

    Reinke, Wendy M; Herman, Keith C; Stormont, Melissa; Newcomer, Lori; David, Kimberly

    2013-11-01

    Many school-based interventions to promote student mental health rely on teachers as implementers. Thus, understanding the interplay between the multiple domains of fidelity to the intervention and intervention support systems such as coaching and teacher implementation of new skills is an important aspect of implementation science. This study describes a systematic process for assessing multiple domains of fidelity. Data from a larger efficacy trial of the Incredible Years Teacher Classroom Management (IY TCM) program are utilized. Data on fidelity to the IY TCM workshop training sessions and onsite weekly coaching indicate that workshop leaders and the IY TCM coach implemented the training and coaching model with adequate adherence. Further, workshop leaders' ratings of engagement were associated with teacher implementation of specific praise, following training on this content. Lastly, the IY TCM coach differentiation of teacher exposure to coaching was evaluated and found to be associated with teacher implementation of classroom management practices and student disruptive behavior.

  15. Integrating the Electronic Health Record into high-fidelity interprofessional intensive care unit simulations.

    Science.gov (United States)

    Gold, Jeffrey A; Tutsch, Alycia S R; Gorsuch, Adriel; Mohan, Vishnu

    2015-01-01

    With the rapid adoption of electronic health records (EHR), there is a growing appreciation for the central role they play in clinical decision making and team communication, with many studies documenting new safety issues with integration of the EHR into the clinical enterprise. To study these issues, we created a high-fidelity simulation instance of our clinical EHR. In this paper, we describe the impact of integrating the EHR into high-fidelity, interprofessional intensive care unit (ICU) simulations, and the errors induced. We found a number of safety issues directly related to the EHR including alert fatigue, negative impacts on interprofessional communication, and problems with selective data gathering, and these issues were present for all members of the interprofessional team. Through successful integration of the EHR into high-fidelity team-based simulations, we now have an infrastructure to focus educational initiative and deploy informatics solutions to mitigate these safety issues.

  16. Bacterial global regulators DksA/ppGpp increase fidelity of transcription.

    Science.gov (United States)

    Roghanian, Mohammad; Zenkin, Nikolay; Yuzenkova, Yulia

    2015-02-18

    Collisions between paused transcription elongation complexes and replication forks inevitably happen, which may lead to collapse of replication fork and could be detrimental to cells. Bacterial transcription factor DksA and its cofactor alarmone ppGpp were proposed to contribute to prevention of such collisions, although the mechanism of this activity remains elusive. Here we show that DksA/ppGpp do not destabilise transcription elongation complexes or inhibit their backtracking, as was proposed earlier. Instead, we show, both in vitro and in vivo, that DksA/ppGpp increase fidelity of transcription elongation by slowing down misincorporation events. As misincorporation events cause temporary pauses, contribution to fidelity suggests the mechanism by which DksA/ppGpp contribute to prevention of collisions of transcription elongation complexes with replication forks. DksA is only the second known accessory factor, after transcription factor Gre, that increases fidelity of RNA synthesis in bacteria.

  17. A quantum fidelity study of the anisotropic next-nearest-neighbour triangular lattice Heisenberg model.

    Science.gov (United States)

    Thesberg, Mischa; Sørensen, Erik S

    2014-10-22

    Ground- and excited-state quantum fidelities in combination with generalized quantum fidelity susceptibilites, obtained from exact diagonalizations, are used to explore the phase diagram of the anisotropic next-nearest-neighbour triangular Heisenberg model. Specifically, the J'-J2 plane of this model, which connects the J1-J2 chain and the anisotropic triangular lattice Heisenberg model, is explored using these quantities. Through the use of a quantum fidelity associated with the first excited-state, in addition to the conventional ground-state fidelity, the BKT-type transition and Majumdar-Ghosh point of the J1-J2 chain (J'=0) are found to extend into the J'-J2 plane and connect with points on the J2=0 axis thereby forming bounded regions in the phase diagram. These bounded regions are then explored through the generalized quantum fidelity susceptibilities χρ, χ₁₂₀°, χD and χCAF which are associated with the spin stiffness, 120° spiral order parameter, dimer order parameter and collinear antiferromagnetic order parameter respectively. These quantities are believed to be extremely sensitive to the underlying phase and are thus well suited for finite-size studies. Analysis of the fidelity susceptibilities suggests that the J', J2≪J phase of the anisotropic triangular model is either a collinear antiferromagnet or possibly a gapless disordered phase that is directly connected to the Luttinger phase of the J1-J2 chain. Furthermore, the outer region is dominated by incommensurate spiral physics as well as dimer order.

  18. Contig sequences and their annotation (amino acid sequence and results of homology search), and expression profile - Dicty_cDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available Dicty_cDB Contig sequences and their annotation (amino acid sequence and results of homology search), and express...s of homology search), and expression profile Description of data contents Contig...o acid sequence and results of homology search), and expression profile - Dicty_cDB | LSDB Archive ...

  19. On the Fidelity of “CORK” Borehole Hydrologic Observatory Pressure Records

    Directory of Open Access Journals (Sweden)

    Keir Becker

    2007-09-01

    Full Text Available Long-term formation pressure monitoring in Ocean Drilling Program (ODP and Integrated Ocean Drilling Program (IODP boreholes using evolving Circulation Obviation Retrofit Kit (CORK hydrologic observatory technology has led to unanticipated applications as a result of the growing duration of recording intervals and the improvement of measurement fidelity. Current capabilities provide geologically meaningful observations over a broad range of time scales from static state to 1 Hz, allowing investigations of many coupled hydrologic, geodynamic, and seismologic phenomena. In this review, we present observations that provide constraints on current limits to recording fidelity, and examples of how leakage can affect pressure observations.

  20. Implementing a high-fidelity simulation program in a community college setting.

    Science.gov (United States)

    Tuoriniemi, Pamela; Schott-Baer, Darlene

    2008-01-01

    Despite their relatively high cost, there is heightened interest by faculty in undergraduate nursing programs to implement high-fidelity simulation (HFS) programs. High-fidelity simulators are appealing because they allow students to experience high-risk, low-volume patient problems in a realistic setting. The decision to purchase a simulator is the first step in the process of implementing and maintaining an HFS lab. Knowledge, technical skill, commitment, and considerable time are needed to develop a successful program. The process, as experienced by one community college nursing program, is described.