Kinetics of Cellulose Digestion by Fibrobacter succinogenes S85
Maglione, G.; Russell, J. B.; Wilson, D. B.
1997-01-01
Growing cultures of Fibrobacter succinogenes S85 digested cellulose at a rapid rate, but nongrowing cells and cell extracts did not have detectable crystalline cellulase activity. Cells that had been growing exponentially on cellobiose initiated cellulose digestion and succinate production immediately, and cellulose-dependent succinate production could be used as an index of enzyme activity against crystalline cellulose. Cells incubated with cellulose never produced detectable cellobiose, and...
Diauxic growth of Fibrobacter succinogenes S85 on cellobiose and lactose.
Ghali, Ines; Sofyan, Ahmad; Ohmori, Hideyuki; Shinkai, Takumi; Mitsumori, Makoto
2017-08-15
Fibrobacter succinogenes rapidly colonizes the preruminant calf rumen and becomes a dominant cellulolytic bacterium in the rumen after weaning. Although F. succinogenes actively degrades cellulose in the rumen, it seems that there is no or little of its substrate, cellulose, in the rumen of preweaned calves. We thus evaluated the ability of F. succinogenes to utilize lactose, a main sugar of milk, with or without the presence of cellobiose. We grew F. succinogenes S85 on media containing 2.5% lactose combined with 0%-0.2% cellobiose or a medium with 0.2% cellobiose but without lactose. The generation times on the 0.2% cellobiose medium and the 2.5% lactose medium were 1.9 and 16.2 h, respectively. The bacterium showed rapid growth on cellobiose and diauxic growth on the lactose media containing 0.05%-0.2% cellobiose. Moreover, the production of β-galactosidase was low in the presence of 0.1%-0.2% cellobiose. Since the β-galactosidase contained a signal peptide and a Por secretion system C-terminal sorting domain, we speculate that the β-galactosidase would be secreted from the bacterial cells by the Por secretion system. Our data indicate the possibility that F. succinogenes could colonize preruminant calf rumen, consuming the lactose present in cow milk. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Garret Suen
Full Text Available Fibrobacter succinogenes is an important member of the rumen microbial community that converts plant biomass into nutrients usable by its host. This bacterium, which is also one of only two cultivated species in its phylum, is an efficient and prolific degrader of cellulose. Specifically, it has a particularly high activity against crystalline cellulose that requires close physical contact with this substrate. However, unlike other known cellulolytic microbes, it does not degrade cellulose using a cellulosome or by producing high extracellular titers of cellulase enzymes. To better understand the biology of F. succinogenes, we sequenced the genome of the type strain S85 to completion. A total of 3,085 open reading frames were predicted from its 3.84 Mbp genome. Analysis of sequences predicted to encode for carbohydrate-degrading enzymes revealed an unusually high number of genes that were classified into 49 different families of glycoside hydrolases, carbohydrate binding modules (CBMs, carbohydrate esterases, and polysaccharide lyases. Of the 31 identified cellulases, none contain CBMs in families 1, 2, and 3, typically associated with crystalline cellulose degradation. Polysaccharide hydrolysis and utilization assays showed that F. succinogenes was able to hydrolyze a number of polysaccharides, but could only utilize the hydrolytic products of cellulose. This suggests that F. succinogenes uses its array of hemicellulose-degrading enzymes to remove hemicelluloses to gain access to cellulose. This is reflected in its genome, as F. succinogenes lacks many of the genes necessary to transport and metabolize the hydrolytic products of non-cellulose polysaccharides. The F. succinogenes genome reveals a bacterium that specializes in cellulose as its sole energy source, and provides insight into a novel strategy for cellulose degradation.
Li, Qiang; Siles, Jose A; Thompson, Ian P
2010-10-01
Succinic acid is a platform molecule that has recently generated considerable interests. Production of succinate from waste orange peel and wheat straw by consolidated bioprocessing that combines cellulose hydrolysis and sugar fermentation, using a cellulolytic bacterium, Fibrobacter succinogenes S85, was studied. Orange peel contains D-limonene, which is a well-known antibacterial agent. Its effects on batch cultures of F. succinogenes S85 were examined. The minimal concentrations of limonene found to inhibit succinate and acetate generation and bacterial growth were 0.01%, 0.1%, and 0.06% (v/v), respectively. Both pre-treated orange peel by steam distillation to remove D: -limonene and intact wheat straw were used as feedstocks. Increasing the substrate concentrations of both feedstocks, from 5 to 60 g/L, elevated succinate concentration and productivity but lowered the yield. In addition, pre-treated orange peel generated greater succinate productivities than wheat straw but had similar resultant titres. The greatest succinate titres were 1.9 and 2.0 g/L for pre-treated orange peel and wheat straw, respectively. This work demonstrated that agricultural waste such as wheat straw and orange peel can be biotransformed to succinic acid by a one-step consolidated bioprocessing. Measures to increase fermentation efficiency are also discussed.
Guiavarch, Erell; Pons, Agnes; Creuly, Catherine; Dussap, Claude-Gilles
2008-12-01
Fibrobacter succinogenes S85, a strictly anaerobic Gram-negative bacterium, was grown in continuous culture in a bioreactor at different dilution rates (0.02 to 0.092 h(-1)) on a fully synthetic culture medium with glucose as carbon source. Glucose and ammonium sulfate consumption, as well as biomass, succinate, acetate, formate, and carbohydrate production were regularly measured. The relevant biomass elemental compositions were established for each dilution rate. Robustness of the experimental information was checked by C and N mass balances estimation, which were satisfactory. A detailed overall stoichiometry analysis of the process, including all substrates and products of the culture, was proposed. Online and off-line parameters measured during the culture brought a large number of data which were weighted by their respective variance associated to the measured value. The material balance resulted in an overdetermined linear system of equations made of weighted relationships including experimental data, elemental balances (C, H, O, N, S, Na), and an additional constraint. The mass balances involved in stoichiometric equations were solved using data reconciliation and linear algebra methods to take into account error measurements. This methodology allowed to establish the overall stoichiometric equation for each dilution rate studied.
Lissens, Geert; Verstraete, Willy; Albrecht, Tobias; Brunner, Gerd; Creuly, Catherine; Seon, Jerome; Dussap, Gilles; Lasseur, Christophe
2004-06-01
The feasibility of nearly-complete conversion of lignocellulosic waste (70% food crops, 20% faecal matter and 10% green algae) into biogas was investigated in the context of a life support project. The treatment comprised a series of processes, i.e., a mesophilic laboratory scale CSTR (continuously stirred tank reactor), an upflow biofilm reactor, a fiber liquefaction reactor employing the rumen bacterium Fibrobacter succinogenes and a hydrothermolysis system in near-critical water. By the one-stage CSTR, a biogas yield of 75% with a specific biogas production of 0.37 l biogas g(-1) VSS (volatile suspended solids) added at a RT (hydraulic retention time) of 20-25 d was obtained. Biogas yields could not be increased considerably at higher RT, indicating the depletion of readily available substrate after 25 d. The solids present in the CSTR-effluent were subsequently treated in two ways. Hydrothermal treatment (T approximately 310-350 degrees C, p approximately 240 bar) resulted in effective carbon liquefaction (50-60% without and 83% with carbon dioxide saturation) and complete sanitation of the residue. Application of the cellulolytic Fibrobacter succinogenes converted remaining cellulose contained in the CSTR-effluent into acetate and propionate mainly. Subsequent anaerobic digestion of the hydrothermolysis and the Fibrobacter hydrolysates allowed conversion of 48-60% and 30%, respectively. Thus, the total process yielded biogas corresponding with conversions up to 90% of the original organic matter. It appears that particularly mesophilic digestion in conjunction with hydrothermolysis at near-critical conditions offers interesting features for (nearly) complete and hygienic carbon and energy recovery from human waste in a bioregenerative life support context.
Degradation of lucerne stem cell walls by five rumen bacterial species
Jung, H.G.; Engels, F.M.; Weimer, P.J.
2004-01-01
The rumen bacterial strains Butyrivibrio fibrisolvens H17c, Fibrobacter succinogenes S85, Lachnospira multiparus 40, Ruminococcus albus 7 and R. flavefaciens FD-1 were compared individually and as a five-species mixture with a rumen inoculum for their ability to degrade lucerne (Medicago sativa L.)
Čater, Maša; Fanedl, Lijana; Malovrh, Špela; Marinšek Logar, Romana
2015-06-01
Lignocellulosic substrates are widely available but not easily applied in biogas production due to their poor anaerobic degradation. The effect of bioaugmentation by anaerobic hydrolytic bacteria on biogas production was determined by the biochemical methane potential assay. Microbial biomass from full scale upflow anaerobic sludge blanket reactor treating brewery wastewater was a source of active microorganisms and brewery spent grain a model lignocellulosic substrate. Ruminococcus flavefaciens 007C, Pseudobutyrivibrio xylanivorans Mz5(T), Fibrobacter succinogenes S85 and Clostridium cellulovorans as pure and mixed cultures were used to enhance the lignocellulose degradation and elevate the biogas production. P. xylanivorans Mz5(T) was the most successful in elevating methane production (+17.8%), followed by the coculture of P. xylanivorans Mz5(T) and F. succinogenes S85 (+6.9%) and the coculture of C. cellulovorans and F. succinogenes S85 (+4.9%). Changes in microbial community structure were detected by fingerprinting techniques. Copyright © 2015 Elsevier Ltd. All rights reserved.
McDonald, James E; Houghton, James N I; Rooks, David J; Allison, Heather E; McCarthy, Alan J
2012-04-01
Cellulose is reputedly the most abundant organic polymer in the biosphere, yet despite the fundamental role of cellulolytic microorganisms in global carbon cycling and as potential sources of novel enzymes for biotechnology, their identity and ecology is not well established. Cellulose is a major component of landfill waste and its degradation is therefore a key feature of the anaerobic microbial decomposition process. Here, we targeted a number of taxa containing known cellulolytic anaerobes (members of the bacterial genus Fibrobacter, lineages of Clostridium clusters I, III, IV and XIV, and anaerobic fungi of the Neocallimastigales) in landfill leachate and colonized cellulose 'baits' via PCR and quantitative PCR (qPCR). Fibrobacter spp. and Clostridium clusters III, IV and XIV were detected in almost all leachate samples and cluster III and XIV clostridia were the most abundant (1-6% and 1-17% of total bacterial 16S rRNA gene copies respectively). Two landfill leachate microcosms were constructed to specifically assess those microbial communities that colonize and degrade cellulose substrates in situ. Scanning electron microscopy (SEM) of colonized cotton revealed extensive cellulose degradation in one microcosm, and Fibrobacter spp. and Clostridium cluster III represented 29% and 17%, respectively, of total bacterial 16S rRNA gene copies in the biofilm. Visible cellulose degradation was not observed in the second microcosm, and this correlated with negligible relative abundances of Clostridium cluster III and Fibrobacter spp. (≤ 0.1%), providing the first evidence that the novel fibrobacters recently detected in landfill sites and other non-gut environments colonize and degrade cellulose substrates in situ. © 2012 Society for Applied Microbiology and Blackwell Publishing Ltd.
Magnesium requirement of some of the principal rumen cellulolytic bacteria.
Morales, M S; Dehority, B A
2014-09-01
Information available on the role of Mg for growth and cellulose degradation by rumen bacteria is both limited and inconsistent. In this study, the Mg requirements for two strains each of the cellulolytic rumen species Fibrobacter succinogenes (A3c and S85), Ruminococcus albus (7 and 8) and Ruminococcus flavefaciens (B34b and C94) were investigated. Maximum growth, rate of growth and lag time were all measured using a complete factorial design, 2(3)×6; factors were: strains (2), within species (3) and Mg concentrations (6). R. flavefaciens was the only species that did not grow when Mg was singly deleted from the media, and both strains exhibited a linear growth response to increasing Mg concentrations (PR. flavefaciens B34b was estimated as 0.54 mM; whereas the requirement for R. flavefaciens C94 was >0.82 as there was no plateau in growth. Although not an absolute requirement for growth, strains of the two other species of cellulolytic bacteria all responded to increasing Mg concentrations. For F. succinogenes S85, R. albus 7 and R. albus 8, their requirement estimated from maximum growth was 0.56, 0.52 and 0.51, respectively. A requirement for F. succinogenes A3c could not be calculated because there was no solution for contrasts. Whether R. flavefaciens had a Mg requirement for cellulose degradation was determined in NH3-free cellulose media, using a 2×4 factorial design, 2 strains and 4 treatments. Both strains of R. flavefaciens were found to have an absolute Mg requirement for cellulose degradation. Based on reported concentrations of Mg in the rumen, 1.0 to 10.1 mM, it seems unlikely that an in vivo deficiency of this element would occur.
Production and consumption of nitrous oxide in nitrate-ammonifying Wolinella succinogenes cells.
Luckmann, Monique; Mania, Daniel; Kern, Melanie; Bakken, Lars R; Frostegård, Asa; Simon, Jörg
2014-08-01
Global warming is moving more and more into the public consciousness. Besides the commonly mentioned carbon dioxide and methane, nitrous oxide (N2O) is a powerful greenhouse gas in addition to its contribution to depletion of stratospheric ozone. The increasing concern about N2O emission has focused interest on underlying microbial energy-converting processes and organisms harbouring N2O reductase (NosZ), such as denitrifiers and ammonifiers of nitrate and nitrite. Here, the epsilonproteobacterial model organism Wolinella succinogenes is investigated with regard to its capacity to produce and consume N2O during growth by anaerobic nitrate ammonification. This organism synthesizes an unconventional cytochrome c nitrous oxide reductase (cNosZ), which is encoded by the first gene of an atypical nos gene cluster. However, W. succinogenes lacks a nitric oxide (NO)-producing nitrite reductase of the NirS- or NirK-type as well as an NO reductase of the Nor-type. Using a robotized incubation system, the wild-type strain and suitable mutants of W. succinogenes that either produced or lacked cNosZ were analysed as to their production of NO, N2O and N2 in both nitrate-sufficient and nitrate-limited growth medium using formate as electron donor. It was found that cells growing in nitrate-sufficient medium produced small amounts of N2O, which derived from nitrite and, most likely, from the presence of NO. Furthermore, cells employing cNosZ were able to reduce N2O to N2. This reaction, which was fully inhibited by acetylene, was also observed after adding N2O to the culture headspace. The results indicate that W. succinogenes cells are competent in N2O and N2 production despite being correctly grouped as respiratory nitrate ammonifiers. N2O production is assumed to result from NO detoxification and nitrosative stress defence, while N2O serves as a terminal electron acceptor in anaerobic respiration. The ecological implications of these findings are discussed. © 2014 The Authors.
Degradation of plant wastes by anaerobic process using rumen bacteria.
Seon, J; Creuly, C; Duchez, D; Pons, A; Dussap, C G
2003-01-01
An operational reactor has been designed for the fermentation of a pure culture of Fibrobacter succinogenes with the constraints of strict anaerobic condition. The process is controlled by measurements of pH, redox, temperature and CO2 pressure; it allows an efficient degradation (67%) of lignocellulosic wastes such as a mixture of wheat straw, soya bean cake and green cabbage.
Succinic acid production from acid hydrolysate of corn fiber by Actinobacillus succinogenes.
Chen, Kequan; Jiang, Min; Wei, Ping; Yao, Jiaming; Wu, Hao
2010-01-01
Dilute acid hydrolysate of corn fiber was used as carbon source for the production of succinic acid by Actinobacillus succinogenes NJ113. The optimized hydrolysis conditions were obtained by orthogonal experiments. When corn fiber particles were of 20 mesh in size and treated with 1.0% sulfuric acid at 121 degrees C for 2 h, the total sugar yield could reach 63.3%. It was found that CaCO(3) neutralization combined with activated carbon adsorption was an effective method to remove fermentation inhibitors especially furfural that presented in the acid hydrolysate of corn fiber. Only 5.2% of the total sugar was lost, while 91.9% of furfural was removed. The yield of succinic acid was higher than 72.0% with the detoxified corn fiber hydrolysate as the carbon source in anaerobic bottles or 7.5 L fermentor cultures. It was proved that the corn fiber hydrolysate could be an alternative to glucose for the production of succinic acid by A. succinogenes NJ113.
Advanced anaerobic bioconversion of lignocellulosic waste for the melissa life support system
Lissens, G.; Verstraete, W.; Albrecht, T.; Brunner, G.; Creuly, C.; Dussap, G.; Kube, J.; Maerkl, H.; Lasseur, C.
The feasibility of nearly-complete conversion of lignocellulosic waste (70% food crops, 20% faecal matter and 10% green algae) into biogas was investigated in the context of the MELiSSA loop (Micro-Ecological Life Support System Alternative). The treatment comprised a series of processes, i.e. a mesophilic laboratory scale CSTR (continuously stirred tank reactor), an upflow biofilm reactor, a fiber liquefaction reactor employing the rumen bacterium Fibrobacter succinogenes and a hydrothermolysis system in near-critical water. By the one-stage CSTR, a biogas yield of 75% with a specific biogas production of 0.37 l biogas g-1 VSS (volatile suspended solids) added at a RT (hydraulic retention time) of 20-25 d was obtained. Biogas yields could not be increased considerably at higher RT, indicating the depletion of readily available substrate after 25 d. The solids present in the CSTR-effluent were subsequently treated in two ways. Hydrothermal treatment (T ˜ 310-350C, p ˜ 240 bar) resulted in effective carbon liquefaction (50-60% without and 83% with carbon dioxide saturation) and complete sanitation of the residue. Application of the cellulolytic Fibrobacter succinogenes converted remaining cellulose contained in the CSTR-effluent into acetate and propionate mainly. Subsequent anaerobic digestion of the hydrothermolysis and the Fibrobacter hydrolysates allowed conversion of 48-60% and 30%, respectively. Thus, the total process yielded biogas corresponding with conversions up to 90% of the original organic matter. It appears that particularly mesophilic digestion in conjunction with hydrothermolysis offers interesting features for (nearly) the MELiSSA system. The described additional technologies show that complete and hygienic carbon and energy recovery from human waste within MELiSSA is technically feasible, provided that the extra energy needed for the thermal treatment is guaranteed.
Corona-González, Rosa Isela; Varela-Almanza, Karla María; Arriola-Guevara, Enrique; Martínez-Gómez, Álvaro de Jesús; Pelayo-Ortiz, Carlos; Toriz, Guillermo
2016-04-01
The aim of this work was to obtain fermentable sugars by enzymatic or acid hydrolyses of Agave tequilana Weber bagasse in order to produce succinic acid with Actinobacillus succinogenes. Hydrolyses were carried out with mineral acids (sulfuric and hydrochloric acids) or a commercial cellulolytic enzyme, and were optimized statistically by a response surface methodology, having as factors the concentration of acid/enzyme and time of hydrolysis. The concentration of sugars obtained at optimal conditions for each hydrolysis were 21.7, 22.4y 19.8g/L for H2SO4, HCl and the enzymatic preparation respectively. Concerning succinic acid production, the enzymatic hydrolyzates resulted in the highest yield (0.446g/g) and productivity (0.57g/Lh) using A. succinogenes in a batch reactor system. Repeated batch fermentation with immobilized A. succinogenes in agar and with the enzymatic hydrolyzates resulted in a maximum concentration of succinic acid of 33.6g/L from 87.2g/L monosaccharides after 5 cycles in 40h, obtaining a productivity of 1.32g/Lh. Copyright © 2016. Published by Elsevier Ltd.
Yang, Zhuona; Jiang, Min; Li, Jian; Fang, Xiaojiang; Ye, Guizi; Bai, Xuefei; Zheng, Xiaoyu; Wei, Ping
2010-11-01
Different neutralizing agents were used as pH controller to investigate their effects on the growth and succinic acid production of Actinobacillus succinogenes NJ113. The fermentation results showed that Ca(OH)2, CaCO3 and NH4OH were not suitable for succinic acid production by A. succinogenes NJ113 because of their negative effects on cell growth. When Na-base was used, cells would flocculate and lump, and due to the sodium ion concentration reaching to a high level, OD660 dropped sharply after 12 h of fermentation. Mg-base was better because there was no significant inhibition by magnesium ion. Two combined neutralizing agents were used to maintain pH level, one with NaOH and Mg(OH)2 while the other with Na2CO3 and Mg(OH)2. The optimum ratios of the combined neutralizing agents were both 1:1 (g:g) when using 100 g/L glucose. When NaOH and Mg(OH)2 were chosen with the ratio of 1:1(g:g), 69.8 g/L of the succinic acid and 74.5% of the yield was obtained.
Carberry, Ciara A; Kenny, David A; Han, Sukkyan; McCabe, Matthew S; Waters, Sinead M
2012-07-01
Feed-efficient animals have lower production costs and reduced environmental impact. Given that rumen microbial fermentation plays a pivotal role in host nutrition, the premise that rumen microbiota may contribute to host feed efficiency is gaining momentum. Since diet is a major factor in determining rumen community structure and fermentation patterns, we investigated the effect of divergence in phenotypic residual feed intake (RFI) on ruminal community structure of beef cattle across two contrasting diets. PCR-denaturing gradient gel electrophoresis (DGGE) and quantitative PCR (qPCR) were performed to profile the rumen bacterial population and to quantify the ruminal populations of Entodinium spp., protozoa, Fibrobacter succinogenes, Ruminococcus flavefaciens, Ruminococcus albus, Prevotella brevis, the genus Prevotella, and fungi in 14 low (efficient)- and 14 high (inefficient)-RFI animals offered a low-energy, high-forage diet, followed by a high-energy, low-forage diet. Canonical correspondence and Spearman correlation analyses were used to investigate associations between physiological variables and rumen microbial structure and specific microbial populations, respectively. The effect of RFI on bacterial profiles was influenced by diet, with the association between RFI group and PCR-DGGE profiles stronger for the higher forage diet. qPCR showed that Prevotella abundance was higher (P < 0.0001) in inefficient animals. A higher (P < 0.0001) abundance of Entodinium and Prevotella spp. and a lower (P < 0.0001) abundance of Fibrobacter succinogenes were observed when animals were offered the low-forage diet. Thus, differences in the ruminal microflora may contribute to host feed efficiency, although this effect may also be modulated by the diet offered.
Directory of Open Access Journals (Sweden)
Sophie Comtet-Marre
2018-02-01
Full Text Available Ruminants fulfill their energy needs for growth primarily through microbial breakdown of plant biomass in the rumen. Several biotic and abiotic factors influence the efficiency of fiber degradation, which can ultimately impact animal productivity and health. To provide more insight into mechanisms involved in the modulation of fibrolytic activity, a functional DNA microarray targeting genes encoding key enzymes involved in cellulose and hemicellulose degradation by rumen microbiota was designed. Eight carbohydrate-active enzyme (CAZyme families (GH5, GH9, GH10, GH11, GH43, GH48, CE1, and CE6 were selected which represented 392 genes from bacteria, protozoa, and fungi. The DNA microarray, designated as FibroChip, was validated using targets of increasing complexity and demonstrated sensitivity and specificity. In addition, FibroChip was evaluated for its explorative and semi-quantitative potential. Differential expression of CAZyme genes was evidenced in the rumen bacterium Fibrobacter succinogenes S85 grown on wheat straw or cellobiose. FibroChip was used to identify the expressed CAZyme genes from the targeted families in the rumen of a cow fed a mixed diet based on grass silage. Among expressed genes, those encoding GH43, GH5, and GH10 families were the most represented. Most of the F. succinogenes genes detected by the FibroChip were also detected following RNA-seq analysis of RNA transcripts obtained from the rumen fluid sample. Use of the FibroChip also indicated that transcripts of fiber degrading enzymes derived from eukaryotes (protozoa and anaerobic fungi represented a significant proportion of the total microbial mRNA pool. FibroChip represents a reliable and high-throughput tool that enables researchers to monitor active members of fiber degradation in the rumen.
Comtet-Marre, Sophie; Chaucheyras-Durand, Frédérique; Bouzid, Ourdia; Mosoni, Pascale; Bayat, Ali R; Peyret, Pierre; Forano, Evelyne
2018-01-01
Ruminants fulfill their energy needs for growth primarily through microbial breakdown of plant biomass in the rumen. Several biotic and abiotic factors influence the efficiency of fiber degradation, which can ultimately impact animal productivity and health. To provide more insight into mechanisms involved in the modulation of fibrolytic activity, a functional DNA microarray targeting genes encoding key enzymes involved in cellulose and hemicellulose degradation by rumen microbiota was designed. Eight carbohydrate-active enzyme (CAZyme) families (GH5, GH9, GH10, GH11, GH43, GH48, CE1, and CE6) were selected which represented 392 genes from bacteria, protozoa, and fungi. The DNA microarray, designated as FibroChip, was validated using targets of increasing complexity and demonstrated sensitivity and specificity. In addition, FibroChip was evaluated for its explorative and semi-quantitative potential. Differential expression of CAZyme genes was evidenced in the rumen bacterium Fibrobacter succinogenes S85 grown on wheat straw or cellobiose. FibroChip was used to identify the expressed CAZyme genes from the targeted families in the rumen of a cow fed a mixed diet based on grass silage. Among expressed genes, those encoding GH43, GH5, and GH10 families were the most represented. Most of the F. succinogenes genes detected by the FibroChip were also detected following RNA-seq analysis of RNA transcripts obtained from the rumen fluid sample. Use of the FibroChip also indicated that transcripts of fiber degrading enzymes derived from eukaryotes (protozoa and anaerobic fungi) represented a significant proportion of the total microbial mRNA pool. FibroChip represents a reliable and high-throughput tool that enables researchers to monitor active members of fiber degradation in the rumen.
Pasma, Satriani Aga; Daik, Rusli; Maskat, Mohamad Yusof
2013-11-01
Succinic acid is a common metabolite in plants, animals and microorganisms. It has been used widely in agricultural, food and pharmaceutical industries. Enzymatic hydrolysate glucose from oil palm empty fruit bunch (OPEFB) cellulose was used as a substrate for succinic acid production using Actinobacillus succinogenes. Using cellulose extraction from OPEFB can enhance the production of glucose as a main substrate for succinic acid production. The highest concentration of glucose produced from enzymatic hydrolysis is 167 mg/mL and the sugar recovery is 0.73 g/g of OPEFB. By optimizing the culture medium for succinic acid fermentation with enzymatic hydrolysate of OPEFB cellulose, the nitrogen sources could be reduced to just only 2.5 g yeast extract and 2.5 g corn step liquor. Batch fermentation was carried out using enzymatic hydrolysate of OPEFB cellulose with yeast extract, corn steep liquor and the salts mixture, 23.5 g/L succinic acid was obtained with consumption of 72 g/L glucose in enzymatic hydrolysate of OPEFB cellulose at 38 hours and 37°C. This study suggests that enzymatic hydrolysate of OPEFB cellulose maybe an alternative substrate for the efficient production of succinic acid by Actinobacillus succinogenes.
A phylogenomic analysis of the bacterial phylum Fibrobacteres
Directory of Open Access Journals (Sweden)
Nurdyana eAbdul Rahman
2016-01-01
Full Text Available The Fibrobacteres has been recognized as a bacterial phylum for over a decade, but little is known about the group beyond its environmental distribution, and characterization of its sole cultured representative genus, Fibrobacter, after which the phylum was named. Based on these incomplete data, it is thought that cellulose hydrolysis, anaerobic metabolism, and lack of motility are unifying features of the phylum. There are also contradicting views as to whether an uncultured sister lineage, candidate phylum TG3, should be included in the Fibrobacteres. Recently, chitin-degrading cultured representatives of TG3 were obtained isolated from a hypersaline soda lake, and the genome of one species, Chitinivibrio alkaliphilus, sequenced and described in detail. Here, we performed a comparative analysis of Fibrobacter succinogenes, C. alkaliphilus and eight near or substantially complete Fibrobacteres/TG3 genomes of environmental populations recovered from termite gut, anaerobic digester, and sheep rumen metagenomes. We propose that TG3 should be amalgamated with the Fibrobacteres phylum based on robust monophyly of the two lineages and shared character traits. Polymer hydrolysis, using a distinctive set of glycoside hydrolases and binding domains, appears to be a prominent feature of members of the Fibrobacteres. Not all members of this phylum are strictly anaerobic as some termite gut Fibrobacteres have respiratory chains adapted to the microaerophilic conditions found in this habitat. Contrary to expectations, motility is is predicted to be an ancestral and common trait in this phylum and has only recently been lost in F. succinogenes and its relatives based on phylogenetic distribution of flagellar genes. Our findings extend current understanding of the Fibrobacteres and provide an improved basis for further investigation of this phylum.
Diet-dependent modular dynamic interactions of the equine cecal microbiota
DEFF Research Database (Denmark)
Kristoffersen, Camilla; Jensen, Rasmus Bovbjerg; Avershina, Ekaterina
2016-01-01
Knowledge on dynamic interactions in microbiota is pivotal for understanding the role of bacteria in the gut. We herein present comprehensive dynamic models of the horse cecal microbiota, which include short-chained fatty acids, carbohydrate metabolic networks, and taxonomy. Dynamic models were...... diets. We observed marked differences in the microbial dynamic interaction patterns for Fibrobacter succinogenes, Lachnospiraceae, Streptococcus, Treponema, Anaerostipes, and Anaerovibrio between the two diet groups. Fluctuations and microbiota interactions were the most pronounced for the starch rich...... sugars for the starch-rich diet and monosaccharides for the fiber-rich diet. In conclusion, diet may not only affect the composition of the cecal microbiota, but also dynamic interactions and metabolic cross-feeding....
Detection of fiber-digesting bacteria in the forestomach contents of llamas (Lama glama by PCR
Directory of Open Access Journals (Sweden)
María E Cerón Cucchi
Full Text Available The high fibrolytic activity and large biomass of strictly-anaerobic bacteria that inhabit the rumen makes them primarily responsible for the degradation of the forage consumed by ruminants. Llamas feed mainly on low quality fibrous roughages that are digested by an active and diverse microflora. The products of this fermentation are volatile fatty acids and microbial biomass, which will be used by the animals. The aim of this study was to detect the three major fiber-digesting anaerobic bacteria in the forestomach contents of llamas by PCR. In this study, we detected Ruminococcus albus, Ruminococcus flavefaciens and Fibrobacter succinogenes in the forestomach contents of eight native llamas from Argentina.
Chen, Ke-Quan; Li, Jian; Ma, Jiang-Feng; Jiang, Min; Wei, Ping; Liu, Zhong-Min; Ying, Han-Jie
2011-01-01
The enzymatic hydrolysate of spent yeast cells was evaluated as a nitrogen source for succinic acid production by Actinobacillus succinogenes NJ113, using corn fiber hydrolysate as a carbon source. When spent yeast cell hydrolysate was used directly as a nitrogen source, a maximum succinic acid concentration of 35.5 g/l was obtained from a glucose concentration of 50 g/l, with a glucose utilization of 95.2%. Supplementation with individual vitamins showed that biotin was the most likely factor to be limiting for succinic acid production with spent yeast cell hydrolysate. After supplementing spent yeast cell hydrolysate and 90 g/l of glucose with 150 μg/l of biotin, cell growth increased 32.5%, glucose utilization increased 37.6%, and succinic acid concentration was enhanced 49.0%. As a result, when biotin-supplemented spent yeast cell hydrolysate was used with corn fiber hydrolysate, a succinic acid yield of 67.7% was obtained from 70.3 g/l of total sugar concentration, with a productivity of 0.63 g/(l h). Our results suggest that biotin-supplemented spent yeast cell hydrolysate may be an alternative nitrogen source for the efficient production of succinic acid by A. succinogenes NJ113, using renewable resources. Crown Copyright © 2010. Published by Elsevier Ltd. All rights reserved.
Denman, Stuart E; McSweeney, Christopher S
2006-12-01
Traditional methods for enumerating and identifying microbial populations within the rumen can be time consuming and cumbersome. Methods that involve culturing and microscopy can also be inconclusive, particularly when studying anaerobic rumen fungi. A real-time PCR SYBR Green assay, using PCR primers to target total rumen fungi and the cellulolytic bacteria Ruminococcus flavefaciens and Fibrobacter succinogenes, is described, including design and validation. The DNA and crude protein contents with respect to the fungal biomass of both polycentric and monocentric fungal isolates were investigated across the fungal growth stages to aid in standard curve generation. The primer sets used were found to be target specific with no detectable cross-reactivity. Subsequently, the real-time PCR assay was employed in a study to detect these populations within cattle rumen. The anaerobic fungal target was observed to increase 3.6-fold from 0 to 12 h after feeding. The results also indicated a 5.4-fold increase in F. succinogenes target between 0 and 12 h after feeding, whereas R. flavefaciens was observed to maintain more or less consistent levels. This is the first report of a real-time PCR assay to estimate the rumen anaerobic fungal population.
Lee, Shin Ja; Shin, Nyeon Hak; Jeong, Jin Suk; Kim, Eun Tae; Lee, Su Kyoung; Lee, Sung Sill
2018-01-01
Due to the threat of global warming, the livestock industry is increasingly interested in exploring how feed additives may reduce anthropogenic greenhouse gas emissions, especially from ruminants. This study investigated the effect of Rhodophyta supplemented bovine diets on in vitro rumen fermentation and rumen microbial diversity. Cannulated Holstein cows were used as rumen fluid donors. Rumen fluid:buffer (1:2; 15 mL) solution was incubated for up to 72 h in six treatments: a control (timothy hay only), along with substrates containing 5% extracts from five Rhodophyta species ( Grateloupia lanceolata [Okamura] Kawaguchi, Hypnea japonica Tanaka, Pterocladia capillacea [Gmelin] Bornet, Chondria crassicaulis Harvey, or Gelidium amansii [Lam.] Lamouroux). Compared with control, Rhodophyta extracts increased cumulative gas production after 24 and 72 h (p = 0.0297 and p = 0.0047). The extracts reduced methane emission at 12 and 24 h (p<0.05). In particular, real-time polymerase chain reaction analysis indicated that at 24 h, ciliate-associated methanogens, Ruminococcus albus and Ruminococcus flavefaciens decreased at 24 h (p = 0.0002, p<0.0001, and p<0.0001), while Fibrobacter succinogenes ( F. succinogenes ) increased (p = 0.0004). Additionally, Rhodophyta extracts improved acetate concentration at 12 and 24 h (p = 0.0766 and p = 0.0132), as well as acetate/propionate (A/P) ratio at 6 and 12 h (p = 0.0106 and p = 0.0278). Rhodophyta extracts are a viable additive that can improve ruminant growth performance (higher total gas production, lower A/P ratio) and methane abatement (less ciliate-associated methanogens, Ruminococcus albus and Ruminococcus flavefaciens and more F. succinogenes .
Directory of Open Access Journals (Sweden)
Savinska L. O.
2015-08-01
Full Text Available Aim. Generation of polyclonal antibodies specific to the ribosomal protein S6 kinase isoform – p85S6K1 and directed to the N-terminal (1–23 aa extension of p85S6K1. Methods. Animal immunization with synthetic (1–23 aa peptide, ELISA, Western blot, Immunoprecipitation, immunofluorescent analysis. Results. Polyclonal antibodies have been generated, which specifically recognize only p85 but not p70 isoform of S6K1 in western blot, immunoprecipitation and immunofluorescence analysis. Conclusions. The obtained antibodies can be recommended for studies on the p85S6K1 and other S6K1 isoforms possessing the N-terminal extension – the identification of binding protein partners, analysis of subcellular localization under different physiological conditions, elucidation of the signal transduction pathways involving different S6K1 isoforms.
McSweeney, C S; Denman, S E
2007-11-01
To examine the effect of sulfur-containing compounds on the growth of anaerobic rumen fungi and the fibrolytic rumen bacteria Ruminococcus albus, Ruminococcus flavefaciens and Fibrobacter succinogenes in pure culture and within the cattle rumen. The effect of two reduced sulfur compounds, 3-mercaptopropionic acid (MPA) or 3-mercapto-1-propanesulfonic acid as the sole S source on growth of pure fibroyltic fungal and bacterial cultures showed that these compounds were capable of sustaining growth. An in vivo trial was then conducted to determine the effect of sulfur supplements (MPA and sodium sulfate) on microbial population dynamics in cattle fed the roughage Dichanthium aristatum. Real-time PCR showed significant increases in fibrolytic bacterial and fungal populations when cattle were supplemented with these compounds. Sulfate supplementation leads to an increase in dry matter intake without a change in whole tract dry matter digestibility. Supplementation of low S-containing diets with either sodium sulfate or MPA stimulates microbial growth with an increase in rumen microbial protein supply to the animal. Through the use of real-time PCR monitoring, a better understanding of the effect of S supplementation on discrete microbial populations within the rumen is provided.
Directory of Open Access Journals (Sweden)
Melanie B Lengowski
Full Text Available This study examined ruminal microbial community composition alterations during initial adaption to and following incubation in a rumen simulation system (Rusitec using grass or corn silage as substrates. Samples were collected from fermenter liquids at 0, 2, 4, 12, 24, and 48 h and from feed residues at 0, 24, and 48 h after initiation of incubation (period 1 and on day 13 (period 2. Microbial DNA was extracted and real-time qPCR was used to quantify differences in the abundance of protozoa, methanogens, total bacteria, Fibrobacter succinogenes, Ruminococcus albus, Ruminobacter amylophilus, Prevotella bryantii, Selenomonas ruminantium, and Clostridium aminophilum. We found that forage source and sampling time significantly influenced the ruminal microbial community. The gene copy numbers of most microbial species (except C. aminophilum decreased in period 1; however, adaption continued through period 2 for several species. The addition of fresh substrate in period 2 led to increasing copy numbers of all microbial species during the first 2-4 h in the fermenter liquid except protozoa, which showed a postprandial decrease. Corn silage enhanced the growth of R. amylophilus and F. succinogenes, and grass silage enhanced R. albus, P. bryantii, and C. aminophilum. No effect of forage source was detected on total bacteria, protozoa, S. ruminantium, or methanogens or on total gas production, although grass silage enhanced methane production. This study showed that the Rusitec provides a stable system after an adaption phase that should last longer than 48 h, and that the forage source influenced several microbial species.
Directory of Open Access Journals (Sweden)
Shin Ja Lee
2018-01-01
Full Text Available Objective Due to the threat of global warming, the livestock industry is increasingly interested in exploring how feed additives may reduce anthropogenic greenhouse gas emissions, especially from ruminants. This study investigated the effect of Rhodophyta supplemented bovine diets on in vitro rumen fermentation and rumen microbial diversity. Methods Cannulated Holstein cows were used as rumen fluid donors. Rumen fluid:buffer (1:2; 15 mL solution was incubated for up to 72 h in six treatments: a control (timothy hay only, along with substrates containing 5% extracts from five Rhodophyta species (Grateloupia lanceolata [Okamura] Kawaguchi, Hypnea japonica Tanaka, Pterocladia capillacea [Gmelin] Bornet, Chondria crassicaulis Harvey, or Gelidium amansii [Lam.] Lamouroux. Results Compared with control, Rhodophyta extracts increased cumulative gas production after 24 and 72 h (p = 0.0297 and p = 0.0047. The extracts reduced methane emission at 12 and 24 h (p<0.05. In particular, real-time polymerase chain reaction analysis indicated that at 24 h, ciliate-associated methanogens, Ruminococcus albus and Ruminococcus flavefaciens decreased at 24 h (p = 0.0002, p<0.0001, and p<0.0001, while Fibrobacter succinogenes (F. succinogenes increased (p = 0.0004. Additionally, Rhodophyta extracts improved acetate concentration at 12 and 24 h (p = 0.0766 and p = 0.0132, as well as acetate/propionate (A/P ratio at 6 and 12 h (p = 0.0106 and p = 0.0278. Conclusion Rhodophyta extracts are a viable additive that can improve ruminant growth performance (higher total gas production, lower A/P ratio and methane abatement (less ciliate-associated methanogens, Ruminococcus albus and Ruminococcus flavefaciens and more F. succinogenes.
The core faecal bacterial microbiome of Irish Thoroughbred racehorses.
O' Donnell, M M; Harris, H M B; Jeffery, I B; Claesson, M J; Younge, B; O' Toole, P W; Ross, R P
2013-12-01
In this study, we characterized the gut microbiota in six healthy Irish thoroughbred racehorses and showed it to be dominated by the phyla Firmicutes, Bacteroidetes, Proteobacteria, Verrucomicrobia, Actinobacteria, Euryarchaeota, Fibrobacteres and Spirochaetes. Moreover, all the horses harboured Clostridium, Fibrobacter, Faecalibacterium, Ruminococcus, Eubacterium, Oscillospira, Blautia Anaerotruncus, Coprococcus, Treponema and Lactobacillus spp. Notwithstanding the sample size, it was noteworthy that the core microbiota species assignments identified Fibrobacter succinogenes, Eubacterium coprostanoligenes, Eubacterium hallii, Eubacterium ruminantium, Oscillospira guillermondii, Sporobacter termiditis, Lactobacillus equicursoris, Treponema parvum and Treponema porcinum in all the horses. This is the first study of the faecal microbiota in the Irish thoroughbred racehorse, a significant competitor in the global bloodstock industry. The information gathered in this pilot study provides a foundation for veterinarians and other equine health-associated professionals to begin to analyse the microbiome of performance of racehorses. This study and subsequent work may lead to alternate dietary approaches aimed at minimizing the risk of microbiota-related dysbiosis in these performance animals. Although Irish thoroughbreds are used nationally and internationally as performance animals, very little is known about the core faecal microbiota of these animals. This is the first study to characterize the bacterial microbiota present in the Irish thoroughbred racehorse faeces and elucidate a core microbiome irrespective of diet, animal management and geographical location. © 2013 The Society for Applied Microbiology.
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... succinogenes] ... Length = 85 ... Query: 3 ... LDSAIKLEIISKFARGEKDTGSPEVQVALLSRRISDLTEHLKVNVKDHASRLGL...LKLVAQ 62 ... LDSAIKLEIISKFARGEKDTGSPEVQVALLSRRISDLTEHLKVNVKDHASRLGLLKLVAQ Sbjct: 1 ... LDSAIKLEIISKFARGEKDTGSPEVQVALLSRRISDLTEHLKVNVKDHASRLGLLKLVAQ 60 ...
Ding, Xuezhi; Long, Ruijun; Zhang, Qian; Huang, Xiaodan; Guo, Xusheng; Mi, Jiandui
2012-10-01
The objective was to evaluate the effect of dietary coconut oil on methane (CH(4)) emissions and the microbial community in Tibetan sheep. Twelve animals were assigned to receive either a control diet (oaten hay) or a mixture diet containing concentrate (maize meal), in which coconut oil was supplemented at 12 g/day or not for a period of 4 weeks. CH(4) emissions were measured by using the 'tunnel' technique, and microbial communities were examined using quantitative real-time PCR. Daily CH(4) production for the control and forage-to-concentrate ratio of 6:4 was 17.8 and 15.3 g, respectively. Coconut oil was particularly effective at reducing CH(4) emissions from Tibetan sheep. The inclusion of coconut oil for the control decreased CH(4) production (in grams per day) by 61.2%. In addition, there was a positive correlation between the number of methanogens and the daily CH(4) production (R = 0.95, P coconut oil supplemented at 12 g/day decreases the number of methanogens by 77% and a decreases in the ruminal fungal population (85-95%) and Fibrobacter succinogenes (50-98%) but an increase in Ruminococcus flavefaciens (25-70%). The results from our experiment suggest that adding coconut oil to the diet can reduce CH(4) emissions in Tibetan sheep and that these reductions persist for at least the 4-week feeding period.
Samsudin, Anjas Asmara; Wright, André-Denis; Al Jassim, Rafat
2014-10-01
The total bacterial community of Fibrobacter succinogenes and Ruminococcus flavefaciens in fibre-enriched culture of the foregut contents of 12 adult feral camels (Camelus dromedaries) fed on native vegetation in Australia was investigated using quantitative PCR. Foregut contents were collected postmortem, pooled and filtered before divided into two fractions. One fraction was used for extraction of DNA, while the other fraction was inoculated straight away into BM 10 contained filter paper (FP), cotton thread (CT) or neutral detergent fibre (NDF) as the sole carbohydrate sources in Hungate tubes. The tubes were incubated anaerobically at 39 °C for 1 week. After a near complete degradation of the FP and CT and extensive turbidity in the NDF, media subculturing was carried out into fresh media tubes. This was repeated twice before genomic DNA was extracted and used for quantification of bacteria. Using an absolute quantification method, the numbers of cells in 1 ml of each sample ranged from 4.07 × 10(6) to 2.73 × 10(9) for total bacteria, 1.34 × 10(3) to 2.17 × 10(5) for F. succinogenes and 5.78 × 10(1) to 3.53 × 10(4) for R. flavefaciens. The mean cell number of F. succinogenes was highest in the FP enrichment medium at approximately 107-fold, whereas for the R. flavefaciens targeted primer, the NDF enrichment media had the highest mean cell number at approximately 4-fold when compared to the rumen content. The data presented here provide evidence of fibre type preference by the two main fibre-degrading bacteria and would help us understand the interaction between fibre type and fibre-degrading microorganisms, which has ramification on camel nutrition at different seasons and environments.
Petri, R M; Forster, R J; Yang, W; McKinnon, J J; McAllister, T A
2012-06-01
To determine the effects of the removal of forage in high-concentrate diets on rumen fermentation conditions and rumen bacterial populations using culture-independent methods. Detectable bacteria and fermentation parameters were measured in the solid and liquid fractions of digesta from cattle fed two dietary treatments, high concentrate (HC) and high concentrate without forage (HCNF). Comparison of rumen fermentation conditions showed that duration of time spent below pH 5·2 and rumen osmolality were higher in the HCNF treatment. Simpson's index of 16S PCR-DGGE images showed a greater diversity of dominant species in the HCNF treatment. Real-time qPCR showed populations of Fibrobacter succinogenes (P = 0·01) were lower in HCNF than HC diets. Ruminococcus spp., F. succinogenes and Selenomonas ruminantium were at higher (P ≤ 0·05) concentrations in the solid vs the liquid fraction of digesta regardless of diet. The detectable bacterial community structure in the rumen is highly diverse. Reducing diet complexity by removing forage increased bacterial diversity despite the associated reduction in ruminal pH being less conducive for fibrolytic bacterial populations. Quantitative PCR showed that removal of forage from the diet resulted in a decline in the density of some, but not all fibrolytic bacterial species examined. Molecular techniques such as DGGE and qPCR provide an increased understanding of the impacts of dietary changes on the nature of rumen bacterial populations, and conclusions derived using these techniques may not match those previously derived using traditional laboratory culturing techniques. © 2012 The Authors. Journal of Applied Microbiology © 2012 The Society for Applied Microbiology.
International Nuclear Information System (INIS)
Morrison, M.; Nelson, K.E.
2005-01-01
Improving microbial degradation of plant cell wall polysaccharides remains one of the highest priority goals for all livestock enterprises, including the cattle herds and draught animals of developing countries. The North American Consortium for Genomics of Fibrolytic Ruminal Bacteria was created to promote the sequencing and comparative analysis of rumen microbial genomes, offering the potential to fully assess the genetic potential in a functional and comparative fashion. It has been found that the Fibrobacter succinogenes genome encodes many more endoglucanases and cellodextrinases than previously isolated, and several new processive endoglucanases have been identified by genome and proteomic analysis of Ruminococcus albus, in addition to a variety of strategies for its adhesion to fibre. The ramifications of acquiring genome sequence data for rumen microorganisms are profound, including the potential to elucidate and overcome the biochemical, ecological or physiological processes that are rate limiting for ruminal fibre degradation. (author)
Min, B R; Pinchak, W E; Anderson, R C; Hume, M E
2006-10-01
The role of ruminal bacteria in the frothy bloat complex common to cattle grazing winter wheat has not been previously determined. Two experiments, one in vitro and another in vivo, were designed to elucidate the effects of fresh wheat forage on bacterial growth, biofilm complexes, rumen fermentation end products, rumen bacterial diversity, and bloat potential. In Exp. 1, 6 strains of ruminal bacteria (Streptococcus bovis strain 26, Prevotella ruminicola strain 23, Eubacterium ruminantium B1C23, Ruminococcus albus SY3, Fibrobacter succinogenes ssp. S85, and Ruminococcus flavefaciens C94) were used in vitro to determine the effect of soluble plant protein from winter wheat forage on specific bacterial growth rate, biofilm complexes, VFA, and ruminal H2 and CH4 in mono or coculture with Methanobrevibacter smithii. The specific growth rate in plant protein medium containing soluble plant protein (3.27% nitrogen) was measured during a 24-h incubation at 39 degrees C in Hungate tubes under a CO2 gas phase. A monoculture of M. smithii was grown similarly, except under H2:CO2 (1:1), in a basal methanogen growth medium supplemented likewise with soluble plant protein. In Exp. 2, 6 ruminally cannulated steers grazing wheat forage were used to evaluate the influence of bloat on the production of biofilm complexes, ruminal microbial biodiversity patterns, and ruminal fluid protein fractions. In Exp. 1, cultures of R. albus (P bloated than for nonbloated steers when grazing wheat forage. The molecular analysis of the 16S rDNA showed that 2 different ruminal microbiota populations developed between bloated and nonbloated animals grazing wheat forage. Bloat in cattle grazing wheat pastures may be caused by increased production of biofilm, resulting from a diet-influenced switch in the rumen bacterial population.
Directory of Open Access Journals (Sweden)
Kim Minseok
2012-09-01
Full Text Available Abstract Background The number and diversity of uncultured ruminal bacterial and archaeal species revealed by 16S rRNA gene (rrs sequences greatly exceeds that of cultured bacteria and archaea. However, the significance of uncultured microbes remains undetermined. The objective of this study was to assess the numeric importance of select uncultured bacteria and cultured bacteria and the impact of diets and microenvironments within cow rumen in a comparative manner. Results Liquid and adherent fractions were obtained from the rumen of Jersey cattle fed hay alone and Holstein cattle fed hay plus grain. The populations of cultured and uncultured bacteria present in each fraction were quantified using specific real-time PCR assays. The population of total bacteria was similar between fractions or diets, while total archaea was numerically higher in the hay-fed Jersey cattle than in the hay-grain-fed Holstein cattle. The population of the genus Prevotella was about one log smaller than that of total bacteria. The populations of Fibrobacter succinogenes, Ruminococcus flavefaciens, the genus Butyrivibrio, and R. albus was at least one log smaller than that of genus Prevotella. Four of the six uncultured bacteria quantified were as abundant as F. succinogenes, R. flavefaciens and the genus Butyrivibrio. In addition, the populations of several uncultured bacteria were significantly higher in the adherent fractions than in the liquid fractions. These uncultured bacteria may be associated with fiber degradation. Conclusions Some uncultured bacteria are as abundant as those of major cultured bacteria in the rumen. Uncultured bacteria may have important contribution to ruminal fermentation. Population dynamic studies of uncultured bacteria in a comparative manner can help reveal their ecological features and importance to rumen functions.
Krypton-85 Monitoring at BfS in Germany and Technical Solutions for Safeguards
International Nuclear Information System (INIS)
Schlosser, C.; Klingberg, F.
2015-01-01
The radioactive noble gas isotope krypton-85 with a half-life of 10.76 years is produced by nuclear fission. The main source of krypton-85 in the atmosphere are releases from reprocessing plants for nuclear fuel in the Northern Hemisphere. This volatile isotope is not retained in such plants and thus a very good indicator for the processing of irradiated nuclear fuel. This includes reprocessing for military purposes. Additionally, Kr-85 could be used as tracer for the validation of Atmospheric Transport Models. The German Federal Office for Radiation Protection (BfS) operates a noble gas laboratory and a global network which continuously monitors the krypton-85 activity concentrations in ground level air since the 1970s. The atmospheric activity concentration has continuously been increasing since the installation of reprocessing plants for nuclear fuels in the early 1950s until 2003. In the first decades it came mostly from military applications and later from civil reprocessing. Since 2003 the atmospheric krypton-85 background level in the Northern Hemisphere is nearly constant with a value of around 1.5 Bq/m 3 in Central Europe. The baseline is superimposed by spikes as a result from discharges of two European reprocessing plants of nuclear fuel, Sellafield and La Hague. The laboratory of the BfS and the techniques used will be presented. Long time series will be discussed and the use of ATM for source location demonstrated. (author)
Energy Technology Data Exchange (ETDEWEB)
Moriarty, K.; Johnson, C.; Sears, T.; Bergeron, P.
2009-12-01
This study reviews E85 dispensing infrastructure advances and issues and evaluates the geographic concentration of flexible fuel vehicles (FFVs), E85 stations, ethanol production facilities, and E85 suppliers. Costs, space, financial incentives, and barriers to adding E85 fueling equipment at existing stations are also assessed. This study found that E85 is increasingly available in the U.S. in half of the states; however, the other half have minimal or no E85 fueling options. Despite these gains, E85 is only available at 1% of U.S. gasoline stations. Ethanol production reached 9.5 billion gallons in 2008, but less than 1% is consumed as E85. FFVs have not reached a significant concentration in any county, metropolitan area, or state.
Mateos, I; Ranilla, M J; Saro, C; Carro, M D
2017-11-01
Rusitec fermenters are in vitro systems widely used to study ruminal fermentation, but little is known about the microbial populations establishing in them. This study was designed to assess the time evolution of microbial populations in fermenters fed medium- (MC; 50% alfalfa hay : concentrate) and high-concentrate diets (HC; 15 : 85 barley straw : concentrate). Samples from solid (SOL) and liquid (LIQ) content of fermenters were taken immediately before feeding on days 3, 8 and 14 of incubation for quantitative polymerase chain reaction and automated ribosomal intergenic spacer analysis analyses. In SOL, total bacterial DNA concentration and relative abundance of Ruminococcus flavefaciens remained unchanged over the incubation period, but protozoal DNA concentration and abundance of Fibrobacter succinogenes, Ruminococcus albus and fungi decreased and abundance of methanogenic archaea increased. In LIQ, total bacterial DNA concentration increased with time, whereas concentration of protozoal DNA and abundance of methanogens and fungi decreased. Diet×time interactions were observed for bacterial and protozoal DNA and relative abundance of F. succinogenes and R. albus in SOL, as well as for protozoal DNA in LIQ. Bacterial diversity in SOL increased with time, but no changes were observed in LIQ. The incubated diet influenced all microbial populations, with the exception of total bacteria and fungi abundance in LIQ. Bacterial diversity was higher in MC-fed than in HC-fed fermenters in SOL, but no differences were detected in LIQ. Values of pH, daily production of volatile fatty acids and CH4 and isobutyrate proportions remained stable over the incubation period, but other fermentation parameters varied with time. The relationships among microbial populations and fermentation parameters were in well agreement with those previously reported in in vivo studies. Using 15N as a microbial marker or quantifying total microbial DNA for estimating microbial protein synthesis
Directory of Open Access Journals (Sweden)
Eun T. Kim
2015-04-01
Full Text Available The objective of this study was to evaluate the in vitro effects of flavonoid-rich plant extracts (PE on ruminal fermentation characteristics and methane emission by studying their effectiveness for methanogenesis in the rumen. A fistulated Holstein cow was used as a donor of rumen fluid. The PE (Punica granatum, Betula schmidtii, Ginkgo biloba, Camellia japonica, and Cudrania tricuspidata known to have high concentrations of flavonoid were added to an in vitro fermentation incubated with rumen fluid. Total gas production and microbial growth with all PE was higher than that of the control at 24 h incubation, while the methane emission was significantly lower (p<0.05 than that of the control. The decrease in methane accumulation relative to the control was 47.6%, 39.6%, 46.7%, 47.9%, and 48.8% for Punica, Betula, Ginkgo, Camellia, and Cudrania treatments, respectively. Ciliate populations were reduced by more than 60% in flavonoid-rich PE treatments. The Fibrobacter succinogenes diversity in all added flavonoid-rich PE was shown to increase, while the Ruminoccocus albus and R. flavefaciens populations in all PE decreased as compared with the control. In particular, the F. succinogenes community with the addition of Birch extract increased to a greater extent than that of others. In conclusion, the results of this study showed that flavonoid-rich PE decreased ruminal methane emission without adversely affecting ruminal fermentation characteristics in vitro in 24 h incubation time, suggesting that the flavonoid-rich PE have potential possibility as bio-active regulator for ruminants.
Tangi, Malleswarara
2017-08-31
The valence and conduction band offsets (VBO and CBO) at the semiconductor heterojunction are crucial parameters to design the active region of contemporary electronic and optoelectronic devices. In this report, to study the band alignment parameters at the In0.15Al0.85N/MoS2 lattice matched heterointerface, large area MoS2 single layers are chemical vapor deposited on molecular beam epitaxial grown In0.15Al0.85N films and vice versa. We grew InAlN having an in-plane lattice parameter closely matching with that of MoS2. We confirm that the grown MoS2 is a single layer from optical and structural analyses using micro-Raman spectroscopy and scanning transmission electron microscopy. The band offset parameters VBO and CBO at the In0.15Al0.85N/MoS2 heterojunction are determined to be 2.08 ± 0.15 and 0.60 ± 0.15 eV, respectively, with type-I band alignment using high-resolution x-ray photoelectron spectroscopy in conjunction with ultraviolet photoelectron spectroscopy. Furthermore, we design a MoS2 quantum well structure by growing an In0.15Al0.85N layer on MoS2/In0.15Al0.85N type-I heterostructure. By reducing the nitrogen plasma power and flow rate for the overgrown In0.15Al0.85N layers, we achieve unaltered structural properties and a reasonable preservation of photoluminescence intensity with a peak width of 70 meV for MoS2 quantum well (QW). The investigation provides a pathway towards realizing large area, air-stable, lattice matched, and eventual high efficiency In0.15Al0.85N/MoS2/In0.15Al0.85N QW-based light emitting devices.
Effect of Gynosaponin on Rumen Methanogenesis under Different Forage-Concentrate Ratios
Directory of Open Access Journals (Sweden)
Bakhetgul Manatbay
2014-08-01
Full Text Available The study aimed to investigate the effects of gynosaponin on in vitro methanogenesis under different forage-concentrate ratios (F:C ratios. Experiment was conducted with two kinds of F:C ratios (F:C = 7:3 and F:C = 3:7 and gynosaponin addition (0 mg and 16 mg in a 2×2 double factorial design. In the presence of gynosaponin, methane production and acetate concentration were significantly decreased, whereas concentration of propionate tended to be increased resulting in a significant reduction (p<0.05 of acetate:propionate ratio (A:P ratio, in high-forage substrate. Gynosaponin treatment increased (p<0.05 the butyrate concentration in both F:C ratios. Denaturing gradient gel electrophoresis (DGGE analysis showed there was no apparent shift in the composition of total bacteria, protozoa and methanogens after treated by gynosaponin under both F:C ratios. The real-time polymerase chain reaction (PCR analysis indicated that variable F:C ratios significantly affected the abundances of Fibrobacter succinogenes, Rumninococcus flavefaciens, total fungi and counts of protozoa (p<0.05, but did not affect the mcrA gene copies of methanogens and abundance of total bacteria. Counts of protozoa and abundance of F.succinogenes were decreased significantly (p<0.05, whereas mcrA gene copies of methanogens were decreased slightly (p<0.10 in high-forage substrate after treated by gynosaponin. However, gynosaponin treatment under high-concentrate level did not affect the methanogenesis, fermentation characteristics and tested microbes. Accordingly, overall results suggested that gynosaponin supplementation reduced the in vitro methanogenesis and improved rumen fermentation under high-forage condition by changing the abundances of related rumen microbes.
DEFF Research Database (Denmark)
Gunnarsson, Ingólfur Bragi; Alvarado-Morales, Merlin; Angelidaki, Irini
2014-01-01
Biogas is an attractive renewable energy carrier. However, it contains CO2 which limits certain applications of biogas. Here we report a novel approach for removing CO2 from biogas and capturing it as a biochemical through a biological process. This approach entails converting CO2 into bio...... and titre, CO2 consumption rate and CH4 purity. When using biogas as the only CO2 source at 140 kPa, the CO2 consumption rate corresponded to 2.59 L CO2 L-1 d-1 with a final succinic acid titre of 14.4 g L-1. Under this pressure condition the highest succinic acid yield and biogas quality reached......-succinic acid using the bacterial strain Actinobacillus succinogenes 130Z, and simultaneously producing high purity CH4 (>95%). Results showed that when pressure during fermentation was increased from 101.325 to 140 kPa, higher CO2 solubility was achieved, thereby positively affecting final succinic acid yield...
Sun, Hua; Wu, Yueming; Wang, Yanming; Wang, Chong; Liu, Jianxin
2017-04-01
To investigate effects of Aspergillus oryzae culture (AOC) and 2-hydroxy-4-(methylthio) butanoic acid (HMB) on milk performance and rumen fermentation of dairy cows. Sixty-four multiparous Chinese Holstein cows were randomly allocated into four experimental diets: (i) Control diet; (ii) AOC diet: 5 g AOC/day per head; (iii) HMB diet: 25 g HMB/day; and (iv) AH diet: 5 g AOC plus 25 g HMB/day. Added HMB tended to increase the yield of milk protein (P = 0.06) and 3.5% fat-corrected milk (P = 0.08) and milk fat content (P = 0.09). Milk fat yield (P = 0.03) and the contents of milk protein (P = 0.05) were increased by adding HMB. The cows fed on AOC diet had a tendency for higher body weight (BW) gain (P = 0.08). Addition of AOC, HMB and AH increased content of microbial protein (MCP) and total volatile fatty acids (VFA) (P rumen fluid. Populations of rumen fungi, Fibrobacter succinogenes and Ruminococcus flavefaciens relative to total bacterial 16S rDNA (P ≤ 0.03) and activity of carboxymethylcellulase (CMCase) (P contents of MCP and total VFA potentially by stimulating rumen microbe populations and CMCase activity. © 2016 Japanese Society of Animal Science.
Krypton-85 removal and storage; Separacion y almacenamiento de Kripton-85
Energy Technology Data Exchange (ETDEWEB)
Gutierrez, J.
1978-07-01
A literature survey was made in order to predict the atmospheric Kr-85 concentration in the future and it s effect on the population. As a consequence the need for its treatment and removal as a previous step to gaseous waste disposal is justified. A literature review of possible methods of Kr-85 removal and storage is also included. (Author) 43 refs.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Fees. 9.85 Section 9.85 Energy NUCLEAR REGULATORY COMMISSION PUBLIC RECORDS Privacy Act Regulations Fees § 9.85 Fees. Fees shall not be charged for search or... available for review, although fees may be charged for additional copies. Fees established under 31 U.S.C...
2010-01-01
... operating exclusively through the Internet. 7.5009 Section 7.5009 Banks and Banking COMPTROLLER OF THE... under 12 U.S.C. 85 of national banks operating exclusively through the Internet. For purposes of 12 U.S.C. 85, the main office of a national bank that operates exclusively through the Internet is the...
Krypton 85 at La Hague; Krypton 85 a La Hague
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-11-01
The gaseous effluents from the fuel reprocessing plant of Cogema-La Hague (France) are regularly measured and controlled. This paper reports on three press releases: the one of Cogema from November 6, 1998 concerning the impact of these effluents and the results of {sup 85}Kr measurements performed in the vicinity of the facility, and the two communiques of the French office of protection against ionizing radiations (OPRI) from November 13 and 20, 1998 relative to the environmental and human impacts of the {sup 85}Kr releases from the La Hague facility. (J.S.)
50 CFR 85.21 - Application procedures.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Application procedures. 85.21 Section 85... Application for Grants § 85.21 Application procedures. (a) Eligible applicants will submit their proposals to..., Missouri, Ohio, and Wisconsin Division of Federal Aid, U.S. Fish and Wildlife Service, Bishop Henry Whipple...
Directory of Open Access Journals (Sweden)
Pedro Andrade Katsuki
2006-12-01
Full Text Available Objetivou-se avaliar a cinética ruminal da degradação de MS, PB e FDN da silagem de milho em ambiente ruminal inoculado com diferentes aditivos. Utilizou-se um delineamento em quadrado latino 4 x 4, com quatro bovinos holandeses e quatro períodos de incubação, em ambiente ruminal adaptado ou não com diferentes aditivos alimentares. Foram testados os seguintes tratamentos: SCL - silagem de milho em ambiente ruminal sem inoculação de aditivo; SBL - silagem de milho em ambiente ruminal inoculado com 5 g de produto comercial contendo bactérias ruminais e intestinais liofilizadas (Ruminobacter amylophilum: 3,0 x 10(11 ufc/kg; Fibrobacter succinogenes: 3,0 x 10(11 ufc/kg; Succinovibrio dextrinsolvens: 4,4 x 10(11 ufc/kg; Bacillus cereus: 3,5 x 10(11 ufc/kg; Lactobacillus acidophilus: 3,5 x 10(11 ufc/kg e Streptococcus faecium: 3,5 x 10(11 ufc/kg; SEC - silagem de milho em ambiente ruminal inoculado com 15 g de produto comercial contendo enzimas celulolíticas (xilanase 10%; e SMS - silagem de milho em ambiente ruminal inoculado com 3 g de produto comercial contendo monensina sódica. Os tratamentos SBL e SEC não afetaram a fração potencialmente degradável (b dos nutrientes avaliados da silagem de milho. A monensina sódica reduziu a fração (b da MS (51,01% e a degradabilidade potencial da silagem de milho (72,33%. Entre os aditivos estudados, a monensina sódica proporcionou a maior fração não-degradável da FDN (45,57%, reduzindo o desaparecimento desta fração a partir de 48 horas de incubação intra-ruminal. Os diferentes aditivos, nas concentrações estudadas, não proporcionaram melhora na degradabilidade efetiva da MS, PB e FDN da silagem de milho.Four bulls fitted with ruminal cannula were used in a 4 x 4 Latin square design to evaluate the effects of different ruminally inoculated additives on the degradation kinetics of DM, CP, and NDF of corn silage (CS. The treatments were: control CS incubated in rumen with no
Shen, N; Qin, Y; Wang, Q; Liao, S; Zhu, J; Zhu, Q; Mi, H; Adhikari, B; Wei, Y; Huang, R
2015-06-01
The potential of using corn steep liquor powder (CSLP), peanut meal (PM), soybean meal (SM), cotton meal (CM) and urea as the substitute of yeast extract (YE) as the nitrogen source was investigated for producing succinic acid (SA). Actinobacillus succinogenes GXAS137 was used as the fermenting bacterium and sugarcane molasses was used as the main substrate. None of these materials were able to produce SA as high as YE did. The CSLP could still be considered as a feasible and inexpensive alternate for YE as the yield of SA produced using CSLP was second only to the yield of SA obtained by YE. The use of CSLP-PM mixed formulation (CSLP to PM ratio = 2·6) as nitrogen source produced SA up to 59·2 g l(-1) with a productivity of 1·2 g l(-1) h(-1). A batch fermentation using a stirred bioreactor produced up to 60·7 g l(-1) of SA at the same formulation. Fed-batch fermentation that minimized the substrate inhibition produced 64·7 g l(-1) SA. These results suggest that sugarcane molasses supplemented with a mixture of CSLP and PM as the nitrogen source could be used to produce SA more economically using A. succinogenes. Significance and impact of the study: Succinic acid (SA) is commonly used as a platform chemical to produce a number of high value derivatives. Yeast extract (YE) is used as a nitrogen source to produce SA. The high cost of YE is currently the limiting factor for industrial production of SA. This study reports the use of a mixture of corn steep liquor powder (CSLP) and peanut meal (PM) as an inexpensive nitrogen source to substitute YE. The results showed that this CSLP-PM mixed formulation can be used as an effective and economic nitrogen source for the production of SA. © 2015 The Society for Applied Microbiology.
AlZahal, Ousama; Li, Fuyong; Guan, Le Luo; Walker, Nicola D; McBride, Brian W
2017-06-01
The objective of the current study was to employ a DNA-based sequencing technology to study the effect of active dry yeast (ADY) supplementation, diet type, and sample location within the rumen on rumen bacterial community diversity and composition, and to use an RNA-based method to study the effect of ADY supplementation on rumen microbial metabolism during high-grain feeding (HG). Our previous report demonstrated that the supplementation of lactating dairy cows with ADY attenuated the effect of subacute ruminal acidosis. Therefore, we used samples from that study, where 16 multiparous, rumen-cannulated lactating Holstein cows were randomly assigned to 1 of 2 dietary treatments: ADY (Saccharomyces cerevisiae strain Y1242, 80 billion cfu/animal per day) or control (carrier only). Cows received a high-forage diet (77:23, forage:concentrate), then were abruptly switched to HG (49:51, forage:concentrate). Rumen bacterial community diversity and structure were highly influenced by diet and sampling location (fluid, solids, epimural). The transition to HG reduced bacterial diversity, but epimural bacteria maintained a greater diversity than fluid and solids. Analysis of molecular variance indicated a significant separation due to diet × sampling location, but not due to treatment. Across all samples, the analysis yielded 6,254 nonsingleton operational taxonomic units (OTU), which were classified into several phyla: mainly Firmicutes, Bacteroidetes, Fibrobacteres, Tenericutes, and Proteobacteria. High forage and solids were dominated by OTU from Fibrobacter, whereas HG and fluid were dominated by OTU from Prevotella. Epimural samples, however, were dominated in part by Campylobacter. Active dry yeast had no effect on bacterial community diversity or structure. The phylum SR1 was more abundant in all ADY samples regardless of diet or sampling location. Furthermore, on HG, OTU2 and OTU3 (both classified into Fibrobacter succinogenes) were more abundant with ADY in fluid
Cross-section measurements of the 86Kr(γ,n) reaction to probe the s-process branching at 85Kr.
Raut, R; Tonchev, A P; Rusev, G; Tornow, W; Iliadis, C; Lugaro, M; Buntain, J; Goriely, S; Kelley, J H; Schwengner, R; Banu, A; Tsoneva, N
2013-09-13
We have carried out photodisintegration cross-section measurements on 86Kr using monoenergetic photon beams ranging from the neutron separation energy, S(n) = 9.86 MeV, to 13 MeV. We combine our experimental 86Kr(γ,n)85Kr cross section with results from our recent 86Kr(γ,γ') measurement below the neutron separation energy to obtain the complete nuclear dipole response of 86Kr. The new experimental information is used to predict the neutron capture cross section of 85Kr, an important branching point nucleus on the abundance flow path during s-process nucleosynthesis. Our new and more precise 85Kr(n,γ)86Kr cross section allows us to produce more precise predictions of the 86Kr abundance from s-process models. In particular, we find that the models of the s process in asymptotic giant branch stars of mass <1.5M⊙, where the 13C neutron source burns convectively rather than radiatively, represent a possible solution for the highest 86Kr:82Kr ratios observed in meteoritic stardust SiC grains.
Krypton-85 removal and storage
International Nuclear Information System (INIS)
Gutierrez Fernandez, J.
1978-01-01
A literature survey was made in order to predict the atmospheric Kr-85 concentration in the future and it s effect on the population. As a consequence the need for its treatment and removal as a previous step to gaseous waste disposal is justified. A literature review of possible methods of Kr-85 removal and storage is also included. (Author) 43 refs
Cross-Section Measurements of the Kr86(γ,n) Reaction to Probe the s-Process Branching at Kr85
Raut, R.; Tonchev, A. P.; Rusev, G.; Tornow, W.; Iliadis, C.; Lugaro, M.; Buntain, J.; Goriely, S.; Kelley, J. H.; Schwengner, R.; Banu, A.; Tsoneva, N.
2013-09-01
We have carried out photodisintegration cross-section measurements on Kr86 using monoenergetic photon beams ranging from the neutron separation energy, Sn=9.86MeV, to 13 MeV. We combine our experimental Kr86(γ,n)Kr85 cross section with results from our recent Kr86(γ,γ') measurement below the neutron separation energy to obtain the complete nuclear dipole response of Kr86. The new experimental information is used to predict the neutron capture cross section of Kr85, an important branching point nucleus on the abundance flow path during s-process nucleosynthesis. Our new and more precise Kr85(n,γ)Kr86 cross section allows us to produce more precise predictions of the Kr86 abundance from s-process models. In particular, we find that the models of the s process in asymptotic giant branch stars of mass <1.5M⊙, where the C13 neutron source burns convectively rather than radiatively, represent a possible solution for the highest Kr86∶Kr82 ratios observed in meteoritic stardust SiC grains.
Institute of Scientific and Technical Information of China (English)
Li Chang-qing; Alatengdalai; Xue Shu-yuan; Atsushi Asano; Atsushi Tajima; Naoto Ishikawa
2017-01-01
The present experiment was conducted to determine the effects of Molasses-Urea Supplementation (MUS) on weight gain, ruminal fermentation and major microbial populations in sheep on a winter grazing regime in Inner Mongolia. Total 40 sheep, allowed free consumption of MUS after grazing, served as a treatment group, while 30 sheep, fed only by pasture grazing, served as a control group. Ruminal fermentation parameters, consisted of pH, Bacterial Crude Protein (BCP) and ammonia nitrogen (NH3-N) were measured. In addition, numbers of five symbiotic bacteria were investigated. The results showed as follows: the average daily weight gain, concentration of NH3-N and numbers of protozoa were significantly higher (p<0.05) in the treatment group than those in the control group. Contrastingly, no significant difference was found in BCP concentration and pH between the two groups. At the end of the experiment, the populations of Selenomonas ruminantium,Anaerovibrio lipolytica,Fibrobacter succinogenes,Ruminococcus flaveciens and Ruminococcus albus in the treatment group were significantly higher than those of the control group (p<0.05). These results demonstrated that greater weight gain could be induced during winter in Inner Mongolia by improved nutritional status through promotion of microbial populations using urea and sugar.
Lovastatin-Enriched Rice Straw Enhances Biomass Quality and Suppresses Ruminal Methanogenesis
Directory of Open Access Journals (Sweden)
Mohammad Faseleh Jahromi
2013-01-01
Full Text Available The primary objective of this study was to test the hypothesis that solid state fermentation (SSF of agro-biomass (using rice straw as model; besides, breaking down its lignocellulose content to improve its nutritive values also produces lovastatin which could be used to suppress methanogenesis in the rumen ecosystem. Fermented rice straw (FRS containing lovastatin after fermentation with Aspergillus terreus was used as substrate for growth study of rumen microorganisms using in vitro gas production method. In the first experiment, the extract from the FRS (FRSE which contained lovastatin was evaluated for its efficacy for reduction in methane (CH4 production, microbial population, and activity in the rumen fluid. FRSE reduced total gas and CH4 productions (P<0.01. It also reduced (P<0.01 total methanogens population and increased the cellulolytic bacteria including Ruminococcus albus, Fibrobacter succinogenes (P<0.01, and Ruminococcus flavefaciens (P<0.05. Similarly, FRS reduced total gas and CH4 productions, methanogens population, but increased in vitro dry mater digestibility compared to the non-fermented rice straw. Lovastatin in the FRSE and the FRS significantly increased the expression of HMG-CoA reductase gene that produces HMG-CoA reductase, a key enzyme for cell membrane production in methanogenic Archaea.
Ground transport stress affects bacteria in the rumen of beef cattle: A real-time PCR analysis.
Deng, Lixin; He, Cong; Zhou, Yanwei; Xu, Lifan; Xiong, Huijun
2017-05-01
Transport stress syndrome often appears in beef cattle during ground transportation, leading to changes in their capacity to digest food due to changes in rumen microbiota. The present study aimed to analyze bacteria before and after cattle transport. Eight Xianan beef cattle were transported over 1000 km. Rumen fluid and blood were sampled before and after transport. Real-time PCR was used to quantify rumen bacteria. Cortisol and adrenocorticotrophic hormone (ACTH) were measured. Cortisol and ACTH were increased on day 1 after transportation and decreased by day 3. Cellulolytic bacteria (Fibrobacter succinogenes and Ruminococcus flavefaciens), Ruminococcus amylophilus and Prevotella albensis were increased at 6 h and declined by 15 days after transport. There was a significant reduction in Succinivibrio dextrinosolvens, Prevotella bryantii, Prevotella ruminicola and Anaerovibrio lipolytica after transport. Rumen concentration of acetic acid increased after transport, while rumen pH and concentrations of propionic and butyric acids were decreased. Body weight decreased by 3 days and increased by 15 days after transportation. Using real-time PCR analysis, we detected changes in bacteria in the rumen of beef cattle after transport, which might affect the growth of cattle after transport. © 2016 Japanese Society of Animal Science.
28 CFR 16.85 - Exemption of U.S. Parole Commission-limited access.
2010-07-01
...) Statistical, Educational and Developmental System (JUSTICE/PRC-006). (5) Workload Record, Decision Result, and...-limited access. 16.85 Section 16.85 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE... Scheduling and Control System (JUSTICE/PRC-001). (2) Inmate and Supervision Files System (JUSTICE/PRC-003...
Tangi, Malleswararao; Mishra, Pawan; Li, Ming-Yang; Shakfa, Mohammad Khaled; Anjum, Dalaver H.; Hedhili, Mohamed N.; Ng, Tien Khee; Li, Lain-Jong; Ooi, Boon S.
2017-01-01
matching with that of MoS2. We confirm that the grown MoS2 is a single layer from optical and structural analyses using micro-Raman spectroscopy and scanning transmission electron microscopy. The band offset parameters VBO and CBO at the In0.15Al0.85N/MoS2
International Nuclear Information System (INIS)
1998-11-01
The gaseous effluents from the fuel reprocessing plant of Cogema-La Hague (France) are regularly measured and controlled. This paper reports on three press releases: the one of Cogema from November 6, 1998 concerning the impact of these effluents and the results of 85 Kr measurements performed in the vicinity of the facility, and the two communiques of the French office of protection against ionizing radiations (OPRI) from November 13 and 20, 1998 relative to the environmental and human impacts of the 85 Kr releases from the La Hague facility. (J.S.)
Preliminary Assessment of Spatial Competition in the Market for E85
Energy Technology Data Exchange (ETDEWEB)
Bentley Clinton
2017-02-01
The Preliminary Assessment of Spatial Competition in the Market for E85 presentation and supplementary report from the U.S. Department of Energy’s National Renewable Energy Laboratory examine how the spacing of E85 fueling stations impacts E85 retail pricing. The analysis finds an inverse correlation between station density and E85 prices, with local competition putting downward pressure on E85 prices. A gas station with E85 whose nearest competitor is within a 0.5 mile radius is associated with a lower E85 price per gallon than an otherwise identical station with E85 whose nearest competitor is farther away. The analysis also finds a higher level of correlation between E85 and both E10 and wholesale gasoline prices than with ethanol costs. This indicates that E85 may, in fact, be priced with respect to its substitute fuel, and not based on the cost of its inputs. These findings help identify key trends and barriers in E85 markets and highlight data gaps that, if addressed, could help enable competitive E85 markets. The analysis was released in February 2017 and uses national and Minnesota-specific price data.
Long term storage techniques for 85Kr
International Nuclear Information System (INIS)
Foster, B.A.; Pence, D.T.; Staples, B.A.
1975-01-01
As new nuclear fuel reprocessing plants go on stream, the collection of fission product 85 Kr will be required to avoid potential local release problems and long-term atmospheric buildup. Storage of the collected 85 Kr for a period of at least 100 years will be necessary to allow approximately 99.9 percent decay before it is released. A program designed to develop and evaluate proposed methods for long-term storage of 85 Kr is discussed, and the results of a preliminary evaluation of three methods, high pressure steel cylinders, zeolite encapsulation, and clathrate inclusion are presented. (U.S.)
Zhu, Zhi; Song, Zhen-Hui; Cao, Li-Ting; Wang, Yong; Zhou, Wen-Zhang; Zhou, Pei; Zuo, Fu-Yuan
2018-04-01
This study was conducted to evaluate effects of traditional Chinese medicine formula (TCMF) combined with several herbs on ruminal fermentation, enzyme activities and nutrient digestibility. Twenty finishing bulls were assigned to control or different TCMFs (Yufeisan-1, -2, -3; 2.5% dry matter (DM) in concentrate). Results showed that DM intake was higher (P < 0.05) in the Yufeisan-3 group than others. Compared to control, apparent digestibility of crude protein and neutral detergent fiber were increased (P < 0.05) by Yufeisan-3. No changes were observed in ruminal pH, concentrations of ammonia-N, microbial crude protein and total volatile fatty acid, whereas ratio of acetate to propionate was lower (P < 0.05) and propionate proportion tended to be higher (P < 0.1) in three TCMFs than control. Ruminal xylanase (P = 0.061) and carboxymethylcellulase (P < 0.05) activities were higher in Yufeisan-3 than control. No changes were observed in abundance of total bacteria, fungi and protozoa, whereas Fibrobacter succinogenes (P = 0.062) and Ruminococcus flavefaciens (P < 0.05) were increased and total methanogens was reduced (P = 0.069) by Yufeisan-3 compared to control. Yufeisan-3 improved nutrient digestibility and ruminal enzyme activity, and modified fermentation and microbial community, maybe due to the presence of Herba agastaches, Cortex phellodendri and Gypsum fibrosum. © 2018 Japanese Society of Animal Science.
Wang, Cong; Liu, Qiang; Guo, Gang; Huo, WenJie; Ma, Le; Zhang, YanLi; Pei, CaiXia; Zhang, ShuanLin; Wang, Hao
2016-12-01
The present experiment was undertaken to determine the effects of dietary addition of rumen-protected folic acid (RPFA) on ruminal fermentation, nutrient degradability, enzyme activity and the relative quantity of ruminal cellulolytic bacteria in growing beef steers. Eight rumen-cannulated Jinnan beef steers averaging 2.5 years of age and 419 ± 1.9 kg body weight were used in a replicated 4 × 4 Latin square design. The four treatments comprised supplementation levels of 0 (Control), 70, 140 and 210 mg RPFA/kg dietary dry matter (DM). On DM basis, the ration consisted of 50% corn silage, 47% concentrate and 3% soybean oil. The DM intake (averaged 8.5 kg/d) was restricted to 95% of ad libitum intake. The intake of DM, crude protein (CP) and net energy for growth was not affected by treatments. In contrast, increasing RPFA supplementation increased average daily gain and the concentration of total volatile fatty acid and reduced ruminal pH linearly. Furthermore, increasing RPFA supplementation enhanced the acetate to propionate ratio and reduced the ruminal ammonia N content linearly. The ruminal effective degradability of neutral detergent fibre from corn silage and CP from concentrate improved linearly and was highest for the highest supplementation levels. The activities of cellobiase, xylanase, pectinase and α-amylase linearly increased, but carboxymethyl-cellulase and protease were not affected by the addition of RPFA. The relative quantities of Butyrivibrio fibrisolvens, Ruminococcus albus, Ruminococcus flavefaciens and Fibrobacter succinogenes increased linearly. With increasing RPFA supplementation levels, the excretion of urinary purine derivatives was also increased linearly. The present results indicated that the supplementation of RPFA improved ruminal fermentation, nutrient degradability, activities of microbial enzymes and the relative quantity of the ruminal cellulolytic bacteria in a dose-dependent manner. According to the conditions of this
Preliminary Assessment of Spatial Competition in the Market for E85: Presentation Supplement
Energy Technology Data Exchange (ETDEWEB)
Clinton, Bentley [National Renewable Energy Lab. (NREL), Golden, CO (United States); Johnson, Caley [National Renewable Energy Lab. (NREL), Golden, CO (United States); Moriarty, Kristi [National Renewable Energy Lab. (NREL), Golden, CO (United States); Newes, Emily [National Renewable Energy Lab. (NREL), Golden, CO (United States); Vimmerstedt, Laura [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-02-01
The Preliminary Assessment of Spatial Competition in the Market for E85 presentation and supplementary report from the U.S. Department of Energy’s National Renewable Energy Laboratory examine how the spacing of E85 fueling stations impacts E85 retail pricing. The analysis finds an inverse correlation between station density and E85 prices, with local competition putting downward pressure on E85 prices. A gas station with E85 whose nearest competitor is within a 0.5 mile radius is associated with a lower E85 price per gallon than an otherwise identical station with E85 whose nearest competitor is farther away. The analysis also finds a higher level of correlation between E85 and both E10 and wholesale gasoline prices than with ethanol costs. This indicates that E85 may, in fact, be priced with respect to its substitute fuel, and not based on the cost of its inputs. These findings help identify key trends and barriers in E85 markets and highlight data gaps that, if addressed, could help enable competitive E85 markets. The analysis was released in February 2017 and uses national and Minnesota-specific price data.
Effects of feeding whole linseed on ruminal fatty acid composition and microbial population in goats
Directory of Open Access Journals (Sweden)
Kamaleldin Abuelfatah
2016-12-01
Full Text Available The objective of the present study was to evaluate the effect of feeding different levels of whole linseed, as a source of n-3 polyunsaturated fatty acids (PUFA, on ruminal fatty acid composition and microbial population in the goat. Twenty-four crossbred Boer goats were assigned to 3 dietary treatments: L0 (control, L10 and L20 containing 0, 10%, or 20% whole linseed, respectively. The ruminal pH and concentration of total volatile fatty acids (VFA were not affected by dietary treatments. The feeding of L10 and L20 diets produced higher (P < 0.05 molar proportions of acetate and lower (P < 0.05 molar proportions of butyrate and valerate than the L0 diet. Molar proportions of myristic acid (C14:0 and palmitic acid (C16:0 were lower (P < 0.05 in the rumen of goats offered L10 and L20 diets than the control diet. However, stearic acid (C18:0, vaccenic acid (C18:1 trans-11, conjugated linoleic acid (CLA, C18:2 trans-10, cis-12 and α-lenolenic acid (C18:3 n-3 were higher (P < 0.05 in the rumen of goats fed L10 and L20 than L0. Both inclusion levels of linseed in the diet (L10 and L20 reduced the ruminal total bacteria, methanogens, and protozoa compared with L0 (P < 0.05. The effect of the dietary treatments on cellulolytic bacteria, varied between the individual species. Both inclusion levels of linseed resulted in a significant decrease (P < 0.05 in the population of Fibrobacter succinogenes, and Rumunococus flavefaciens compared with L0, with no significant difference between the groups fed linseed diets. The population of Rumunococus albus was not affected by the different dietary treatments. It was concluded that inclusion of whole linseed in the diet of goats could increase the concentration of PUFA in the rumen, and decrease the population of F. succinogenes, R. flavefaciens, methanogens and protozoa in rumen liquid of goats.
Rinke de Wit, T. F.; Bekelie, S.; Osland, A.; Wieles, B.; Janson, A. A.; Thole, J. E.
1993-01-01
The genes for two novel members (designated 85A and 85C) of the Mycobacterium leprae antigen 85 complex family of proteins and the gene for the closely related M. leprae MPT51 protein were isolated. The complete DNA sequence of the M. leprae 85C gene and partial sequences of the 85A and MPT51 genes
On the economic sustainability of ethanol E85
International Nuclear Information System (INIS)
Tatum, Shaun W.; Skinner, Sarah J.; Jackson, John D.
2010-01-01
Several studies have considered the sustainability of corn-based ethanol as produced in the US as a major fuel source from a technical perspective. However, not much attention has been paid to the market-based aspects of corn-based ethanol as a sustainable fuel. We address this question by offering an econometric analysis of the E85 (apparently the most viable of the potential substitutes for gasoline) market using demand and supply analysis. Reduced form price equation estimates indicate that the cross elasticity of E85's price with respect to the price of gasoline does not differ significantly from unity, so that any rise in gasoline prices will be matched (in percentage terms) by a corresponding rise in the price of E85. Thus, given the current market, which includes significant government subsidy, the prospect that E85 will ever be price competitive with gasoline is indeed dim. (author)
On the economic sustainability of ethanol E85
Energy Technology Data Exchange (ETDEWEB)
Tatum, Shaun W.; Skinner, Sarah J.; Jackson, John D.
2010-11-15
Several studies have considered the sustainability of corn-based ethanol as produced in the US as a major fuel source from a technical perspective. However, not much attention has been paid to the market-based aspects of corn-based ethanol as a sustainable fuel. We address this question by offering an econometric analysis of the E85 (apparently the most viable of the potential substitutes for gasoline) market using demand and supply analysis. Reduced form price equation estimates indicate that the cross elasticity of E85's price with respect to the price of gasoline does not differ significantly from unity, so that any rise in gasoline prices will be matched (in percentage terms) by a corresponding rise in the price of E85. Thus, given the current market, which includes significant government subsidy, the prospect that E85 will ever be price competitive with gasoline is indeed dim. (author)
11 CFR 100.85 - Legal or accounting services to political party committees.
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Legal or accounting services to political party committees. 100.85 Section 100.85 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) Exceptions to Contributions § 100.85 Legal or accounting services to political party...
Energy Technology Data Exchange (ETDEWEB)
Tran, Timothy H. [Cornell University, Ithaca, New York 14853-1301 (United States); Krishnamoorthy, Kalyanaraman; Begley, Tadhg P., E-mail: begley@tamu.edu [Texas A& M University, College Station, TX 77842 (United States); Ealick, Steven E., E-mail: begley@tamu.edu [Cornell University, Ithaca, New York 14853-1301 (United States)
2011-10-01
MetY is the first reported structure of an O-acetylhomoserine sulfhydrylase that utilizes a protein thiocarboxylate intermediate as the sulfur source in a novel methionine-biosynthetic pathway instead of catalyzing a direct sulfhydrylation reaction. O-Acetylhomoserine sulfhydrylase (OAHS) is a pyridoxal 5′-phosphate (PLP) dependent sulfide-utilizing enzyme in the l-cysteine and l-methionine biosynthetic pathways of various enteric bacteria and fungi. OAHS catalyzes the conversion of O-acetylhomoserine to homocysteine using sulfide in a process known as direct sulfhydrylation. However, the source of the sulfur has not been identified and no structures of OAHS have been reported in the literature. Here, the crystal structure of Wolinella succinogenes OAHS (MetY) determined at 2.2 Å resolution is reported. MetY crystallized in space group C2 with two monomers in the asymmetric unit. Size-exclusion chromatography, dynamic light scattering and crystal packing indicate that the biological unit is a tetramer in solution. This is further supported by the crystal structure, in which a tetramer is formed using a combination of noncrystallographic and crystallographic twofold axes. A search for structurally homologous proteins revealed that MetY has the same fold as cystathionine γ-lyase and methionine γ-lyase. The active sites of these enzymes, which are also PLP-dependent, share a high degree of structural similarity, suggesting that MetY belongs to the γ-elimination subclass of the Cys/Met metabolism PLP-dependent family of enzymes. The structure of MetY, together with biochemical data, provides insight into the mechanism of sulfur transfer to a small molecule via a protein thiocarboxylate intermediate.
33 CFR 173.85 - Fees levied by the Coast Guard.
2010-07-01
.... 173.85 Section 173.85 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) BOATING SAFETY VESSEL NUMBERING AND CASUALTY AND ACCIDENT REPORTING Issue of Certificate of.... (b) Fees are payable by check or money-order made payable to the “U.S. Coast Guard”; by major credit...
Directory of Open Access Journals (Sweden)
Xiang H. Zhao
2014-03-01
Full Text Available A rumen simulation technique apparatus with eight 800 mL fermentation vessels was used to investigate the effects of rumen degradable protein (RDP level and non-fibre carbohydrate (NFC type on ruminal fermentation, microbial growth, and populations of ruminal cellulolytic bacteria. Treatments consisted of two NFC types (starch and inulin supplemented with 0 g/d (low RDP or 1.56 g/d (high RDP sodium caseinate. No significant differences existed among dietary treatments in the apparent disappearance of dietary nutrients except for dietary N, which increased with increased dietary RDP (P<0.001. Compared with starch, inulin treatments reduced the molar proportion of acetate (P<0.001, the acetate:propionate ratio (P<0.001, and methane production (P=0.006, but increased the butyrate proportion (P<0.001. Increased dietary RDP led to increases in production of total volatile fatty acid (P=0.014 and methane (P=0.050, various measures of N (P≤0.046, and 16s rDNA copy numbers of Ruminococcus flavefaciens (P≤0.010. Non-fibre carbohydrate source did not affect daily microbial N flow regardless of dietary RDP, but ammonia N production was lower for inulin than for starch treatments under high RDP conditions (P<0.001. Compared with starch treatments, inulin depressed the copy numbers of Fibrobacter succinogenes in solid fraction (P=0.023 and R. flavefaciens in liquid (P=0.017 and solid fractions (P=0.007, but it increased the carboxymethylcellulase activity in solid fraction (P=0.045. Current results suggest that starch and inulin differ in ruminal volatile fatty acid fermentation but have similar effects on ruminal digestion and microbial synthesis in vitro, although inulin suppressed the growth of partial ruminal cellulolytic bacteria.
38 CFR 3.953 - Pub. L. 85-56 and Pub. L. 85-857.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Pub. L. 85-56 and Pub. L... ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation Protection § 3.953 Pub. L. 85-56 and Pub. L. 85-857. (a) In receipt of or entitled to receive benefits on December 31, 1958. Any person...
NCBI nr-aa BLAST: CBRC-DNOV-01-2483 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2483 ref|NP_906290.1| PUTATIVE TWO-COMPONENT SENSOR [Wolinella succino...genes DSM 1740] emb|CAE09190.1| PUTATIVE TWO-COMPONENT SENSOR [Wolinella succinogenes] NP_906290.1 8.6 34% ...
Kern, Melanie; Simon, Jörg
2016-09-01
Sensing potential nitrogen-containing respiratory substrates such as nitrate, nitrite, hydroxylamine, nitric oxide (NO) or nitrous oxide (N2 O) in the environment and subsequent upregulation of corresponding catabolic enzymes is essential for many microbial cells. The molecular mechanisms of such adaptive responses are, however, highly diverse in different species. Here, induction of periplasmic nitrate reductase (Nap), cytochrome c nitrite reductase (Nrf) and cytochrome c N2 O reductase (cNos) was investigated in cells of the Epsilonproteobacterium Wolinella succinogenes grown either by fumarate, nitrate or N2 O respiration. Furthermore, fumarate respiration in the presence of various nitrogen compounds or NO-releasing chemicals was examined. Upregulation of each of the Nap, Nrf and cNos enzyme systems was found in response to the presence of nitrate, NO-releasers or N2 O, and the cells were shown to employ three transcription regulators of the Crp-Fnr superfamily (homologues of Campylobacter jejuni NssR), designated NssA, NssB and NssC, to mediate the upregulation of Nap, Nrf and cNos. Analysis of single nss mutants revealed that NssA controls production of the Nap and Nrf systems in fumarate-grown cells, while NssB was required to induce the Nap, Nrf and cNos systems specifically in response to NO-generators. NssC was indispensable for cNos production under any tested condition. The data indicate dedicated signal transduction routes responsive to nitrate, NO and N2 O and imply the presence of an N2 O-sensing mechanism. © 2015 Society for Applied Microbiology and John Wiley & Sons Ltd.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Principal. 85.995 Section 85.995 Education Office of...) Definitions § 85.995 Principal. Principal means— (a) An officer, director, owner, partner, principal investigator, or other person within a participant with management or supervisory responsibilities related to a...
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Gambling. 27.85 Section 27.85 Wildlife and... WILDLIFE REFUGE SYSTEM PROHIBITED ACTS Disturbing Violations: Personal Conduct § 27.85 Gambling. Gambling in any form, or the operation of gambling devices, for money or otherwise, on any national wildlife...
Klevenhusen, Fenja; Meile, Leo; Kreuzer, Michael; Soliva, Carla R
2011-10-01
Before being able to implement effective ruminal methane mitigation strategies via feed supplementation, the assessment of side effects on ruminal fermentation and rumen microbial populations is indispensable. In this respect we investigated the effects of monolaurin, a methane-mitigating lipid, on methanogens and important carbohydrate-degrading bacteria present in ruminal fluid of dairy cattle in continuous culture employing the rumen simulation technique. In six experimental runs, each lasting for 10 days, four diets with different carbohydrate composition, based on hay, maize, wheat and a maize-wheat mixture, either remained non-supplemented or were supplemented with monolaurin and incubated in a ruminal-fluid buffer mixture. Incubation liquid samples from days 6 to 10 of incubation were analyzed with relative quantitative polymerase chain reaction (qPCR) of 16S rRNA genes to assess monolaurin-induced shifts in specific rumen microbial populations in relation to the corresponding non-supplemented diets. Monolaurin completely inhibited Fibrobacter succinogenes in all diets while the response of the other cellulolytic bacteria varied in dependence of the diet. Megasphaera elsdenii remained unaffected by monolaurin in the two diets containing maize, but was slightly stimulated by monolaurin with the wheat and largely with the hay diet. The supply of monolaurin suppressed Methanomicrobiales below the detection limit with all diets, whereas relative 16S rRNA gene copy numbers of Methanobacteriales increased by 7-fold with monolaurin in case of the hay diet. Total Archaea were decreased by up to over 90%, but this was significant only for the wheat containing diets. Thus, monolaurin exerted variable effects mediated by unknown mechanisms on important ruminal microbes involved in carbohydrate degradation, along with its suppression of methane formation. The applicability of monolaurin for methane mitigation in ruminants thus depends on the extent to which adverse
Energy Technology Data Exchange (ETDEWEB)
Sandstrom, Matthew M.
2012-03-30
This is the final report for a grant-funded project to financially assist and otherwise provide support to projects that increase E85 infrastructure in Michigan at retail fueling locations. Over the two-year project timeframe, nine E85 and/or flex-fuel pumps were installed around the State of Michigan at locations currently lacking E85 infrastructure. A total of five stations installed the nine pumps, all providing cost share toward the project. By using cost sharing by station partners, the $200,000 provided by the Department of Energy facilitated a total project worth $746,332.85. This project was completed over a two-year timetable (eight quarters). The first quarter of the project focused on project outreach to station owners about the incentive on the installation and/or conversion of E85 compatible fueling equipment including fueling pumps, tanks, and all necessary electrical and plumbing connections. Utilizing Clean Energy Coalition (CEC) extensive knowledge of gasoline/ethanol infrastructure throughout Michigan, CEC strategically placed these pumps in locations to strengthen the broad availability of E85 in Michigan. During the first and second quarters, CEC staff approved projects for funding and secured contracts with station owners; the second through eighth quarters were spent working with fueling station owners to complete projects; the third through eighth quarters included time spent promoting projects; and beginning in the second quarter and running for the duration of the project was spent performing project reporting and evaluation to the US DOE. A total of 9 pumps were installed (four in Elkton, two in Sebewaing, one in East Lansing, one in Howell, and one in Whitmore Lake). At these combined station locations, a total of 192,445 gallons of E85, 10,786 gallons of E50, and 19,159 gallons of E30 were sold in all reporting quarters for 2011. Overall, the project has successfully displaced 162,611 gallons (2,663 barrels) of petroleum, and reduced
International Nuclear Information System (INIS)
Rozanski, K.; Florkowski, T.
1978-01-01
The possibility of 85 Kr dating of groundwater is being investigated. The method of gas extraction from 200 to 300 litres of water sample has been developed. The Argon and Krypton mixture, separated from the gas extracted from water, was counted in a 1.5 ml volume proportional counter. The amount of krypton gas in the counter was determined by mass spectrometry. A number of surface and groundwater samples were analyzed indicating an 85 Kr concentration ranging from present atmospheric content (river water) to zero values. 85 Kr 'blank value' was determined to be about 5 per cent of present 85 Kr atmospheric content. For groundwater samples, the mean residence time in the system was calculated assuming the exponential model and known 85 Kr input function. Further improvement of the method should bring higher yield of krypton separation and lower volume of water necessary for analysis. (orig.) [de
Directory of Open Access Journals (Sweden)
Wan Heo
2016-03-01
Full Text Available This study was aimed to evaluate the stability of conjugated linoleic acids (CLAs by nano-encapsulation against in vitro ruminal biohydrogenation by microbial enzymatic conversion. CLAs (free fatty acid form of CLA [CLA-FFA], nano-encapsulated CLA-FFA, triglyceride form of CLA [CLA-TG], and nano-encapsulated CLA-TG were used in the in vitro fermentation experiments. When Butyrivibrio fibrisolvens (B. fibrisolvens was incubated with CLA-FFAs, the concentrations of cis-9, trans-11 CLA and vaccenic acid (VA slightly was decreased and increased by nano-encapsulation, respectively. When B. fibrisolvens was incubated with CLA-TG, the concentrations of cis-9, trans-11 CLA and VA decreased, but these were increased when B. fibrisolvens was incubated with nano-encapsulated CLA-TG. The nano-encapsulation was more effective against the in vitro biohydrogenation activity of B.fibrisolvens incubated with CLA-FFA than with CLA-TG. In the in vitro ruminal incubation test, the total gas production and concentration of total volatile fatty acids incubated with nano-encapsulated CLA-FFA and CLA-TG were increased significantly after 24 h incubation (p<0.05. Nano-encapsulated CLA-FFA might, thus, improve the ruminal fermentation characteristics without adverse effects on the incubation process. In addition, nano-encapsulated CLA-FFA increased the population of Fibrobacter succinogenes and decreased the population of B. fibrisolvens population. These results indicate that nano-encapsulation could be applied to enhance CLA levels in ruminants by increasing the stability of CLA without causing adverse effects on ruminal fermentation.
Energy Technology Data Exchange (ETDEWEB)
Puig, J R; Sandier, J [Centre d' Etudes Nucleaires de Saclay (France)
1962-01-15
Krypton-85, a {beta}-emitter with a long half-life and low biological hazard, has considerable industrial potentialities. It is difficult, however, to manufacture sources since the element occurs in gaseous form and cannot be chemically fixed. The authors describe a method of krypton-fixation in a macromolecular matrix formed by mass polymerization of a liquid monomer containing krypton; they also give an account of the preparation of two types of source produced in this way-one enclosed in polystyrene, the other in polyvinyl acetate. Such sources lose krypton; the activity of the first decreases by 8 % daily, that of the second by 3 % daily. These apparent decays enable the diffusion coefficients of krypton in these polymers to be calculated. Diffusion appears to be prevented by the cross-linkages which exist in the polymers. (author) [French] Le krypton-85, emetteur {beta} de longue periode et de faible danger biologique, offre des avantages importants pour une utilisation industrielle. Mais la fabrication de sources est difficile du fait que cet element se presente sous forme gazeuse et qu'il ne peut etre fixe chimiquement. Les auteurs exposent une methode de fixation du krypton dans une matrice macromoleculaire formee par la polymerisation en masse d'un monomere liquide contenant le krypton, et decrivent les preparations de deux types de sources realisees sur ce principe - l'une enfermee dans du polystyrene, l'autre dans de l'acetate de polyvinyle. Les sources ainsi obtenues laissent echapper du krypton; leur activite diminue de 8% par jour pour la premiere et de 3% par jour pour la seconde. Ces decroissances apparentes permettent de calculer les coefficients de diffusion du krypton dans ces polymeres. Celle-ci parait empechee par les liaisons de pontage existant dans le polymere. (author) [Spanish] El cripton-85 es un emisor beta de periodo largo y poco peligroso desde el punto de vista biologico, que ofrece considerables ventajas para su empleo en la
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557359 >1mwmA 3 314 11 322 5e-28 ... ref|NP_907174.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN (FRAGMENT) [Wolinella ... succinogenes DSM 1740] emb|CAE10074.1| PUTATIVE ROD ... SHAPE-DETERMIN...ING PROTEIN (FRAGMENT) [Wolinella ... succinogenes] ... Length = 312 ...
Coalition Cooperation Defines Roadmap for E85 and Biodiesel
Energy Technology Data Exchange (ETDEWEB)
2007-06-01
This Clean Cities success story relates how Colorado's Colorado Biofuels Coalition was formed and provides guidance on forming other such coalitions. This Colorado's coalition sucessfully increase the number of fueling stations providing biofuels and has goals to the number even more. Plans also include assisting with financing infrastructure, making alternative fuels available to more fleets, and educating about E85 and biodiesel use.
30 CFR 7.85 - Critical characteristics.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Critical characteristics. 7.85 Section 7.85 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND... Underground Coal Mines § 7.85 Critical characteristics. The following critical characteristics shall be...
Directory of Open Access Journals (Sweden)
M.V. Santos
2008-06-01
Full Text Available Objetivou-se avaliar a tolerância de Tifton 85 e Brachiaria brizantha ao glyphosate e verificar o controle de B. brizantha em área de pastagem de Tifton 85 já estabelecida. O delineamento experimental foi em blocos casualizados, com quatro repetições, em que se testaram as doses: 0, 720, 1.440, 2.160 e 2.880 g ha-1 de glyphosate. Cada parcela possuía dimensões de 3,5 m de comprimento por 3,0 m de largura, totalizando 10,5 m², com área útil de 7,5 m ². A eficiência do herbicida no controle de B. brizantha e o nível de intoxicação nas plantas de Tifton 85 foram avaliados 15, 30 e 60 dias após aplicação (DAA, mediante escala de 0 a 100, em que 0 é ausência de controle e/ou intoxicação e 100, controle total ou morte das plantas. Para avaliação da produção e do potencial de rebrota das forrageiras, as plantas de ambas as espécies foram colhidas aos 300 DAA e secas em estufa. Observou-se controle acima de 90% das plantas de B. brizantha a partir das doses de 1.473,75 e 1.721,25 g ha-1 de glyphosate, aos 30 e 60 DAA, respectivamente. As porcentagens de intoxicação das plantas de Tifton 85, referente a estas doses de controle de B. brizantha, foram, respectivamente, de 24,90 e 4,13% aos 30 e 60 DAA. Além disso, aos 60 DAA, para a maior dose avaliada (2.880 g ha-1 de glyphosate foi observada intoxicação das plantas de Tifton 85 de apenas 18,22%. Aos 300 DAA, observou-se ausência de produção de massa seca de B. brizantha a partir da dose de 2.160 g ha-1 do herbicida, devido ao eficiente controle. Os resultados evidenciam maior tolerância das plantas de Tifton 85 ao glyphosate em relação às plantas de B. brizantha, possibilitando o controle desta espécie em pastagem estabelecida de Tifton 85, sem causar danos à forrageira cultivada.This study aimed to evaluate Tifton 85 and Brachiaria brizantha tolerance glyphosate and verity Brachiaria brizantha control in an established Tifton 85 pasture area. Rates of 0; 720; 1
Structure and origin of the 85 degrees E ridge
Digital Repository Service at National Institute of Oceanography (India)
Ramana, M.V.; Subrahmanyam, V.; Chaubey, A.K.; Ramprasad, T.; Sarma, K.V.L.N.S.; Krishna, K.S.; Desa, M.; Murty, G.P.S.; Subrahmanyam, C
The submerged 85 degrees E Ridge in the Bay of Bengal trends approximately N-S between 19 degrees N and 6 degrees N latitudes. Off the southeast coast of Sri Lanka it takes an arcuate shape and seems to terminate with the northweard extension...
Eesti piirivalve tähistas 85. aastapäeva
2007-01-01
President Toomas Hendrik Ilvese sõnavõtust Eesti kutselise piirivalve 85. aastapäeva tähistamise pidulikul kontsertaktusel 1. novembril 2007 Estonia kontserdisaalis. Ingl. k. ilmunud ka: Vaba Eesti Sõna 8. nov. 2007, lk. 12, pealk.: President Ilves thanked the Estonian border guards
Energy Technology Data Exchange (ETDEWEB)
1985-01-01
The South African Association for Food Science and Technology held the SAAFOST '85 conference from 19-22 August 1985 in Pretoria. This conference on food and food preservation includes several papers on the different aspects of food irradiation which include radicidation, radappertization and radicidation.
International Nuclear Information System (INIS)
1985-01-01
The South African Association for Food Science and Technology held the SAAFOST '85 conference from 19-22 August 1985 in Pretoria. This conference on food and food preservation includes several papers on the different aspects of food irradiation which include radicidation, radappertization and radicidation
Directory of Open Access Journals (Sweden)
Odilon Gomes Pereira
2012-01-01
Full Text Available Objetivou-se avaliar os índices de crescimento do capim-tifton 85 adubado com quatro doses de nitrogênio (0, 33, 66, 100, e 133 kg/ha de N e colhido em três alturas da planta (30, 40 e 50 cm. O delineamento experimental utilizado foi inteiramente casualizado em esquema de parcelas subdivididas com três repetições. As doses de nitrogênio corresponderam às parcelas e as alturas na data de corte, às subparcelas. Para todas as variáveis analisadas, a interação dose de N × altura da planta não foi significativa. A taxa assimilatória líquida e a taxa de crescimento relativo do capim-tifton 85 aumentaram com as doses de nitrogênio. A razão de área foliar (RAF decresceu linearmente com a altura de corte das plantas, mas aumentou, também de forma linear, com a dose de nitrogênio. De modo linear, a razão de peso foliar decresceu com a altura de corte da planta forrageira e aumentou com a dose de nitrogênio. A área foliar específica do capim-tifton 85 foi influenciada de forma linear e positiva apenas pela adubação nitrogenada. O índice de área foliar (IAF do capim-tifton 85 aumentou cerca de 0,05 unidade a cada centímetro de incremento na altura de corte das plantas. Houve resposta quadrática da dose de nitrogênio no IAF do capim-tifton 85. O acréscimo na altura do capim-tifton 85 na época do corte reduz a participação de lâmina foliar na forragem. A adubação nitrogenada aumenta a taxa de crescimento do capim-tifton 85, portanto, para assegurar colheita eficiente da forragem, ao aumentar a dose de nitrogênio, é necessário reduzir o intervalo de colheita.The objective this study was to evaluate the growth rates of Tifton 85 bermudagrass under four nitrogen levels (0, 33, 66, 100, and 133 kg/ha N and harvested at three plant heights (30, 40 and 50 cm. The experimental design was completely randomized in a split plot scheme with three replications. Nitrogen rates were set in the plots and plants heights in the
24 CFR 85.25 - Program income.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Program income. 85.25 Section 85.25... TRIBAL GOVERNMENTS Post-Award Requirements Financial Administration § 85.25 Program income. (a) General. Grantees are encouraged to earn income to defray program costs. Program income includes income from fees...
International Nuclear Information System (INIS)
Kolar, J.; Strizik, L.; Kohoutek, T.; Wagner, T.; Voyiatzis, G. A.; Chrissanthopoulos, A.; Yannopoulos, S. N.
2013-01-01
Photostructural changes—the hallmark of non-crystalline chalcogenides—are in essence the basis of a number of photoinduced effects, i.e., changes of their physical properties, which are exploited in a variety of applications, especially in photonics and optoelectronics. Despite the vast number of investigations of photostructural changes, there is currently lack of systematic studies on how the thermal history, which affects glass structure, modifies the extent of photostructural changes. In this article, we study the role of thermal history on photostructural changes in glassy As 15 S 85 . This particular sulfur-rich composition has been chosen based on the colossal photostructural response it exhibits under near-band gap light irradiation, which inherently originates from its nanoscale phase-separated nature. To control the thermal history, the glass was quenched to various temperatures and each of these quenched products was annealed under four different conditions. Off-resonant Raman scattering was used to study the equilibrium study of each product. Structural changes of interest involve changes of the sulfur atoms participating into S 8 rings and S n chains. Their ratio was found to depend on quenching/annealing conditions. Near-band gap light was used to perturb the rings-to-chain ratio and at the same time to record these changes through Raman scattering, revealing an intricate behavior of photostructural changes. Ab initio calculations were employed to determine the stability of various sulfur clusters/molecules thus aiding the correlation of the particular photo-response of glassy As 15 S 85 with its structural constituents
34 CFR 85.920 - Civil judgment.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Civil judgment. 85.920 Section 85.920 Education Office...) Definitions § 85.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of... creates a civil liability for the complained of wrongful acts, or a final determination of liability under...
50 CFR 85.41 - Allowable costs.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Allowable costs. 85.41 Section 85.41... Use/Acceptance of Funds § 85.41 Allowable costs. (a) Allowable grant costs are limited to those costs... applicable Federal cost principles in 43 CFR 12.60(b). Purchase of informational signs, program signs, and...
20 CFR 401.85 - Exempt systems.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Exempt systems. 401.85 Section 401.85... INFORMATION The Privacy Act § 401.85 Exempt systems. (a) General policy. The Privacy Act permits certain types of specific systems of records to be exempt from some of its requirements. Our policy is to exercise...
Energy Technology Data Exchange (ETDEWEB)
Pannetier, R [Commissariat a l' Energie Atomique, 92 - Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1968-06-01
Techniques for sampling and measuring krypton-85 have been developed which allowed to determine its geographical distribution. From its use as a tracer, an evaluation of the air masses which cross over the subtropical fronts has been derived. Besides, the stratospheric character of air pollution by krypton-85 at the level of the antarctic soil has been shown out. Levels of krypton-85 seem to point out to an underestimation of the assessment of nuclear explosion fission energies as adopted by the United Nations Scientific committee on the effects of atomic radiation and emphasize the need to set limits as soon as possible to the amounts of krypton-85 released to the atmosphere by fuel-reprocessing plants. (author) [French] La mise au point de techniques de prelevement et de mesure du krypton-85 atmospherique a permis de determiner sa repartition geographique. De son utilisation comme traceur on deduit une evaluation des masses d'air qui traversent les fronts subtropicaux. Par ailleurs, le caractere stratospherique de la pollution de l'air par le krypton-85 au niveau du sol antarctique est mis en evidence. Le bilan du krypton-85 semble reveler une sous-estimation du bilan des energies de fission des explosions adopte par le Comite scientifique des Nations Unies et souligne la necessite de limiter des que possible les quantites de krypton-85 rejetees dans l'atmosphere par les usines de traitement de combustibles irradies. (auteur)
2010-07-01
... 40 Protection of Environment 28 2010-07-01 2010-07-01 true [Reserved] 407.85 Section 407.85 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS CANNED AND PRESERVED FRUITS AND VEGETABLES PROCESSING POINT SOURCE CATEGORY Canned and Miscellaneous...
Environmental monitoring for krypton-85
International Nuclear Information System (INIS)
Barber, D.E.
1973-01-01
85 Kr presents unique environmental monitoring problems because it does not react with other elements and compounds at normal ambient temperatures and pressures. However, elaborate means are available to manage the 85 Kr problem, but a simpler, inexpensive approach is required if monitoring is to be accomplished at many sampling locations. This work shows that environmental monitoring for 85 Kr is possible by collecting air samples in thin plastic bags, and counting the bags for beta particle activity. The direct counting of contained samples of this type makes it possible to detect concentrations less than the public MPC for 85 Kr. The bagged-sample technique is readily adaptable to any environmental monitoring station with power to run a low-volume air pump. The idea of counting the bagged-sample directly is a new, low-cost, approach to environmental gas monitoring which may have application in environmental, clinical, and industrial situations
46 CFR 56.85-15 - Postheat treatment.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Postheat treatment. 56.85-15 Section 56.85-15 Shipping... APPURTENANCES Heat Treatment of Welds § 56.85-15 Postheat treatment. (a) Where pressure retaining components... preheat and postheat treatment requirements of Table 56.85-10 apply to the thicker of the components being...
24 CFR 85.44 - Termination for convenience.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Termination for convenience. 85.44 Section 85.44 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... § 85.44 Termination for convenience. Except as provided in § 85.43 awards may be terminated in whole or...
Decoding Computer Games: Studying “Special Operation 85”
Directory of Open Access Journals (Sweden)
Bahareh Jalalzadeh
2009-11-01
Full Text Available As other media, computer games convey messages which have tow features: explicit and implicit. Semiologically studying computer games and comparing them with narrative structures, the present study attempts to discover the messages they convey. Therefore we have studied and decoded “Special operation 85” as a semiological text. Results show that the game’s features, as naming, interests and motivations of the engaged people, and the events narrated, all lead the producers to their goals of introducing and publicizing Iranian-Islamic cultural values. Although this feature makes “Special Opreation 85” a unique game, it fails in its attempt to produce a mythical personage in Iranian-Islamic cultural context.
East African Medical Journal - Vol 85, No 3 (2008)
African Journals Online (AJOL)
Congenital Lymphoedema, Bronchiectasis And Seizure: Case Report · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Semiz, E Dagdeviren, H Ergin, I Kilic, M Cimbis, E Semiz, 145-149. http://dx.doi.org/10.4314/eamj.v85i3.9635 ...
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Employment. 85.31 Section 85.31 Public Welfare....31 Employment. No qualified individuals with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...
Apparent 85Kr ages of groundwater within the Royal watershed, Maine, USA.
Sidle, W C
2006-01-01
Specific 85Kr activity is mapped from 264 domestic and municipal wells sampled during 2002-2004 in the Royal watershed (361 km2), Maine. Gas samples are collected at 20 m, 40 m, and > 50 m interval depths within the unconfined aquifers. Gas extraction for 85Kr from wells is obtained directly via a wellhead methodology avoiding conventional collection of large sample volumes. Atmospheric 85Kr input to the recharge environment is estimated at 1.27 Bq m(-3) by time-series analyses of weighted monthly precipitation (2001-2004). Numerical simulation of Kr gas transport through the variable unsaturated zones to the water table suggests up to 12-year time lags locally, thus biasing the 85Kr groundwater ages. Apparent 85Kr ages suggest that approximately 70% of groundwater near 20 m depth was recharged less than 30 years BP (2004). Mass-age transport modeling suggests that post mid-1950s recharge penetrates to part of the basin's floor and that older groundwater seeps from the underlying fractured bedrock may occur.
40 CFR 85.1413 - Decertification.
2010-07-01
...) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1413 Decertification. (a... under 40 CFR 85.1414; or (ii) Use of the certified equipment is causing urban bus engine emissions to... purchased by an urban bus operator prior to decertification, shall be considered certified pursuant to this...
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Oxygen. 147.85 Section 147.85 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DANGEROUS CARGOES HAZARDOUS SHIPS' STORES Stowage and Other...) of oxygen may be on board a vessel engaged in industrial operations, if it is stowed on deck or in a...
Tapeinou, Anthi; Giannopoulou, Efstathia; Simal, Carmen; Hansen, Bjarke E; Kalofonos, Haralabos; Apostolopoulos, Vasso; Vlamis-Gardikas, Alexios; Tselios, Theodore
2018-01-01
Anthraquinone type compounds, especially di-substituted amino alkylamino anthraquinones have been widely studied as immunosuppressants. The anthraquinone ring is part of mitoxandrone that has been used for the treatment of multiple sclerosis (MS) and several types of tumors. A desired approach for the treatment of MS would be the immunosuppression and elimination of specific T cells that are responsible for the induction of the disease. Herein, the development of a peptide compound bearing an anthraquinone derivative with the potential to specifically destroy the encephalitogenic T cells responsible for the onset of MS is described. The compound consists of the myelin basic protein (MBP) 85-99 immunodominant epitope (MBP 85-99 ) coupled to an anthraquinone type molecule (AQ) via a disulfide (S-S) and 6 amino hexanoic acid (Ahx) residues (AQ-S-S-(Ahx) 6 MBP 85-99 ). AQ-S-S-(Ahx) 6 MBP 85-99 could bind to HLA II DRB1*-1501 antigen with reasonable affinity (IC 50 of 56 nM) The compound was localized to the nucleus of Jurkat cells (an immortalized line of human T lymphocytes) 10 min after its addition to the medium and resulted in lowered Bcl-2 levels (apoptosis). Entrance of the compound was abolished when cells were pre-treated with cisplatin, an inhibitor of thioredoxin reductase. Accordingly, levels of free thiols were elevated in the culture supernatants of Jurkat cells exposed to N-succinimidyl 3-(2-pyridyldithio) propionate coupled to (Ahx) 6 MBP 85-99 via a disulphide (SPDP-S-S-(Ahx) 6 MBP 85-99 ) but returned to normal after exposure to cisplatin. These results raise the possibility of AQ-S-S-(Ahx) 6 MBP 85-99 being used as an eliminator of encephalitogenic T cells via implication of the thioredoxin system for the generation of the toxic, thiol-containing moiety (AQ-SH). Future experiments would ideally determine whether SPDP-S-S-(Ahx) 6 MBP 85-99 could incorporate into HLA II DRB1*-1501 tetramers and neutralize encephalitogenic T cell lines sensitized to
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false State. 85.1005 Section 85.1005 Education Office of the....1005 State. (a) State means— (1) Any of the states of the United States; (2) The District of Columbia; (3) The Commonwealth of Puerto Rico; (4) Any territory or possession of the United States; or (5) Any...
Application of krypton-85 in groundwater dating
International Nuclear Information System (INIS)
Rozanski, K.
1979-01-01
The method for determination 85 Kr activity in groundwater and its application in isotope hydrology is presented. Various aspects of 85 Kr presence in the earth's ecosphere are discussed in the first part of the paper. The method for 85 Kr activity measurement in groundwater is presented in the second part of the paper. Analytical procedure consists of the following steps: extraction of the gases dissolved in water sample, separation of the Ar+Kr mixture from the gases, 85 Kr activity measurement in miniature proportional counter, mass spectrometry determination of the krypton gas volume in the proportional counter. About 7 days is necessary for complete analysis of one sample - the error of analysis not exceeds 10 per cent. The results of 85 Kr activity measurements (together with tritium and carbon 14 C determinations) in 14 different water samples allowed to verify usefulness of 85 Kr dating of young water. (author)
40 CFR 85.1410 - Changes after certification.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Changes after certification. 85.1410 Section 85.1410 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1410 Changes...
49 CFR 572.85 - Lumbar spine flexure.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Lumbar spine flexure. 572.85 Section 572.85... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) ANTHROPOMORPHIC TEST DEVICES 9-Month Old Child § 572.85 Lumbar spine flexure. (a) When subjected to continuously applied force in accordance with paragraph (b...
50 CFR 17.85 - Special rules-invertebrates.
2010-10-01
... 50 Wildlife and Fisheries 2 2010-10-01 2010-10-01 false Special rules-invertebrates. 17.85 Section 17.85 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR....85 Special rules—invertebrates. (a) Seventeen mollusks in the Tennessee River. The species in the...
Hyperfine spectra of the radioactive isotopes 81Kr and 85Kr
International Nuclear Information System (INIS)
Cannon, B.D.
1993-01-01
Isotope shifts and hyperfine constants are reported for the radioactive isotopes 81 Kr and 85 Kr and the stable isotope 83 Kr. The previously unreported nuclear moments of 81 Kr were determined to be μ I =-0.909(4) nuclear magneton and Q=+0.630(13) b from the hyperfine constants. This work increases the number of transitions for which 85 Kr hyperfine constants and isotope shifts have been measured from 1 to 4. The hyperfine anomaly for krypton reported in the previous measurement of 85 Kr hyperfine constants [H. Gerhardt et al., Hyperfine Interact. 9, 175 (1981)] is not supported by this work. The isotope shifts and hyperfine constants of 83 Kr measured in this work are in excellent agreement with previous work. Saturation spectroscopy was used to study transitions from krypton's metastable 1s 5 state to the 2p 9 , 2p 7 , and 2p 6 states. In saturation spectra, different line shapes were observed for the even- and odd-mass krypton isotopes. This even- versus odd-line-mass shape difference can be explained using the large cross section that has been reported for collisional transfer of the 1s 5 state excitation between krypton atoms. Two-color two-photon laser-induced fluorescence was used to measure the hyperfine spectra of the 1s 5- 4d 4 ' transition using the 2p 9 state as the intermediate state. This technique proved to be more sensitive than saturation spectroscopy
Lee, Shin Ja; Shin, Nyeon Hak; Jeong, Jin Suk; Kim, Eun Tae; Lee, Su Kyoung; Lee, Il Dong; Lee, Sung Sill
2018-01-01
Gelidium amansii (Lamouroux) is a red alga belonging to the family Gelidaceae and is commonly found in the shallow coasts of many East Asian countries, including Korea, China, and Japan. G. amansii has traditionally been utilized as an edible alga, and has various biological activities. The objective of this study was to determine whether dietary supplementation of G. amansii could be useful for improving ruminal fermentation. As assessed by in vitro fermentation parameters such as pH, total gas, volatile fatty acid (VFA) production, gas profile (methane, carbon dioxide, hydrogen, and ammonia), and microbial growth rate was compared to a basal diet with timothy hay. Cannulated Holstein cows were used as rumen fluid donors and 15 mL rumen fluid: buffer (1:2) was incubated for up to 72 h with four treatments with three replicates. The treatments were: control (timothy only), basal diet with 1% G. amansii extract, basal diet with 3% G. amansii extract, and basal diet with 5% G. amansii extract. Overall, the results of our study indicate that G. amansii supplementation is potentially useful for improving ruminant growth performance, via increased total gas and VFA production, but does come with some undesirable effects, such as increasing pH, ammonia concentration, and methane production. In particular, real-time polymerase chain reaction indicated that the methanogenic archaea and Fibrobacter succinogenes populations were significantly reduced, while the Ruminococcus flavefaciens populations were significantly increased at 24 h, when supplemented with G. amansii extracts as compared with controls. More research is required to elucidate what G. amansii supplementation can do to improve growth performance, and its effect on methane production in ruminants.
Directory of Open Access Journals (Sweden)
Shin Ja Lee
2018-01-01
Full Text Available Objective Gelidium amansii (Lamouroux is a red alga belonging to the family Gelidaceae and is commonly found in the shallow coasts of many East Asian countries, including Korea, China, and Japan. G. amansii has traditionally been utilized as an edible alga, and has various biological activities. The objective of this study was to determine whether dietary supplementation of G. amansii could be useful for improving ruminal fermentation. Methods As assessed by in vitro fermentation parameters such as pH, total gas, volatile fatty acid (VFA production, gas profile (methane, carbon dioxide, hydrogen, and ammonia, and microbial growth rate was compared to a basal diet with timothy hay. Cannulated Holstein cows were used as rumen fluid donors and 15 mL rumen fluid: buffer (1:2 was incubated for up to 72 h with four treatments with three replicates. The treatments were: control (timothy only, basal diet with 1% G. amansii extract, basal diet with 3% G. amansii extract, and basal diet with 5% G. amansii extract. Results Overall, the results of our study indicate that G. amansii supplementation is potentially useful for improving ruminant growth performance, via increased total gas and VFA production, but does come with some undesirable effects, such as increasing pH, ammonia concentration, and methane production. In particular, real-time polymerase chain reaction indicated that the methanogenic archaea and Fibrobacter succinogenes populations were significantly reduced, while the Ruminococcus flavefaciens populations were significantly increased at 24 h, when supplemented with G. amansii extracts as compared with controls. Conclusion More research is required to elucidate what G. amansii supplementation can do to improve growth performance, and its effect on methane production in ruminants.
Diversity of diazotrophic gut inhabitants of pikas (Ochotonidae) revealed by PCR-DGGE analysis.
Kizilova, A K; Kravchenko, I K
2014-01-01
Diazotrophic gut symbionts are considered to act as nitrogen providers for their hosts, as was shown for various termite species. Although the diet of lagomorphs, like pikas or rabbits, is very poor in nitrogen and energy, their fecal matter contains 30-40% of protein. Since our hypothesis was that pikas maintained a diazotrophic consortium in their gastrointestinal tract, we conducted the first investigation of microbial diversity in pika guts. We obtained gut samples from animals of several Ochotona species, O. hyperborea (Northern pika), O. mantchurica (Manchurian pika), and O. dauurica (Daurian pika), in order to retrieve and compare the nitrogen-fixing communities of different pika species. The age and gender of the animals were taken into consideration. We amplified 320-bp long fragments of the nifH gene using the DNA extracted directly from the colon and cecum samples of pika's gut, resolved them by DGGE, and performed phylogenetic reconstruction of 51 sequences obtained from excised bands. No significant difference was detected between the nitrogen-fixing gut inhabitants of different pika species. NifH sequences fell into two clusters. The first cluster contained the sequences affiliated with NifH Cluster I (Zehr et al., 2003) with similarity to Sphingomonas sp., Bradyrhizobium sp., and various uncultured bacteria from soil and rhizosphere. Sequences from the second group were related to Treponema sp., Fibrobacter succinogenes, and uncultured clones from the guts of various termites and belonged to NifH Cluster III. We suggest that diazotrophic organisms from the second cluster are genuine endosymbionts of pikas and provide nitrogen for further synthesis processes thus allowing these animals not to be short of protein.
Faubladier, Céline; Julliand, Véronique; Danel, Justine; Philippeau, Christelle
2013-09-28
The present study aimed at (1) describing age-related changes in faecal bacterial functional groups involved in carbohydrate degradation and in their activities in foals (n 10) from birth (day (d) 0) to 6 months (d180) and (2) investigating the effect of maternal supplementation (five mares per treatment) from d - 45 to d60 with fermented feed products on response trends over time of the foal bacterial carbohydratedegrading capacity. Maternal supplementation with fermented feed products stimulated foal growth from d0 to d60 and had an impact on the establishment of some digestive bacterial groups and their activities in foals from d0 to d5 but not in the longer term. Irrespective of the maternal treatment, total bacteria, total anaerobic, lactate-utilising and amylolytic bacteria were established immediately after birth (Panaerobes and lactate utilisers were established rapidly between d0 and d2 (P=0·021 and 0·066, respectively) and the increase in the percentage of propionate occurred earlier (P=0·013). Maternal supplementation had no effect on the establishment of fibrolytic bacteria and their activity. Cellulolytic bacteria and Fibrobacter succinogenes first appeared at d2 and d5, and increased progressively, reaching stable values at d30 and d60, respectively. From the second week of life, the increase in the molar percentage of acetate and the ratio (acetate + butyrate):propionate (P<0·05) suggested that fibrolytic activity had begun. From d60, only minor changes in bacterial composition and activities occurred, showing that the bacterial carbohydrate-degrading capacity was established at 2 months of age.
International Nuclear Information System (INIS)
1985-01-01
The energy research program 85 (EFP-85) is prepared by the Danish Ministry of Energy in order to continue the extension of the Danish energy research and development started through the former Trade Ministry's programs EM-1 (1976) and EM-2 (1978), and Ministry of Energy's programs EFP-80, EFP-81, EFP-82, EFP-83, and EFP-84. The new program is a continuation of the activities in the period 1985-87 with a total budget of 110 mio. DKK. The program gives a brief description of background, principles, organization and financing, and a detailed description of each research area. (ln)
45 CFR 81.85 - Offer of proof.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Offer of proof. 81.85 Section 81.85 Public Welfare... 80 OF THIS TITLE Hearing Procedures § 81.85 Offer of proof. An offer of proof made in connection with... identification and shall accompany the record as the offer of proof. ...
50 CFR 85.10 - Purpose and scope.
2010-10-01
...) FINANCIAL ASSISTANCE-WILDLIFE SPORT FISH RESTORATION PROGRAM CLEAN VESSEL ACT GRANT PROGRAM General § 85.10 Purpose and scope. The purpose of this part is to establish requirements for state participation in the... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Purpose and scope. 85.10 Section 85.10...
Ultra-Trace Analysis of Krypton-85
International Nuclear Information System (INIS)
Daerr, H.; Kalinowski, M.; Kohler, M.; Sahling, P.
2010-01-01
To strengthen the efficiency and effectiveness of nuclear safeguards for detecting undeclared nuclear material and activities we propose to use the radioactive krypton isotope Krypton-85 as a tracer for clandestine plutonium production. The main idea is to detect inexplicable atmospheric Kr85 concentration using the novel technology atom trap trace analysis (ATTA) in order to detect an undeclared reprocessing facility. The Additional Protocol (INFCIRC/540, 1997) establishes the possibility to take environmental samples. Krypton-85 has a combination of unique features which makes it an ideal tracer for plutonium separation activities anywhere in the world. It is always generated along with plutonium and 99.9% remains within the fuel cladding. Due to its half-life of 10.76 years, significant amounts of krypton-85 still remain in the spent fuel even after long cooling times. Krypton is not removed from the atmosphere by any processes like chemical reactions or wash-out. Furthermore, there are no other relevant sources of krypton-85 besides of reprocessing. The novel technology of atom trap trace analysis (ATTA) has been demonstrated by the physics group at Argonne National Laboratory in 1999. This is an ultra-sensitive trace analysis technique able to detect single krypton atoms. We are setting up an ATTA apparatus in our laboratory, which is designed to fulfill all requirements to detect clandestine plutonium production. Our goal is to determine Krypton-85 concentration of one liter samples of atmospheric air with an analysis time of 3 hours. This sample volume reduction is a significant step, since one liter can be taken as a grab sample by sucking it directly into pre-evacuated bottles at atmospheric pressure. The small samples size and the short analysis time of ATTA will make it possible to use krypton-85 as a tracer for clandestine plutonium production with routine operation. (author)
34 CFR 101.85 - Offer of proof.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Offer of proof. 101.85 Section 101.85 Education... PRACTICE AND PROCEDURE FOR HEARINGS UNDER PART 100 OF THIS TITLE Hearing Procedures § 101.85 Offer of proof. An offer of proof made in connection with an objection taken to any ruling of the presiding officer...
International Nuclear Information System (INIS)
Butkus, D.
1999-01-01
Model experiments have shown that inert gas 85 Kr is accumulated by plants. The aim of the work was to determine the way of the capture of inert gas by growing plants: either only through their overground part from air or in addition through their overground part from air or in addition through roots which accumulate water dissolved materials. For this purpose potatoes were grown in the chamber where the 85 Kr volume activity was (3.6±0.1)*10 6 Bq*m -3 . It was determined that 85 Kr gas accumulation was greater in those plant parts which grow faster and are further from the soil. Measurement results of 85 Kr activity of a potato tuber slightly differed from the environment background activity. It shows that the main penetration of inert gas into the plant occurred by absorption from air. (author)
Kr-85 signatures for various plutonium production schemes
Energy Technology Data Exchange (ETDEWEB)
Stanoszek, Paul [Carl Friedrich von Weizsaecker-Centre for Science and Peace Research (Germany)
2009-07-01
Kr-85 is considered to be the best atmospheric indicator of unreported weapon-grade material production. This fact is based on the half-life of 10.76 years of Kr-85 and its chemical inactivity, which makes it even detectable after extended periods of cooling time. Kr-85 is produced as fission product during nuclear reactor operation and remains in the fuel until reprocessing starts. In order to determine the detectability of plutonium production the Kr-85 source term has to be assessed. The important issue of this presentation is the question on the minimum signal that an inspector can expect under the assumption that a proliferator minimizes his Kr-85 generation in order to circumvent a Kr-85 detection. A further assumption is that for nuclear weapon production a burn-up of typically around 2 MWd/kg is used. In addition, if clandestine plutonium production takes place, the source term might be used to estimate the amount of separated plutonium. The methodology of this study is based on a linkage between MCNPX and MATLAB. All results for actinide concentrations and Kr-85 are evaluated for different enrichments of U-235 and compared to known literature data. The Kr-85 source term per kilogram plutonium depends on the enrichments. As a result the lowest Kr-85 source term is found for depleted uranium.
40 CFR 725.85 - Microorganism identity.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Microorganism identity. 725.85 Section... to Information § 725.85 Microorganism identity. (a) Claims applicable to the period prior to... specific microorganism identity at the time of submission of the information. This claim will apply only to...
40 CFR 720.85 - Chemical identity.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Chemical identity. 720.85 Section 720... PREMANUFACTURE NOTIFICATION Confidentiality and Public Access to Information § 720.85 Chemical identity. (a... submits information to EPA under this part may assert a claim of confidentiality for the chemical identity...
44 CFR 6.85 - Reproduction fees.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reproduction fees. 6.85... HOMELAND SECURITY GENERAL IMPLEMENTATION OF THE PRIVACY ACT OF 1974 Fees § 6.85 Reproduction fees. (a... over 81/2 x 14 inches or whose physical characteristics do not permit reproduction by routine...
33 CFR 159.85 - Sewage removal.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sewage removal. 159.85 Section...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.85 Sewage removal. The device must be designed for efficient removal of nearly all of the liquid and solids in the sewage retention...
24 CFR 85.41 - Financial reporting.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Financial reporting. 85.41 Section... § 85.41 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this... financial reports to Federal agencies, or (ii) Requesting advances or reimbursements when letters of credit...
International Nuclear Information System (INIS)
Schroeder, K.J.P.; Roether, W.
1975-01-01
More than 95% of the krypton-85 that is at present observed in the environment on a global scale originates from the combined releases following nuclear-power generation and plutonium production, while atmospheric fusion-bomb testing accounts for the same percentage of the global tritium. The global inventories at the end of 1973 were 55 MCi (estimated uncertainty +- 10%) of krypton-85, and 2900 MCi (+- 25%) of tritium. From the excess of the global krypton-85 inventory over the amounts accounted for by the sources other than plutonium production, it is concluded that 130 tonnes of plutonium-239 have been produced up to 1970. Pronounced fractionation occurs between atmosphere and hydrosphere, in the sense that the concentration of krypton-85 is lowered, and that of tritium (being overwhelmingly in the form of a water molecule, HTO) is greatly increased, in the hydrosphere. Largely as a consequence of this fractionation, the environmental tritium to krypton-85 ratios cover a wide range, with values lowest in the troposphere (typical order of magnitude 10 -1 Ci/Ci) and highest in continental surface water (of the order of 10 5 ). Preliminary oceanic krypton-85 data are reported, which indicate that the concentration decrease with depth in the ocean is very similar for both nuclides. Effluents from nuclear power reactors and reprocessing plants have tritium to krypton-85 ratios that do not differ markedly from those found at present in the troposphere; on the other hand, the very high ratios that are typical of the hydrosphere may offer opportunities of detecting such effluents in the hydrosphere on the basis of tritium to krypton-85 ratios. Considerable uncertainties in the ratios of the effluents have, however, to be anticipated, arising from varying, and fluctuating, fractionation between the two nuclides in the release processes. (author)
40 CFR 85.1415 - Treatment of confidential information.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Treatment of confidential information. 85.1415 Section 85.1415 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1415...
Energy Technology Data Exchange (ETDEWEB)
Jaruga, Pawel, E-mail: pawel.jaruga@nist.gov [Biochemical Science Division, National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States); Department of Clinical Biochemistry, Collegium Medicum, Nicolaus Copernicus University, Bydgoszcz (Poland); Dizdaroglu, Miral [Biochemical Science Division, National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States)
2010-06-18
Biomarkers of oxidatively induced DNA damage are of great interest and can potentially be used for the early detection of disease, monitoring the progression of disease and determining the efficacy of therapy. The present work deals with the measurement in human urine of (5'R)-8,5'-cyclo-2'-deoxyadenosine (R-cdA) and (5'S)-8,5'-cyclo-2'-deoxyadenosine (S-cdA). These modified nucleosides had hitherto not been considered or investigated to be present in urine as possible biomarkers of oxidatively induced DNA damage. Urine samples were collected from volunteers, purified and analyzed by LC-MS/MS with isotope-dilution. R-cdA and S-cdA were detected in urine and quantified. Creatinine levels were also measured. In addition, we measured 8-hydroxy-2'-deoxyguanosine that is commonly used as a biomarker. This study shows, for the first time, that R-cdA and S-cdA exist in human urine and can be identified and quantified by LC-MS/MS. We propose that R-cdA and S-cdA may be well-suited biomarkers for disease processes such as carcinogenesis.
Etxeberria, Igone; Etxebarria, Itziar; Urdaneta, Elena; Yanguas, Jose Javier
2016-09-01
Past research on emotion regulation strategies has concluded that older adults use more passive strategies than young adults. However, we found scarce research in this field focusing on the oldest old (i.e. those aged 85 and over). The aim of this study was to analyze whether or not differences exist in the way older adults aged 85 and over (centenarians included) use emotion regulation strategies, in comparison with younger age groups (65-74 and 75-84 years old). Participants were 257 older adults from Spain, all aged between 65 and 104. The sample was divided into four age groups: 65-74; 75-84; 85-94; and 95-104 years old. Participants completed the Strategy Questionnaire after reading each of the vignettes designed to elicit feelings of either sadness or anger. The questionnaire measures four types of regulation strategies: Passive, Express, Solve and Seek. The 85-94 age group and centenarians were found to use proactive (Express, Seek) and Solve strategies less in comparison with younger age groups when regulating sadness and anger. In contrast, an increased use of Passive strategies was observed in the regulation of both emotions in the 85-94 age group. Significant differences were also found between centenarians and younger age groups in the use of Passive strategies for sadness, although not for anger. Age differences were observed in the use of emotion regulation strategies, with older age groups using proactive strategies less and passive strategies more.
38 CFR 4.85 - Evaluation of hearing impairment.
2010-07-01
... impairment. 4.85 Section 4.85 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS SCHEDULE FOR RATING DISABILITIES Disability Ratings Impairment of Auditory Acuity § 4.85 Evaluation of hearing impairment. (a) An examination for hearing impairment for VA purposes must be conducted by a state-licensed...
DEFF Research Database (Denmark)
Tafur Monroy, Idelfonso; Öhman, Filip; Yvind, Kresten
2006-01-01
We report on a bidirectional 85 km long reach PON system supported by distributed fiber Raman amplification with a record 7.5 Gb/s remote carrier modulated upstream signal by employing a reflective SOA-EA monolithically integrated circuit......We report on a bidirectional 85 km long reach PON system supported by distributed fiber Raman amplification with a record 7.5 Gb/s remote carrier modulated upstream signal by employing a reflective SOA-EA monolithically integrated circuit...
46 CFR 56.50-85 - Tank-vent piping.
2010-10-01
... of the tanks to vent pipes. (2) Tanks having a comparatively small surface, such as fuel oil settling... 46 Shipping 2 2010-10-01 2010-10-01 false Tank-vent piping. 56.50-85 Section 56.50-85 Shipping... APPURTENANCES Design Requirements Pertaining to Specific Systems § 56.50-85 Tank-vent piping. (a) This section...
7 CFR 8.5 - Revocation of present authorizations.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Revocation of present authorizations. 8.5 Section 8.5 Agriculture Office of the Secretary of Agriculture 4-H CLUB NAME AND EMBLEM § 8.5 Revocation of present authorizations. Effective September 16, 1985, authorization permits for the use of the 4-H Club Name and Emblem...
Directory of Open Access Journals (Sweden)
Linda Monica Premazzi
2011-03-01
Full Text Available Com o objetivo de avaliar a influência de doses e épocas de aplicação de nitrogênio após o corte no fator de correção de área foliar, na taxa de alongamento de folhas e no comprimento e área da lâmina foliar do capim-bermuda tifton 85 (Cynodon spp foram conduzidos dois experimentos em casa de vegetação. Ambos os experimentos foram estabelecidos em vasos com capacidade para 7 kg de terra, com solo classificado como Neossolo Quartzarênico Órtico típico, em esquema fatorial 4 × 2, para avaliação de quatro doses de nitrogênio (0, 80, 160 e 240 mg kg-1 de solo e duas épocas de aplicação (imediatamente após o corte e sete dias após o corte das plantas. O delineamento experimental foi em blocos completos ao acaso, com quatro repetições. Com o fornecimento de nitrogênio, observou-se diminuição no fator de correção de área foliar. O nitrogênio proporciona variação positiva no comprimento foliar, na área da lâmina foliar e na taxa de alongamento da folha, variações que ocorreram em maior grandeza entre a não-aplicação de nitrogênio e a dose de 80 mg kg-1 de solo.With the objective of evaluating the influence of nitrogen rates and application time after cutting on correction factor for leaf area, on leaf elongation rate and on blade leaf length and area of tifton 85 bermudagrass (Cynodon spp, two experiments were carried out in a greenhouse. Both experiments were established in pots with capacity for 7 kg of soil classified as Entisol, in a 4 × 2 factorial scheme, for evaluation of four nitrogen rates (0, 80, 160 and 240 mg kg-1 of soil and two application times (immediately after cutting and seven days after cutting of the plants. It was used a complete randomized block design, with four replications. As nitrogen was supplied, it was observed a decrease in the correction factor for leaf area. There is a predominance of positive effects of nitrogen on leaf length, on leaf blade area and on leaf elongation rate
International Nuclear Information System (INIS)
1985-01-01
The annual report for Atomic Energy of Canada Limited is presented. An overview of the last year's major events is given and some new areas of expansion are outlined. Financial data for the fiscal year 1984/85 is also given
Krypton-85 pollution and atmospheric electricity
International Nuclear Information System (INIS)
Harrison, R.G.; ApSimon, H.M.
1994-01-01
Krypton-86 is a chemically inert radioactive gas present in the atmosphere, concentrations of which have been greatly increased by nuclear reprocessing and weapons testing since 1945. The long half-life (10.7 yr), allows the gas to mix thoroughly in the atmosphere. Ionization caused by krypton-85 increases the electrical conductivity of atmospheric air. Further increases in krypton-85 emissions seem inevitable. The increase in air conductivity due to release of krypton-85 will vary with height, and be larger over the oceans than over the land. Increases in conductivity will produce uncertain effects on atmospheric phenomena, so changes are compared in magnitude with other factors perturbing the conductivity, such as combustion aerosol burdens, volcanic eruptions and nuclear weapons testing. Conductivity changes are expected to have the greatest significance for meteorological phenomena close to the source. (Author)
Assessment of Meteorological Drought Indices in Korea Using RCP 8.5 Scenario
Directory of Open Access Journals (Sweden)
Dongwoo Jang
2018-03-01
Full Text Available Diverse drought indices have been developed and used across the globe to assess and monitor droughts. Among them, the Standardized Precipitation Index (SPI and Reconnaissance Drought Index (RDI are drought indices that have been recently developed and are being used in the world’s leading countries. This study took place in Korea’s major observatories for drought prediction until 2100, using the Representative Concentration Pathway (RCP 8.5 scenario. On the basis of the drought index measured by SPI, future climates were forecast to be humid, as the index would rise over time. In contrast, the RDI, which takes evapotranspiration into account, anticipated dry climates, with the drought index gradually falling over time. From the analysis of the drought index through the RCP 8.5 scenario, extreme drought intensity will be more likely to occur due to rising temperatures. To obtain the diversity of drought prediction, the evapotranspiration was deemed necessary for calculating meteorological droughts.
Duarte, Andrea Camacho; Durmic, Zoey; Vercoe, Philip E; Chaves, Alexandre V
2017-12-01
The effect of increasing the concentration of commercial pequi (Caryocar brasiliense) oil on fermentation characteristics and abundance of methanogens and fibrolityc bacteria was evaluated using the rumen simulation technique (Rusitec). In vitro incubation was performed over 15 days using a basal diet consisting of ryegrass, maize silage and concentrate in equal proportions. Treatments consisted of control diet (no pequi oil inclusion, 0 g/kg DM), pequi dose 1 (45 g/kg DM), and pequi dose 2 (91 g/kg DM). After a 7 day adaptation period, samples for fermentation parameters (total gas, methane, and VFA production) were taken on a daily basis. Quantitative real time PCR (q-PCR) was used to evaluate the abundance of the main rumen cellulolytic bacteria, as well as abundance of methanogens. Supplementation with pequi oil did not reduce overall methane production (P = 0.97), however a tendency (P = 0.06) to decrease proportion of methane in overall microbial gas was observed. Increasing addition of pequi oil was associated with a linear decrease (P < 0.01) in dry matter disappearance of maize silage. The abundance of total methanogens was unchanged by the addition of pequi oil, but numbers of those belonging to Methanomassiliicoccaceae decreased in liquid-associated microbes (LAM) samples (P < 0.01) and solid-associated microbes (SAM) samples (P = 0.09) respectively, while Methanobrevibacter spp. increased (P < 0.01) only in SAM samples. Fibrobacter succinogenes decreased (P < 0.01) in both LAM and SAM samples when substrates were supplemented with pequi oil. In conclusion, pequi oil was ineffective in mitigating methane emissions and had some adverse effects on digestibility and selected fibrolytic bacteria. Copyright © 2017 Elsevier Ltd. All rights reserved.
Patra, A K; Yu, Z
2013-03-01
Coconut (CO) and fish (FO) oils were previously shown to inhibit rumen methanogenesis and biohydrogenation, which mitigates methane emission and helps improve beneficial fatty acids in meat and milk. This study aimed at investigating the comparative effects of CO and FO on the methanogenesis, fermentation, and microbial abundances and diversity in vitro rumen cultures containing different doses (0, 3.1, and 6.2 mL/L) of each oil and 400mg feed substrate using rumen fluid from lactating dairy cows as inocula. Increasing doses of CO and FO quadratically decreased concentrations of methane, but hydrogen concentrations were only increased quadratically by CO. Both oils linearly decreased dry matter and neutral detergent fiber digestibility of feeds but did not affect the concentration of total volatile fatty acids. However, CO reduced acetate percentage and acetate to propionate ratio and increased the percentages of propionate and butyrate to a greater extent than FO. Ammonia concentration was greater for CO than FO. As determined by quantitative real-time PCR, FO had greater inhibition to methanogens than CO, but the opposite was true for protozoal, Ruminococcus flavefaciens, and Fibrobacter succinogenes. Ruminococcus albus was not affected by either oil. Denaturing gradient gel electrophoresis (DGGE) profiles revealed that bacterial and archaeal community composition were changed differently by oil type. Based on Pareto-Lorenz evenness curve analysis of the DGGE profiles, CO noticeably changed the functional organization of archaea compared with FO. In conclusion, although both CO and FO decreased methane concentrations to a similar extent, the mode of reduction and the effect on abundances and diversity of archaeal and bacterial populations differed between the oils. Thus, the use of combination of CO and FO at a low dose may additively lower methanogenesis in the rumen while having little adverse effect on rumen fermentation. Copyright © 2013 American Dairy
Wang, C; Liu, Q; Zhang, Y L; Pei, C X; Zhang, S L; Wang, Y X; Yang, W Z; Bai, Y S; Shi, Z G; Liu, X N
2015-02-01
The objective of this study was to evaluate the effects of isobutyrate supplementation on rumen microflora, enzyme activities and methane emissions in Simmental steers consuming a corn stover-based diet. Eight ruminally cannulated Simmental steers were used in a replicated 4 × 4 Latin square experiment. The treatments were control (without isobutyrate), low isobutyrate (LIB), moderate isobutyrate (MIB) and high isobutyrate (HIB) with 8.4, 16.8 and 25.2 g isobutyrate per steer per day respectively. Isobutyrate was hand-mixed into the concentrate portion. Diet consisted of 60% corn stover and 40% concentrate [dry matter (DM) basis]. Dry matter intake (averaged 9 kg/day) was restricted to a maximum of 90% of ad libitum intake. Population of total bacteria, cellulolytic bacteria and anaerobic fungi were linearly increased, whereas that of protozoa and total methanogens was linearly reduced with increasing isobutyrate supplementation. Real-time PCR quantification of population of Ruminococcus albus, Ruminococcus flavefaciens, Butyrivibrio fibrisolvens and Fibrobacter succinogenes was linearly increased with increasing isobutyrate supplementation. Activities of carboxymethyl cellulase, xylanase and β-glucosidase were linearly increased, whereas that of protease was linearly reduced. Methane production was linearly decreased with increasing isobutyrate supplementation. Effective degradabilities of cellulose and hemicellulose of corn stover were linearly increased, whereas that of crude protein in diet was linearly decreased with increasing isobutyrate supplementation. The present results indicate that isobutyrate supplemented improved microflora, rumen enzyme activities and methane emissions in steers. It was suggested that the isobutyrate stimulated the digestive micro-organisms or enzymes in a dose-dependent manner. In the experimental conditions of this trial, the optimum isobutyrate dose was approximately 16.8 g isobutyrate per steer per day. Journal of Animal
40 CFR 85.1708 - National security exemption.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false National security exemption. 85.1708... Vehicle Engines § 85.1708 National security exemption. A manufacturer requesting a national security... agency of the Federal Government charged with responsibility for national defense. [39 FR 32611, Sept. 10...
International Nuclear Information System (INIS)
Momoshima, Noriyuki; Inoue, Fumio; Sugihara, Shinji; Shimada, Jun; Taniguchi, Makoto
2010-01-01
Atmospheric 85 Kr concentration at Fukuoka, Japan was determined by an improved 85 Kr analytical method using liquid scintillation counting (LSC). An average value of 1.54 ± 0.05 Bq m -3 was observed in 2008, which is about two times that measured in 1981 at Fukuoka, indicating a 29 mBq y -1 rate of increase as an average for these 27 years. The analytical method developed involves collecting Kr from air using activated charcoal at liquid N 2 temperature and purifying it using He at dry ice temperature, followed by Kr separation by gas chromatography. An overall Kr recovery of 76.4 ± 8.1% was achieved when Kr was analyzed in 500-1000 l of air. The Kr isolated by gas chromatography was collected on silica gel in a quartz glass vial cooled to liquid N 2 temperature and the activity of 85 Kr was measured with a low-background LS counter. The detection limit of 85 Kr activity by the present analytical method is 0.0015 Bq at a 95% confidence level, including all propagation errors, which is equivalent with 85 Kr in 1.3 l of the present air under the analytical conditions of 72.1% counting efficiency, 0.1597 cps background count rate, and 76.4% Kr recovery.
Analysis of radioxenon and Krypton-85 at the BfS noble gas laboratory.
Schlosser, C; Bollhöfer, A; Schmid, S; Krais, R; Bieringer, J; Konrad, M
2017-08-01
Proportional counters and a β-γ coincidence system and their performance characteristics are described, with emphasis on internal and external quality controls. Typical limits of detection (LD) are 8mBqm -3 for 85 Kr and 4mBqm -3 for 133 Xe for the proportional counters, while for similar xenon volumes the LD for 133 Xe in the β-γ system is approximately 4 times lower. Results of comparative analyses agree above the limit of quantification. Xenon-133 levels in southern Germany are presently at or below the LD of the proportional counters, but above the LD of the β-γ system, which is now routinely used for analysis of environmental samples. Copyright © 2017 Elsevier Ltd. All rights reserved.
10 CFR 76.85 - Assessment of accidents.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Assessment of accidents. 76.85 Section 76.85 Energy... Assessment of accidents. The Corporation shall perform an analysis of potential accidents and consequences to... postulated accidents which include internal and external events and natural phenomena in order to ensure...
1985-08-13
INTER-AMERICAN AFFAIRS Cuban ’Diplomatic Couriers’ Seen Sowing Subversion in Latin America (Armando Cisneros; LA ESTRELLA , 14 Jan 85) Caribbean...Group Presents Alternatives to New Taxes (LA ESTRELLA DE PANAMA, 26 Feb 85) 103 - d - 132 PARAGUAY PERU Patria Scores State Department Human...Contadora, Foreign Debt (Nicolas Ardito Barletta, Miguel de la Madrid; LA ESTRELLA DE PANAMA, 26 May 85) 53 Madero: Any PRI-Generated Violence
MODELING THE DEMAND FOR E85 IN THE UNITED STATES
Energy Technology Data Exchange (ETDEWEB)
Liu, Changzheng [ORNL; Greene, David L [ORNL
2013-10-01
How demand for E85 might evolve in the future in response to changing economics and policies is an important subject to include in the National Energy Modeling System (NEMS). This report summarizes a study to develop an E85 choice model for NEMS. Using the most recent data from the states of Minnesota, North Dakota, and Iowa, this study estimates a logit model that represents E85 choice as a function of prices of E10 and E85, as well as fuel availability of E85 relative to gasoline. Using more recent data than previous studies allows a better estimation of non-fleet demand and indicates that the price elasticity of E85 choice appears to be higher than previously estimated. Based on the results of the econometric analysis, a model for projecting E85 demand at the regional level is specified. In testing, the model produced plausible predictions of US E85 demand to 2040.
Environmental consequences of atmospheric krypton-85
International Nuclear Information System (INIS)
Boeck, W.L.
1978-01-01
This project examines the thesis that atmospheric background ionization is relevant to the understanding of weather. Projections of future world-wide use of nuclear energy imply that sufficient krypton-85 will be produced and may be released to significantly alter the natural ionization background. The scope of the project includes an assessment of krypton-85 on the electrical aspects of the atmosphere as well as the consequences of an altered electrical state of the atmosphere. The results of a first approximation model for the effects of krypton-85 on the atmosphere show that the electric field at the surface of the ocean would be reduced by about 25 percent and at a continental station by about 15 percent. At about two kilometers altitude, the electric field would be reduced by about 14 percent over the oceans and 16 percent over the land. The effects decrease quickly with increasing altitude. Analytical studies of the equations for fair weather atmospheric electricity yield solutions suitable for the interpretation of time dependent phenomena with periods longer than a few seconds. A brief analysis shows that a perfect assessment is not necessary to make an error-free decision regarding krypton-85 control measures. From the viewpoint of a decision-maker, those aspects that could swing the decision from one alternative to another are priority areas for analysis
37 CFR 1.85 - Corrections to drawings.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Corrections to drawings. 1.85... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions The Drawings § 1.85 Corrections to drawings. (a) A utility or plant application will not be placed on the files for examination...
New method of 85Kr reduction in a noble gas based low-background detector
International Nuclear Information System (INIS)
Akimov, D.Yu.; Burenkov, A.A.; Kovalenko, A.G.; Simakov, G.E.; Bolozdynya, A.I.; Hall, C.; Kuzminov, V.V.
2017-01-01
Krypton-85 is an anthropogenic beta-decaying isotope which produces low energy backgrounds in dark matter and neutrino experiments, especially those based upon liquid xenon. Several technologies have been developed to reduce the Kr concentration in such experiments. We propose to augment those separation technologies by first adding to the xenon an 85 Kr-free sample of krypton in an amount much larger than the natural krypton that is already present. After the purification system reduces the total Kr concentration to the same level, the final 85 Kr concentration will be reduced even further by the dilution factor. A test cell for measurement of the activity of various Kr samples has been assembled, and the activity of 25-year-old krypton has been measured. The measured activity agrees well with the expected activity accounting for the 85 Kr abundance of the earth's atmosphere in 1990 and the half-life of the isotope. Additional tests with a Kr sample produced in the year 1944 (before the atomic era) have been done in order to demonstrate the sensitivity of the test cell.
Energy Technology Data Exchange (ETDEWEB)
Bower, Stanley [Ford Motor Company, Dearborn, MI (United States)
2011-12-31
A 5.0L V8 twin-turbocharged direct injection engine was designed, built, and tested for the purpose of assessing the fuel economy and performance in the F-Series pickup of the Dual Fuel engine concept and of an E85 optimized FFV engine. Additionally, production 3.5L gasoline turbocharged direct injection (GTDI) EcoBoost engines were converted to Dual Fuel capability and used to evaluate the cold start emissions and fuel system robustness of the Dual Fuel engine concept. Project objectives were: to develop a roadmap to demonstrate a minimized fuel economy penalty for an F-Series FFV truck with a highly boosted, high compression ratio spark ignition engine optimized to run with ethanol fuel blends up to E85; to reduce FTP 75 energy consumption by 15% - 20% compared to an equally powered vehicle with a current production gasoline engine; and to meet ULEV emissions, with a stretch target of ULEV II / Tier II Bin 4. All project objectives were met or exceeded.
28 CFR 0.85a - Criminal justice policy coordination.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Criminal justice policy coordination. 0.85a Section 0.85a Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Federal Bureau of Investigation § 0.85a Criminal justice policy coordination. The Federal Bureau...
Potential for beneficial use of krypton-85
International Nuclear Information System (INIS)
Tingey, G.L.; Jensen, G.A.; McClanahan, E.D.; Lytle, J.M.; Rising, K.R.
1983-03-01
Large quantities of krypton-85 (about 42 MCi) are contained in stored power-reactor fuels and about 1 MCi/year in fuels processed at each of the Savannah River and Hanford defense fuel-processing plants. This nuclear byproduct could be a significant material resource if used in specialized applications. Recently a technique for implanting krypton in a growing sputter-deposited metallic film has been developed. This yields a stable, high-concentration source of krypton-85 which may have applications for small power generators. Metal deposits containing up to 14 at. % have been prepared that would give a heat source of 0.9 W/cm 3 if fully enriched krypton-85 were implanted. Potential applications for up to 10-W batteries include power for runway lighting and other specialized military applications in remote locations, power for telephone or radiocommunications in the far North, and power for monitoring equipment for tracking animals. Krypton-85 has the advantage of being environmentally the most acceptable heat-producing radioisotope available for power production. 1 figure
Release of dissolved 85Kr by standing
International Nuclear Information System (INIS)
Ootsuka, Norikatsu; Yamamoto, Tadatoshi; Tsukui, Kohei
1986-01-01
The experiments on the release of dissolved 85 Kr by standing at room temperature were carried out to examine the influence of liquid level in a sampler and properties of solvent on the release efficiency. Six kinds of organic solvents as well as water were taken as solvents. The half-life period in case of the decrease in concentration of the dissolved 85 Kr which was used as an index of release efficiency, was proportional to the liquid level in the sampler and was inversely proportional to the diffusion coefficient of Kr gas in solvent. For organic solvents belonging to homologous series, the half-life period became longer with increasing the carbon number of solvent molecule. From the relationship between the half-life period and the carbon number, the release efficiency in the dissolved 85 Kr can be predicted for any commonly used solvent as a practical application. This method was found to be an effective means of removing the dissolved 85 Kr of low level though it takes rather long time. (author)
Enhanced Ozone Production at Low Temperatures due to Ethanol (E85)
Ginnebaugh, D. L.; Livingstone, P. L.; Jacobson, M. Z.
2009-12-01
The increased use of ethanol in transportation fuels warrants an investigation of its consequences. An important component of such an investigation is the temperature-dependence of ethanol and gasoline exhaust chemistry. We use the near-explicit Master Chemical Mechanism (MCM, version 3.1, LEEDS University) with the SMVGEAR II chemical ordinary differential solver to provide the speed necessary to simulate explicit chemistry to examine such effects. The MCM has over 13,500 organic reactions and 4,600 species. SMVGEAR II is a sparse-matrix Gear solver that reduces the computation time significantly while maintaining any specified accuracy. Although for this study we use a box model, we determined that the speed of the MCM with the SMVGEAR solver will allow the MCM to be modeled in 3-dimensions. We also verified the accuracy of the model with comparisons to smog chamber data. We use species-resolved tailpipe emissions data for E85 (15% gasoline, 85% ethanol fuel blend) and gasoline vehicles to compare the impact of each on ozone and carcinogenic organic gases as a function of ambient temperature and background concentrations, using Los Angeles in 2020 as a base case. We use two different emissions sets - one is a compilation of data taken at near 24 C and the other from data taken at -7 C - to determine how atmospheric chemistry and emissions are affected by temperature. We include diurnal effects by examining 2 day and 5 day scenarios. We find that for both emission data sets, the average ozone concentrations through the range of temperatures tested are higher with E85 than with gasoline by 8 parts per billion volume (ppbv) at higher temperatures to 55 ppbv at low temperatures and low sunlight (winter conditions) for an area with a high nitrogen oxides (NOx) to non-methane organic gases (NMOG) ratio. The results suggest that E85's effect on health through ozone formation becomes increasingly more significant relative to gasoline as temperatures decreased due to the
Molecular mechanism for the action of the anti-CD44 monoclonal antibody MEM-85
Czech Academy of Sciences Publication Activity Database
Škerlová, Jana; Král, Vlastimil; Kachala, M.; Fábry, Milan; Bumba, Ladislav; Svergun, D.I.; Tosner, Z.; Veverka, V.; Řezáčová, Pavlína
2015-01-01
Roč. 191, č. 2 (2015), s. 214-223 ISSN 1047-8477 R&D Projects: GA ČR(CZ) GA15-11851S EU Projects: European Commission 264257 Institutional support: RVO:68378050 ; RVO:61388971 Keywords : CD44 * Epitope mapping * Monoclonal antibody * MEM-85 * SAXS * NMR Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.570, year: 2015
46 CFR 196.85-1 - Magazine operation and control.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine operation and control. 196.85-1 Section 196.85... OPERATIONS Magazine Control § 196.85-1 Magazine operation and control. (a) Keys to magazine spaces and magazine chests shall be kept in the sole control or custody of the Master or one delegated qualified...
7 CFR 301.85-2b - Exempted articles. 1
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Exempted articles. 1 301.85-2b Section 301.85-2b... § 301.85-2b Exempted articles. 1 1 The articles hereby exempted remain subject to applicable restrictions under other quarantines and other provisions of this subpart. (a) The following articles are...
46 CFR 56.85-5 - Heating and cooling method.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Heating and cooling method. 56.85-5 Section 56.85-5... APPURTENANCES Heat Treatment of Welds § 56.85-5 Heating and cooling method. Heat treatment may be accomplished by a suitable heating method that will provide the desired heating and cooling rates, the required...
The Study of Reducing Krypton-85 Activity in Metal Halide Lamp%降低金卤灯内氪-85活度的研究
Institute of Scientific and Technical Information of China (English)
叶碧君
2012-01-01
通过测试及分析不同氪-85活度填充气体的同规格金卤灯的各项性能参数,研究了在确保金卤灯各项性能的前提下,降低金卤灯中氪-85活度的可行性及金卤灯中氪-85存在的必要性,可以为今后确定金卤灯中需添加的最低氪-85活度提供参考。%By analyzing the parameters of metal halide lamps which are filled with gas with different activity of krypton-85, the paper studies the feasibility of reducing krypton-85 activity in metal halide lamp while ensuring the lamp performance, and proves the necessity of its existence of krypton-85 in metal halide lamp. it can provide us a reference to determine the minimum krypton-85 activity to he added in metal halide lamps.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What must I do if I learn of information required under § 85.335 after entering into a covered transaction with the Department of Education? 85.350 Section 85.350 Education Office of the Secretary, Department of Education GOVERNMENTWIDE DEBARMENT AND...
International Nuclear Information System (INIS)
Ternon, Jean-Francois
1990-01-01
Krypton-85 present in the environment has essentially an anthropogenic origin, and the knowledge of the evolution of its concentration in the atmosphere, and of its mode of penetration in the ocean by gaseous exchange at the surface, and its bio-geochemical stability in the environment make it a potential tool to trace movements of water masses in the ocean. This research thesis aims at being a contribution to the implementation of an experimental device which would allow very low concentrations of krypton-85 in the ocean to be measured. After a presentation of the general context, the author reports the development of the two last steps of krypton-85 measurement: the separation of krypton by gas chromatography, and the measurement of krypton-85 by low-level radioactive counting. Then, the author reports the study of the use of krypton-85 as a tracer in oceanography, and notably highlights its similarities with CFC which are widely used to study ocean circulation [fr
Computer-controlled on-line gamma analysis for krypton-85
International Nuclear Information System (INIS)
Canuette, R.P.
1980-03-01
85 Kr will be evolved from spent nuclear fuel during both the voloxidation and dissolution processes, so a reliable method for on-line analysis of 85 Kr in the off-gas system is needed. Tritium, 14 C, and 129 I were trapped, and the activity of 85 Kr was then measured using a Li-drifted Ge detector. Equipment used to carry out this analysis is described; the PET computer is used. The 85 Kr evolution rate was correlated with the fuel dissolution rate; the close correlation permits one to monitor the fuel dissolution process. 11 figures
Jin, Yan-Li; Tang, Ren-Jie; Wang, Hai-Hai; Jiang, Chun-Mei; Bao, Yan; Yang, Yang; Liang, Mei-Xia; Sun, Zhen-Cang; Kong, Fan-Jing; Li, Bei; Zhang, Hong-Xia
2017-10-01
Brassinosteroids (BRs) are essential hormones that play crucial roles in plant growth, reproduction and response to abiotic and biotic stress. In Arabidopsis, AtCYP85A2 works as a bifunctional cytochrome P450 monooxygenase to catalyse the conversion of castasterone to brassinolide, a final rate-limiting step in the BR-biosynthetic pathway. Here, we report the functional characterizations of PtCYP85A3, one of the three AtCYP85A2 homologous genes from Populus trichocarpa. PtCYP85A3 shares the highest similarity with AtCYP85A2 and can rescue the retarded-growth phenotype of the Arabidopsis cyp85a2-2 and tomato d x mutants. Constitutive expression of PtCYP85A3, driven by the cauliflower mosaic virus 35S promoter, increased the endogenous BR levels and significantly promoted the growth and biomass production in both transgenic tomato and poplar. Compared to the wild type, plant height, shoot fresh weight and fruit yield increased 50%, 56% and 43%, respectively, in transgenic tomato plants. Similarly, plant height and stem diameter increased 15% and 25%, respectively, in transgenic poplar plants. Further study revealed that overexpression of PtCYP85A3 enhanced xylem formation without affecting the composition of cellulose and lignin, as well as the cell wall thickness in transgenic poplar. Our finding suggests that PtCYP85A3 could be used as a potential candidate gene for engineering fast-growing trees with improved wood production. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
2010-04-01
...,000 in total aggregate fair market value upon termination or completion of the award, and if the... TRIBAL GOVERNMENTS Post-Award Requirements Changes, Property, and Subawards § 85.33 Supplies. (a) Title...
7 CFR 1001.85 - Assessment for order administration.
2010-01-01
... 1001.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE NORTHEAST MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1001.85...
7 CFR 1033.85 - Assessment for order administration.
2010-01-01
... 1033.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE MIDEAST MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1033.85...
7 CFR 1032.85 - Assessment for order administration.
2010-01-01
... 1032.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE CENTRAL MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1032.85...
7 CFR 1126.85 - Assessment for order administration.
2010-01-01
... 1126.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE SOUTHWEST MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1126.85...
7 CFR 1006.85 - Assessment for order administration.
2010-01-01
... 1006.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE FLORIDA MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1006.85...
7 CFR 1007.85 - Assessment for order administration.
2010-01-01
... 1007.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE SOUTHEAST MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1007.85...
7 CFR 1131.85 - Assessment for order administration.
2010-01-01
... 1131.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE ARIZONA MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1131.85...
7 CFR 1005.85 - Assessment for order administration.
2010-01-01
... 1005.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE APPALACHIAN MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1005.85...
7 CFR 1124.85 - Assessment for order administration.
2010-01-01
... 1124.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE MILK IN THE PACIFIC NORTHWEST MARKETING AREA Order Regulating Handling Administrative Assessment and Marketing Service Deduction § 1124.85...
Gemini/GMOS Spectroscopy of Globular Clusters in the Merger Remnant Galaxy M85
Ko, Youkyung; Lee, Myung Gyoon; Park, Hong Soo; Sohn, Jubee; Lim, Sungsoon; Hwang, Narae
2018-06-01
M85 is a peculiar S0 galaxy in Virgo and a well-known merger remnant. We present the first spectroscopic study of globular clusters (GCs) in M85. We obtain spectra for 21 GC candidates and the nucleus of M85 using the Gemini Multi-Object Spectrograph on the Gemini North 8.1 m telescope. From their radial velocities, 20 of the GCs are found to be members of M85. We find a strong rotation signal of the M85 GC system with a rotation amplitude of 235 km s‑1. The rotation axis of the GC system has a position angle of about 161°, which is 51.°5 larger than that of the stellar light. The rotation-corrected radial velocity dispersion of the GC system is estimated to be {σ }{{r},{cor}}=160 km s‑1. The rotation parameter {{Ω }}{R}icor}/{σ }{{r},{cor}} of the GC system is derived to be {1.47}-0.48+1.05, which is one of the largest among known early-type galaxies. The ages and metallicities of the GCs, which show the same trend as the results based on Lick indices, are derived from full spectrum fitting (ULySS). About half of the GCs are an intermediate-age population whose mean age is ∼3.7 ± 1.9 Gyr, having a mean [Fe/H] value of ‑0.26. The other half are old and metal-poor. These results suggest that M85 experienced a wet merging event about 4 Gyr ago, forming a significant population of star clusters. The strong rotational feature of the GC system can be explained by an off-center major merging.
2012-05-01
mph) SRS 123 / SR 85 Traffic Volumes Receptor Max 1-Hr CO Conc (ppm) Max 8-Hr CO Conc (ppm) AADT VPH Alternative 2 (East Shift) and...8.4 5.0 AADT: Annual Average Daily Traffic. VPH : Vehicles per Hour Environmental Consequences Air Quality Impacts
Boiyo, D. Kiboi; Isoe, G. M.; Gamatham, R. R. G.; Leitch, A. W. R.; Gibbon, T. B.
2016-02-01
For the first time, we demonstrate, VCSEL-to-VCSEL wavelength conversion within the low attenuation 1550 nm window, including transmission over fibre and bit error rate (BER) performance characterization. We experimentally demonstrate a low injection power optical wavelength conversion by injecting an optical beam from a signal carrier master vertical cavity surface-emitting laser (VCSEL) into the side-mode of the slave VCSEL. This technique solves the challenge of wavelength collisions and also provides wavelength re-use in typical wavelength division multiplexed (WDM) systems. This paper, for the first time, uses two 1550 nm VCSELs with tunability range of 3 nm for a 5-9.8 mA bias current. The master VCSEL is modulated with a non-return-to-zero (NRZ) pseudo-random binary sequence (PRBS_27-1) 8.5 Gb/s data. A data conversion penalty of 1.1 dB is realized when a 15 dBm injection beam is used. The transmission performance of the converted wavelength from the slave VCSEL is evaluated using BER measurement at a 10-9 threshold. A 0.5 dB transmission penalty of the converted wavelength data is realized in an 8.5 Gb/s transmission over 24.7 km. This work is vital for optical fibre systems that may require wavelength switching for transmission of data signals.
2010-07-01
... POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1409 Warranty. (a) As a condition of... equipment will not cause an urban bus engine to exceed the emission requirements of this subpart and the...
Climate aspects of radioactive trace gases, especially krypton-85
International Nuclear Information System (INIS)
Kollert, R.; Butzin, M.
1990-01-01
The amount of krypton 85 currently present in the atmosphere is 3.300 Peta Bq. This atmospheric krypton contamination stems from atom bomb tests of the past and from nuclear power plants as well as spent fuel reprocessing plants. The paper investigates the air-electric and air-chemical impact of Kr-85 on the atmosphere and makes a forecast of the future Kr-85 contamination. (DG) [de
Update and improvement of the global krypton-85 emission inventory
International Nuclear Information System (INIS)
Ahlswede, Jochen; Hebel, Simon; Ross, J. Ole; Schoetter, Robert; Kalinowski, Martin B.
2013-01-01
Krypton-85 is mainly produced in nuclear reactors by fission of uranium and plutonium and released during chopping and dissolution of spent fuel rods in nuclear reprocessing facilities. As noble gas it is suited as a passive tracer for evaluation of atmospheric transport models. Furthermore, research is ongoing to assess its quality as an indicator for clandestine reprocessing activities. This paper continues previous efforts to compile a comprehensive historic emission inventory for krypton-85. Reprocessing facilities are the by far largest emitters of krypton-85. Information on sources and calculations used to derive the annual krypton-85 emission is provided for all known reprocessing facilities in the world. In addition, the emission characteristics of two plants, Tokai (Japan) and La Hague (France), are analysed in detail using emission data with high temporal resolution. Other types of krypton-85 sources are power reactors, naval reactors and isotope production facilities. These sources contribute only little or negligible amounts of krypton-85 compared to the large reprocessing facilities. Taking the decay of krypton-85 into account, the global atmospheric inventory is estimated to about 5500 PBq at the end of 2009. The correctness if the inventory has been proven by meteorological simulations and its error is assumed to be in the range of a few percent. - Highlights: ► Krypton-85 is mainly produced in nuclear reactors and released during reprocessing. ► Krypten-85 can be possibly used as an indicator for clandestine reprocessing. ► This work provides an up-to-date global krypton-85 emission inventory. ► The inventory includes emissions from all possible artificial sources.
Energy Technology Data Exchange (ETDEWEB)
Brown, L; Salter, S [comps.
1985-01-01
References relating to the 1984-85 UK miners strike are listed under the following subject headings: events and analysis - a chronological record; short term effects - coal stocks and supplies, electricity supplies, financial, industrial and economic; the miners and their leadership; social aspects - civil liberties, media coverage, mining communities, picketing, policing, the future; pit closures. 240 references.
Survey of analytical methods for environmental monitoring of krypton-85
International Nuclear Information System (INIS)
Jaquish, R.E.; Moghissi, A.A.
1973-01-01
Numerous methods have been developed for measuring krypton-85 in air as krypton ultimately accumulates in air once it is released into the environment. However, krypton-85 can be present in other media such as natural gas from wells stimulated with nuclear devices or in water when krypton-85 is used for aeration studies. Methods for the measurement of ambient levels of krypton-85 require a concentration of krypton from a large air sample of one m 3 or more. If elevated levels are to be measured, carrier krypton may be used provided the contamination of atmospheric krypton with krypton-85 does not interfere with the measurement. In certain cases, such as in the vicinity of nuclear fuel processing plants, direct measurement techniques may be used. A variety of techniques are employed for krypton-85 counting. At low levels, internal gas counting or organic scintillation is used to measure the beta emission of this radionuclide. At higher levels the gamma emission of krypton-85 may be measured using scintillation or solid state gamma spectroscopic methods. Techniques for collection of the sample, concentration of krypton, and radioactivity measurement of krypton-85 are discussed and various processes are critically evaluated and compared
Disposition and biological effect of inhaled 85Kr
International Nuclear Information System (INIS)
Willard, D.H.; Ballou, J.E.; Ragan, H.A.; Gandolfi, A.J.
1978-01-01
Half-lives of approximately 5, 30, and 100 min were obtained for whole-body clearance of inhaled 85 Kr in beagle dogs. Analysis showed the highest partition coefficients in lungs, bone marrow, and fat. Circulating blood elements were not lowered permanently after 85 Kr exposures
10 CFR 26.85 - Collector qualifications and responsibilities.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Collector qualifications and responsibilities. 26.85 Section 26.85 Energy NUCLEAR REGULATORY COMMISSION FITNESS FOR DUTY PROGRAMS Collecting Specimens for... reports, if any; results of tests to establish employee competency for the position he or she holds...
Ambient krypton-85 air sampling at Hanford
International Nuclear Information System (INIS)
Trevathan, M.S.; Price, K.R.
1985-01-01
In the fall of 1982, the Environmental Evaluations Section of Pacific Northwest Laboratory (PNL) initiated a network of continuous 85 Kr air samplers located on and around the Hanford Site. This effort was in response to the resumption of operations at a nuclear fuel reprocessing plant located onsite where 85 Kr was to be released during fuel dissolution. Preoperational data were collected using noble gas samplers designed by the Environmental Protection Agency-Las Vegas (EPA-LV). The samplers functioned erratically resulting in excessive maintenance costs and prompted a search for a new sampling system. State-of-the-art 85 Dr sampling methods were reviewed and found to be too costly, too complex and inappropriate for field application, so a simple bag collection system was designed and field tested. The system is composed of a reinforced, heavy plastic bag, connected to a variable flow pump and housed in a weatherproof enclosure. At the end of the four week sampling period the air in the bag is transferred by a compressor into a pressure tank for easy transport to the laboratory for analysis. After several months of operation, the air sampling system has proven its reliability and sensitivity to ambient levels of 85 Kr
Ambient krypton-85 air sampling at Hanford
International Nuclear Information System (INIS)
Trevathan, M.S.; Price, K.R.
1984-10-01
In the fall of 1982, the Environmental Evaluations Section of Pacific Northwest Laboratory (PNL) initiated a network of continuous krypton-85 air samplers located on and around the Hanford Site. This effort was in response to the resumption of operations at a nuclear fuel reprocessing plant located onsite where krypton-85 was to be released during fuel dissolution. Preoperational data were collected using noble gas samplers designed by the Environmental Protection Agency-Las Vegas (EPA-LV). The samplers functioned erratically resulting in excessive maintenance costs and prompted a search for a new sampling system. State of the art krypton-85 sampling methods were reviewed and found to be too costly, too complex and inappropriate for field application, so a simple bag collection system was designed and field tested. The system is composed of a reinforced, heavy plastic bag, connected to a variable flow pump and housed in a weatherproof enclosure. At the end of the four week sampling period the air in the bag is transferred by a compressor into a pressure tank for easy transport to the laboratory for analysis. After several months of operation, the air sampling system has proven its reliability and sensitivity to ambient levels of krypton-85. 3 references, 3 figures, 1 table
The distribution, atmospheric transfer, and assessment of krypton-85
International Nuclear Information System (INIS)
Pannetier, R.
1968-06-01
Techniques for sampling and measuring krypton-85 have been developed which allowed to determine its geographical distribution. From its use as a tracer, an evaluation of the air masses which cross over the subtropical fronts has been derived. Besides, the stratospheric character of air pollution by krypton-85 at the level of the antarctic soil has been shown out. Levels of krypton-85 seem to point out to an underestimation of the assessment of nuclear explosion fission energies as adopted by the United Nations Scientific committee on the effects of atomic radiation and emphasize the need to set limits as soon as possible to the amounts of krypton-85 released to the atmosphere by fuel-reprocessing plants. (author) [fr
40 CFR 85.1715 - Aircraft meeting the definition of motor vehicle.
2010-07-01
... motor vehicle. 85.1715 Section 85.1715 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Motor Vehicles and Motor Vehicle Engines § 85.1715 Aircraft meeting the definition of motor vehicle. This section applies for aircraft meeting the definition of motor vehicle in § 85.1703. (a) For the...
45 CFR 85.62 - Coordination and compliance responsibilities.
2010-10-01
... are enacted and existing programs expire, the above list appears to be sufficient. Section 85... those instances, they will fall under the definition in § 85.3. Therefore, there is no need to change... complete complaint. Two commenters stated their belief that the definition of complete complaint is too...
49 CFR 1242.85 - Fringe benefits (account 12-63-00).
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Fringe benefits (account 12-63-00). 1242.85 Section 1242.85 Transportation Other Regulations Relating to Transportation (Continued) SURFACE....85 Fringe benefits (account 12-63-00). Separate the common expenses in proportion to the total common...
40 CFR 85.1703 - Definition of motor vehicle.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Definition of motor vehicle. 85.1703... (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Exclusion and Exemption of Motor Vehicles and Motor Vehicle Engines § 85.1703 Definition of motor vehicle. (a) For the purpose of determining the...
2010-07-01
... § 85.3 Definitions. Health Promotion. Any combination of health education and related organizational... alterations that will improve or protect health. It includes those activities intended to support and..., health promotion includes smoking prevention and cessation, physical fitness, nutrition, stress...
40 CFR 85.1405 - Applicability.
2010-07-01
... POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1405 Applicability. The provisions of... 1993 and earlier model year urban buses whose engines are rebuilt or replaced after January 1, 1995... additives to be used with urban bus engines. ...
Directory of Open Access Journals (Sweden)
Daniela B Oss
2016-12-01
Full Text Available This study evaluated the effect of increasing the proportion of bison relative to cattle inoculum on fermentation and microbial populations within an artificial rumen (Rusitec. The experiment was a completely randomized design with a factorial treatment structure (proportion cattle:bison inoculum; 0:100, 33:67, 67:33 and 100:0 replicated in two Rusitec apparatuses (n=8 fermenters. The experiment was 15 d with 8 d of adaptation and 7 d of sampling. Fermenters were fed a diet of 70:30 barley straw:concentrate (DM basis. True digestibility of DM was determined after 48 h of incubation from d 13-15, and daily ammonia (NH3 and volatile fatty acid (VFA production were measured on d 9-12. Protozoa counts were determined at d 9, 11, 13 and 15 and particle-associated bacteria (PAB from d 13-15. Select bacterial populations in the PAB were measured using RT-qPCR. Fermenter was considered the experimental unit and day of sampling as a repeated measure. Increasing the proportion of bison inoculum resulted in a quadratic effect (P0.05. Increasing bison inoculum linearly increased (P<0.05 concentrate aNDF disappearance, total and concentrate N disappearance as well as total daily VFA and acetate production. A positive quadratic response (P<0.05 was observed for daily NH3-N, propionate, butyrate, valerate, isovalerate and isobutyrate production, as well as the acetate:propionate ratio. Increasing the proportion of bison inoculum linearly increased (P<0.05 total protozoa numbers. No effects were observed on pH, total gas and methane production, microbial N synthesis, or copies of 16S rRNA associated with total bacteria, Selenomonas ruminantium or Prevotella bryantii. Increasing bison inoculum had a quadratic effect (P<0.05 on Fibrobacter succinogenes, and tended to linearly (P<0.10 increase Ruminococcus flavefaciens and decrease (P<0.05 Ruminococcus albus copy numbers. In conclusion, bison inoculum increased the degradation of feed protein and fibre. A mixture
Monitoring of air pollutants and greenhouse gases. Monitoring Krypton-85
International Nuclear Information System (INIS)
Novitchkov, V.
1996-01-01
Krypton-85 is an anthropogenic radioactive noble gas, a gaseous fission product which builds up in the atmosphere. The World Meteorological Organization (WMO) Global Atmospheric Watch (GAW) integrates many monitoring and research activities involving the measurements of atmospheric composition. Kr-85 represents one of the gases recommended by the WMO for monitoring. The collaborative program of the Moscow State Engineering Physics Institute (MEPI) and the US Air Resources Laboratory (ARL) NOAA activities is aimed at determining the possible future consequences of Krypton-85 content (trend) increasing in the earth's atmosphere. The research is conducted at the MEPI to study the character of KR-85 release into the atmosphere and its distribution in the atmosphere, to determine Kr-85 possible sources. If only the question of the direct impact of Kr-85 on climate would be considered, only the order of magnitude of the atmospheric concentration would be of interest. In this case almost any available detection method and a precision as low as some 10% would be acceptable. If however, Kr-85 is to be applied as a tracer for the improvement of our present knowledge of local, regional and global transport and mixing processes and the validation of global-scale transport and mixing models, a much higher precision is required (order of +1%). This high standard cannot be met without a permanent quality assurance programmer. It is within the framework of the WMO that MEPI and the Air Resources Laboratory NOAA USA proposes collaboration of Kr-85 scientific findings. The project MEPI open-quotes Monitoring Krypton-85close quotes is being financed through the International Science and Technology Center
Laboratory sensor design for fiber-optic detection of 85Kr
International Nuclear Information System (INIS)
Geelhood, B.D.; Knopf, M.A.
1994-06-01
The goal of the fiber-optic detection of 85 Kr project is to produce a sensor to detect 85 Kr in real-time from either an airborne or ground-based platform. The 85 Kr gas is a fission product which is released in large quantities during fuel reprocessing and in minor quantities during nuclear reactor operations. Thus an airborne plume of 85 Kr is a radioactive signature of proliferation. Since 85 Kr has a 10.72 year half life, it is difficult for a proliferator to contain the gas for several half lives to avoid releasing the radioactive signature of proliferation. The long half life also results in a plume that can extend several kilometers from the source, which allows initial proliferation monitoring from large distances. The sensor can be used to make stand-alone, real-time measurements of 85 Kr that can be used as direct evidence for proliferation and/or as a screening sensor to determine when to collect air samples for further laboratory analysis. This report provides a summary of the 85 Kr beta sensor design that PNL will use in the laboratory to: (1) demonstrate the measurement technique, (2) establish minimum detection limits, and (3) optimize the sensor design for the final airborne sensor package. The goal of the final airborne sensor package will be to measure 85 Kr at activity levels as low as or as close to ambient background levels as possible with a reasonably sized sensor
Bioethanol E85 as a fuel for dual fuel diesel engine
International Nuclear Information System (INIS)
Tutak, Wojciech
2014-01-01
Highlights: • An increase in the E85 fraction is changing the nature of the HRR course. • Change of combustion phasing with E85 fraction. • The ignition delay of dual fuel engine decreases with increasing E85 fuel. • Premixed combustion of E85 fuel reduces smoke emissions. - Abstract: This study investigates the potential of E85 fuelling in a diesel engine. Researches were performed using a three-cylinder a direct injection diesel engine. A dual-fuelling technology is implemented such that E85 is introduced into the intake manifold using a port-fuel injector while diesel is injected directly into the cylinder. The primary aim of the study was to determine the operating parameters of the engine powered on E85 bioethanol fuel in dual fuel system. The parameters that were taken into account are: engine efficiency, indicated mean effective pressure, heat release rate, combustion duration and ignition delay, combustion phasing and exhaust toxicity. With E85 fuel participation, NO x and soot emissions were reduced, whereas CO and HC emissions increased considerably. It was found that E85 participation in a combustible mixture reduced the excess air factor for the engine and this led to increased emissions of CO and HC, but decreased emissions of nitrogen oxides and soot
Energy Technology Data Exchange (ETDEWEB)
Momoshima, Noriyuki, E-mail: momoshima.noriyuki.551@m.kyushu-u.ac.j [Radioisotope Center, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Inoue, Fumio [Graduate School of Science, Kyushu University, 6-10-1Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Sugihara, Shinji [Radioisotope Center, Kyushu University, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Shimada, Jun [Graduate School of Science and Technology, Kumamoto University, 2-39-1 Kurokami, Kumamoto 860-8555 (Japan); Taniguchi, Makoto [Research Institute for Humanity and Nature, 457-4 Motoyama Kamigamo, Kita-ku, Kyoto 603-8047 (Japan)
2010-08-15
Atmospheric {sup 85}Kr concentration at Fukuoka, Japan was determined by an improved {sup 85}Kr analytical method using liquid scintillation counting (LSC). An average value of 1.54 {+-} 0.05 Bq m{sup -3} was observed in 2008, which is about two times that measured in 1981 at Fukuoka, indicating a 29 mBq y{sup -1} rate of increase as an average for these 27 years. The analytical method developed involves collecting Kr from air using activated charcoal at liquid N{sub 2} temperature and purifying it using He at dry ice temperature, followed by Kr separation by gas chromatography. An overall Kr recovery of 76.4 {+-} 8.1% was achieved when Kr was analyzed in 500-1000 l of air. The Kr isolated by gas chromatography was collected on silica gel in a quartz glass vial cooled to liquid N{sub 2} temperature and the activity of {sup 85}Kr was measured with a low-background LS counter. The detection limit of {sup 85}Kr activity by the present analytical method is 0.0015 Bq at a 95% confidence level, including all propagation errors, which is equivalent with {sup 85}Kr in 1.3 l of the present air under the analytical conditions of 72.1% counting efficiency, 0.1597 cps background count rate, and 76.4% Kr recovery.
Applications developed for byproduct 85Kr and tritium
International Nuclear Information System (INIS)
Remini, W.C.; Case, F.N.; Haff, K.W.; Tiegs, S.M.
1983-01-01
The radionuclides, krypton-85 and tritium, both of which are gases under ordinary conditions, are used in many applications in industries and by the military forces. Krypton-85 is produced during the fissioning of uranium and is released during the dissolution of spent-fuel elements. It is a chemically inert gas that emits 0.695-MeV beta rays and a small yield of 0.54-MeV gammas over a half life of 10.3 years. Much of the 85 Kr currently produced is released to the atmosphere; however, large-scale reprocessing of fuel will require collection of the gas and storage as a waste product. An alternative to storage is utilization, and since the chemical and radiation characteristics of 85 Kr make this radionuclide a relatively low hazard from the standpoint of contamination and biological significance, a number of uses have been developed. Tritium is produced as a byproduct of the nuclear-weapons program, and it has a half life of 12.33 years. It has a 0.01861-MeV beta emission and no gamma emission. The absence of a gamma-ray energy eliminates the need for external shielding of the devices utilizing tritium, thus making them easily transportable. Many of the applications require only small quantities of 85 Kr or tritium; however, these uses are important to the technology base of the nation. A significant development that has the potential for beneficial utilization of large quantities of 85 Kr and of tritium involves their use in the production of low-level lighting devices. Since these lights are free from external fuel supplies, have a long half life (> 10 years), are maintenance-free, reliable, and easily deployed, both military and civilian airfield-lighting applications are being studied
Estimation of radiation hazard of global 85Kr
International Nuclear Information System (INIS)
Vasilenko, I.Ya.; Moskalev, Yu.I.; Istomina, A.G.
1979-01-01
The data on sources and levels of the 85 Kr biosphere contamination are presented on the basis of generalization and analysis of literature. The potential irradiation doses for people are calculated and the biological estimation of the hazard of 85 Kr accumulation in the atmosphere up to 2050 is given taking into account the prospects for development of nuclear power engineering. The basis of the estimation is the radionuclide blastomogeneous and genetic effect. The conclusion is made that the prospects for development of nuclear power engineering do not lead to any sufficient increase in the number of malignant tumors and genetic abnormalities caused by 85 Kr radiation comparing with their natural frequency
J-85 jet engine noise measured in the ONERA S1 wind tunnel and extrapolated to far field
Soderman, Paul T.; Julienne, Alain; Atencio, Adolph, Jr.
1991-01-01
Noise from a J-85 turbojet with a conical, convergent nozzle was measured in simulated flight in the ONERA S1 Wind Tunnel. Data are presented for several flight speeds up to 130 m/sec and for radiation angles of 40 to 160 degrees relative to the upstream direction. The jet was operated with subsonic and sonic exhaust speeds. A moving microphone on a 2 m sideline was used to survey the radiated sound field in the acoustically treated, closed test section. The data were extrapolated to a 122 m sideline by means of a multiple-sideline source-location method, which was used to identify the acoustic source regions, directivity patterns, and near field effects. The source-location method is described along with its advantages and disadvantages. Results indicate that the effects of simulated flight on J-85 noise are significant. At the maximum forward speed of 130 m/sec, the peak overall sound levels in the aft quadrant were attentuated approximately 10 dB relative to sound levels of the engine operated statically. As expected, the simulated flight and static data tended to merge in the forward quadrant as the radiation angle approached 40 degrees. There is evidence that internal engine or shock noise was important in the forward quadrant. The data are compared with published predictions for flight effects on pure jet noise and internal engine noise. A new empirical prediction is presented that relates the variation of internally generated engine noise or broadband shock noise to forward speed. Measured near field noise extrapolated to far field agrees reasonably well with data from similar engines tested statically outdoors, in flyover, in a wind tunnel, and on the Bertin Aerotrain. Anomalies in the results for the forward quadrant and for angles above 140 degrees are discussed. The multiple-sideline method proved to be cumbersome in this application, and it did not resolve all of the uncertainties associated with measurements of jet noise close to the jet. The
42 CFR 85.6 - Advance notice of visits.
2010-10-01
... investigation. Advance notice will not be given when, in the judgment of the NIOSH officer, giving such notice..., advance notice will be given by NIOSH to the employer. Upon the request of the employer, NIOSH will inform... 42 Public Health 1 2010-10-01 2010-10-01 false Advance notice of visits. 85.6 Section 85.6 Public...
Environmental behaviour and dosimetry of Krypton-85
International Nuclear Information System (INIS)
Patek, P.
1980-12-01
Although 85 Kr has only small influence on the total radiation burden to man, monitoring and safety considerations have to be done, especially regarding the operation of fuel reprocessing plants. The natural, military and civilian sources of 85 Kr are discussed and a survey is given on the possibilities of Krypton removal from off-gas streams. Regarding the environmental behaviour of the released Krypton-amounts it was shown, that only the atmospheric dispersion is of influence to the succeeding irradiation of the population. Krypton is transferred to man only by inhalation and remains with different halflives in the human body. The highest absorbed dose is caused by beta-rays to the skin and in the airways of the lungs. While the highest dose equivalent rates to the most exposed individuals are reached by local sources from fuel reprocessing plants, the highest collective effective dose equivalent commitment is reached for global dispersed 85 Kr. (author)
Preliminary Assessment of Spatial Competition in the Market for E85
Energy Technology Data Exchange (ETDEWEB)
Clinton, Bentley [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-02-01
Anecdotal evidence suggests retail E85 prices may track retail gasoline prices rather than wholesale costs. This indicates E85 prices may be higher than they would be if priced on a cost basis hence limiting adoption by some price-sensitive consumers. Using publicly available and proprietary E83 and regular gasoline price data, we examine pricing behavior in the market for E85. Specifically, we assess the extent to which local retail competition in E85 markets decreases E85 retail prices. Results of econometric analysis suggest that higher levels of retail competition (measured in terms of station density) are associated with lower E85 prices at the pump. While more precise causal estimates may be produced from more comprehensive data, this study is the first to our knowledge that estimates the spatial competition dimension of E85 pricing behavior by firms. This is an initial presentation; a related technical report is also available.
Suppression of the stellar enhancement factor and the reaction 85Rb(p,n)85Sr
International Nuclear Information System (INIS)
Rauscher, T.; Kiss, G. G.; Gyuerky, Gy.; Simon, A.; Fueloep, Zs.; Somorjai, E.
2009-01-01
It is shown that a Coulomb suppression of the stellar enhancement factor occurs in many endothermic reactions at and far from stability. Contrary to common assumptions, reaction measurements for astrophysics with minimal impact of stellar enhancement should be preferably performed for those reactions instead of their reverses, despite of their negative Q value. As a demonstration, the cross section of the astrophysically relevant 85 Rb(p,n) 85 Sr reaction has been measured by activation between 2.16≤E c.m. ≤3.96 MeV and the astrophysical reaction rates at p process temperatures for (p,n) as well as (n,p) are directly inferred from the data. Additionally, our results confirm a previously derived modification of a global optical proton potential. The presented arguments are also relevant for other α- and proton-induced reactions in the p, rp, and νp processes.
Statistical Analysis of the Factors Influencing Consumer Use of E85
Energy Technology Data Exchange (ETDEWEB)
Bromiley, P.; Gerlach, T.; Marczak, K.; Taylor, M.; Dobrovolny, L.
2008-07-01
Evaluating the sales patterns of E85 retail outlets can provide important information about consumer behavior regarding E85, locating future E85 fueling infrastructure, and developing future alternative fuel policies and programs.
High efficiency Dual-Cycle Conversion System using Kr-85.
Prelas, Mark A; Tchouaso, Modeste Tchakoua
2018-04-26
This paper discusses the use of one of the safest isotopes known isotopes, Kr-85, as a candidate fuel source for deep space missions. This isotope comes from 0.286% of fission events. There is a vast quantity of Kr-85 stored in spent fuel and it is continually being produced by nuclear reactors. In using Kr-85 with a novel Dual Cycle Conversion System (DCCS) it is feasible to boost the system efficiency from 26% to 45% over a single cycle device while only increasing the system mass by less than 1%. The Kr-85 isotope is the ideal fuel for a Photon Intermediate Direct Energy Conversion (PIDEC) system. PIDEC is an excellent choice for the top cycle in a DCCS. In the top cycle, ionization and excitation of the Kr-85:Cl gas mixture (99% Kr and 1% Cl) from beta particles creates KrCl* excimer photons which are efficiently absorbed by diamond photovoltaic cells on the walls of the pressure vessels. The benefit of using the DCCS is that Kr-85 is capable of operating at high temperatures in the primary cycle and the residual heat can then be converted into electrical power in the bottom cycle which uses a Stirling Engine. The design of the DCCS begins with a spherical pressure vessel of radius 13.7 cm with 3.7 cm thick walls and is filled with a Kr-85:Cl gas mixture. The inner wall has diamond photovoltaic cells attached to it and there is a sapphire window between the diamond photovoltaic cells and the Kr-85:Cl gas mixture which shields the photovoltaic cells from beta particles. The DCCS without a gamma ray shield has specific power of 6.49 W/kg. A removable 6 cm thick tungsten shield is used to safely limit the radiation exposure levels of personnel. A shadow shield remains in the payload to protect the radiation sensitive components in the flight package. The estimated specific power of the unoptimized system design in this paper is about 2.33 W/kg. The specific power of an optimized system should be higher. The Kr-85 isotope is relatively safe because it
40 CFR 85.1406 - Certification.
2010-07-01
... POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1406 Certification. (a) Certification... provide some level of particulate emission reduction, and will not cause the urban bus engine to fail to... urban bus engines. (c) Test equipment selection. Certification shall be based upon tests utilizing...
KCNE1 D85N polymorphism — a sex-specific modifier in type 1 long QT syndrome?
Directory of Open Access Journals (Sweden)
Marjamaa Annukka
2011-01-01
Full Text Available Abstract Background Long QT syndrome (LQTS is an inherited ion channel disorder manifesting with prolongation of the cardiac repolarization phase and severe ventricular arrhythmias. The common KCNE1 D85N potassium channel variant prolongs QT interval by inhibiting IKs (KCNQ1 and IKr (KCNH2 currents and is therefore a suitable candidate for a modifier gene in LQTS. Methods We studied the effect of D85N on age-, sex-, and heart rate-adjusted QT-interval duration by linear regression in LQTS patients carrying the Finnish founder mutations KCNQ1 G589D (n = 492, KCNQ1 IVS7-2A>G (n = 66, KCNH2 L552S (n = 73, and KCNH2 R176W (n = 88. We also investigated the association between D85N and clinical variables reflecting the severity of the disease. Results D85N was associated with a QT prolongation by 26 ms (SE 8.6, p = 0.003 in males with KCNQ1 G589D (n = 213, but not in females with G589D (n = 279. In linear regression, the interaction between D85N genotype and sex was significant (p = 0.028. Within the KCNQ1 G589D mutation group, KCNE1 D85N carriers were more often probands of the family (p = 0.042 and were more likely to use beta blocker medication (p = 0.010 than non-carriers. The number of D85N carriers in other founder mutation groups was too small to assess its effects. Conclusions We propose that KCNE1 D85N is a sex-specific QT-interval modifier in type 1 LQTS and may also associate with increased severity of disease. Our data warrant additional studies on the role of KCNE1 D85N in other genetically homogeneous groups of LQTS patients.
Update and improvement of the global krypton-85 emission inventory.
Ahlswede, Jochen; Hebel, Simon; Ross, J Ole; Schoetter, Robert; Kalinowski, Martin B
2013-01-01
Krypton-85 is mainly produced in nuclear reactors by fission of uranium and plutonium and released during chopping and dissolution of spent fuel rods in nuclear reprocessing facilities. As noble gas it is suited as a passive tracer for evaluation of atmospheric transport models. Furthermore, research is ongoing to assess its quality as an indicator for clandestine reprocessing activities. This paper continues previous efforts to compile a comprehensive historic emission inventory for krypton-85. Reprocessing facilities are the by far largest emitters of krypton-85. Information on sources and calculations used to derive the annual krypton-85 emission is provided for all known reprocessing facilities in the world. In addition, the emission characteristics of two plants, Tokai (Japan) and La Hague (France), are analysed in detail using emission data with high temporal resolution. Other types of krypton-85 sources are power reactors, naval reactors and isotope production facilities. These sources contribute only little or negligible amounts of krypton-85 compared to the large reprocessing facilities. Taking the decay of krypton-85 into account, the global atmospheric inventory is estimated to about 5500 PBq at the end of 2009. The correctness if the inventory has been proven by meteorological simulations and its error is assumed to be in the range of a few percent. Copyright © 2012 Elsevier Ltd. All rights reserved.
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... succinogenes] ... Length = 120 ... Query: 6 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVD...LPGVQKEDI 65 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQK...EDI Sbjct: 1 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQKEDI 60 ...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... succinogenes] ... Length = 111 ... Query: 45 ... ITPSELEALQNQGVRVVDIRTEPEWQQTGVIPQSERLTFFDARGNYDAL...GFLKRLEQRGI 104 ... ITPSELEALQNQGVRVVDIRTEPEWQQTGVIPQSERLTFFDARGNYDALGFLKR...LEQRGI Sbjct: 1 ... ITPSELEALQNQGVRVVDIRTEPEWQQTGVIPQSERLTFFDARGNYDALGFLKRLEQRGI 60 ...
44 CFR 5.85 - Authentication and attestation of copies.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Authentication and attestation of copies. 5.85 Section 5.85 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT... Authentication and attestation of copies. The Administrator, Deputy Administrators, Regional Administrators...
10 CFR 51.85 - Draft environmental impact statement-rulemaking.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Draft environmental impact statement-rulemaking. 51.85... Implementing Section 102(2) Draft Environmental Impact Statements-Rulemaking § 51.85 Draft environmental impact... Commission has determined to prepare an environmental impact statement. ...
Radioactive 85Kr in krypton enriched with a light isotope
International Nuclear Information System (INIS)
Kuz'minov, V.V.; Novikov, V.M.; Pomanskii, A.A.; Pritychenko, B.V.; Vieiar, J.; Garcia, E.; Morales, A.; Morales, J.; Nunes-Lagos, R.; Piumendon, J.
1993-01-01
Radioactive krypton 85, a product of nuclear power generation, is known to be accumulating in the atmosphere continuously. Its volumetric activity in natural krypton is 700-800 Bq/liter. This can cause difficulties, e.g., in the fabrication of nuclear radiation detector for high-mass krypton. Krypton with a reduced 85 Kr content can be obtained by isotope separation. As part of an experiment to look for two-positron decay and conversion of an atomic electron to a positron in 78 Kr, Saenz measured the 85 Kr content in 78 Kr-enriched krypton. A mixture of two 85 Kr samples was used as the working substance of a cylindrical ionization chamber. The useful volume (1.33 liter) of the chamber contained 35.3 liters of gas at ∼2.5 kPa. The energy resolution of the detector at an energy of 0.511 MeV was 3.8%. The measurements were made in a passive lead shield 20 cm thick in an underground laboratory at a depth of 675 m water equivalent. Results are presented for counting rates in low-energy regions, contribution of krypton-85 to background, and the volumetric activity of krypton-85
Ihracska, Balazs; Korakianitis, Theodosios P.; Ruiz, Paula; Emberson, David Robert; Crookes, Roy James; Diez, Alvaro; Wen, Dongsheng
2014-01-01
Premixed fuel-air flame propagation is investigated in a single-cylinder, spark-ignited, four-stroke optical test engine using high-speed imaging. Circles and ellipses are fitted onto image projections of visible light emitted by the flames. The images are subsequently analysed to statistically evaluate: flame area; flame speed; centroid; perimeter; and various flame-shape descriptors. Results are presented for gasoline, isooctane, E85 and M85. The experiments were conducted at stoichiometric...
Breitkopf, Susanne B.; Yang, Xuemei; Begley, Michael J.; Kulkarni, Meghana; Chiu, Yu-Hsin; Turke, Alexa B.; Lauriol, Jessica; Yuan, Min; Qi, Jie; Engelman, Jeffrey A.; Hong, Pengyu; Kontaridis, Maria I.; Cantley, Lewis C.; Perrimon, Norbert; Asara, John M.
2016-02-01
Using a series of immunoprecipitation (IP) - tandem mass spectrometry (LC-MS/MS) experiments and reciprocal BLAST, we conducted a fly-human cross-species comparison of the phosphoinositide-3-kinase (PI3K) interactome in a drosophila S2R+ cell line and several NSCLC and human multiple myeloma cell lines to identify conserved interacting proteins to PI3K, a critical signaling regulator of the AKT pathway. Using H929 human cancer cells and drosophila S2R+ cells, our data revealed an unexpected direct binding of Corkscrew, the drosophila ortholog of the non-receptor protein tyrosine phosphatase type II (SHP2) to the Pi3k21B (p60) regulatory subunit of PI3K (p50/p85 human ortholog) but no association with Pi3k92e, the human ortholog of the p110 catalytic subunit. The p85-SHP2 association was validated in human cell lines, and formed a ternary regulatory complex with GRB2-associated-binding protein 2 (GAB2). Validation experiments with knockdown of GAB2 and Far-Western blots proved the direct interaction of SHP2 with p85, independent of adaptor proteins and transfected FLAG-p85 provided evidence that SHP2 binding on p85 occurred on the SH2 domains. A disruption of the SHP2-p85 complex took place after insulin/IGF1 stimulation or imatinib treatment, suggesting that the direct SHP2-p85 interaction was both independent of AKT activation and positively regulates the ERK signaling pathway.
International Nuclear Information System (INIS)
Ballou, J.E.
1982-01-01
The purpose of this research is to obtain biological data to supplement earlier evaluations of the hazards of 85 Kr exposure. The studies include both short-term and chronic exposure of rats, dogs and sheep to determine tissue distribution and retention kinetics for metabolic modeling purposes. Dose-effect studies in rats exposed acutely as newborns or chronically for most of their life span are included to identify tissues at risk and determine tumorigenic potency
Kunstiakadeemia - 85 / Reet Varblane
Varblane, Reet, 1952-
1999-01-01
28. XI tähistas Eesti Kunstiakadeemia oma 85. aastapäeva. Kunstihariduse tulevikule pühendatud paneeldiskussioonist Sakala keskuse väikeses saalis, pressikonverentsist, pidulikust aktusest. Kunstiakadeemia esimesteks audoktoriteks promoveeriti Boris Bernshtein, Kaljo Põllu, Enno Hallek, Ilja Kabakov. Auliikmeteks nimetati Mari Adamson, Leo Gens, Leili Kuldkepp, Helene Kuma, Paul Luhtein, Arseni Mölder, Evald Okas, Helmut Oruvee, Bruno Tomberg, Jaan Vares. Juubelialbumi kujundas Jüri Kaarma, ajaloolise ülevaate kirjutas Leo Gens
Directory of Open Access Journals (Sweden)
Odilon Gomes Pereira
2011-09-01
Full Text Available Objetivou-se avaliar características morfogênicas e estruturais do capim-tifton 85 adubado com nitrogênio nas doses de 0, 33, 66, 100 ou 133 kg/ha.ano em três alturas à data de corte (30, 40 ou 50 cm. O delineamento foi inteiramente casualizado em esquema de parcelas subdivididas com três repetições. As doses de nitrogênio (N corresponderam às parcelas e as alturas ao tempo de corte, às subparcelas. A taxa de aparecimento foliar do capim-tifton 85 foi influenciada de forma negativa pela altura da planta na época do corte e de maneira positiva pela dose de nitrogênio. A taxa de senescência foliar e o número total de folhas por perfilho diminuíram, enquanto a taxa de alongamento foliar aumentou com a adubação nitrogenada. Por outro lado, a taxa de senescência foliar e o número total de folhas por perfilho aumentaram com a altura das plantas na época da colheita. Já o número de folhas vivas por perfilho não foi influenciado pela dose de nitrogênio nem pela altura da planta na época do corte. Para uma mesma altura do capim-tifton 85 na época da colheita, a adubação nitrogenada aumenta o fluxo de tecidos e a frequência de desfolhação. Na condição de desfolhação intermitente, o capim-tifton 85 deve ser colhido com altura de até 30 cm.The objective of this study was to evaluate the morphogenic and structural characteristics of tifton 85 bermudagrass under different nitrogen doses (0, 33, 66, 100 or 133 kg/ha.year of N and three different plant heights (30, 40 or 50 cm at harvesting time. A split plot scheme in a completely randomized design with three replications was used. The nitrogen (N doses stood for the portions and the haversting heights, for the subportions. The leaf appearance rate of tifton 85 bermudagrass was negatively influenced by plant height at harvesting time, but positively influenced by N dose. Leaf senescence rate and total number of leaves per tiller decreased, whereas leaf elongation rate
Preliminary studies in sheep exposed to 85Kr atmospheres
International Nuclear Information System (INIS)
Andrew, F.D.; Willard, D.H.; Ballou, J.E.; Sikov, M.R.
1977-01-01
Accumulation of 85 Kr in arterial blood of sheep occurs within 10 min of inhalation exposure initiation, and disappears by 30 min after exposure termination. As reported for other species, 85 Kr concentrations in fat were approximately 10 times those in other tissues
Directory of Open Access Journals (Sweden)
Eduardo C. Severiano
2010-01-01
Full Text Available A produção de forragens conservadas utilizando-se um tráfego intenso de maquinário sob condições inadequadas de água no solo, tem condicionado compactação do solo e a degradação das pastagens. No enfrentamento desta grave questão faz-se necessário o conhecimento do potencial de descompactação do solo, promovido por algumas forrageiras. Objetivou-se, com o presente trabalho, avaliar a descompactação de um Argissolo ao ser cultivado com capim-tifton 85 e sua produção. O experimento foi conduzido na Universidade Federal de Lavras, no período de fevereiro a junho de 2007, em delineamento inteiramente casualizado cultivando-se o capim-tifton nos seguintes graus de compactação do solo: 66, 83, 88, 92 e 98%. Avaliaram-se os atributos físicos, o comportamento compressivo do solo e a produção de massa seca do capim. A descompactação foi quantificada pela redução da pressão de preconsolidação após o cultivo. Os modelos de capacidade de suporte de carga refletiram as alterações na macroporosidade do solo. Nas condições do estudo o capim-tifton 85 promoveu a descompactação do solo, a qual é diretamente proporcional ao grau de compactação inicial. A produção de forragem aumenta sempre que o solo é descompactado.The production of conserved forages using an intense traffic of machinery under inadequate conditions of water content in the soil has caused soil compaction and the degradation of pastures. In order to face this serious problem it is necessary to know the potential of soil loosening by some forage plants. The objective of the present study was to evaluate the loosening of an Argisol cultivated with Tifton 85 grass, as well as its production. The experiment was conducted at the Federal University of Lavras, from February to June 2007, using a completely randomized design, cultivating the Tifton 85 grass under the following compaction degrees: 66, 83, 88, 92 and 98%. The physical attributes, the compressive
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
Signed by more than 25 associations, or enterprises and the Government, this charter underlines eight main points in favor of the super-ethanol E85 development. Then the charter defines the actions plan allowing to assure the success of the launching and the development of the super-ethanol E85 channel: the necessary standards and technic, the diversified and impressive offer of flex-fuel vehicles, the E85 distribution network on the territory, the development of a competitive and sustainable channel of ethanol production, the economic and fiscal conditions allowing the E85 to be competitive facing the fossil fuels and the following of the actions plan. (A.L.B.)
40 CFR 85.1401 - General applicability.
2010-07-01
...) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1401 General applicability. The requirements of this subpart shall be applicable to 1993 and earlier model year urban buses...
Molecular mechanism for the action of the anti-CD44 monoclonal antibody MEM-85
Czech Academy of Sciences Publication Activity Database
Škerlová, Jana; Král, V.; Kachala, M.; Fábry, M.; Bumba, L.; Svergun, D. I.; Tošner, Z.; Veverka, Václav; Řezáčová, Pavlína
2015-01-01
Roč. 191, č. 2 (2015), s. 214-223 ISSN 1047-8477 R&D Projects: GA MŠk(CZ) LK11205; GA MŠk(CZ) LO1304 Institutional support: RVO:61388963 Keywords : CD44 * epitope mapping * monoclonal antibody * MEM-85 * NMR * SAXS Subject RIV: CE - Biochemistry Impact factor: 2.570, year: 2015
Simulating the mesoscale transport of krypton-85.
Felsberg, Anne; Ross, J Ole; Schlosser, Clemens; Kirchner, Gerald
2018-01-01
Due to its half-life, chemical inertness and low solubility in water, radioactive 85 Kr is a valuable tracer for testing the performance of atmospheric dispersion models in simulating long-range transport of pollutants. This paper evaluates the capability of simulating the dispersion of radiokrypton emitted by a nuclear fuel reprocessing plant in north-west France. Three time periods during which elevated activity concentrations of 85 Kr in ground level air were detected in south-west Germany are chosen. Simulations have been performed using the HYSPLIT code and the European Centre for Median-Range Weather Forecasts (ECMWF) data base. Although their results show a slight trend of underestimating the measured 85 Kr concentrations, there is a significant correlation and moderate scatter between observations and simulations with about 50% of the results being within a factor of two of the measured concentrations. The simulated travel time distributions provided a valuable tool for providing additional insight into the dispersion of the tracer radionuclides and for identifying potential causes of deviations between measured and calculated concentrations. Copyright © 2017. Published by Elsevier Ltd.
Mutig, Alex; Lott, James A.; Blokhin, Sergey A.; Moser, Philip; Wolf, Philip; Hofmann, Werner; Nadtochiy, Alexey M.; Bimberg, Dieter
2011-03-01
The progressive penetration of optical communication links into traditional copper interconnect markets greatly expands the applications of vertical cavity surface emitting lasers (VCSELs) for the next-generation of board-to-board, moduleto- module, chip-to-chip, and on-chip optical interconnects. Stability of the VCSEL parameters at high temperatures is indispensable for such applications, since these lasers typically reside directly on or near integrated circuit chips. Here we present 980 nm oxide-confined VCSELs operating error-free at bit rates up to 25 Gbit/s at temperatures as high as 85 °C without adjustment of the drive current and peak-to-peak modulation voltage. The driver design is therefore simplified and the power consumption of the driver electronics is lowered, reducing the production and operational costs. Small and large signal modulation experiments at various temperatures from 20 up to 85 °C for lasers with different oxide aperture diameters are presented in order to analyze the physical processes controlling the performance of the VCSELs. Temperature insensitive maximum -3 dB bandwidths of around 13-15 GHz for VCSELs with aperture diameters of 10 μm and corresponding parasitic cut-off frequencies exceeding 22 GHz are observed. Presented results demonstrate the suitability of our VCSELs for practical high speed and high temperature stable short-reach optical links.
Energy Technology Data Exchange (ETDEWEB)
Takeuchi, A., E-mail: takeuchi@imr.tohoku.ac.jp; Zhang, Y.; Takenaka, K.; Makino, A. [Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan)
2015-05-07
Fe-based Fe{sub 85}B{sub 15}, Fe{sub 84}B{sub 15}Cu{sub 1}, Fe{sub 82}Si{sub 2}B{sub 15}Cu{sub 1}, Fe{sub 85}Si{sub 2}B{sub 12}Cu{sub 1}, and Fe{sub 85}Si{sub 2}B{sub 8}P{sub 4}Cu{sub 1} (NANOMET{sup ®}) alloys were experimental and computational analyzed to clarify the features of NANOMET that exhibits high saturation magnetic flux density (B{sub s}) nearly 1.9 T and low core loss than conventional nanocrystalline soft magnetic alloys. The X-ray diffraction analysis for ribbon specimens produced experimentally by melt spinning from melts revealed that the samples were almost formed into an amorphous single phase. Then, the as-quenched samples were analyzed with differential scanning calorimeter (DSC) experimentally for exothermic enthalpies of the primary and secondary crystallizations (ΔH{sub x1} and ΔH{sub x2}) and their crystallization temperatures (T{sub x1} and T{sub x2}), respectively. The ratio ΔH{sub x1}/ΔH{sub x2} measured by DSC experimentally tended to be extremely high for the Fe{sub 85}Si{sub 2}B{sub 8}P{sub 4}Cu{sub 1} alloy, and this tendency was reproduced by the analysis with commercial software, Thermo-Calc, with database for Fe-based alloys, TCFE7 for Gibbs free energy (G) assessments. The calculations exhibit that a volume fraction (V{sub f}) of α-Fe tends to increase from 0.56 for the Fe{sub 85}B{sub 15} to 0.75 for the Fe{sub 85}Si{sub 2}B{sub 8}P{sub 4}Cu{sub 1} alloy. The computational analysis of the alloys for G of α-Fe and amorphous phases (G{sub α-Fe} and G{sub amor}) shows that a relationship G{sub α-Fe} ∼ G{sub amor} holds for the Fe{sub 85}Si{sub 2}B{sub 12}Cu{sub 1}, whereas G{sub α-Fe} < G{sub amor} for the Fe{sub 85}Si{sub 2}B{sub 8}P{sub 4}Cu{sub 1} alloy at T{sub x1} and that an extremely high V{sub f} = 0.75 was achieved for the Fe{sub 85}Si{sub 2}B{sub 8}P{sub 4}Cu{sub 1} alloy by including 2.8 at. % Si and 4.5 at. % P into α-Fe. These computational results indicate that the Fe{sub 85}Si{sub 2}B
Debye’s temperature and heat capacity for Sr0.15Ba0.85Bi2Nb2O9 relaxor ferroelectric ceramic
Directory of Open Access Journals (Sweden)
A. Peláiz-Barranco
2016-03-01
Full Text Available A lead-free relaxor ferroelectric, Sr0.15Ba0.85Bi2Nb2O9, was synthesized via solid-state reaction and the temperature-dependence of the heat capacity was measured in a wide temperature range. The dielectric permittivity was also measured between 500Hz and 5MHz in the same temperature range. No anomaly has been detected in the heat capacity curve for the whole temperature range covered in the present experiments, while broad peaks have been observed in the dielectric permittivity with high frequency dispersion. A typical relaxor behavior has been observed from the dielectric analysis. The Debye’s temperature has showed a minimum value near the freezing temperature. The results are discussed considering the spin-glass model and the high frequency dispersion, which has been observed for the studied relaxor system.
Investigation of the interaction of 85Kr with plants in model experiments
International Nuclear Information System (INIS)
Butkus, D.V.; Morkunas, G.S.; Bluvshtejn, D.Yu.; Styro, B.I.
1988-01-01
The method of investigation of the interaction of 85 Kr with plants is described using model experiments and data analysis. The dependencies of the coefficient of 85 Kr absorption by plants on the biological structure of the plant, the concentration of krypton-85 in the environment, the method of plant exposition in the environment with the 85 Kr admixture are provided. The time dependencies of 85 Kr desorption from plants are given. 4 refs.; 7 figs.; 3 tabs
40 CFR 85.1509 - Final admission of modification and test vehicles.
2010-07-01
... test vehicles. 85.1509 Section 85.1509 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Importation of Motor Vehicles and Motor Vehicle Engines § 85.1509 Final admission of modification and test vehicles. (a) Except...
46 CFR 221.85 - Hearing procedures.
2010-10-01
... § 221.85 Hearing procedures. (a) The Hearing Officer shall conduct a fair and impartial proceeding in... the authentication of any written exhibit or statement. (c) At the close of the Party's presentation...
Yoakim, M; Hou, W; Liu, Y; Carpenter, C L; Kapeller, R; Schaffhausen, B S
1992-01-01
The binding of phosphatidylinositol-3-kinase to the polyomavirus middle T antigen is facilitated by tyrosine phosphorylation of middle T on residue 315. The pp85 subunit of phosphatidylinositol-3-kinase contains two SH2 domains, one in the middle of the molecule and one at the C terminus. When assayed by blotting with phosphorylated middle T, the more N-terminal SH2 domain is responsible for binding to middle T. When assayed in solution with glutathione S transferase fusions, both SH2s are capable of binding phosphorylated middle T. While both SH2 fusions can compete with intact pp85 for binding to middle T, the C-terminal SH2 is the more efficient of the two. Interaction between pp85 or its SH2 domains and middle T can be blocked by a synthetic peptide comprising the tyrosine phosphorylation sequence around middle T residue 315. Despite the fact that middle T can interact with both SH2s, these domains are not equivalent. Only the C-terminal SH2-middle T interaction was blocked by anti-SH2 antibody; the two SH2 fusions also interact with different cellular proteins. Images PMID:1380095
2010-10-01
... Use/Acceptance of Funds § 85.40 Cost sharing. (a) The Federal share shall not exceed 75% of total... grant objectives and represent the current market value of noncash contributions furnished as part of...
Factoring 51 and 85 with 8 qubits.
Geller, Michael R; Zhou, Zhongyuan
2013-10-28
We construct simplified quantum circuits for Shor's order-finding algorithm for composites N given by products of the Fermat primes 3, 5, 17, 257, and 65537. Such composites, including the previously studied case of 15, as well as 51, 85, 771, 1285, 4369, … have the simplifying property that the order of a modulo N for every base a coprime to N is a power of 2, significantly reducing the usual phase estimation precision requirement. Prime factorization of 51 and 85 can be demonstrated with only 8 qubits and a modular exponentiation circuit consisting of no more than four CNOT gates.
Factoring 51 and 85 with 8 qubits
Geller, Michael R.; Zhou, Zhongyuan
2013-10-01
We construct simplified quantum circuits for Shor's order-finding algorithm for composites N given by products of the Fermat primes 3, 5, 17, 257, and 65537. Such composites, including the previously studied case of 15, as well as 51, 85, 771, 1285, 4369, … have the simplifying property that the order of a modulo N for every base a coprime to N is a power of 2, significantly reducing the usual phase estimation precision requirement. Prime factorization of 51 and 85 can be demonstrated with only 8 qubits and a modular exponentiation circuit consisting of no more than four CNOT gates.
Plasma steam reforming of E85 for hydrogen rich gas production
International Nuclear Information System (INIS)
Zhu Xinli; Hoang Trung; Lobban, Lance L; Mallinson, Richard G
2011-01-01
E85 (85 vol% ethanol and 15 vol% gasoline) is a partly renewable fuel that is increasing in supply availability. Hydrogen production from E85 for fuel cell or internal combustion engine applications is a potential method for reducing CO 2 emissions. Steam reforming of E85 using a nonthermal plasma (pulse corona discharge) reactor has been exploited at low temperature (200-300 0 C) without external heating, diluent gas, oxidant or catalyst in this work. Several operational parameters, including the discharge current, E85 concentration and feed flow rate, have been investigated. The results show that hydrogen rich gases (63-67% H 2 and 22-29% CO, with small amounts of CO 2 , C 2 hydrocarbons and CH 4 ) can be produced by this method. A comparison with ethanol reforming and gasoline reforming under identical conditions has also been made and the behaviour of E85 reforming is found to be close to that of ethanol reforming with slightly higher C 2 hydrocarbons yields.
Alternative processes for the long-term storage of Kr-85
International Nuclear Information System (INIS)
Penzhorn, R.D.
1977-12-01
The forseeable problems which are characteristic of the long-term storage of Kr-85, are discussed on the basis of the chemical, physical and radiological properties of the fission noble gases krypton and xenon as well as rubidium, the daughter nuclide of Kr-85. The various alternatives suggested in the literature for the long-term storage of Kr-85 are reviewed. The technological realization of each of the proposed alternatives is analyzed. (orig.) [de
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... succinogenes] ... Length = 146 ... Query: 28 ... PEEQREALASLVRFIDNTKSDLDVAIYSFTNKEISKAIRKAAERGVKIRLIYDE...SANKGV 87 ... PEEQREALASLVRFIDNTKSDLDVAIYSFTNKEISKAIRKAAERGVKIRLIYDESANKGV... Sbjct: 1 ... PEEQREALASLVRFIDNTKSDLDVAIYSFTNKEISKAIRKAAERGVKIRLIYDESANKGV 60 ... Query: 148 YETLLITENLEWTQKAKRYF
2010-07-01
... POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1402 Definitions. The definitions of this..., state, city department, or private or public entity controlling the use of one or more urban buses... part means a part present in or on an engine at the time an urban bus is originally sold to the...
40 CFR 85.2305 - Duration and applicability of certificates of conformity.
2010-07-01
... certificates of conformity. 85.2305 Section 85.2305 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Clean Air Act § 85.2305 Duration and applicability of certificates of conformity. (a) Except as provided in paragraph (b) of this section, a certificate of conformity is deemed to be effective and cover the...
Physical properties and heat transfer characteristics of materials for krypton-85 storage
International Nuclear Information System (INIS)
Christensen, A.B.
1977-09-01
Krypton-85 decay results in heat generation, and the subsequent temperature increase in the krypton-85 storage media must be evaluated. This report compiles the physical properties of krypton and of potential krypton-85 storage materials which are required to calculate the maximum temperature developed during storage. Temperature calculations were made for krypton-85 stored as a gas or immobilized solid in steel storage cylinders. The effects of krypton-85 loading, cylinder radius, storage media properties, and exterior cooling on storage temperature were shown
41 CFR 102-83.85 - What is a central business area?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a central business area? 102-83.85 Section 102-83.85 Public Contracts and Property Management Federal Property... Location of Space Urban Areas § 102-83.85 What is a central business area? Central business area (CBA...
41 CFR 102-85.95 - Who pays for the TI allowance?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who pays for the TI allowance? 102-85.95 Section 102-85.95 Public Contracts and Property Management Federal Property Management... GSA SPACE Tenant Improvement Allowance § 102-85.95 Who pays for the TI allowance? The customer agency...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... TRANSPORTER [Wolinella succinogenes] ... Length = 223 ... Query: 35 ... GELRVGLEPGYLPFEMKDKKGNVIG...FDVDLAREMAKAMGVKLKLVPTSWDGLIPGLVTEK 94 ... GELRVGLEPGYLPFEMKDKKGNVIGFDVDLA...REMAKAMGVKLKLVPTSWDGLIPGLVTEK Sbjct: 1 ... GELRVGLEPGYLPFEMKDKKGNVIGFDVDLAREMAKAMGVKLKLVPTSWDGLIPGLVTEK 60 ... Qu
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... PEPTIDYL-PROLYL ISOMERASE [Wolinella succinogenes] ... Length = 147 ... Query: 29 ... VVVLETTSGTIELTLFPKAAPKAVENFTTH...VKNGYYDGLIFHRVIKRFMLQXXXXXXXXX 88 ... VVVLETTSGTIELTLFPKAAPKAVENFTTH...VKNGYYDGLIFHRVIKRFMLQ ... Sbjct: 1 ... VVVLETTSGTIELTLFPKAAPKAVENFTTHVKNGYYDGLIFHRVIKRFMLQGGDP
40 CFR 85.1407 - Notification of intent to certify.
2010-07-01
... handling costs and taxes; (ii) A detailed breakout of the total number of hours necessary to install the... documentation that demonstrate compliance with the life cycle cost requirements specified in § 85.1403(b)(1)(ii... by the equipment certifier as evidence of compliance with the emission requirements specified in § 85...
45 CFR 1386.85 - Filing and service of papers.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Filing and service of papers. 1386.85 Section 1386... Requirements General § 1386.85 Filing and service of papers. (a) All papers in the proceedings must be filed... transcripts of testimony need be filed. (b) Copies of papers in the proceedings must be served on all parties...
JSC Case Study: Fleet Experience with E-85 Fuel
Hummel, Kirck
2009-01-01
JSC has used E-85 as part of an overall strategy to comply with Presidential Executive Order 13423 and the Energy Policy Act. As a Federal fleet, we are required to reduce our petroleum consumption by 2 percent per year, and increase the use of alternative fuels in our vehicles. With the opening of our onsite dispenser in October 2004, JSC became the second federal fleet in Texas and the fifth NASA center to add E-85 fueling capability. JSC has a relatively small number of GSA Flex Fuel fleet vehicles at the present time (we don't include personal vehicles, or other contractor's non-GSA fleet), and there were no reasonably available retail E-85 fuel stations within a 15-minute drive or within five miles (one way). So we decided to install a small 1000 gallon onsite tank and dispenser. It was difficult to obtain a supplier due to our low monthly fuel consumption, and our fuel supplier contract has changed three times in less than five years. We experiences a couple of fuel contamination and quality control issues. JSC obtained good information on E-85 from the National Ethanol Vehicle Coalition (NEVC). We also spoke with Defense Energy Support Center, (DESC), Lawrence Berkeley Laboratory, and US Army Fort Leonard Wood. E-85 is a liquid fuel that is dispensed into our Flexible Fuel Vehicles identically to regular gasoline, so it was easy for our vehicle drivers to make the transition.
Tafur Monroy, I.; Öhman, F.; Yvind, K.; Kjaer, R.; Peucheret, C.; Koonen, A.M.J.; Jeppesen, P.
2006-01-01
We report on a bidirectional 85 km long reach PON system supported by distributed fiber Raman amplification with a record 7.5 Gb/s remote carrier modulated upstream signal by employing a reflective SOA-EA monolithically integrated circuit.
Preliminary Assessment of Spatial Competition in the Market for E85: Presentation Supplement
Energy Technology Data Exchange (ETDEWEB)
Clinton, Bentley [National Renewable Energy Lab. (NREL), Golden, CO (United States); Johnson, Caley [National Renewable Energy Lab. (NREL), Golden, CO (United States); Moriarty, Kristi [National Renewable Energy Lab. (NREL), Golden, CO (United States); Newes, Emily [National Renewable Energy Lab. (NREL), Golden, CO (United States); Vimmerstedt, Laura [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-02-01
Anecdotal evidence suggests retail E85 prices may track retail gasoline prices rather than wholesale costs. This indicates E85 prices may be higher than they would be if priced on a cost basis hence limiting adoption by some price-sensitive consumers. Using publicly available and proprietary E85 and regular gasoline price data, we examine pricing behavior in the market for E85. Specifically, we assess the extent to which local retail competition in E85 markets decreases E85 retail prices. Results of econometric analysis suggest that higher levels of retail competition (measured in terms of station density) are associated with lower E85 prices at the pump. While more precise causal estimates may be produced from more comprehensive data, this study is the first to our knowledge that estimates the spatial competition dimension of E85 pricing behavior by firms. This technical report elaborates on a related presentation.
24 CFR 85.22 - Allowable costs.
2010-04-01
... uniform cost accounting standards that comply with cost principles acceptable to the Federal agency. ... TRIBAL GOVERNMENTS Post-Award Requirements Financial Administration § 85.22 Allowable costs. (a... increment above allowable costs) to the grantee or subgrantee. (b) Applicable cost principles. For each kind...
Steady-State Characterization of Bacteriorhodopsin-D85N Photocycle
Timucin, Dogan A.; Downie, John D.; Norvig, Peter (Technical Monitor)
1999-01-01
An operational characterization of the photocycle of the genetic mutant D85N of bacteriorhodopsin, BR-D85N, is presented. Steady-state bleach spectra and pump-probe absorbance data are obtained with thick hydrated films containing BR-D85N embedded in a gelatin host. Simple two- and three-state models are used to analyze the photocycle dynamics and extract relevant information such as pure-state absorption spectra, photochemical-transition quantum efficiencies, and thermal lifetimes of dominant states appearing in the photocycle, the knowledge of which should aid in the analysis of optical recording and retrieval of data in films incorporating this photochromic material. The remarkable characteristics of this material and their implications from the viewpoint of optical data storage and processing are discussed.
Directory of Open Access Journals (Sweden)
Ana Clara Rodrigues Cavalcante
2004-12-01
Full Text Available Avaliaram-se o consumo, a digestibilidade, o pH e concentração de amônia ruminais e a taxa de passagem em bovinos alimentados com dietas contendo feno de capim-tifton 85 (TIF e silagem de milho (SM em diferentes proporções. Utilizaram-se quatro animais castrados, com peso médio de 523kg, fistulados no rúmen, distribuídos em um quadrado latino 4 x 4, recebendo 60% de volumoso e 40% de concentrado, na base da matéria seca. O volumoso consistiu das seguintes proporções (%: 100 TIF:0 SM; 67 TIF:33 SM; 33 TIF:67 SM e 0 TIF:100 SM. Os consumos de matéria seca (MS, de matéria orgânica (MO e de matéria orgânica digestível (MOD, de proteína bruta (PB, de fibra em detergente neutro (FDN e de carboidratos totais (CHOT e digeríveis (CHOD não foram influenciados pelas diferentes proporções de feno de capim-tifton 85: silagem de milho nas dietas, registrando-se valores médios de 9,2; 8,7; 6,4; 1,1; 3,7; 7,3 e 5,4 kg/dia, respectivamente. O consumo de extrato etéreo (EE elevou linearmente com o aumento da silagem de milho nas dietas. As digestibilidades aparentes da MS, MO, PB, EE e CHO também não foram influenciadas pelas diferentes proporções de silagem de milho, obtendo-se, respectivamente, valores médios de 71,8; 73,0; 69,5; 69,2 e 73,9%. Para a digestibilidade da FDN, observou-se efeito quadrático, estimando-se valor máximo de 65,2% para dietas contendo 30,98% de silagem de milho. Estimou-se concentração máxima de amônia de 12,0 mg/100 ml e valor mínimo de pH de 5,98 às 2,44 e 6,82 horas após a alimentação, respectivamente. A taxa de passagem não foi influenciada pelas diferentes proporções de feno:silagem, no volumoso, apresentando valor médio de 4,2%/hora.The intake, digestibility, ruminal pH and ammonia concentrations and passage rate were evaluated in steers fed corn silage (CS and Tifton 85 bermudagrass hay (T85H-based diets, at different forage proportions. Four rumen fistulated steers with 523 kg of live
40 CFR 425.85 - Pretreatment standards for existing sources (PSES).
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Pretreatment standards for existing sources (PSES). 425.85 Section 425.85 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS LEATHER TANNING AND FINISHING POINT SOURCE CATEGORY Pigskin Subcategory...
7 CFR 160.85 - Sale of mixed turpentine not lawful.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Sale of mixed turpentine not lawful. 160.85 Section 160.85 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) NAVAL STORES...
Oxygenated fuel (M-85) behavior in the subsurface -- A Laboratory scale investigation
International Nuclear Information System (INIS)
Donaldson, C.R.; Barker, J.F.; Chatzis, I.
1993-01-01
M-85 is an oxygenated fuel consisting of 85% methanol and 15% gasoline. The complete miscibility of methanol with water may lead to a significantly different source behavior and contamination scenario for M-85 relative to a conventional gasoline. A laboratory investigation involving phase equilibria, cosolvency and column experiments was designed to assess the subsurface behavior of M-85 in comparison to API PS-6 gasoline. Liquid-liquid equilibrium determinations have indicated that unlike PS-6, which is essentially immiscible with water, M-85 would behave as a single miscible phase with groundwater under certain conditions. However, as mixing with groundwater proceeded, two distinct, immiscible phases would result. Column experiments involved the injection of a slug of M-85 or PS-6 onto a saturated, packed column of Borden sand. Aqueous BTEX and methanol breakthrough curves were prepared based on column effluent analyses. Subsequent soil sample analyses provided information regarding the residual gasoline phase distributions from each source. The results of the column experiments indicated that the groundwater contamination arising from an M-85 source would be more complex than from PS-6. The plume of dissolved organic compounds migrating from an M-85 source was characterized by a high methanol content front and associated enhanced BTEX concentrations relative to PS-6, due to methanol's cosolubility effects
Krypton-85 health risk assessment for a nuclear fuel reprocessing plant
International Nuclear Information System (INIS)
Mellinger, P.J.; Brackenbush, L.W.; Tanner, J.E.; Gilbert, E.S.
1984-08-01
The risks involved in the routine release of 85 Kr from nuclear fuel reprocessing operations to the environment were compared to those resulting from the capture and storage of 85 Kr. Instead of releasing the 85 Kr to the environment when fuel is reprocessed, it can be captured, immobilized and stored. Two alternative methods of capturing 85 Kr (cryogenic distillation and fluorocarbon absorption) and one method of immobilizing the captured gas (ion implantation/sputtering) were theoretically incorporated into a representative fuel reprocessing plant, the Barnwell Nuclear Fuel Plant, even though there are no known plans to start up this facility. Given the uncertainties in the models used to generate lifetime risk numbers (0.02 to 0.027 radiation induced fatal cancers expected in the occupational workforce and 0.017 fatal cancers in the general population), the differences in total risks for the three situations, (i.e., no-capture and two-capture alternatives) cannot be considered meaningful. It is possible that no risks would occur from any of the three situations. There is certainly no reason to conclude that risks from 85 Kr routinely released to the environment are greater than those that would result from the other two situations considered. Present regulations mandate recovery and disposal of 85 Kr from the off gases of a facility reprocessing spent fuel from commercial sources. Because of the lack of a clear-cut indication that recovery woud be beneficial, it does not seem prudent to burden the facilities with a requirement for 85 Kr recovery, at least until operating experience demonstrates the incentive. The probable high aging of the early fuel to be processed and the higher dose resulting from the release of the unregulated 3 H and 14 C also encourage delaying implementation of the 85 Kr recovery in the early plants
Characterization of the Met326Ile variant of phosphatidylinositol 3-kinase p85alpha
DEFF Research Database (Denmark)
Almind, Katrine; Delahaye, Laurent; Hansen, Torben
2002-01-01
. When the four human p85alpha proteins were expressed in yeast, a 27% decrease occurred in the level of protein expression of p85alpha(Ile/Asp) (P = 0.03) and a 43% decrease in p85alpha(Ile/Asn) (P = 0.08) as compared with p85alpha(Met/Asp). Both p85alpha(Ile/Asp) and p85alpha(Ile/Asn) also exhibited...... increased binding to phospho-insulin receptor substrate-1 by 41% and 83%, respectively (P substrate-1 slightly increased in brown preadipocytes derived from p85alpha...... knockout mice. Both p85alpha(Met) and p85alpha(Ile) had similar effects on AKT activity and were able to reconstitute differentiation of the preadipocytes, although the triglyceride concentration in fully differentiated adipocytes and insulin-stimulated 2-deoxyglucose uptake were slightly lower than...
5 CFR 1201.85 - Enforcing subpoenas.
2010-01-01
....85 Administrative Personnel MERIT SYSTEMS PROTECTION BOARD ORGANIZATION AND PROCEDURES PRACTICES AND... in the foreign country. (b) Upon application by the Special Counsel, the Board may seek court enforcement of a subpoena issued by the Special Counsel in the same manner in which it seeks enforcement of...
The anti-tumor efficacy of nanoparticulate form of ICD-85 versus free form
Directory of Open Access Journals (Sweden)
Zare Mirakabadi, A.
2015-04-01
Full Text Available Biodegradable polymeric nanoparticles (NPs have been intensively studied as a possible way to enhance anti-tumor efficacy while reducing side effects. ICD-85, derived from the venom of two separate species of venomous animals, has been shown to exhibit anti-cancer activity. In this report polymer based sodium alginate nanoparticles of ICD-85 was used to enhance its therapeutic effects and reduce its side effects. The inhibitory effect was evaluated by MTT assay. The necrotic effect was assessed using LDH assay. The induction of apoptosis was analyzed by caspase-8 colorimetric assay kit. Cytotoxicity assay in HeLa cells demonstrated enhanced efficacy of ICD-85 loaded NPs compared to the free ICD-85. The IC50 values obtained in HeLa cells after 48 h, for free ICD-85 and ICD-85 loaded NPs were 26±2.9μg ml-1 and 18±2.5μg ml-1, respectively. While it was observed that free ICD-85 exhibits mild cytotoxicity towards normal MRC-5 cells (IC50>60μg ml-1, ICD-85 loaded NPs was found to have higher efficacy in anti-proliferative activity on HeLa cells in vitro without any significant cytotoxic effect on normal MRC-5 cells. The apoptosis-induction mechanism by both form of ICD-85 on HeLa cells was found to be through activation of caspase-8 with approximately 2 fold greater of ICD-85 loaded NPs as compared to free ICD-85. Our work reveals that although ICD-85 in free form is relatively selective to inhibit the growth of cancer cells via apoptosis as compared to normal cells, but nanoparticulate form increases its selectivity towards cancer cells.
Development of long term storage technique for recovered Kr-85, (1)
International Nuclear Information System (INIS)
Inada, Eiichi; Motoyama, Shigeji; Tsunoda, Naomi; Yamamoto, Keizo; Hirano, Seiji.
1979-01-01
The adsorption storage method of radioactive krypton Kr-85 using a double cylinder packed with activated charcoal is expected to be put into practical use as an intermediate storing method until the immobilization technique for long term storage is established. In this paper, the conceptual design of an intermediate, remote-controlled Kr-85 storage facility is presented. The features of this system are double containment, low pressure storage, and remote control. Kr-85 is at first filled into a double cylinder by the adsorbing effect of activated charcoal at low temperature (-196 deg C) by cooling with liquid nitrogen. Then, the unwelded portion of the outer cylinder containing the inner cylinder is welded and inspected to make double containment. The double cylinders are cooled by ventilation to remove the decay heat of Kr-85, and krypton leakage is always monitored. If any leakage is detected, the double cylinder is transferred to the cutting cell for the re-encapsulation of Kr-85 in a safe double cylinder. All operations are performed by remote control because of a high radiation field. The expected amount and composition of Kr-85 to be recovered from the reprocessing plant are also given as the design conditions. (Wakatsuki, Y.)
Willingness to pay for E85 from corn, switchgrass, and wood residues
Energy Technology Data Exchange (ETDEWEB)
Jensen, Kimberly L.; Clark, Christopher D.; English, Burton C.; Menard, R. Jamey; Skahan, Denise K.; Marra, Adrienne C. [Department of Agricultural Economics, The University of Tennessee, 302 Morgan Hall, Knoxville, TN, 37996 (United States)
2010-11-15
Willingness to pay (WTP) for E85 (automotive fuel blend of 85% ethanol and 15% gasoline) was estimated from a contingent choice exercise contained in a national survey of consumers. The choice exercise included E85 blends from three different feedstock sources (corn grain, switchgrass, and wood wastes) and an E10 blend (10% ethanol and 90% gasoline) with corn grain as the ethanol feedstock. Results from the study indicate willingness to pay a premium for E85 from switchgrass compared with E10 from corn. Concerns about land use for ''food versus fuel'' had a negative impact on WTP for E85 from corn grain, while greater concerns about fuel security relative to the environment had a positive impact. (author)
Willingness to pay for E85 from corn, switchgrass, and wood residues
International Nuclear Information System (INIS)
Jensen, Kimberly L.; Clark, Christopher D.; English, Burton C.; Menard, R. Jamey; Skahan, Denise K.; Marra, Adrienne C.
2010-01-01
Willingness to pay (WTP) for E85 (automotive fuel blend of 85% ethanol and 15% gasoline) was estimated from a contingent choice exercise contained in a national survey of consumers. The choice exercise included E85 blends from three different feedstock sources (corn grain, switchgrass, and wood wastes) and an E10 blend (10% ethanol and 90% gasoline) with corn grain as the ethanol feedstock. Results from the study indicate willingness to pay a premium for E85 from switchgrass compared with E10 from corn. Concerns about land use for ''food versus fuel'' had a negative impact on WTP for E85 from corn grain, while greater concerns about fuel security relative to the environment had a positive impact. (author)
Potential of tannin-rich plants for modulating ruminal microbes and ruminal fermentation in sheep.
Rira, M; Morgavi, D P; Archimède, H; Marie-Magdeleine, C; Popova, M; Bousseboua, H; Doreau, M
2015-01-01
The objective of this work was to study nutritional strategies for decreasing methane production by ruminants fed tropical diets, combining in vitro and in vivo methods. The in vitro approach was used to evaluate the dose effect of condensed tannins (CT) contained in leaves of Gliricidia sepium, Leucaena leucocephala, and Manihot esculenta (39, 75, and 92 g CT/kg DM, respectively) on methane production and ruminal fermentation characteristics. Tannin-rich plants (TRP) were incubated for 24 h alone or mixed with a natural grassland hay based on Dichanthium spp. (control plant), so that proportions of TRP were 0, 0.25, 0.5, 0.75, and 1.0. Methane production, VFA concentration, and fermented OM decreased with increased proportions of TRP. Numerical differences on methane production and VFA concentration among TRP sources may be due to differences in their CT content, with greater effects for L. leucocephala and M. esculenta than for G. sepium. Independently of TRP, the response to increasing doses of CT was linear for methane production but quadratic for VFA concentration. As a result, at moderate tannin dose, methane decreased more than VFA. The in vivo trial was conducted to investigate the effect of TRP on different ruminal microbial populations. To this end, 8 rumen-cannulated sheep from 2 breeds (Texel and Blackbelly) were used in two 4 × 4 Latin square designs. Diets were fed ad libitum and were composed of the same feeds used for the in vitro trial: control plant alone or combined with pellets made from TRP leaves at 44% of the diet DM. Compared to TRP, concentration of Ruminococcus flavefaciens was greater for the control diet and concentration of Ruminococcus albus was least for the control diet. The methanogen population was greater for Texel than for Blackbelly. By contrast, TRP-containing diets did not affect protozoa or Fibrobacter succinogenes numbers. Hence, TRP showed potential for mitigating methane production by ruminants. These findings suggest
2010-01-01
... SPECIAL USE AIRSPACE Prohibited Areas § 73.85 Using agency. For the purpose of this subpart, the using agency is the agency, organization or military command that established the requirements for the prohibited area. Editorial Note: Sections 73.87 through 73.99 are reserved for descriptions of designated...
Directory of Open Access Journals (Sweden)
Joanna Collerton
Full Text Available Falls are common in older people and increase in prevalence with advancing old age. There is limited knowledge about their impact in those aged 85 years and older, the fastest growing age group of the population. We investigated the prevalence and impact of falls, and the overlap between falls, dizziness and blackouts, in a population-based sample of 85 year olds.Cross-sectional analysis of baseline data from Newcastle 85+ Cohort Study.Primary care, North-East England.816 men and women aged 85 years.Structured interview with research nurse. Cost-consequence analysis of fall-related healthcare costs.Over 38% (313/816 of participants had fallen at least once in the previous 12 months and of these: 10.6% (33/312 sustained a fracture, 30.1% (94/312 attended an emergency department, and 12.8% (40/312 were admitted to hospital. Only 37.2% (115/309 of fallers had specifically discussed their falls problem with their general practitioner and only 12.7% (39/308 had seen a falls specialist. The average annual healthcare cost per faller was estimated at £202 (inter-quartile range £174-£231 or US$329 ($284-$377. 'Worry about falling' was experienced by 42.0% (128/305 of fallers, 'loss of confidence' by 40.0% (122/305, and 'going out less often' by 25.9% (79/305; each was significantly more common in women, odds ratios (95% confidence interval for women: men of 2.63 (1.45-4.55, 4.00 (2.27-7.14, and 2.86 (1.54-5.56 respectively. Dizziness and blackouts were reported by 40.0% (318/796 and 6.4% (52/808 of participants respectively. There was marked overlap in the report of falls, dizziness and blackouts.Falls in 85 year olds are very common, associated with considerable psychological and physical morbidity, and have high impact on healthcare services. Wider use of fall prevention services is needed. Significant expansion in acute and preventative services is required in view of the rapid growth in this age group.
7 CFR 301.85-9 - Movement of live golden nematodes.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of live golden nematodes. 301.85-9 Section... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE DOMESTIC QUARANTINE NOTICES Golden Nematode Quarantine and Regulations § 301.85-9 Movement of live golden nematodes. Regulations requiring a permit for and otherwise...
40 CFR 85.2107 - Warranty remedy.
2010-07-01
... adjustment, repair or replacement of those components which have been installed in or on a vehicle for the... vehicle validly presented for repair to any authorized service facility authorized by the vehicle... authorized repair facility) to repair a vehicle within the time period specified under § 85.2106(d) after the...
Effect of chronic 85Kr exposure
International Nuclear Information System (INIS)
Willard, D.H.; DeFord, H.S.; Ballou, J.E.
1980-01-01
Groups of rats exposed continuously for 15 mo to 85 Kr atmospheres have received measured dose rates of 2750, 370, and 38 rad/yr. With more than 75% of the rats still alive, there has been no dose-related effect on weight gain but a probably significant effect on survival
40 CFR 85.1411 - Labeling requirements.
2010-07-01
...) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1411 Labeling... shall be affixed to the rebuilt engine which states, “Certified to EPA Urban Bus Engine Rebuild... warranter) to EPA Urban Bus Engine Rebuild Emission Standards”; and (2) A list of the vehicles or engines...
Sorption Behavior of Strontium-85 Onto Colloids of Silica and Smectite
International Nuclear Information System (INIS)
Lu, N.; Triay, I.R.; Mason, C.F.V.; Longmire, P.A.
1998-01-01
Strontium-90 is one of the sizable radioactive contaminants found in DP Canyon at Los Alamos, New Mexico. Radioactive surveys found the 90 Sr is present in surface and groundwater in DP Canyon and Los Alamos Canyon. Colloids may influence the transport of this radionuclide in surface water and groundwater environments in both canyons. In this study, we investigated the sorption/desorption behavior of Sr on colloids of smectite and silica. Laboratory batch sorption experiments were conducted using 85 Sr as a surrogate to 90 Sr. Groundwater, collected from DP Canyon and from Well J-13 at Yucca Mountain, Nevada, and deionized water were used in this study. Our results show that 92% to 100% of 85 Sr was rapidly adsorbed onto smectite colloids in all three waters. The concentrations of Ca 2+ significantly influence the adsorption of 85 Sr onto silica colloids. Desorption of 85 Sr from smectite colloids is much slower than the sorption process. Desorption of 85 Sr from silica colloids was rapid in DP groundwater and slow using J-13 groundwater and deionized water
34 CFR 85.530 - Where can I find the EPLS?
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Where can I find the EPLS? 85.530 Section 85.530 Education Office of the Secretary, Department of Education GOVERNMENTWIDE DEBARMENT AND SUSPENSION... through the Internet, currently at http://epls.arnet.gov. (b) As of November 26, 2003, you may also...
34 CFR 85.800 - What are the causes for debarment?
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What are the causes for debarment? 85.800 Section 85... customers between competitors, and bid rigging; (3) Commission of embezzlement, theft, forgery, bribery... debarment or suspension action; or (5) Violation of the provisions of the Drug-Free Workplace Act of 1988...
International Nuclear Information System (INIS)
Kulyukhin, S.A.; Konovalova, N.A.; Rumer, I.A.; Kamenskaya, A.N.; Mikheev, N.B.
2005-01-01
Coprecipitation of 137 Cs and 85 Sr with [Na(18-crown-6]BPh 4 solid phase from aqueous, aqueous-ethanolic, and alkaline solutions is studied. 137 C s and 85 Sr co-crystallize with [Na(18-crown-6]BPh 4 from aqueous and aqueous-ethanolic solutions. The cocrystallization coefficients D of 137 Cs and 85 Sr from aqueous solutions are 2.6 ± 0.5 and 3.3 ± 0.3, respectively. For aqueous-ethanolic solutions, the corresponding values are 4.4 ± 0.5 and 3.4 ± 0.4. In the alkaline solutions (0.1 and 1 M NaOH), 54-74% of 137 Cs and 37-51% of 85 Sr pass into the [Na(18-crown-6)]BPh 4 solid phase, depending on the crown ether concentration in the system [ru
Adsorption properties of a molecular 5 A sieve for 85Kr
International Nuclear Information System (INIS)
Wardaszko, T.; Nidecka, J.
1978-01-01
The enrichment processes which are necessary at low-level 85 Kr determinations in the atmospheric air require the knowledge of adsorption properties of appropriate sorbing agents, such as a molecular 5A sieve. Following low-temperature adsorption, under specified conditions, of known amounts of 85 Kr diluted in the air, desorption was carried out and then the 85 Kr content in the temperature fraction as well as their total volume were determined. Distribution curves for the above quantities in fractions are presented. (author)
40 CFR 85.2105 - Aftermarket parts.
2010-07-01
... aftermarket part in the maintenance or repair of a vehicle. A vehicle manufacturer that honors a valid....2107(c). (b) Except as provided in § 85.2104(h), a vehicle manufacturer may deny an emission performance warranty claim on the basis of an uncertified aftermarket part used in the maintenance or repair...
40 CFR 85.1803 - Remedial Plan.
2010-07-01
... POLLUTION FROM MOBILE SOURCES Recall Regulations § 85.1803 Remedial Plan. (a) When any manufacturer is... the total parts requirement of each person who is to perform the repair under the remedial plan to be...: (i) The recall campaign number; and (ii) A code designating the campaign facility at which the repair...
A review of ''The potential effects of release of krypton-85''
International Nuclear Information System (INIS)
Saunders, C.P.R.
1993-06-01
A Report into the potential effects of the release of Krypton-85 from the Thermal Oxide Reprocessing Plant (THORP) at Sellafield, was commissioned by British Nuclear Fuels Ltd. The report dealt with the atmospheric impact of the release of Krypton-85 and considered specifically the areas of atmospheric electricity, ionisation, aerosols and conductivity, in terms of the releases of Krypton-85 from THORP. This present review has three objectives: to consider the atmospheric effects of the proposed discharges from THORP, to comment upon the magnitude of the postulated effects from Krypton-85 discharges compared with those from other sources of radioactivity in the atmosphere, and, to comment on the conclusions drawn by the authors of the report. This review was conducted under the aegis of the United Kingdom Inspectorate of Pollution. (author)
The International Reactor Dosimetry File (IRDF-85)
International Nuclear Information System (INIS)
Cullen, D.E.; McLaughlin, P.K.
1985-04-01
This document describes the contents of the second version of the International Reactor Dosimetry File (IRDF-85), distributed by the Nuclear Data Section of the International Atomic Energy Agency. This library superseded IRDF-82. (author)
Bioeconomy Initiative at MBI International
Energy Technology Data Exchange (ETDEWEB)
Kleff, Susanne, Ph.D.
2011-11-30
Di-carboxylic acids have the potential to replace petrochemicals used in the polymer industry (Werpy and Petersen, 2004). MBI developed a process for the production of succinic acid using a proprietary organism. During this work MBI assessed the feasibility to produce other carboxylic acids either using A. succinogenes or other organisms. The development of recombinant A. succinogenes strain derivatives for a mono-carboxylic acid through over-expression of enzymatic activities was successful. Fermentations achieved titers of 58 g/L for this organic acid. Recombinant strains that produced the same acid, but a different stereoisomer, reached titers of 10 g/L. Attempts to increase the titers for this isomer as well as other organic acids were unsuccessful. MBI is looking for commercial partners to pursue the development of recombinant A. succinogenes strains for the production of other organic acids. Attempts to develop recombinant strains of A. succinogenes for fumaric acid production through introduction of various antisense RNA constructs were unsuccessful. Alternative suitable organisms were evaluated and Rhizopus oryzae, a natural fumaric acid producer with potential for process improvements, was selected. A novel fermentation and one-step recovery process was developed that allowed capture of IP, produced titers of >80 g/L with a productivity of 1.8 g/L-h and 57% (g/g glucose) yield. The process was scaled to 2000 L pilot scale. The economic analysis projected a production cost of 72 c/lb. Recycling and re-use of the base was demonstrated and incorporated into the process. The ability of the organism to produce fumaric acid from other carbon sources and biomass hydrolysate was demonstrated. The production of other organic acids was evaluated and techno-economic de-risking roadmap documents were prepared.
Effect of chronic 85Kr exposure
International Nuclear Information System (INIS)
Willard, D.H.; Deford, H.S.; Gerk, R.E.; Ballou, J.E.
1979-01-01
Rats are being exposed continuously for their life span to three concentrations of 85 Kr: 3 x 10 -3 , 3 x 10 -4 , and 3 x 10 -5 μCi/ml. A group of treated controls exposed to room air completes the study. No effects of treatment have been observed up to 70 days postexposure
Lightning and 85-GHz MCSs in the Global Tropics
Toracinta, E. Richard; Zipser, E. J.
1999-01-01
Numerous observations of tropical convection show that tropical continental mesoscale convective systems (MCSs) are much more prolific lightning producers than their oceanic counterparts. Satellite-based climatologies using 85-GHz passive microwave ice-scattering signatures from the Special Sensor Microwave/Imager (SSM/I) indicate that MCSs of various size and intensity are found throughout the global tropics. In contrast, global lightning distributions show a strong land bias with an order of magnitude difference between land and ocean lightning. This is somewhat puzzling, since 85-GHz ice-scattering and the charge separation processes that lead to lightning are both thought to depend upon the existence of large graupel particles. The fact that low 85-GHz brightness temperatures are observed in tropical oceanic MCSs containing virtually no lightning leads to the postulate that tropical oceanic and tropical continental MCSs have fundamentally different hydrometeor profiles through the mixed phase region of the cloud (0 C Lightning Imaging Sensor (LIS), and the first space-borne radar, facilitates high-resolution case studies of MCS structure throughout the global tropics. An important precursor, however, is to better understand the distribution of MCSs and lightning in the tropics. With that objective in mind, this research undertakes a systematic comparison of 85-GHz-defined MCSs and lightning over the global tropics for a full year, as an initial step toward quantifying differences between land and ocean convective systems.
International Nuclear Information System (INIS)
Zameroski, Nathan D; Hager, Gordon D; Erickson, Christopher J; Burke, John H
2014-01-01
Doppler free two photon absorption spectroscopy was employed to measure the pressure broadening and frequency shift rates of the 5S 1/2 (F = 3) → 5D 5/2 (F = 5, 4, 3, 2, 1) (778.105 nm) and the 5S 1/2 (F = 2) → 7S 1/2 (F = 2) (760.126 nm) two photon transitions in 85 Rb by the noble gases and N 2 . To our knowledge, these rates are reported on for the first time. The self-broadening and shift rate of the 5S 1/2 (F = 3) → 5D 5/2 (F = 5, 4, 3, 2, 1) transition and self -broadening rate of the 5S 1/2 (F = 2) → 7S 1/2 (F = 2) transition were also measured. The temperature dependence of the self-frequency shift (Rb-Rb collisions) of these transitions is presented. Helium diffusion rates through Quartz and Pyrex cells are also calculated and the implication of helium diffusion through glass vapor cells is discussed in regards to atomic frequency standards based on these transitions. Experimental pressure broadening and shift rates are compared to theoretically calculated rates assuming a 6, 8 or 6, 8, 10 difference potential and pseudo potential model. Reasonable agreement is achieved between experimental and theoretical values. (paper)
Energy Technology Data Exchange (ETDEWEB)
Visser, Ate [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bibby, Richard K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Moran, Jean E. [California State Univ. (CalState), Long Beach, CA (United States); Singleton, Michael J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Esser, Bradley K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-06-01
A capability for the analysis of krypton-85 (85Kr) in groundwater samples was developed at LLNL. Samples are collected by extracting gas from 2000-4000 L of groundwater at the well, yielding approximately 0.2 cm3 STP krypton. Sample collection takes 1 to 4 hours. Krypton is purified in the laboratory using a combination of molecular sieve and activated charcoal traps, and transferred to a liquid scintillation vial. The 85Kr activity is measured by liquid scintillation on a Quantulus 1220 liquid scintillation counter from PerkinElmer. The detection limit for a typical 0.2 cm3Kr sample size is 11% of the present day activity in air, corresponding to the decay corrected activity in air in 1987. The typical measurement uncertainty is below 10% for recently recharged samples. Six groundwater samples were collected, purified and counted. 85Kr was not detected in any of the samples counted at LLNL. 85Kr was detected by the low level counting laboratory of Bern University in all samples between 1.5 and 6.6 decays per minute per cm3 krypton, corresponding to decay corrected activities in air between 1971 and 1985. The new capability is an excellent complement to tritium-helium, expanding the existing suite of age dating tools available to the GAMA program (35S, 3H/3He, 14C and radiogenic helium). 85Kr can replace 3H/3He in settings where 3H/3He ages are impossible to determine (for example where terrigenic helium overwhelms tritiogenic helium) and provides additional insight into travel time distributions in complex mixed groundwater systems.
UGC galaxies stronger than 25 mJy at 4.85 GHz
International Nuclear Information System (INIS)
Condon, J.J.; Frayer, D.T.; Broderick, J.J.
1991-01-01
UGC galaxies in the declination band +5 to +75 deg were identified by position coincidence with radio sources stronger than 25 mJy on the Green Bank 4.85 GHz sky maps. Candidate identifications were confirmed or rejected with the aid of published aperture-synthesis maps and new 4.86 GHz VLA maps having 15 or 18 arcsec resolution, resulting in a sample of 347 nearby radio galaxies plus five new quasar-galaxy pairs. The radio energy sources in UGC galaxies were classified as starbursts or monsters on the basis of their infrared-radio flux ratios, infrared spectral indices, and radio morphologies. The rms scatter in the logarithmic infrared-radio ratio q is not more than 0.16 for starburst galaxies selected at 4.85 GHz. Radio spectral indices were obtained for nearly all of the UGC galaxies, and S0 galaxies account for a disproportionate share of the compact flat-spectrum (alpha less than 0.5) radio sources. The extended radio jets and lobes produced by monsters are preferentially, but not exclusively, aligned within about 30 deg of the optical minor axes of their host galaxies. The tendency toward minor-axis ejection appears to be independent of radio-source size and is strongest for elliptical galaxies. 230 refs
40 CFR 85.1802 - Notice to manufacturer of nonconformity; submission of Remedial Plan.
2010-07-01
... nonconformity; submission of Remedial Plan. 85.1802 Section 85.1802 Protection of Environment ENVIRONMENTAL... Regulations § 85.1802 Notice to manufacturer of nonconformity; submission of Remedial Plan. (a) A manufacturer... category of vehicles or engines encompassed by the determination of nonconformity, will give the factual...
40 CFR 85.1506 - Inspection and testing of imported motor vehicles and engines.
2010-07-01
... motor vehicles and engines. 85.1506 Section 85.1506 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Importation of Motor Vehicles and Motor Vehicle Engines § 85.1506 Inspection and testing of imported motor vehicles and...
High Temperature Creep of an Al-8,5Fe-1,3V-1,7Si Alloy
Czech Academy of Sciences Publication Activity Database
Kuchařová, Květa; Zhu, S. J.; Čadek, Josef
2002-01-01
Roč. 40, č. 2 (2002), s. 69-84 ISSN 0023-432X R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Al-8,5Fe 1,3V 1,7Si alloy * creep behavior , true threshold stress Subject RIV: JI - Composite Materials Impact factor: 0.493, year: 2002
Energy Technology Data Exchange (ETDEWEB)
Frank, G.; Steinkopff, T. [Deutscher Wetterdienst (Germany); Salvamoser, J. [Institut fuer Angewandte Isotopen-, Gas- und Umweltuntersuchungen (IGU), Woerthsee (Germany)
2016-07-01
The Deutscher Wetterdienst (DWD, German Meteorological Service) operates since 1996 a sampling and measurement device for the radioactive rare gases Kr-85 and Xe-133 in Offenbach. These measurements are embedded in the German Measurement and Information System for Monitoring Environmental Radioactivity (Integriertes Mess- und Informationssystem zur Ueberwachung der Radioaktivitaet in der Umwelt, IMIS) [1]. In addition to these measurements the DWD is sampling rare gases in Potsdam and since 2014 in Trier in cooperation with the Bundesamt fuer Strahlenschutz (Federal Office for Radiation Protection, BfS). In the frame of the Global Atmosphere Watch (GAW)-program of the WMO the DWD operated a sampling station at the Zugspitze (Schneefernerhaus) from 1999 to 2005. This location at the Zugspitze is well suited for the observation of long distance transport of Kr-85 in the higher atmosphere. The DWD in Offenbach operates a complex analytical system for the measurement of Kr-85 and Xe-133 since 1998. This system consists of sampling with first enrichment, second enrichment, gas chromatographic separation and preparation of Krypton and Xenon and measurement of Kr-85 and Xe-133. Using the example Fukushima, it is shown, that the radioactive rare gases Kr-85 and Xe-133 are well undisturbed tracers for atmospheric transport in case of a nuclear accident or routine nuclear reprocessing plants. Measurements of Xe-133, I-131, Cs-137 and Kr-85 are correlated with source and atmospheric transport to the sampling sites at Offenbach and Potsdam.
Atmospheric krypton-85 during 1962 and 1963
Energy Technology Data Exchange (ETDEWEB)
Ehhalt, D.; Muennich, K. O.; Roether, W.; Schoelch, J.; Stich, W.
1963-11-15
The krypton-85 found in the atmosphere presumably originates from two different sources, namely fission bomb tests and processing of burned-out fuel elements from nuclear reactors. This paper discusses the impact of the sources of krypton in the atmosphere in greater detail.
Complex of MUC1, CIN85 and Cbl in Colon Cancer Progression and Metastasis
International Nuclear Information System (INIS)
Cascio, Sandra; Finn, Olivera J.
2015-01-01
We previously reported that CIN85, an 85 KDa protein known to be involved in tumor cell migration and metastasis through its interaction with Cbl, associates with MUC1 in tumor cells. MUC1/CIN85 complex also regulates migration and invasion of tumor cells in vitro. Here, we examined specifically human colon carcinoma tissue microarrays (TMA) by immunohistochemistry for the expression of MUC1 and CIN85 and their potential role in cancer progression and metastasis. We detected a significant increase in expression of both MUC1 and CIN85 associated with advanced tumor stage and lymph node metastasis. We further investigated if Cbl could also be present in the MUC1/CIN85 complex. Co-immunoprecipitation assay showed that Cbl co-localized both with CIN85 and with MUC1 in a human colon cancer cell line. To begin to investigate the in vivo relevance of MUC1 overexpression and association with CIN85 and Cbl in cancer development and progression, we used human MUC1 transgenic mice that express MUC1 on the colonic epithelial cells, treated with azoxymethane to initiate and dextran sulfate sodium (AOM/DSS) to promote colorectal carcinogenesis. MUC1.Tg mice showed higher tumor incidence and decreased survival when compared with wild-type mice. Consistent with the in vitro data, the association of MUC1, CIN85 and Cbl was detected in colon tissues of AOM/DSS-treated MUC1 transgenic mice. MUC1/CIN85/Cbl complex appears to contribute to promotion and progression of colon cancer and thus increased expression of MUC1, CIN85 and Cbl in early stage colon cancer might be predictive of poor prognosis
Complex of MUC1, CIN85 and Cbl in Colon Cancer Progression and Metastasis
Energy Technology Data Exchange (ETDEWEB)
Cascio, Sandra, E-mail: sac131@pitt.edu [Department of Immunology, University of Pittsburgh School of Medicine, E1040 Biomedical Science Tower, Pittsburgh, PA 15261 (United States); Fondazione Ri.Med, via Bandiera, Palermo 90133 (Italy); Finn, Olivera J., E-mail: sac131@pitt.edu [Department of Immunology, University of Pittsburgh School of Medicine, E1040 Biomedical Science Tower, Pittsburgh, PA 15261 (United States)
2015-02-10
We previously reported that CIN85, an 85 KDa protein known to be involved in tumor cell migration and metastasis through its interaction with Cbl, associates with MUC1 in tumor cells. MUC1/CIN85 complex also regulates migration and invasion of tumor cells in vitro. Here, we examined specifically human colon carcinoma tissue microarrays (TMA) by immunohistochemistry for the expression of MUC1 and CIN85 and their potential role in cancer progression and metastasis. We detected a significant increase in expression of both MUC1 and CIN85 associated with advanced tumor stage and lymph node metastasis. We further investigated if Cbl could also be present in the MUC1/CIN85 complex. Co-immunoprecipitation assay showed that Cbl co-localized both with CIN85 and with MUC1 in a human colon cancer cell line. To begin to investigate the in vivo relevance of MUC1 overexpression and association with CIN85 and Cbl in cancer development and progression, we used human MUC1 transgenic mice that express MUC1 on the colonic epithelial cells, treated with azoxymethane to initiate and dextran sulfate sodium (AOM/DSS) to promote colorectal carcinogenesis. MUC1.Tg mice showed higher tumor incidence and decreased survival when compared with wild-type mice. Consistent with the in vitro data, the association of MUC1, CIN85 and Cbl was detected in colon tissues of AOM/DSS-treated MUC1 transgenic mice. MUC1/CIN85/Cbl complex appears to contribute to promotion and progression of colon cancer and thus increased expression of MUC1, CIN85 and Cbl in early stage colon cancer might be predictive of poor prognosis.
Comparison of the results of climate change impact assessment between RCP8.5 and SSP2 scenarios
Lee, D. K.; Park, J. H.; Park, C.; Kim, S.
2017-12-01
Climate change scenarios are mainly published by the Intergovernmental Panel on Climate Change (IPCC), and include SRES (Special Report on Emission Scenario) scenarios (IPCC Third Report), RCP (Representative Concentration Pathways) scenarios (IPCC 5th Report), and SSP (Shared Socioeconomic Pathways) scenarios. Currently widely used RCP scenarios are based on how future greenhouse gas concentrations will change. In contrast, SSP scenarios are that predict how climate change will change in response to socio-economic indicators such as population, economy, land use, and energy change. In this study, based on RCP 8.5 climate data, we developed a new Korean scenario using the future social and economic scenarios of SSP2. In the development of the scenario, not only Korea's emissions but also China and Japan's emissions were considered in terms of space. In addition, GHG emissions and air pollutant emissions were taken into consideration. Using the newly developed scenarios, the impacts assessments of the forest were evaluated and the impacts were evaluated using the RCP scenarios. The average precipitation is similar to the SSP2 scenario and the RCP8.5 scenario, but the SSP2 scenario shows the maximum value is lower than RCP8.5 scenario. This is because the SSP2 scenario simulates the summer precipitation weakly. The temperature distribution is similar for both scenarios, and it can be seen that the average temperature in the 2090s is higher than that in the 2050s. At present, forest net primary productivity of Korea is 693 tC/km2, and it is 679 tC/km2 when SSP2 scenario is applied. Also, the damage of forest by ozone is about 4.1-5.1%. On the other hand, when SSP2 scenario is applied, the forest net primary productivity of Korea is 607 tC/km2 and the forest net primary productivity of RCP8.5 scenario is 657 tC/km2. The analysis shows that the damage caused by climate change is reduced by 14.2% for the SSP2 scenario and 6.9% for the RCP8.5 scenario. The damage caused
Diffusive transport of strontium-85 in sand-bentonite mixtures
International Nuclear Information System (INIS)
Gillham, R.W.; Robin, M.J.L.; Dytynyshyn, D.J.
1983-06-01
Diffusion experiments have been used to determine the transport of 85 Sr in sand-bentonite mixtures. The diffusion experiments were performed on one natural soil (Chalk River sand) and on seven mixtures of bentonite and silica sand, containing from 0 percent to 100 percent bentonite. Two non-reactive solutes ( 36 Cl and 3 H) and one reactive solute ( 85 Sr) were used in the study. The experiments with non-reactive solutes yielded estimates of tortuosity factors. Retardation factors were obtained from experimental porosities, experimental bulk densities, and from batch distribution coefficients (Ksub(d)). These Ksub(d) values are a simple way of describing the solute/medium reaction, and are based on the assumption that the cation-exchange reaction may be described by a linear adsorption isotherm passing through the origin. The results demonstrate that, for practical purposes and for our experimental conditions, the use of the distribution coefficient provides a convenient means of calculating the effective diffusion coefficient for 85 Sr. The porosity and bulk density were also found to have a considerable influence on the effective diffusion coefficient, through the retardation factor. Mixtures containing 5-10 percent bentonite were found to be more effective in retarding 85 Sr than either sand alone, or mixtures containing more bentonite. In the soils of higher bentonite content, the effect of increased cation-exchange capacity was balanced by a decreasing ratio of bulk density to porosity
7 CFR 301.85-8 - Inspection and disposal of regulated articles and pests.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Inspection and disposal of regulated articles and pests. 301.85-8 Section 301.85-8 Agriculture Regulations of the Department of Agriculture (Continued... Nematode Quarantine and Regulations § 301.85-8 Inspection and disposal of regulated articles and pests. Any...
An immunochemical assay for 8,5'-cyclonucleotides in irradiated nucleic acids
International Nuclear Information System (INIS)
Fuciarelli, A.F.; Raleigh, J.A.
1985-01-01
The transfer of radiation damage initiated in the sugar phosphate backbone to a nucleotide base as exemplified by 8,5'-cyclonucleotide formation has been investigated in polyadenylic acid, native and heat-denatured DNA. Polyclonal antiserum was raised in rabbits with a protein-8,5'-cycloadenosine-5'monophosphate (8,5'-cycloAMP) conjugate prepared by the carbodiimide method. An indirect, enzyme-linked immunosorbent assay (ELISA) was developed with this antiserum to probe for 8,5'-cycloAMP formation. The assay can readily detect product formation in polyadenylic acid irradiated to a total dose of 1.0 krad in the absence of oxygen. Product formation in native or heat-denatured DNA irradiated in 0.1 M phosphate buffer (pH 7.00) in the absence of oxygen is detected after approximately 20 krads. The authors shall extend these studies to determine the utility of immunochemical assays for investigating the radiation chemistry of nucleic acids
41 CFR 102-85.25 - What is the basic principle governing OAs?
2010-07-01
... Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 85-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.25 What is the basic principle...
The candidate TB vaccine, MVA85A, induces highly durable Th1 responses.
Directory of Open Access Journals (Sweden)
Michele Tameris
Full Text Available Vaccination against tuberculosis (TB should provide long-term protective immunity against Mycobacterium tuberculosis (M.tb. The current TB vaccine, Bacille Calmette-Guerin (BCG, protects against disseminated childhood TB, but protection against lung TB in adolescents and adults is variable and mostly poor. One potential reason for the limited durability of protection may be waning of immunity through gradual attrition of BCG-induced T cells. We determined if a MVA85A viral-vector boost could enhance the durability of mycobacteria-specific T cell responses above those induced by BCG alone.We describe a long-term follow-up study of persons previously vaccinated with MVA85A. We performed a medical history and clinical examination, a tuberculin skin test and measured vaccine-specific T cell responses in persons previously enrolled as adults, adolescents, children or infants into three different Phase II trials, between 2005 and 2011.Of 252 potential participants, 183 (72.6% consented and completed the study visit. Vaccine-induced Ag85A-specific CD4+ T cell responses were remarkably persistent in healthy, HIV-uninfected adults, adolescents, children and infants, up to 6 years after MVA85A vaccination. Specific CD4+ T cells expressed surface markers consistent with either CD45RA-CCR7+ central memory or CD45RA-CCR7- effector memory T cells. Similarly durable Ag85A-specific CD4+ T cell responses were detected in HIV-infected persons who were on successful antiretroviral therapy when MVA85A was administered. By contrast, Ag85A-specific CD4+ T cell frequencies in untreated MVA85A-vaccinated HIV-infected persons were mostly undetectable 3-5 years after vaccination.MVA85A induces remarkably durable T cell responses in immunocompetent persons. However, results from a recent phase IIb trial of MVA85A, conducted in infants from the same geographic area and study population, showed no vaccine efficacy, suggesting that these durable T cell responses do not
26 CFR 1.85-1 - Unemployment compensation.
2010-04-01
.... (a) Introduction. Section 85 prescribes rules relating to the inclusion in gross income of... than in cash or on some other basis. (ii) Disability and worker's compensation payments. Amounts in the nature of unemployment compensation also include cash disability payments made pursuant to a governmental...
Immune Checkpoint Function of CD85j in CD8 T Cell Differentiation and Aging
Directory of Open Access Journals (Sweden)
Claire E. Gustafson
2017-06-01
Full Text Available Aging is associated with an increased susceptibility to infection and a failure to control latent viruses thought to be driven, at least in part, by alterations in CD8 T cell function. The aging T cell repertoire is characterized by an accumulation of effector CD8 T cells, many of which express the negative regulatory receptor CD85j. To define the biological significance of CD85j expression on CD8 T cells and to address the question whether presence of CD85j in older individuals is beneficial or detrimental for immune function, we examined the specific attributes of CD8 T cells expressing CD85j as well as the functional role of CD85j in antigen-specific CD8 T cell responses during immune aging. Here, we show that CD85j is mainly expressed by terminally differentiated effector (TEMRAs CD8 T cells, which increase with age, in cytomegalovirus (CMV infection and in males. CD85j+ CMV-specific cells demonstrate clonal expansion. However, TCR diversity is similar between CD85j+ and CD85j− compartments, suggesting that CD85j does not directly impact the repertoire of antigen-specific cells. Further phenotypic and functional analyses revealed that CD85j identifies a specific subset of CMV-responsive CD8 T cells that coexpress a marker of senescence (CD57 but retain polyfunctional cytokine production and expression of cytotoxic mediators. Blocking CD85j binding enhanced proliferation of CMV-specific CD8 T cells upon antigen stimulation but did not alter polyfunctional cytokine production. Taken together, these data demonstrate that CD85j characterizes a population of “senescent,” but not exhausted antigen-specific effector CD8 T cells and indicates that CD85j is an important checkpoint regulator controlling expansion of virus-specific T cells during aging. Inhibition of CD85j activity may be a mechanism to promote stronger CD8 T cell effector responses during immune aging.
34 CFR 85.600 - How do suspension and debarment actions start?
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false How do suspension and debarment actions start? 85.600 Section 85.600 Education Office of the Secretary, Department of Education GOVERNMENTWIDE DEBARMENT AND... suspension and debarment actions start? When we receive information from any source concerning a cause for...
Certification of an optimal TSP tour through 85,900 cities
DEFF Research Database (Denmark)
Applegate, David L.; Bixby, Robert E.; Chvatal, Vasek
2009-01-01
We describe a computer code and data that together certify the optimality of a solution to the 85,900-city traveling salesman problem pla85900, the largest instance in the TSPLIB collection of challenge problems......We describe a computer code and data that together certify the optimality of a solution to the 85,900-city traveling salesman problem pla85900, the largest instance in the TSPLIB collection of challenge problems...
Peculiarity of the FEU-85 photomultiplier use for time measurements
International Nuclear Information System (INIS)
Akimov, D.Yu.; Samojlenko, V.T.
1983-01-01
Regime of the PM-85 operation, ensuring high time resolution with the minimum effects of prepulses, has been described. Zonal characteristics of photocathode as to delay of response and amplitude of signal are presented. Elimination of periphery region of the photocathode PM-85 permits to improve time resolution of scintillation detector. Time characteristics of the detector with plastic scintillator dimensions 24x8x0.5 cm are given
40 CFR 68.85 - Hot work permit.
2010-07-01
... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CHEMICAL ACCIDENT PREVENTION PROVISIONS Program 3 Prevention Program § 68.85 Hot work permit. (a) The owner or operator shall issue a hot work permit for hot work operations conducted on or near a covered process. (b...
40 CFR 85.1512 - Admission of catalyst and O2 sensor-equipped vehicles.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Admission of catalyst and O2 sensor... Vehicles and Motor Vehicle Engines § 85.1512 Admission of catalyst and O2 sensor-equipped vehicles. (a)(1... previously admitted under § 85.1505 or § 85.1509 (after June 30, 1988), with a catalyst emission control...
Ag85-focused T-cell immune response controls Mycobacterium avium chronic infection.
Directory of Open Access Journals (Sweden)
Bruno Cerqueira-Rodrigues
Full Text Available CD4+ T cells are essential players for the control of mycobacterial infections. Several mycobacterial antigens have been identified for eliciting a relevant CD4+ T cell mediated-immune response, and numerous studies explored this issue in the context of Mycobacterium tuberculosis infection. Antigen 85 (Ag85, a highly conserved protein across Mycobacterium species, is secreted at the early phase of M. tuberculosis infection leading to the proliferation of Ag85-specific CD4+ T cells. However, in the context of Mycobacterium avium infection, little is known about the expression of this antigen and the elicited immune response. In the current work, we investigated if a T cell receptor (TCR repertoire mostly, but not exclusively, directed at Ag85 is sufficient to mount a protective immune response against M. avium. We show that P25 mice, whose majority of T cells express a transgenic TCR specific for Ag85, control M. avium infection at the same level as wild type (WT mice up to 20 weeks post-infection (wpi. During M. avium infection, Ag85 antigen is easily detected in the liver of 20 wpi mice by immunohistochemistry. In spite of the propensity of P25 CD4+ T cells to produce higher amounts of interferon-gamma (IFNγ upon ex vivo stimulation, no differences in serum IFNγ levels are detected in P25 compared to WT mice, nor enhanced immunopathology is detected in P25 mice. These results indicate that a T cell response dominated by Ag85-specific T cells is appropriate to control M. avium infection with no signs of immunopathology.
Directory of Open Access Journals (Sweden)
Antonio T. de Matos
2013-02-01
Full Text Available Este trabalho foi realizado com o objetivo de avaliar o efeito da aplicação de diferentes taxas de percolado de resíduo sólido urbano (RSU na produtividade e na composição química da parte aérea do capim-Tifton 85 (Cynodon spp. O percolado foi aplicado nas taxas de 0 testemunha; 250; 500; 750 e 1.000 kg ha-1 d-1 de DBO5, durante 8 meses. No tratamento-testemunha, não receptor do percolado, aplicou-se água da rede de abastecimento público, sendo a lâmina de aplicação definida com base na Evapotranspiração de Referência (ETo. O experimento foi analisado no esquema de parcelas subdivididas, tendo nas parcelas cinco concentrações de DBO5, e nas subparcelas, os cortes, no delineamento em blocos casualizados, com quatro repetições. Os dados foram submetidos à análise de regressão e variância. Observou-se aumento na produtividade de matéria seca, nos teores de proteína bruta e nas concentrações de N, K, Na, Ca, Mg, Mn, Cd, Pb e Fe,na parte aérea do capim,com o aumento nas taxas de aplicação do percolado. As concentrações de N, P e Mn tenderam a decrescer com o número de cortes do capim; as de Cd, Pb e Fe tenderam à estabilização após o 2º ou 3º cortes; e as de Na tenderam a aumentar após o 3º corte. As concentrações de K, Ca e Mg ficaram instáveis.The issue of this study was to evaluate the effect of different rates of landfill leachate (LL in productivity and chemical composition of Tifton 85 (Cynodon spp. The leachate was applied at rates of 0 (control, 250, 500, 750, 1,000 kg ha-1 d-1 of BOD5, for eight months. In the control treatment, not receiving the leachate, it was applied water from the public supply network being the water depth of application defined based on the Reference Evapotranspiration (ETo. The experiment was analyzed in a split plot, with five plots concentrations of BOD5 and the cuts the subplots in a randomized block design with four replications. The data were subjected to analysis of
Krypton-85 health risk assessment for a nuclear fuel reprocessing plant
International Nuclear Information System (INIS)
Mellinger, P.J.; Tanner, J.E.; Brackenbush, L.W.; Gilbert, E.S.
1984-08-01
A health risk assessment was conducted to investigate the impact of implementing regulations from the Environmental Protection Agency's Final Environmental Statement - 40 CFR 190 - Environmental Protection Requirements for Normal Operation of Activities in the Uranium Fuel Cycle. Potential risks involved in the routine release of 85 Kr from nuclear fuel reprocessing operations to the environment were compared to those resulting from the capture and storage of 85 Kr. The average occupationally exposed worker was estimated to receive about 400 to 600 mrem/y from 85 Kr recovery and immobilization activities. This dose is a factor of 20,000 to 30,000 higher than the estimated dose to the maximum offsite individual (0.02 mrem/y), and a factor of 130,000 to 200,000 higher than the dose received by the average member of the 50-mile population (0.003 mrem/y) from routine release of all 85 Kr. Given the uncertainties in the models used to generate lifetime risk numbers (0.02-0.027 radiation induced fatal cancers expected in the occupational workforce and 0.017 fatal cancers in the general population), the differences in total risks cannot be considered meaningful. There is certainly no reason to conclude that risks from 85 Kr routinely released to the environment are greater than those that would result from recovery, immobilization and storage of the noble gas. 22 references, 1 figure, 3 tables
Dental status and dental caries in 85-year-old Danes
DEFF Research Database (Denmark)
Vilstrup, Lene; Holm-Pedersen, Poul; Mortensen, Erik Lykke
2007-01-01
OBJECTIVES: This study reports findings on the dental status and the prevalence of dental caries among a group of 85-year-old Danes from the Glostrup 1914 Cohort, Denmark. The purpose of the study was to analyse whether caries experience was related to number of teeth and to indicators...... of functional ability and cognitive function. METHODS: A total of 191 individuals (78 men and 113 women) participated in a cross-sectional population study conducted in 2000. Using mobile dental equipment, a clinical oral examination and an interview were administered to all participants in their homes...... and cognitive impairment tended to have more active caries than 85-year-olds with no impairment. CONCLUSIONS: A substantial proportion of 85-year-old individuals had retained a natural dentition; however, active dental caries is a problem of concern among the most elderly....
Age influence on retention, distribution and internal doses of 85Sr in rat
International Nuclear Information System (INIS)
Tian Wuxun; Wang Decheng; Zhang Hongyuan
1990-01-01
After I.V. 85 Sr, the whole body 85 Sr-retentions in rats were fit to two compartment exponential equations. The equation parameters showed a significantly difference between the young group and both the adult and old groups (p 2 ) for 85 Sr in the slow compartment decreased in regular order from the young to the old groups. In the bone 85 Sr-retention equations Tb 2 of the slow compartment for 85 Sr in the young group was significantly lower than the adult and old groups. The doses of the whole body and red-marrow for young rats were 4.2 times as much as those of adult rats, and 6.2 and 5.9 times as much as those old rats. The dose-cumulative speeds was most quick in the young groups and similar in the adult and the old
N-Linked Protein Glycosylation is Required for Full Competence in Campylobacter jejuni 81-176
National Research Council Canada - National Science Library
Larsen, Joseph C; Szymanski, Christine; Guerry, Patricia
2004-01-01
...) that have subsequently been found in Helicobacter pylori and Wolinella succinogenes. Mutational analyses of some of these genes have implicated their involvement in intestinal epithelial cell invasion and natural competence...
32 CFR 644.85 - General negotiation procedures.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true General negotiation procedures. 644.85 Section... negotiation procedures. (a) Provisions of Military Construction Appropriation Act. (1) Section 108 of the... of Pub. L. 91-646 and this chapter. (c) Negotiations on the basis of ownership; “Package-Deal...
40 CFR 85.1414 - Alternative test procedures.
2010-07-01
... (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1414 Alternative... shall be representative of in-use urban bus operation. The requestor shall supply relevant technical... test is representative of in-use urban bus operation, the Agency shall determine whether to set such...
Nordic reactor safety research 1981-85
International Nuclear Information System (INIS)
Micheelsen, B.
1986-01-01
National resources in Denmark, Finland, Norway, and Sweden were put together with Nordic funds in the four-year research programme 1981-85 on selected areas of nuclear safety. The outcome of the programme, edited in four separate reports, is summarized, and important findings are listed in the areas of probabilistic risk assessment (PRA), loss-of-coolant accidents with small breaks, heat-transfer correlations, and corrosion in the nuclear industry. (author)
Assembly and Molecular Architecture of the Phosphoinositide 3-Kinase p85α Homodimer.
LoPiccolo, Jaclyn; Kim, Seung Joong; Shi, Yi; Wu, Bin; Wu, Haiyan; Chait, Brian T; Singer, Robert H; Sali, Andrej; Brenowitz, Michael; Bresnick, Anne R; Backer, Jonathan M
2015-12-18
Phosphoinositide 3-kinases (PI3Ks) are a family of lipid kinases that are activated by growth factor and G-protein-coupled receptors and propagate intracellular signals for growth, survival, proliferation, and metabolism. p85α, a modular protein consisting of five domains, binds and inhibits the enzymatic activity of class IA PI3K catalytic subunits. Here, we describe the structural states of the p85α dimer, based on data from in vivo and in vitro solution characterization. Our in vitro assembly and structural analyses have been enabled by the creation of cysteine-free p85α that is functionally equivalent to native p85α. Analytical ultracentrifugation studies showed that p85α undergoes rapidly reversible monomer-dimer assembly that is highly exothermic in nature. In addition to the documented SH3-PR1 dimerization interaction, we identified a second intermolecular interaction mediated by cSH2 domains at the C-terminal end of the polypeptide. We have demonstrated in vivo concentration-dependent dimerization of p85α using fluorescence fluctuation spectroscopy. Finally, we have defined solution conditions under which the protein is predominantly monomeric or dimeric, providing the basis for small angle x-ray scattering and chemical cross-linking structural analysis of the discrete dimer. These experimental data have been used for the integrative structure determination of the p85α dimer. Our study provides new insight into the structure and assembly of the p85α homodimer and suggests that this protein is a highly dynamic molecule whose conformational flexibility allows it to transiently associate with multiple binding proteins. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Charter for the development of the super-ethanol E85 channel in France
International Nuclear Information System (INIS)
2006-01-01
Signed by more than 25 associations, or enterprises and the Government, this charter underlines eight main points in favor of the super-ethanol E85 development. Then the charter defines the actions plan allowing to assure the success of the launching and the development of the super-ethanol E85 channel: the necessary standards and technic, the diversified and impressive offer of flex-fuel vehicles, the E85 distribution network on the territory, the development of a competitive and sustainable channel of ethanol production, the economic and fiscal conditions allowing the E85 to be competitive facing the fossil fuels and the following of the actions plan. (A.L.B.)
14 CFR 31.85 - Required basic equipment.
2010-01-01
... following equipment is required: (a) For all balloons: (1) [Reserved] (2) An altimeter. (3) A rate of climb indicator. (b) For hot air balloons: (1) A fuel quantity gauge. If fuel cells are used, means must be... AIRWORTHINESS STANDARDS: MANNED FREE BALLOONS Operating Limitations and Information § 31.85 Required basic...
40 CFR 85.1408 - Objections to certification.
2010-07-01
... (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus Rebuild Requirements § 85.1408 Objections... candidate equipment may cause an urban bus engine to exceed any applicable emission requirements; or (3) Use... conditions or would likely result in an urban bus engine being misadjusted; or (5) Information and/or data...
Energy Technology Data Exchange (ETDEWEB)
Prost, A.; Durieux, B.; Sauvalle, B.; Macaire, A
2006-07-01
The E85 is a fuel realized by a direct and a majority mixing of ethanol in non modified unleaded galena. Created in June 2006, this working group aims to analyze the success conditions of the E85 operating and manage the involved people around a common plan. This report presents the E85 characteristics, shows the economical and environmental interest of the project, provides recommendations and concludes with ten proposals. (A.L.B.)
APPARENT 85KRYPTON AGES OF GROUNDWATER WITHIN THE ROYAL WATERSHED, MAINE, USA
85Kr activities were determined in 264 domestic and municipal wells from 2002-2004 in the Royal watershed (361 km2), Maine. Gas extraction for 85Kr from wells was effected directly via a well-head methodology permitting efficient widespread analys...
10 CFR 30.19 - Self-luminous products containing tritium, krypton-85, or promethium-147.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85, or..., krypton-85, or promethium-147. (a) Except for persons who manufacture, process, produce, or initially transfer for sale or distribution self-luminous products containing tritium, krypton-85, or promethium-147...
41 CFR 102-34.85 - What motor vehicles require motor vehicle identification?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What motor vehicles require motor vehicle identification? 102-34.85 Section 102-34.85 Public Contracts and Property Management... 34-MOTOR VEHICLE MANAGEMENT Identifying and Registering Motor Vehicles Motor Vehicle Identification...
Effects of control technology on the projected krypton-85 environmental inventory
International Nuclear Information System (INIS)
Oscarson, E.E.
1973-01-01
Growth projections for the USA nuclear power industry may be used to make projections of future radioactive material inventories available for potential release to the environment. Since krypton-85 is produced in reactors, the potential routes of release to the environment are at the reactors or the fuel reprocessing plants. The present generation of reactors and fuel reprocessing plants do not use any systems to limit the release of krypton-85 into the biosphere. Clean-up systems are currently being designed and could be introduced when necessary. The cumulative inventory of krypton-85 in the environment is dependent upon the time of introduction of these clean-up systems and their efficiencies, in addition to the total quantity produced. Annual and cumulative inventories of krypton-85 are projected to increase dramatically over the next 50 years. If controls are assumed to be initiated at various years, a series of graphs of different cumulative environmental inventories and the associated doses and health effects are drawn. Varying the year of introduction and the efficiency of these systems allows one to speculate as to the optimum time for control implementation
Schmeisser, Gerhard
2014-01-01
Paul Butzer, who is considered the academic father and grandfather of many prominent mathematicians, has established one of the best schools in approximation and sampling theory in the world. He is one of the leading figures in approximation, sampling theory, and harmonic analysis. Although on April 15, 2013, Paul Butzer turned 85 years old, remarkably, he is still an active research mathematician. In celebration of Paul Butzer’s 85th birthday, New Perspectives on Approximation and Sampling Theory is a collection of invited chapters on approximation, sampling, and harmonic analysis written by students, friends, colleagues, and prominent active mathematicians. Topics covered include approximation methods using wavelets, multi-scale analysis, frames, and special functions. New Perspectives on Approximation and Sampling Theory requires basic knowledge of mathematical analysis, but efforts were made to keep the exposition clear and the chapters self-contained. This volume will appeal to researchers and graduate...
41 CFR 102-85.40 - What are the major components of the pricing policy?
2010-07-01
... components of the pricing policy? 102-85.40 Section 102-85.40 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.40 What are the major components of the pricing policy? The major components of the pricing policy are: (a) An OA between a customer...
Metcalfe, Hannah J; Biffar, Lucia; Steinbach, Sabine; Guzman, Efrain; Connelley, Tim; Morrison, Ivan; Vordermeier, H Martin; Villarreal-Ramos, Bernardo
2018-05-11
There is a need to improve the efficacy of the BCG vaccine against human and bovine tuberculosis. Previous data showed that boosting bacilli Calmette-Guerin (BCG)-vaccinated cattle with a recombinant attenuated human type 5 adenovirally vectored subunit vaccine (Ad5-85A) increased BCG protection and was associated with increased frequency of Ag85A-specific CD4 + T cells post-boosting. Here, the capacity of Ag85A-specific CD4 + T cell lines - derived before and after viral boosting - to interact with BCG-infected macrophages was evaluated. No difference before and after boosting was found in the capacity of these Ag85A-specific CD4 + T cell lines to restrict mycobacterial growth, but the secretion of IL-10 in vitro post-boost increased significantly. Furthermore, cell lines derived post-boost had no statistically significant difference in the secretion of pro-inflammatory cytokines (IL-1β, IL-12, IFNγ or TNFα) compared to pre-boost lines. In conclusion, the protection associated with the increased number of Ag85A-specific CD4 + T cells restricting mycobacterial growth may be associated with anti-inflammatory properties to limit immune-pathology. Copyright © 2018 Department for Environment Food and Rural Affairs. Published by Elsevier Ltd.. All rights reserved.
Separation, storage, and disposal of krypton-85: status and projects
Energy Technology Data Exchange (ETDEWEB)
Laser, M.
1976-09-15
Despite the relatively small impact of 85Kr to man the separation of fission krypton from the off-gas of fuel reprocessing plants must be taken into account. Combined with other advantages also in power reactor stations the retention of 85Kr seems to be attractive. Cryogenic processes are favored worldwide, because the technology has been well proven during several decades in air liquefaction and separation plants. Relatively small modifications must be made to adjust these processes to fission gas separation plants. Some fundamental data however are necessary for the design of a plant. Besides cryogenic processes a liquid adsorption for reprocessing off-gases and charcoal adsorption processes for reactor off-gas are under discussion. The retained krypton can be stored under air or water cooling in usual pressurized steel cylinders. However, legal problems may arise. The steel cylinders can be stored in engineered storage facilities for an intermediate period or finally. In Europe, however, the final storage will be questionable. Therefore, the dumping of 85Kr into the deep sea has been proposed. For this reason a revision of the London Convention is necessary, because the dumping of 85/Kr has not been specified. The IAEA as competent authority is asked to define the conditions for dumping. Injection of krypton containing gases into porous geologic strata may also be possible, if a very small release can be guaranteed.
Measurement of krypton-85 in the atmosphere with a portable apparatus
International Nuclear Information System (INIS)
Okai, T.
1984-01-01
A portable apparatus was developed for the rapid collection, separation and counting of krypton-85 in environmental air samples. The apparatus consists of a molecular sieve trap for the elimination of H 2 O and CO 2 , a charcoal trap for the collection of krypton, a chromatographic column for the isolation of krypton in the air sample and a vial for the disolution of krypton in the scintillation solution. With this apparatus, krypton can be collected from half a cubic meter of air with 94% recovery in about 3 hrs. The measurements of krypton-85 were done several time in Fukuoka area from Jan. 30 to Dec. 9, 1981. The krypton-85 concentration was found to be approximately 21 pCi/m 3 air. The results were compared with those obtained by foreign investigators. (author)
41 CFR 102-85.20 - What does an Occupancy Agreement (OA) do?
2010-07-01
... defines GSA's relationship with each customer agency and: (a) Establishes specific financial terms... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does an Occupancy Agreement (OA) do? 102-85.20 Section 102-85.20 Public Contracts and Property Management Federal Property...
Regulation of the PI3K pathway through a p85α monomer–homodimer equilibrium
Cheung, Lydia W T; Walkiewicz, Katarzyna Wiktoria; Besong, Tabot M.D.; Guo, Huifang; Hawke, David H.; Arold, Stefan T.; Mills, Gordon B.
2015-01-01
The canonical action of the p85α regulatory subunit of phosphatidylinositol 3-kinase (PI3K) is to associate with the p110α catalytic subunit to allow stimuli-dependent activation of the PI3K pathway. We elucidate a p110α-independent role of homodimerized p85α in the positive regulation of PTEN stability and activity. p110α-free p85α homodimerizes via two intermolecular interactions (SH3:proline-rich region and BH:BH) to selectively bind unphosphorylated activated PTEN. As a consequence, homodimeric but not monomeric p85α suppresses the PI3K pathway by protecting PTEN from E3 ligase WWP2-mediated proteasomal degradation. Further, the p85α homodimer enhances the lipid phosphatase activity and membrane association of PTEN. Strikingly, we identified cancer patient-derived oncogenic p85α mutations that target the homodimerization or PTEN interaction surface. Collectively, our data suggest the equilibrium of p85α monomerdimers regulates the PI3K pathway and disrupting this equilibrium could lead to disease development. © Cheung et al.
Regulation of the PI3K pathway through a p85α monomer–homodimer equilibrium
Cheung, Lydia W T
2015-07-29
The canonical action of the p85α regulatory subunit of phosphatidylinositol 3-kinase (PI3K) is to associate with the p110α catalytic subunit to allow stimuli-dependent activation of the PI3K pathway. We elucidate a p110α-independent role of homodimerized p85α in the positive regulation of PTEN stability and activity. p110α-free p85α homodimerizes via two intermolecular interactions (SH3:proline-rich region and BH:BH) to selectively bind unphosphorylated activated PTEN. As a consequence, homodimeric but not monomeric p85α suppresses the PI3K pathway by protecting PTEN from E3 ligase WWP2-mediated proteasomal degradation. Further, the p85α homodimer enhances the lipid phosphatase activity and membrane association of PTEN. Strikingly, we identified cancer patient-derived oncogenic p85α mutations that target the homodimerization or PTEN interaction surface. Collectively, our data suggest the equilibrium of p85α monomerdimers regulates the PI3K pathway and disrupting this equilibrium could lead to disease development. © Cheung et al.
41 CFR 102-85.10 - What is the scope of this part?
2010-07-01
... Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 85-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.10 What is the scope of this part? (a) This part describes GSA policy and principles for the assignment and occupancy of space under its control and the...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...
The Р60-S6K1 isoform of ribosomal protein S6 kinase 1 is a product of alternative mRNA translation
Directory of Open Access Journals (Sweden)
I. V. Zaiets
2018-07-01
Full Text Available Ribosomal protein S6 kinase 1 (S6K1 is a well-known downstream effector of mTORC1 (mechanistic target of rapamycin complex 1 participating primarily in the regulation of cell growth and metabolism. Deregulation of mTOR/S6K1 signaling can promote numerous human pathologies, including cancer, neurodegeneration, cardiovascular disease, and metabolic disorders. As existing data suggest, the S6K1 gene encodes several protein isoforms, including p85-S6K1, p70-S6K1, and p60-S6K1. The two of these isoforms, p85-S6K1 and p70-S6K1, were extensively studied to date. The origin and functional significance of the p60-S6K1 isoform remains a mystery, however, it was suggested that the isoform could be a product of alternative S6K1 mRNA translation. Herein we report the generation of HEK-293 cells exclusively expressing p60-S6K1 as a result of CRISPR/Cas9-mediated inactivation of p85/p70-S6K1 translation. Moreover, the generated modified cells displayed the elevated level of p60-S6K1 expression compared to that in wild-type HEK-293 cells. Our data confirm an assumption that p60-S6K1 is alternatively translated, most probably, from the common for both p70- and p85-S6K1 mRNA transcript and reveal a link between p60-S6K1 expression and such cellular processes as cell proliferation and motility. In addition, our findings indicate that the p60-S6K1 isoform of S6K1 may undergo a mode of regulation distinct from p70- and p85-S6K1 due to the absence of mTOR-regulated p60-S6K1 phosphorylation at T389 that is important for S6K1 activation.
Directory of Open Access Journals (Sweden)
Mahendra Narain Mishra
Full Text Available CONTEXT AND OBJECTIVE: Arterial thrombosis may occur consequent to hereditary thrombophilia and increased lipoprotein(a [Lp(a] and fibrinogen. Our aim was to study the prevalence of common thrombophilia markers in 85 consecutive cases of arterial thrombosis. DESIGN AND SETTING: A retrospective study was conducted from 85 consecutive young patients treated as outpatients or admitted due to stroke or myocardial infarction at a tertiary care hospital. METHODS: Eighty-five Indian patients (age < 45 years presenting ischemic stroke (n = 48 or myocardial infarction (n = 37 and 50 controls were studied for seven thrombophilia markers including antithrombin (AT, factor V, protein C, protein S, activated protein C resistance (APC-R, fibrinogen and Lp(a. Functional assays for protein C, protein S, factor V and APC-R were performed using clotting-based methods. Semi-quantitative estimation of fibrinogen was done using Clauss's method and Lp(a using immunoturbidimetry. Statistical analysis was done using the Epi Info 6 software. RESULTS: Thirty-three samples (38.8% tested positive for one or more thrombophilia markers. The three commonest abnormalities were elevated Lp(a (20%, fibrinogen (17.6% and low APC-R (14.2%. Low levels of protein C, protein S and AT were present in 4.7, 9.4 and 7% of the patients, respectively. Overall, the risk factor profile was: smoking (33%, positive family history (15.3%, hyperlipidemia (7%, hypertension, diabetes mellitus and obesity (2.3% each. CONCLUSIONS: An association was found between low levels of protein C, protein S and AT and arterial thrombosis, but only elevated fibrinogen levels, smoking, positive family history and hyperlipidemia showed statistical significance.
Development of Atmospheric Air 85Kr Monitoring Methodology on the Territory of the USSR
Pakhomov, Sergei; Dubasov, Yury
2014-05-01
Highly sensitive, low-background and high-performance method of beta-radioactivity measurements of the gas samples was developed in mid-eighties at Khlopin Radium institute. This method was based on the use of the serial automated installation for liquid scintillation measurements and special scintillating cells. Cells were equipped with the gas valve, and their internal surface were covered by a thin layer of organic scintillator. This method found was successfully was applied for 85Kr activity measurements in atmospheric krypton samples and for 85Kr concentration measurements in atmospheric air. For the first time, method developed for 85Kr activity measurements, was practically tested in May - June, 1986, while studying radioactive pollution characteristics in the air basin of Russia and Ukraine after the Chernobyl NPP accident. Thus for sampling of atmospheric krypton the industrial krypton-xenon mix manufactured at air-separating plants, located in the cities of Cherepovets, Lipetsk, Krivoi Rog and Enakiyevo was used. In the end of April and in the first half of May it was determined that 1,5-fold excess concentrations of 85Kr in atmospheric air were observed in atmospheric air of considerable part of the European territory of Russia and Ukraine During the period from 1987 to 1991 this method was used for monitoring of 85Kr on the territory of the former USSR in the air basin of Russia, Ukraine and Kazakhstan. Industrial krypton-xenon mix manufactured at 14 large air-separating plants was also used for sampling. Six of them were situated in Russia (Novomoskovsk, Lipetsk, Cherepovets, Chelyabinsk, Nizhni Tagil, Orsk). Seven - in Ukraine (Enakiyevo, Kommunarsk, Krivoi Rog, Makeyevka, Mariupol, Severodonetsk, Dneprodzerzhinsk). One plant was situated in Temirtau, in Kazakhstan. The analysis indicated that in Krivoi Rog; Dneprozhzerzhinsk; Severodonetsk; Makeyevka; Mariupol; Enakiyevo; Kommunarsk; Novomoskovsk and Cherepovets the average 85Kr concentration in
Separation, storage and disposal of krypton-85
International Nuclear Information System (INIS)
1980-01-01
Technical means available for the retention of 85 Kr and its immobilization, storage and disposal are reviewed. Cryogenic processes for the separation of krypton and xenon from diluting gases are discussed in more detail. Besides the cryogenic processes, a liquid adsorption process for reprocessing off-gases and charcoal adsorption and membrane processes for reactor off-gases are also dealt with. The retained krypton can be stored in pressurized containers with air or water cooling. The containers can be kept in engineered storage facilities for an intermediate period or until the 85 Kr has decayed. Alternatively, the krypton may be encapsulated in a solid. The injection of gases containing krypton into suitable geologic strata may also be possible. Much of the equipment required for the separation and storage of krypton, well known from ordinary technology, often needs some adaptation. Further R and D work is, however, needed to solve some problems which are specific to highly concentrated fission krypton. The subject is reviewed under the following headings: methods available for the separation of krypton from off-gases; separation of krypton from reactor off-gas; separation of krypton from reprocessing off-gas; conditioning methods; engineering storage; transportation; disposal
International Nuclear Information System (INIS)
Miyahara, Hiroshi; Watanabe, Tamaki
1978-01-01
An extension of 4πe.x-γ coincidence technique is described to measure the absolute disintegration rate of 85 Sr. This nuclide shows electron capture-gamma decay, and 514keV level of 85 Rb is a meta-stable state with half life of 0.958 μsec. Therefore, the conventional 4 πe.x-γ coincidence technique with about 1 μsec of resolution time can not be applied to this nuclide. To measure the absolute disintegration rate of this, the delayed 4 πe.x-γ coincidence technique with two different resolution time has been used. The disintegration rate was determined from four counting rates of electron-x ray, gamma ray and two coincidences, and the true disintegration rate could be obtained by extraporation of the electron-x ray detection efficiency to 1. Two resolution time appearing in the calculation formulas were determined from the chance coincidence between electron-x ray and delayed gamma ray signals. When the coincidence countings with three different resolution time were carried out by one coincidence circuit, the results calculated from all combinations did not agree each other. However, when the two coincidence circuits of the same type were used to fix the resolution time, a good coincidence absorption function was obtained and the disintegration rate was determined with accuracy of +- 0.5%. To evaluate the validity of the results the disintegration rates were measured by two NaI (Tl) scintillation detectors whose gamma-ray detection efficiency was previously determined and both results were agreed within accuracy of +- 0.5%. This method can be applied with nearly same accuracy for the beta-gamma decay nuclide possessing a meta-stable state of the half life below about 10 μsec. (auth.)
40 CFR 85.1412 - Maintenance and submittal of records for equipment certifiers.
2010-07-01
... AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Urban Bus... affected urban bus operators under § 85.1403(b) and § 85.1407, then the equipment certifier shall submit to EPA, at the time an offer is made, a copy of all offers made to affected urban bus operators for which...
Deactivation of tracer-flo equipment thru retrieval of its radioactive Krypton-85 gas
International Nuclear Information System (INIS)
Domondon, D.B.; Rara, R.B.; Borras, A.M.
1994-01-01
Tracer-flo equipment must be cleared of Krypton-85 before these can be transported. The rules and regulations on safe transport of radioactive materials require Kr-85 gas to be transported in an approved container. A new innovative technique/procedure in deactivating tracer-flo equipment i.e., without separation of the Kr-85 from the nitrogen was developed by the authors. The developed procedure was successfully applied in four tracer-flo equipment of three (3) semiconductor firms. In the process, the three firms have saved about US$ 28,000.00 (P 800,000.00) if the deactivation were undertaken by a foreign service company. The Philippine Nuclear Research Institute (PNRI) retrieved about P 382,000.00 worth of Kr-85 that could be used in industrial applications such as leak tracing of buried pipes, etc. (author). 1 ref.; 5 figs
16 CFR 1.85 - Final environmental impact statements.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Final environmental impact statements. 1.85... Final environmental impact statements. (a) After the close of the comment period, the Bureau responsible for the matter will consider the comments received on the draft environmental impact statement and...
Radiotherapy for cancer patients aged 85 or older
International Nuclear Information System (INIS)
Kan, Tomoko; Kodani, Kazuhiko; Michimoto, Koichi; Ogawa, Toshihide
2009-01-01
The purpose of this study was to investigate the clinical efficacy and problems of radiotherapy for cancer patients aged 85 or older. Fifty-three patients (26 men, 27 women) who underwent radiotherapy were analyzed retrospectively. Median age was 87 years (range; 85-99). Treatment policy was classified into curative, semi-curative (treatment field or total dose were limited due to performance status) and palliative therapy. Head-and-neck, bladder and skin cancer were the most common primary disease. The treatment was deemed curative in 27%, semi-curative in 13%, and palliative in 49%. Total dose of semi-curative therapy was almost same compared with curative therapy. The rate of treatment completion and effectiveness were not significantly different in curative therapy and semi-curative therapy. We should consider to reduce the field size to gross target volume, but to treat with substantial dose to make radiotherapy safe and effective. We must be aware that elderly patients have basically low tolerability. (author)
48 CFR 801.602-85 - Results of review.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Results of review. 801.602... DEPARTMENT OF VETERANS AFFAIRS ACQUISITION REGULATION SYSTEM Career Development, Contracting Authority, and Responsibilities 801.602-85 Results of review. (a) When the review is complete, the reviewing office will advise...
21 CFR 7.85 - Conduct of a presentation of views before report of criminal violation.
2010-04-01
... of criminal violation. 7.85 Section 7.85 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ENFORCEMENT POLICY Criminal Violations § 7.85 Conduct of a presentation of views before report of criminal violation. (a) The presentation of views shall be heard by a...
Neutron Activation Resonance Integrals of 64Zn, 68Zn, 85Rb, 100Mo, 102Ru, 113In, 123Sb, and 180Hf
International Nuclear Information System (INIS)
Ricabarra, M. D.; Turjanski, R.; Ricabarra, G. H.
1969-01-01
The ratio of resonance integral to thermal activation cross sections of the isotopes 64 Zn, 68 Zn, 85 Rb, 100 Mo, 102 Ru, 113 In, 123 Sb, and 180 Hf relative to gold has been determined by measuring cadmium ratios. The standard gold or a secondary standard was mixed uniformly in the samples and the activities resolved with a lithium-drift germanium γ-ray spectrometer. Expressed as Westcott S 0 values the results were: 64 Zn = 2.06 ± 0.03, 68 Zn = 3.72 ± 0.14, 85 Rb = 18.4 ± 0.6, 100 Mo = 21.7 ± 0.8, 102 Ru = 3.76 ± 0.03, 113 In = 24.7 ± 0.5, 123 Sb = 28.3 ± 2.1, 180 Hf = 2.17 ± 0.09. All measurements are relative to S 0 = 17.7 for gold. (author)
Partitioning of krypton-85 in liquid scintillation cocktail
International Nuclear Information System (INIS)
Hohorst, F.A.; Sherlock, M.A.
1994-12-01
Krypton is one of the noble gases. As such, it forms compounds only with exceptionally strong oxidizing agents. The concentration of krypton in air is 1.139 parts per million by volume. In general, its behavior is best described as that of an ideal gas. Krypton-85 is the longest lived of the common radioactive noble gases with a half life of 10.72 years. Gamma radiation at 513.990 keV has an intensity of only 0.434%. Most decay is β - emission with a maximum energy of 687.0 keV and an average energy of 251.4 keV. The analytical chemistry of krypton-85 is driven by these factors. High concentrations may be gamma counted directly. Low levels are typically determined by more sensitive techniques such as liquid scintillation counting (LSC) where detection limits on the order of 1 picocurie (pCi) are routinely achieved. For a 5 standard cubic centimeter (scc) sample, this represents a concentration of 0.2 pCi/scc, well below the DOE Air Immersion Derived Concentration Guideline (G) of 3 pCi/scc. As a gas, krypton in a sealed LSC vial distributes itself between the liquid phase and the gas phase. Some past work has used gamma counting at levels many orders of magnitude greater than those now achievable by LSC to study the distribution of krypton. This effect is of interest in the analytical chemistry of krypton-85 because geometrical considerations influence how much of the material in the gas phase decays generating particles which then impact the liquid phase where they may be counted
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...
Krypton-85 disposal program. Semiannual report, August 15, 1977--March 31, 1978
International Nuclear Information System (INIS)
Klett, R.D.
1979-02-01
The first 7.5 months of the Krypton-85 disposal program are summarized. Included are task definitions and initial progress in geologic disposal system studies, SURF compatibility, augmented heat dissipation, material qualification, exterior canister compatibility, ceramic liners for canisters, and geologic transport. Feasibility studies indicate that Kr-85 can be disposed of at SURF facility or in near-surface geologic repositories
41 CFR 102-85.145 - When are customer agencies responsible for Rent charges?
2010-07-01
...; or (2) All other space: Either GSA's space charges for 4 months plus the cost of tenant improvements or GSA's actual costs, whichever is less. ... PROPERTY 85-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Rent Charges § 102-85.145 When are customer agencies...
2010-07-01
..., emission labeling and fuel economy requirements. 85.1510 Section 85.1510 Protection of Environment..., warranties, emission labeling and fuel economy requirements. The provisions of this section are applicable to... for final admission. (d) Fuel economy labeling. (1) The certificate holder shall affix a fuel economy...
International Nuclear Information System (INIS)
Frank, G.; Steinkopff, T.; Salvamoser, J.
2016-01-01
The Deutscher Wetterdienst (DWD, German Meteorological Service) operates since 1996 a sampling and measurement device for the radioactive rare gases Kr-85 and Xe-133 in Offenbach. These measurements are embedded in the German Measurement and Information System for Monitoring Environmental Radioactivity (Integriertes Mess- und Informationssystem zur Ueberwachung der Radioaktivitaet in der Umwelt, IMIS) [1]. In addition to these measurements the DWD is sampling rare gases in Potsdam and since 2014 in Trier in cooperation with the Bundesamt fuer Strahlenschutz (Federal Office for Radiation Protection, BfS). In the frame of the Global Atmosphere Watch (GAW)-program of the WMO the DWD operated a sampling station at the Zugspitze (Schneefernerhaus) from 1999 to 2005. This location at the Zugspitze is well suited for the observation of long distance transport of Kr-85 in the higher atmosphere. The DWD in Offenbach operates a complex analytical system for the measurement of Kr-85 and Xe-133 since 1998. This system consists of sampling with first enrichment, second enrichment, gas chromatographic separation and preparation of Krypton and Xenon and measurement of Kr-85 and Xe-133. Using the example Fukushima, it is shown, that the radioactive rare gases Kr-85 and Xe-133 are well undisturbed tracers for atmospheric transport in case of a nuclear accident or routine nuclear reprocessing plants. Measurements of Xe-133, I-131, Cs-137 and Kr-85 are correlated with source and atmospheric transport to the sampling sites at Offenbach and Potsdam.
9 CFR 85.4 - Interstate movement of livestock.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Interstate movement of livestock. 85.4... Interstate movement of livestock. (a) Livestock showing clinical evidence of pseudorabies shall not be moved interstate. (b) Livestock that have been exposed to an animal showing clinical evidence of pseudorabies shall...
Analysis of krypton-85 and krypton-81 in a few liters of air.
Tu, Le-Yi; Yang, Guo-Min; Cheng, Cun-Feng; Liu, Gu-Liang; Zhang, Xiang-Yang; Hu, Shui-Ming
2014-04-15
Long-lived radioactive krypton isotopes, (81)Kr (t1/2 = 229,000 year) and (85)Kr (t1/2 = 10.76 year), are ideal tracers. (81)Kr is cosmogenic and can be used for dating groundwater beyond the (14)C age. (85)Kr is a fission product and can be applied in atmospheric studies, nuclear safety inspections, and dating young groundwater. It has long been a challenge to analyze radio-krypton in small samples, in which the total number of such isotopes can be as low as 1 × 10(5). This work presents a system developed to analyze (81)Kr and (85)Kr from a few liters of air samples. A separation system based on cryogenic distillation and gas chromatographic separation is used to extract krypton gas with an efficiency of over 90% from air samples of 1-50 L. (85)Kr/Kr and (81)Kr/Kr ratios in krypton gases are determined from single-atom counting using a laser-based atom trap. In order to test the performance of the system, we have analyzed various samples collected from ambient air and extracted from groundwater, with a minimum size of 1 L. The system can be applied to analyze (81)Kr and (85)Kr in environmental samples including air, groundwater, and ices.
7 CFR 27.85 - Fees; withdrawn requests or applications.
2010-01-01
... Section 27.85 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD CONTAINER REGULATIONS COTTON CLASSIFICATION UNDER COTTON FUTURES LEGISLATION Regulations Costs of...
Directory of Open Access Journals (Sweden)
Rúben Pablo Schocken-Iturrino
2005-04-01
Full Text Available O trabalho foi conduzido para avaliação da presença de Listeria sp. e de fungos nas silagens de capim-Tifton 85 sem emurchecimento, com emurchecimento por uma e duas horas e sem emurchecimento com adição ou não de polpa cítrica (5,0% do peso verde. As amostragens foram efetuadas no momento da abertura do silo (80 dias da ensilagem, aos 15 e 30 dias após exposição ao ar, para avaliar os teores de matéria seca (MS, as alterações químicas (pH, N amoniacal, ácidos orgânicos e a ocorrência de Listeria sp. e de fungos. Os dados foram analisados segundo o delineamento em blocos casualizados, em esquema de parcelas subdivididas (nas parcelas foram avaliadas as silagens submetidas aos tratamentos e nas subparcelas, os períodos de exposição ao ar, com quatro repetições. Observaram-se baixos teores de ácidos orgânicos e de N amoniacal decorrentes dos altos valores de MS, o que acarretou baixa formação de produtos fermentados e elevação do pH. A presença de Listeria sp. foi observada em 65,6% das amostras no momento da abertura dos silos e, destas, 10% foram positivas para Listeria monocytogenes. As silagens apresentaram baixa estabilidade aeróbia, tendo sido registrado aumento na ocorrência dos fungos Penicillium, Fusarium e Pithomyces com o prolongamento do período de exposição ao ar.The experiment was carried out to evaluate the fermentation characteristics, Listeria sp. and molds occurrence on Tifton 85 silage no wilted, wilted for one and two hours and no wilted with or without citrus pulp (5.0 % of fresh forage. The samplings were taken at the opening of the silos (80 days after ensiling, 15, and 30 days after air exposition to evaluated dry matter (DM content, chemical changes (pH, ammonia N, organic acids and Listeria sp., and molds occurrence. Data were analyzed according to a randomized block design in split plot scheme, considering the silage on the plots, and periods of air exposure on the split plot, with four
Handbook for Handling, Storing, and Dispensing E85 and Other Ethanol-Gasoline Blends
Energy Technology Data Exchange (ETDEWEB)
None
2013-09-17
This document serves as a guide for blenders, distributors, sellers, and users of E85 and other ethanol blends above E10. It provides basic information on the proper and safe use of E85 and other ethanol blends and includes supporting technical and policy references.
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING
Yoakim, M; Hou, W; Liu, Y; Carpenter, C L; Kapeller, R; Schaffhausen, B S
1992-01-01
The binding of phosphatidylinositol-3-kinase to the polyomavirus middle T antigen is facilitated by tyrosine phosphorylation of middle T on residue 315. The pp85 subunit of phosphatidylinositol-3-kinase contains two SH2 domains, one in the middle of the molecule and one at the C terminus. When assayed by blotting with phosphorylated middle T, the more N-terminal SH2 domain is responsible for binding to middle T. When assayed in solution with glutathione S transferase fusions, both SH2s are ca...
All-Optical Atom Trap Trace Analysis: Potential Use of 85Kr in Safeguards Activities
International Nuclear Information System (INIS)
Kohler, M.; Sahling, P.; Sieveke, C.; Kirchner, G.
2015-01-01
Sensitive measurement techniques for the detection of anthropogenic tracers demand measurement resolutions down to single atoms, as it has been demonstrated by the first atom trap trace analysis experiments. However, technical limitations had lowered the sample throughput to about 200 per year per machine. We have developed an all-optical apparatus which allows higher sample throughput and small sample sizes at the same time. Krypton-85 as anthropogenic isotope is an ideal tracer for nuclear activities since the only relevant source term is fission. An increased 85Kr concentration in an air sample indicates, that a plume was passing by during sampling. In practice, however, its applicability may be limited by the global and regional background concentrations caused by the emissions of nuclear fuel reprocessing plants. The potential of 85Kr monitoring for safeguards applications has been discussed extensively. Among these is the short range detection of elevated concentrations of 85Kr in the vicinity of reprocessing plants. Our ATTA technique needs sample sizes of about 1 l of air only and thus for the first time will allow simple environmental sampling of 85Kr with high spatial and temporal resolution. The design of such a study including local sampling and tracer transport modelling in proximity to a reprocessing plants is outlined. In addition, such a study could be used also for validating near-field atmospheric dispersion models if the 85Kr source term is known. The potential of environmental analyzes of 85Kr during an IAEA short-notice access is discussed. It is shown that it crucially depends on the emission dynamics after shut-down of fuel dissolution which needs further study. (author)
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. S L Sharma. Articles written in Bulletin of Materials Science. Volume 25 Issue 2 April 2002 pp 85-93 Materials Synthesis. Photoelectronic properties of HgI2 crystals for nuclear radiation detection · S L Sharma H N Acharya · More Details Abstract Fulltext PDF. Photoelectronic ...
Energy Technology Data Exchange (ETDEWEB)
Ross, Jens Ole
2010-02-02
The radioactive noble gas krypton-85 is released into the atmosphere during reprocessing of spent nuclear fuel or irradiated breeding targets. This is a necessary step for plutonium separation. Therefore the {sup 85}Kr signature of reprocessing could possibly be used for the detection of undeclared nuclear facilities producing nuclear weaponusable material. The {sup 85}Kr content of the atmosphere has grown over the last decades as the emissions from military and civilian nuclear industry could not be compensated by the decay with a half-life of 10.76 years. In this study, the global {sup 85}Kr background distribution due to emissions of known reprocessing facilities for the period from 1971 until 2006 was simulated using the atmospheric general circulation model ECHAM5 applying the newest available annual emission data. The convective tracer transport scheme and the operator splitting for the physical calculations in the model were modified in order to guarantee physically correct results for tracer point sources, in particular non negative concentrations. An on-line routine controlling the {sup 85}Kr -budget in the model enforced exact mass conservation. The results of the simulation were evaluated by extensive comparison with measurements performed by the German Federal Office for Radiation Protection with very good agreement at most observation sites except those in the direct vicinity of {sup 85}Kr sources. Of particular interest for the {sup 85}Kr detection potential was the variability of {sup 85}Kr background concentrations which was evaluated for the first time in a global model. In addition, the interhemispheric transport as simulated by ECHAM5 was analyzed using a two-box model providing a mean exchange time of τ {sub ex} = 10.5 months. The analysis of τ{sub ex} over simulated 35 years indicates that in years with strong South Asian or African Monsoon the interhemispheric transport is faster during the monsoon season. A correlation analysis of
7 CFR 301.85-2a - Regulated areas; suppressive and generally infested areas.
2010-01-01
.... The civil divisions and parts of civil divisions described below are designated as golden nematode regulated areas within the meaning of the provisions of this subpart; and such regulated areas are hereby... areas. 301.85-2a Section 301.85-2a Agriculture Regulations of the Department of Agriculture (Continued...
International Nuclear Information System (INIS)
Fuciarelli, A.F.; Shum, F.Y.; Raleigh, J.A.
1987-01-01
A correlation between high-performance liquid chromatography (HPLC) analysis and an in situ enzyme-linked immunosorbent assay (ELISA) for 8,5'-cycloadenosine formation in irradiated poly(A) has been established. The correlation shows that the ELISA precisely reflects changes in the combined yield of R- and S-8,5'-cycloadenosine but that a correction factor must be applied to the ELISA values for accuracy. The HPLC analysis reveals that the intramolecular cyclization proceeds stereoselectively in irradiated poly(A) to preferentially produce the R isomer at pH 7.0 which is similar to the result for irradiated adenosine but in contrast to the result for 5'-AMP where the S isomer predominates at neutral pH. The HPLC analysis shows that two events originating in hydroxyl radical attack at the sugar phosphate backbone in poly(A); that is, adenine release and 8,5'-cycloadenosine formation have somewhat different dose-yield responses. The formation of 8-hydroxyadenosine was detected in the HPLC chromatograms of poly(A) irradiated under N2O at neutral pH, and the yield of this compound was similar to the yield observed in 5'-AMP or adenosine irradiated under similar conditions
Regulation of the PI3K pathway through a p85a monomer-homodimer equilibrium
Aljedani, Safia Salim Eid
2017-01-08
The phosphatidylinositol-3-kinase a (PI3Ka) is heterodimeric enzyme that is composed of p85a regulatory subunit and a p110a catalytic subunit. PI3Ka plays a key role in cell survival, growth and differentation. Owing to its role as a key regulator, the PI3Ka pathway is the most frequently mutated pathway in human cancers, and is targeted by many viruses to insure their survival and successful reproduction. Previous studies have shown that the equilibrium of p85 monomers and dimers regulates the PI3K pathway, suggesting that interrupting this equilibrium could lead to disease development. Moreover, studies suggest that the p85a monomers and dimers have opposing effects on PI3Ka signaling as only the p85a dimers bind to the PTEN phosphatase, whereas p85a monomers bind to the catalytic p110 subunit. However, the mechanism for dimerisation is controversial, and it is unknown why PTEN or p110a bind only dimer or monomer. Therefore, we combine molecular biology, biophsical, computational and structural methods to investigate the suprosingly complex p85 dimerisation mechanism and its control by ligands. Results may inspire novel theraputic approaches.
Falls in very old people: the population-based Umeå 85+ Study in Sweden
von Heideken Wågert, Petra; Gustafson, Yngve; Kallin, Kristina; Jensen, Jane; Lundin-Olsson, Lillemor
2009-01-01
Artikkelen omhandler en studie hvor hensikten var å beskrive forekomst av fall og fallrelaterte skader, og å identifisere predisponerende faktorer for fall hos eldre 85 år og eldre. The aim of this study was to describe incidences of falls and fall-related injuries, and to identify predisposing factors for falls in very old people in a prospective population-based follow-up study for falls. The study is part of the Umeå 85+ Study which includes half of the population aged 85, and the total...
Wang, C; Liu, Q; Guo, G; Huo, W J; Pei, C X; Zhang, S L; Wang, H
2018-05-01
This study evaluated the effects of dietary concentrate levels and 2-methylbutyrate (2MB) supplementation on performance, ruminal fermentation, bacteria abundance, microbial enzyme activity and urinary excretion of purine derivatives (PD) in steers. Eight ruminally cannulated Simmental steers (12 months of age; 389 ± 3.7 kg of body weight) were used in a replicated 4 × 4 Latin square design with a 2 × 2 factorial arrangement. Moderate-concentrate (400 g/kg diet [MC]) or high-concentrate (600 g/kg diet [HC]) diets were fed with or without 2MB (0 g/day [2MB-] or 15.0 g/day [2MB+]). Dry matter intake and average daily gain increased, but feed conversion ratio decreased with the HC diet or 2MB supplementation. Ruminal pH decreased, but total volatile fatty acid increased with the HC diet or 2MB supplementation. Molar proportion of acetate and acetate-to-propionate ratio decreased with the HC diet, but increased with 2MB supplementation. Propionate molar proportion and ruminal NH 3 -N content increased with the HC diet, but decreased with 2MB supplementation. Neutral detergent fibre degradability decreased with the HC diet, but increased with 2MB supplementation. Crude protein degradability increased with the HC diet or 2MB supplementation. Abundance of Ruminococcus albus, Ruminococcus flavefaciens, Fibrobacter succinogenes and Bufyrivibrio fibrisolvens as well as activities of carboxymethyl cellulase, cellobiase, xylanase and pectinase decreased with the HC diet, but increased with 2MB supplementation. However, abundance of Prevotella ruminicola and Ruminobacter amylophilus as well as activities of α-amylase and protease increased with the HC diet or 2MB supplementation. Total PD excretion also increased with the HC diet or 2MB supplementation. The results suggested that growth performance, ruminal fermentation, CP degradability and total PD excretion increased with increasing dietary concentrate level from 40% to 60% or 2MB supplementation. The
International Nuclear Information System (INIS)
Yalsakumar, M.C.; Ananthakrishna, G.; Sahoo, D.; Gopinathan, K.P.
1987-01-01
This is the third progress report since the inception of the Materials Science Laboratory in 1974 and covers the period 1981-85. In view of the long period covered by the report, the individual contributions have been kept brief so that the total length of the report is reasonable; however care has been taken to see that brevity has not obscured clarity. Significant contributions include studies of radiation damage and related defect, solid state physics, behaviour of materials under extremely low temperatures on the one hand and under high pressure and high temperatures on the other and light scattering by materials. The Laboratory has played a key role in the indigeneous development and characterisation of superconducting materials. Theoretical studies have concentrated on stochastic processes, nonlinear phenomena and the newly discovered and fascinating quasicrystals. (author)
Study on the possibility of sea-disposal of krypton-85
International Nuclear Information System (INIS)
Dalen, A. van; Vons, L.H.; Verkerk, B.
1980-01-01
Results of a feasibility study, performed under a contract with the Commission of the European Communities, regarding technical and radiological aspects of sea-disposal of all krypton-85 retained in a large fuel reprocessing facility, are presented. The design of a double-walled, essentially spherical container is described that provides both double containment of the compressed gas and permanent 'disposable' radiation shielding. Three sizes have been studied, i.e. with internal volumes of 0.01, 0.05 and 0.1 m 3 , each designed to hold 0.1 m 3 (STP) of krypton, and each containing approximately 400 TBq of 85 Kr per 0.001 m 3 sphere volume. This results in an internal heat production of 17.5 kW/m 3 . Calculations of temperatures and stresses that would result from the conditions of the required fire test for B(U) transport packages showed that the design would allow the containers to pass this test. Radiological consequences have been considered for disposal of petabecquerel amounts of 85 Kr as a function of undamaged container lifetime on the sea bed. Finally, an indication is given of the necessary amendments to the London Convention in order to allow sea-disposal of these large amounts of radioactive krypton. (author)
Goins, Christopher M; Dajnowicz, Steven; Thanna, Sandeep; Sucheck, Steven J; Parks, Jerry M; Ronning, Donald R
2017-05-12
Previous studies identified ebselen as a potent in vitro and in vivo inhibitor of the Mycobacterium tuberculosis (Mtb) antigen 85 (Ag85) complex, comprising three homologous enzymes required for the biosynthesis of the mycobacterial cell wall. In this study, the Mtb Ag85C enzyme was cocrystallized with azido and adamantyl ebselen derivatives, resulting in two crystallographic structures of 2.01 and 1.30 Å resolution, respectively. Both structures displayed the anticipated covalent modification of the solvent accessible, noncatalytic Cys209 residue forming a selenenylsulfide bond. Continuous difference density for both thiol modifiers allowed for the assessment of interactions that influence ebselen binding and inhibitor orientation that were unobserved in previous Ag85C ebselen structures. The k inact /K I values for ebselen, adamantyl ebselen, and azido ebselen support the importance of observed constructive chemical interactions with Arg239 for increased in vitro efficacy toward Ag85C. To better understand the in vitro kinetic properties of these ebselen derivatives, the energetics of specific protein-inhibitor interactions and relative reaction free energies were calculated for ebselen and both derivatives using density functional theory. These studies further support the different in vitro properties of ebselen and two select ebselen derivatives from our previously published ebselen library with respect to kinetics and protein-inhibitor interactions. In both structures, the α9 helix was displaced farther from the enzyme active site than the previous Ag85C ebselen structure, resulting in the restructuring of a connecting loop and imparting a conformational change to residues believed to play a role in substrate binding specific to Ag85C. These notable structural changes directly affect protein stability, reducing the overall melting temperature by up to 14.5 °C, resulting in the unfolding of protein at physiological temperatures. Additionally, this structural
Information Communication System at Tsukuba EXPO'85
Sakagami, Yasuhiko
At Tsukuba EXPO'85 information communication system which employs the most advanced technology such as optical technology, is operated to conduct EXPO information guide, environmental and security control at the site, and office management, which is effective for smooth management of Exposition and appropriate service to visitors. The author outlines the characteristics of the whole communication system, and also describes how communication system using optical technology is located in the whole communication system, and the system outline.
Organic Rankine-cycle power systems working fluids study. Topical report No. 1: Fluorinol 85
Jain, M. L.; Demirgian, J. C.; Cole, R. L.
1986-09-01
The thermal stability limits and degradation rates of Fluorinol 85 as a function of maximum cycle temperatures are determined. Following the design and construction of a dynamic test loop capable of simulating the thermodynamic conditions of possible prototypical organic Rankine-cycle (ORC) power systems, several test runs were completed. The Fluorinol 85 test loop was operated for about 3800 h at a temperature range of 525 to 600 F. Both liquid and noncondensable vapor (gas) samples were drawn periodically and analyzed using capillary column gas chromatography, gas chromatography/mass spectrometry and mass spectrometry. Results indicate that Fluorinol 85 would not decompose significantly over an extended period, up to a maximum cycle temperature of 550 F. However, 506-h data at 575 F show initiation of significant degradation. The 770-h data at 600 F, using a fresh charge of Fluorinol 85, indicate an annual degradation rate of more than 17.2%. The most significant degradation product observed is hydrofluoric acid, which could cause severe corrosion in an ORC system. Removal of the hydrofluoric acid and prevention of temperature extremes are necessary for an ORC system using Fluorinol 85 as a working fluid.
Teng, Ying; Wang, Xiaomi; Zhu, Ye; Chen, Wei; Christie, Peter; Li, Zhengao; Luo, Yongming
2017-04-01
Pentachloronitrobenzene (PCNB) is a toxic chlorinated nitroaromatic compound. However, only a few bacteria have been reported to be able to utilize PCNB. In the present study, one pentachloronitrobenzene (PCNB)-degrading bacterium, Cupriavidus sp. YNS-85, was isolated from a contaminated Panax notoginseng plantation. The strain co-metabolized 200 mg L -1 PCNB in aqueous solution with a removal rate of 73.8% after 5 days. The bacterium also degraded PCNB effectively under acid conditions (pH 4-6) and showed resistance to toxic trace elements (arsenic, copper, and cadmium). Its ability to utilize proposed PCNB intermediates as sole carbon sources was also confirmed. The soil microcosm experiment further demonstrated that bacterial bioaugmentation enhanced the removal of PCNB (37.8%) from soil and the accumulation of pentachloroaniline (89.3%) after 30 days. Soil enzyme activity and microbial community functional diversity were positively influenced after bioremediation. These findings indicate that Cupriavidus sp. YNS-85 may be a suitable inoculant for in situ bioremediation of PCNB-polluted sites, especially those with acid soils co-contaminated with heavy metal(loid)s.
The cost-effectiveness of OM-85 in managing respiratory tract infections in China.
Xuan, Jianwei; Wang, Lijie; Yin, Hongjun; Xuan, Dennis; Zhou, Yan; Hu, Shanlian
2015-03-01
To demonstrate the health economic impact of OM-85, a bacterial lysates based immunostimulant, for its approved indications in China. A cost-effectiveness decision tree model was constructed comparing OM-85 with the best supportive care/placebo therapy for managing the acute exacerbation of chronic bronchitis and rhinosinusitis in the Chinese population. Clinical efficacy and adverse events (AE) data were included in the model based on a thorough literature review. All localized direct treatment costs, including drug cost, AE costs, and medical treatment costs for underlining diseases were included from a Chinese third party payer perspective. A Key Opinion Leaders (KOL) survey was conducted with 20 senior physicians specialized in respiratory, ENT, allergy, and immunology fields from tertiary hospitals in Beijing, Shanghai, Guangzhou, Hangzhou, Shenyang, and Wuhan to validate the local treatment costs. Incremental cost-effectiveness ratio (ICER) was calculated based on the above efficacy and cost information. OM-85 is a cost-effective therapy when compared with placebo (standard care). OM-85 can treat/prevent one additional full episode exacerbation of chronic bronchitis and one additional full episode exacerbation of rhinosinusitis with only additional costs of RMB 653 and RMB 1182.84, respectively. In comparison, each acute exacerbation of chronic bronchitis will cost RMB 4510.10, and each acute exacerbation of rhinosinuisitis will cost RMB 1807.21 in a Chinese clinical management setting. One-way sensitivity analyses were performed and the ICER result was demonstrated to be consistent. OM 85 reduces acute exacerbations among patients with chronic bronchitis and chronic rhinosinusitis when compared with Placebo (standard care). From a Chinese payer perspective, OM 85 is a cost-effective therapy in the clinical management of both chronic bronchitis and rhinosinusitis in the adult population.
Effects of MVA85A vaccine on tuberculosis challenge in animals: systematic review
Kashangura, Rufaro; Sena, Emily S; Young, Taryn; Garner, Paul
2015-01-01
Background: The existing Bacillus Calmette–Guérin (BCG) vaccination provides partial protection against tuberculosis (TB). The modified vaccinia ankara virus-expressing antigen 85A (MVA85A) aims to boost BCG immunity. We evaluated the animal evidence supporting the testing of MVA85A in humans. Methods: Our protocol included in vivo preclinical studies of the MVA85A booster with BCG compared with BCG alone, followed by a TB challenge. We used standard methods for systematic review of animal studies, and summarized mortality, measures of pathology and lung bacterial load. The comprehensive literature search was to September 2014. Two independent investigators assessed eligibility and performed data extraction. We assessed study quality and pooled bacteria load using random effect meta-analysis. Findings: We included eight studies in 192 animals. Three experiments were in mice, two in guinea pigs, two in macaques and one in calves. Overall, study quality was low with no randomization, baseline comparability not described and blinding not reported. For animal death (including euthanasia due to severe morbidity), studies were underpowered, and overall no benefit demonstrated. No difference was shown for lung pathology measured on an ordinal scale or bacterial load. The largest mortality trial carried out in macaques had more deaths in the MVA85A vaccine group, and was published after a trial in South Africa had started recruiting children. Conclusions: This independent assessment of the animal data does not provide evidence to support efficacy of MVA85A as a BCG booster. More rigorous conduct and reporting of preclinical research are warranted, and we believe the results of studies should be publicly available before embarking on trials in humans, irrespective of the findings. PMID:26351306
Preliminary safety evaluation of a commercial-scale krypton-85 encapsulation facility
International Nuclear Information System (INIS)
Christensen, A.B.; Tanner, J.E.; Knecht, D.A.
1980-09-01
This report demonstrates that a commercial-scale facility for encapsulating krypton-85 in zeolite-5A or glass at a 2000 MTHM per year nuclear fuel reprocessing plant can be designed to contain fragments and the 340 to 850 kCi krypton-85 inventory from an assumed catastrophic failure of the high pressure vessel. The vessel failure was assumed as a worst case and was not based on a detailed design evaluation or operating experience. The process design is based on existing commercial hot isostatic pressing technology operated at up to 40 times the scale required for krypton encapsulation. From the calculated process gas inventory in the pressure vessel and vessel design, the explosive energy of 8.4 kg TNT and vessel plug and fragment velocities were calculated. The facility Containment Cell housing the high pressure vessel was designed to contain the gases, fragments, and the shock wave energy calculated for vessel failure. The Access Cell located directly above the Containment Cell was designed to be a tertiary confinement of krypton-85, should the access hatch be breached
Effects of mycobacteria major secretion protein, Ag85B, on allergic inflammation in the lung.
Directory of Open Access Journals (Sweden)
Yusuke Tsujimura
Full Text Available Many epidemiological studies have suggested that the recent increase in prevalence and severity of allergic diseases such as asthma is inversely correlated with Mycobacterium bovis bacillus Calmette Guerin (BCG vaccination. However, the underlying mechanisms by which mycobacterial components suppress allergic diseases are not yet fully understood. Here we showed the inhibitory mechanisms for development of allergic airway inflammation by using highly purified recombinant Ag85B (rAg85B, which is one of the major protein antigens secreted from M. tuberculosis. Ag85B is thought to be a single immunogenic protein that can elicit a strong Th1-type immune response in hosts infected with mycobacteria, including individuals vaccinated with BCG. Administration of rAg85B showed a strong inhibitory effect on the development of allergic airway inflammation with induction of Th1-response and IL-17and IL-22 production. Both cytokines induced by rAg85B were involved in the induction of Th17-related cytokine-production innate immune cells in the lung. Administration of neutralizing antibodies to IL-17 or IL-22 in rAg85B-treated mice revealed that IL-17 induced the infiltration of neutrophils in BAL fluid and that allergen-induced bronchial eosinophilia was inhibited by IL-22. Furthermore, enhancement of the expression of genes associated with tissue homeostasis and wound healing was observed in bronchial tissues after rAg85B administration in a Th17-related cytokine dependent manner. The results of this study provide evidence for the potential usefulness of rAg85B as a novel approach for anti-allergic effect and tissue repair other than the role as a conventional TB vaccine.
40 CFR 417.85 - Standards of performance for new sources.
2010-07-01
...) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Soaps Subcategory § 417.85 Standards of performance for new sources. The following standards of...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. N S Saxena. Articles written in Bulletin of Materials Science. Volume 23 Issue 5 October 2000 pp 369-375 Glasses. Differential scanning calorimetry studies of Se85Te15–Pb ( = 4, 6, 8 and 10) glasses · N B Maharajan N S Saxena Deepika Bhandari Mousa M Imran D D ...
Magnetic and thermoelectric properties of electron doped Ca{sub 0.85}Pr{sub 0.15}MnO{sub 3}
Energy Technology Data Exchange (ETDEWEB)
Hossain Khan, Momin [Department of Physics, University of Kalyani, Kalyani 741235, West Bengal (India); Pal, Sudipta, E-mail: sudipta.pal@rediffmail.com [Department of Physics, University of Kalyani, Kalyani 741235, West Bengal (India); Bose, Esa [Department of Engineering Physics, B. P. P. I. M.T, Kolkata 700052, West Bengal (India)
2015-10-01
We have investigated temperature-dependent magnetization (M), magnetic susceptibility (χ) and thermoelectric (S) properties of the electron-doped Ca{sub 0.85}Pr{sub 0.15}MnO{sub 3}. With decrease of temperature, paramagnetic (PM) to antiferromagnetic (AFM) phase transition occurs with a well-defined Néel temperature (T{sub N}=122 K). Magnetic susceptibility measurements reveal that the paramagnetic state involves modified Curie–Weiss paramagnetism. Field cooled and zero field cooled magnetization measurements indicate a signature of magnetic frustration. Ferromagnetic (FM) double-exchange interactions associated with doped e{sub g} electrons are favored over competing AFM interactions below T{sub irr}=112 K. Magnetization data also shows a second-order phase transition. The sign reversal in S(T) has been interpreted in terms of the change in the electronic structure relating to the orbital degrees of freedom of the doped e{sub g} electron. Low temperature (5–140 K) thermoelectric power, S (T) signifies the importance of electron–magnon scattering process. - Highlights: • Magnetic and thermoelectric properties have been investigated in Ca{sub 0.85}Pr{sub 0.15}MnO{sub 3}. • It shows a PM–AFM second order phase transition at T{sub N}=122 K. • PM state involves modified Curie–Weiss paramagnetism. • The electron–magnon scattering dominates temperature dependent thermoelectric power.
41 CFR 102-85.5 - By what authority is the pricing policy in this part prescribed?
2010-07-01
... pricing policy in this part prescribed? 102-85.5 Section 102-85.5 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.5 By what authority is the pricing policy in this part prescribed? (a) General authority is granted in the Federal Property and...
Report of the working group on the support and development of the E85 channel
International Nuclear Information System (INIS)
Prost, A.; Durieux, B.; Sauvalle, B.; Macaire, A.
2006-01-01
The E85 is a fuel realized by a direct and a majority mixing of ethanol in non modified unleaded galena. Created in June 2006, this working group aims to analyze the success conditions of the E85 operating and manage the involved people around a common plan. This report presents the E85 characteristics, shows the economical and environmental interest of the project, provides recommendations and concludes with ten proposals. (A.L.B.)
Sechler, S R; Mullenix, M K; Holland, C M; Muntifering, R B
2017-09-01
A 2-yr study was conducted to determine effects of N fertilization level on fiber digestion kinetics and protein degradability characteristics of stockpiled Tifton 85 bermudagrass (T85). Six 0.76-ha pastures of stockpiled T85 were cut to a 10-cm stubble height on August 1 of each yr and fertilized with 56 (56N), 112 (112N), or 168 (168N) kg N/ha (2 pastures/treatment). Fiber digestion kinetics included the 72-hr potential extent of NDF digestion (PED), rate of NDF digestion, and lag time. In yr 1 and 2, PED decreased over the stockpile season. Rates of NDF digestion did not differ ( > 0.05) among N fertilization treatments in either yr. In yr 1, rate of NDF digestion was greatest ( digestion decreased ( digestion rates were similar for November and January 21 sampling dates. Lag time was greater ( digestion ( = -0.60 and -0.25 in yr 1 and 2, respectively) was observed. There was a trend ( = 0.06) for lignin concentration to be positively correlated with lag time ( = 0.39) in yr 1, and a strong relationship was observed in yr 2 ( = 0.91; digestion in stockpiled T85 were influenced more by temporal changes over the stockpile season than by N fertilization level. Supplement formulations based on kinetic parameters of fiber digestion may require periodic adjustment to insure that energy-yielding components of NDF are sufficient to meet animal requirements throughout the stockpile season. The CP fraction in stockpiled T85 contains sufficient RDP to support fibrolytic activity and growth of ruminal microorganisms throughout the stockpile season. Toward the latter end of the season, supplementation with sources of digestible fiber and RDP could be expected to increase MP supply to the host animal.
International Nuclear Information System (INIS)
Puig, J.R.; Sandier, J.
1962-01-01
Krypton-85, a β-emitter with a long half-life and low biological hazard, has considerable industrial potentialities. It is difficult, however, to manufacture sources since the element occurs in gaseous form and cannot be chemically fixed. The authors describe a method of krypton-fixation in a macromolecular matrix formed by mass polymerization of a liquid monomer containing krypton; they also give an account of the preparation of two types of source produced in this way-one enclosed in polystyrene, the other in polyvinyl acetate. Such sources lose krypton; the activity of the first decreases by 8 % daily, that of the second by 3 % daily. These apparent decays enable the diffusion coefficients of krypton in these polymers to be calculated. Diffusion appears to be prevented by the cross-linkages which exist in the polymers. (author) [fr
Energy Technology Data Exchange (ETDEWEB)
Bruffey, Stephanie H [ORNL; Jubin, Robert Thomas [ORNL; Spencer, Barry B [ORNL
2015-10-01
Reprocessing of UNF that has been out of the reactor for less than about 50 y requires the removal of 85Kr from the process off-gas streams. This is needed despite the relatively small amount of that isotope in the combined Xe and Kr inventory (Table 1). The decay of 85Kr to 85Rb presents challenges to the materials that will potentially be used to remove and store the Kr recovered from the off-gas. To address some of these problems, a thorough literature survey was completed, and the results of that analysis are summarized in this document.
40 CFR 85.2109 - Inclusion of warranty provisions in owners' manuals and warranty booklets.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Inclusion of warranty provisions in owners' manuals and warranty booklets. 85.2109 Section 85.2109 Protection of Environment ENVIRONMENTAL....2109 Inclusion of warranty provisions in owners' manuals and warranty booklets. (a) A manufacturer...
Structures of the G85R Variant of SOD1 in Familial Amyotrophic Lateral Sclerosis
Energy Technology Data Exchange (ETDEWEB)
Cao, Xiaohang; Antonyuk, Svetlana V.; Seetharaman, Sai V.; Whitson, Lisa J.; Taylor, Alexander B.; Holloway, Stephen P.; Strange, Richard W.; Doucette, Peter A.; Valentine, Joan Selverstone; Tiwari, Ashutosh; Hayward, Lawrence J.; Padua, Shelby; Cohlberg, Jeffrey A.; Hasnain, S. Samar; Hart, P. John (Texas-HSC); (Cal. State); (UMASS, MED); (UCLA); (Daresbury)
2008-07-21
Mutations in the gene encoding human copper-zinc superoxide dismutase (SOD1) cause a dominant form of the progressive neurodegenerative disease amyotrophic lateral sclerosis. Transgenic mice expressing the human G85R SOD1 variant develop paralytic symptoms concomitant with the appearance of SOD1-enriched proteinaceous inclusions in their neural tissues. The process(es) through which misfolding or aggregation of G85R SOD1 induces motor neuron toxicity is not understood. Here we present structures of the human G85R SOD1 variant determined by single crystal x-ray diffraction. Alterations in structure of the metal-binding loop elements relative to the wild type enzyme suggest a molecular basis for the metal ion deficiency of the G85R SOD1 protein observed in the central nervous system of transgenic mice and in purified recombinant G85R SOD1. These findings support the notion that metal-deficient and/or disulfide-reduced mutant SOD1 species contribute to toxicity in SOD1-linked amyotrophic lateral sclerosis.
Handbook for Handling, Storing, and Dispensing E85 and Other Ethanol-Gasoline Blends (Book)
Energy Technology Data Exchange (ETDEWEB)
Moriarty, K.
2013-09-01
This document serves as a guide for blenders, distributors, sellers, and users of E85 and other ethanol blends above E10. It provides basic information on the proper and safe use of E85 and other ethanol blends and includes supporting technical and policy references.
Viljoen, Albertus; Richard, Matthias; Nguyen, Phuong Chi; Fourquet, Patrick; Camoin, Luc; Paudal, Rishi R; Gnawali, Giri R; Spilling, Christopher D; Cavalier, Jean-François; Canaan, Stéphane; Blaise, Mickael; Kremer, Laurent
2018-02-23
An increasing prevalence of cases of drug-resistant tuberculosis requires the development of more efficacious chemotherapies. We previously reported the discovery of a new class of cyclipostins and cyclophostin (CyC) analogs exhibiting potent activity against Mycobacterium tuberculosis both in vitro and in infected macrophages. Competitive labeling/enrichment assays combined with MS have identified several serine or cysteine enzymes in lipid and cell wall metabolism as putative targets of these CyC compounds. These targets included members of the antigen 85 (Ag85) complex ( i.e. Ag85A, Ag85B, and Ag85C), responsible for biosynthesis of trehalose dimycolate and mycolylation of arabinogalactan. Herein, we used biochemical and structural approaches to validate the Ag85 complex as a pharmacological target of the CyC analogs. We found that CyC 7β , CyC 8β , and CyC 17 bind covalently to the catalytic Ser 124 residue in Ag85C; inhibit mycolyltransferase activity ( i.e. the transfer of a fatty acid molecule onto trehalose); and reduce triacylglycerol synthase activity, a property previously attributed to Ag85A. Supporting these results, an X-ray structure of Ag85C in complex with CyC 8β disclosed that this inhibitor occupies Ag85C's substrate-binding pocket. Importantly, metabolic labeling of M. tuberculosis cultures revealed that the CyC compounds impair both trehalose dimycolate synthesis and mycolylation of arabinogalactan. Overall, our study provides compelling evidence that CyC analogs can inhibit the activity of the Ag85 complex in vitro and in mycobacteria, opening the door to a new strategy for inhibiting Ag85. The high-resolution crystal structure obtained will further guide the rational optimization of new CyC scaffolds with greater specificity and potency against M. tuberculosis . © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.
International Nuclear Information System (INIS)
Boeck, W.L.
1979-01-01
Krypton-85 is a radioactive inert gas produced during normal operations of the nuclear fuel cycle. The quantities of krypton-85, that will be produced in the next century, are sufficient, if released, to alter the electrical state of the atmosphere. The principal hypothesis is that an anthropogenic alteration of the electric state of the atmosphere could alter other meterological phenomena and lead to significant environmental impacts. The goal of this project was to explore some areas of basic science related to the evaluation of that hypothesis. The approach was primarily theoretical. The following topics were addressed: a first approximation model to estimate the effects of krypton-85 on the electrical state of the atmosphere; an analysis of the pathways between krypton-85 production and the atmosphere; an analytical model for fair weather atmospheric electricity; and a dipole model for atmospheric electricity. The results will provide a framework on which detailed models can be built. The results should provide better understanding of some topics in atmospheric electricity
Impact of dedicated E85 vehicle use on ozone and particulate matter in the US
Nopmongcol, Uarporn; Griffin, W. Michael; Yarwood, Greg; Dunker, Alan M.; MacLean, Heather L.; Mansell, Gerard; Grant, John
2011-12-01
Increased use of ethanol as a vehicle fuel worldwide warrants the need to understand air quality impacts of replacing gasoline with ethanol. This study evaluates the impacts of dedicated E85 (85% ethanol/15% gasoline) light-duty vehicles on emissions, ozone and particulate matter (PM) concentrations in the United States for a future year (2022) using a 3-D photochemical model, detailed emissions inventories that account for changes in all sectors studied, and winter and summer meteorology that occurred in 2002. Use of E85 introduces new emissions from ethanol production and distribution, reduces petrochemical industry emissions due to lower gasoline consumption, changes on-road vehicle emissions and alters biogenic emissions due to land use changes. Three scenarios with increased ethanol production for dedicated E85 light-duty vehicles were compared to a base case without increased ethanol production. Increased use of E85 caused both increases and decreases in ozone and PM, driven mainly by changes in NO x emissions related to biogenic and upstream petrochemical industry sources. In all states modeled, adoption of dedicated E85 vehicles caused negligible change in average higher ozone and PM concentrations of importance for air quality management strategies. Ozone and PM changes are relatively insensitive to how land area is allocated for switchgrass production. The findings are subject to various uncertainties, especially those in vehicle technology and emissions from cellulosic ethanol production.
Preliminary safety evaluation of a commercial-scale krypton-85 encapsulation facility
International Nuclear Information System (INIS)
Christensen, A.B.; Tanner, J.E.; Knecht, D.A.
1980-01-01
This paper demonstrates that a commercial-scale facility for encapsulating krypton-85 in zeolite-5A or glass at a 2000 MTHM per year nuclear fuel reprocessing plant can be designed to contain fragments and the 340 to 850 kCi krypton-85 inventory from an assumed catastrophic failure of the high pressure vessel. The vessel failure was assumed as a worst case and was not based on a detailed design evaluation or operating experience. The process design is based on existing commercial hot isostatic pressing technology operated at up to 40 times the scale required for krypton encapsulation. From the calculated process gas inventory in the pressure vessel and vessel design, the maximum explosive energy of 8.4 kg TNT and resulting vessel plug and fragment velocities were calculated. The facility Containment Cell housing the high pressure vessel was designed to contain the gases, fragments, and the shock wave energy calculated for a hypothetical vessel failure. The Access Cell located directly above the Containment Cell was designed to be a tertiary confinement of krypton-85, should the access hatch be breached. 3 figures, 2 tables
Assessment of the potentially beneficial uses of krypton-85. Final report, Task 64
International Nuclear Information System (INIS)
Eggers, P.E.; Gawthrop, W.E.
1975-06-01
Results of a study aimed at assessing the potentially beneficial uses of 85 Kr indicate that self-luminous light sources appear to be the foremost benefical use of 85 Kr. Other assessed uses include heat sources for thermoelectric generators, heat sources for environmental control of submersibles, heat sources for thermodynamic energy cycles, polymerization processes, nondestructive testing, leak detection, biomedical applications, and liquid waste treatment. (TFD)
Comparison of histomorphometry and 85Sr uptake in induced heterotopic bone in rats
DEFF Research Database (Denmark)
Solheim, E; Pinholt, E M; Bang, G
1992-01-01
Heterotopic bone formation in the abdominal muscle of 45 male 8-week-old Wistar rats induced by implantation of 5, 10, or 15 mg demineralized bone (DBM) powder was evaluated at 4 weeks by 85Sr uptake of the implants and area histomorphometry of the induced bone. Two indices of 85Sr uptake were...... with increasing mass of implanted DBM, whereas the osteogenic index did not change....
46 CFR 7.85 - St. Simons Island, GA to Little Talbot Island, FL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false St. Simons Island, GA to Little Talbot Island, FL. 7.85... BOUNDARY LINES Atlantic Coast § 7.85 St. Simons Island, GA to Little Talbot Island, FL. (a) A line drawn from latitude 31°04.1′ N. longitude 81°16.7′ W. (St. Simons Lighted Whistle Buoy “ST S”) to latitude 30...
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85 or... containing tritium, krypton-85 or promethium-147: Requirements for license to manufacture, process, produce... self-luminous products containing tritium, krypton-85, or promethium-147, or to initially transfer such...
24 CFR 85.20 - Standards for financial management systems.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Standards for financial management... Administration § 85.20 Standards for financial management systems. (a) A State must expand and account for grant... statutes. (b) The financial management systems of other grantees and subgrantees must meet the following...
Malignant gliomas (MG) in the elderly. A study of 85 consecutive patients in two institutions
International Nuclear Information System (INIS)
Villa, S.; Vinolas, N.; Verger, E.; Gil, M.; Caralt, L.; Moreno, V.; Graus, F.
1997-01-01
Purpose: The treatment of MG in old patients is controversial and not well established. Some authors consider that adjuvant radiotherapy (RT) is not useful to improve survival. Our aim was to identify which group of patients older than 65 years might benefit of adjuvant radiotherapy (RT). Patients and Methods: A total of 85 consecutive patients were analyzed from two Institutions diagnosed during the period 1987-1995. Forty six were male and 39 female. The median age was 70 (r 65-81). The extent of surgery (S) was analyzed by neurosurgeons reports or postoperative CT scan (32 p. underwent biopsy, 25 partial resection, 28 complete resection). Glioblastoma Multiforme was observed in 64 patients (75%) and anaplastic gliomas in 21 patients (25%). Postoperative Karnofsky Index (KI) was as follows: in 47 p 60% (for 2 p was unknown). Survival probability was estimated using Kaplan-Meier method and compared with log-rank test. Crude and adjusted hazard ratios (HR) were calculated using Cox's regression models. Results: Forty four patients were treated by adjuvant RT and 41 patients were not. Median survival time for all patients was 18.3 weeks. In multivariate analysis we found that the most powerful independent variable was not to receive RT with a hazard ratio of 8.5 (CI 4.55-16.06). Reasons for not RT were: in 7 p. postsurgical complications, in 17 p. KI 40%. Multivariate analysis showed that the most significant independent variable was age ( 71 y) with a HR of 2.85 (CI 1.31-6.19). Conclusions: 1- Patients who did not received RT, due to several reasons, had poorer evolution. 2-In patients who received adjuvant treatment, it was suggested that age is the first variable to consider, although patients older than 71 can benefit of RT (see table)
Czech Academy of Sciences Publication Activity Database
Diaz-de-Quijano, D.; Palacios, P.; Horňák, Karel; Felip, M.
85A, č. 10 (2014), s. 841-853 ISSN 1552-4922 Institutional support: RVO:60077344 Keywords : 3D fluorescence microscopy * deconvolution * ELF phosphate * phosphatase activity * phytoplankton Subject RIV: EE - Microbiology, Virology Impact factor: 2.928, year: 2014
miR-11 regulates pupal size of Drosophila melanogaster via directly targeting Ras85D.
Li, Yao; Li, Shengjie; Jin, Ping; Chen, Liming; Ma, Fei
2017-01-01
MicroRNAs play diverse roles in various physiological processes during Drosophila development. In the present study, we reported that miR-11 regulates pupal size during Drosophila metamorphosis via targeting Ras85D with the following evidences: pupal size was increased in the miR-11 deletion mutant; restoration of miR-11 in the miR-11 deletion mutant rescued the increased pupal size phenotype observed in the miR-11 deletion mutant; ectopic expression of miR-11 in brain insulin-producing cells (IPCs) and whole body shows consistent alteration of pupal size; Dilps and Ras85D expressions were negatively regulated by miR-11 in vivo; miR-11 targets Ras85D through directly binding to Ras85D 3'-untranslated region in vitro; removal of one copy of Ras85D in the miR-11 deletion mutant rescued the increased pupal size phenotype observed in the miR-11 deletion mutant. Thus, our current work provides a novel mechanism of pupal size determination by microRNAs during Drosophila melanogaster metamorphosis. Copyright © 2017 the American Physiological Society.
Energy Technology Data Exchange (ETDEWEB)
Sabourin, C.A.
1985-05-01
One of the main objectives of CANMET's Energy Research program is to develop the technologies required to conserve and to increase the supply of liquid fossil fuels in Canada to bridge the gap that exists between domestic supply and demand (both internal demand and export opportunities). The Energy Research Laboratories (ERL) respond to this R D objective on matters related to the upgrading of oil sands; heavy oil and synthetic crude production; coal/bitumen coprocessing; and improved oil and gas domestic heating furnaces. Another major objective is to develop the technologies to burn fossil fuels, mainly coal, under environmentally acceptable conditions; ERL responds to this objective through research in the areas of coal combustion and gasification. This report summarizes the activities of ERL during the fiscal year 1984/85. A recent reorganization of the ERL is summarily described. The total expenses of ERL in 1984/85 were 169 persons/year, $6.375 million in salaries, $3.499 million in operating costs, $2.740 million in capital investments, and $10,000 million in contracts. Included in the report are listings of employees, patents, publications, technical committees, and contracts. 2 figs., 2 tabs.
International Nuclear Information System (INIS)
Ross, O.; Ahlswede, J.; Annewandter, R.; Kalinowski, M.B.; Rast, S.; Schluenzen, K.H.
2010-01-01
The results of this study were achieved in the project 'Simulation of Atmospheric Noble Gas Concentrations to Assess Sampling Procedures for the Detection of Clandestine Nuclear Reprocessing' (IAEA GER 1643) in the joint programme of IAEA and Federal Government of Germany. In the first year of the project the detectability of additional krypton-85 sources was investigated using atmospheric transport modelling. Krypton-85 is released into the air during reprocessing of spent nuclear fuel rods. Therefore the krypton-85 signature can possibly be used for the detection of undeclared plutonium separation. First, the global krypton-85 background produced by known reprocessing facilities from 1971 until 2006 was simulated with the atmospheric general circulation model ECHAM5 using annual emission data. The model results were evaluated by extensive comparison with measurements performed by the German Federal Office for Radiation Protection. Of particular interest for an assessment of the detectability of unknown sources is the background variability. The variability of concentrations is very high over central Europe, where the large reprocessing plants La Hague and Sellafield are located, and it is very low on the Southern Hemisphere, where no nuclear reprocessing takes place. The analysis of concentration time series on various time scales allows partly a distinction between fluctuations caused by the variability of the sources from variations due to atmospheric dynamics. Furthermore the detection sensitivity to a set of arbitrarily specified source locations is analysed with a Lagrangian particle dispersion model. This, in combination with the location specific background variability, is giving first benchmarks on the capability of using krypton-85 for IAEA Safeguards based on the Additional Protocols foreseeing environmental sampling. (author)
Rare earth conversion coating on Mg-8.5Li alloys
International Nuclear Information System (INIS)
Yang Xiaowei; Wang Guixiang; Dong Guojun; Gong Fan; Zhang Milin
2009-01-01
The conversion coating formed by immersion in a solution containing rare earth salt on Mg-8.5Li alloy was studied and the corrosion resistance was evaluated as well. The surface morphology was observed by scanning electron microscopy (SEM), and the chemical composition was characterized by X-ray photoelectron spectroscopy (XPS). The corrosion behaviors of Mg-8.5Li alloy and conversion coating were assessed by means of potentiodynamic polarization curves, electrochemical impedance spectra (EIS) and immersion tests. The experimental results indicated that the coating with cracked morphology was homogeneous. It was mainly composed of La 2 O 3 , CeO 2 , Mn 2 O 3 and MnO 2 as detected by XPS. The results of electrochemical measurements and immersion tests revealed that the rare earth conversion coating possessed better corrosion resistance than bare alloy and chromate conversion coating.
New method of 85Kr reduction in a noble gas based low-background detector
Akimov, D. Yu.; Bolozdynya, A. I.; Burenkov, A. A.; Hall, C.; Kovalenko, A. G.; Kuzminov, V. V.; Simakov, G. E.
2017-04-01
Krypton-85 is an anthropogenic beta-decaying isotope which produces low energy backgrounds in dark matter and neutrino experiments, especially those based upon liquid xenon. Several technologies have been developed to reduce the Kr concentration in such experiments. We propose to augment those separation technologies by first adding to the xenon an 85Kr-free sample of krypton in an amount much larger than the natural krypton that is already present. After the purification system reduces the total Kr concentration to the same level, the final 85Kr concentration will be reduced even further by the dilution factor. A test cell for measurement of the activity of various Kr samples has been assembled, and the activity of 25-year-old krypton has been measured. The measured activity agrees well with the expected activity accounting for the 85Kr abundance of the earth's atmosphere in 1990 and the half-life of the isotope. Additional tests with a Kr sample produced in the year 1944 (before the atomic era) have been done in order to demonstrate the sensitivity of the test cell.
G8+5 collaboration on energy efficiency and IPEEC: Shortcut to a sustainable future?
International Nuclear Information System (INIS)
Lesage, Dries; Van de Graaf, Thijs; Westphal, Kirsten
2010-01-01
In recent years, the G8+5 system has proven to be a major focal point of international cooperation in the field of energy efficiency. The G8 has set up multiple dialogues and collaborative frameworks with five emerging economies (China, India, Brazil, Mexico and South Africa) on energy and energy efficiency. The most prominent initiative so far is the creation of the International Partnership for Energy Efficiency Cooperation (IPEEC) in 2009. This article critically evaluates these joint efforts between the G8 and the 'Plus Five' on energy efficiency. More specifically, the purpose of this article is (1) to frame and explain the emergence of this kind of great-power cooperation; (2) to map G8+5 collaboration on energy efficiency; and (3) to provide a critical assessment of the relevance, impact and results of G8+5 initiated energy efficiency initiatives. The main conclusion is that the G8+5 system has performed better on the external dimension (steering global governance) than on the internal dimension (coordination of domestic policies) of global energy efficiency governance.
The saturation phenomenon in Kr85 ion implantation in metallic targets
International Nuclear Information System (INIS)
Baptista Junior, V. de P.
1978-01-01
Noble gases, as Krypton containing the radioative isotope Kr 85 , can be stably incorporated into a wide variety of solids and used as tracers or a kind of sensitive probe to measure chemical and physical phenomena. A general review is presented about the methods of incorporation with emphasis on ion bombardment and saturation. The problem of saturation of metal targets was correlated to certain properties in order to get a mathematical approach. Six properties were chosen as more significative to produce a simple model of saturation on experiments of ion implantation with Kr 85 at 45 KeV. The accuracy of the model is limited by the experimental error, the available data and its own simplicity. (Author) [pt
33 CFR 118.85 - Lights on vertical lift bridges.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lights on vertical lift bridges... BRIDGES BRIDGE LIGHTING AND OTHER SIGNALS § 118.85 Lights on vertical lift bridges. (a) Lift span lights. The vertical lift span of every vertical lift bridge shall be lighted so that the center of the...
East African Medical Journal - Vol 85, No 7 (2008)
African Journals Online (AJOL)
Stakeholders perception of HIV sero-discordant couples in western Kenya · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. E Were, K Wools-Kaloustian, J Baliddawa, PO Ayuo, J Sidle, K Fife, 326-333. http://dx.doi.org/10.4314/eamj.v85i7.9650 ...
The neutrino mass from beta spectrum (ITEP-85)
International Nuclear Information System (INIS)
Lubimov, V.
1986-01-01
The new cycle of tritium beta spectrum measurements in valine with the ITEP spectrometer is discussed (ITEP-85). The detailed investigation of the total response function (TRF) has been performed. The special run of beta spectrum measurements carried out in a wide energy interval (3.4 KeV) has turned out to be a sensitive mode for the TRF experimental test. The results confirm the indication of the neutrino nonzero mass. 11 refs., 10 figs
International Nuclear Information System (INIS)
Abbott, D.; Macauley, M.; Vocadlo, D.; Boraston, A.
2009-01-01
Endo-?-d-glucosaminidases from family 85 of glycoside hydrolases (GH85 endohexosaminidases) act to cleave the glycosidic linkage between the two N-acetylglucosamine units that make up the chitobiose core of N-glycans. Endohexosaminidase D (Endo-D), produced by Streptococcus pneumoniae, is believed to contribute to the virulence of this organism by playing a role in the deglycosylation of IgG antibodies. Endohexosaminidases have received significant attention for this reason and, moreover, because they are powerful tools for chemoenzymatic synthesis of proteins having defined glycoforms. Here we describe mechanistic and structural studies of the catalytic domain (SpGH85) of Endo-D that provide compelling support for GH85 enzymes using a catalytic mechanism involving substrate-assisted catalysis. Furthermore, the structure of SpGH85 in complex with the mechanism-based competitive inhibitor NAG-thiazoline (Kd = 28 ?m) provides a coherent rationale for previous mutagenesis studies of Endo-D and other related GH85 enzymes. We also find GH85, GH56, and GH18 enzymes have a similar configuration of catalytic residues. Notably, GH85 enzymes have an asparagine in place of the aspartate residue found in these other families of glycosidases. We propose that this residue, as the imidic acid tautomer, acts analogously to the key catalytic aspartate of GH56 and GH18 enzymes. This topographically conserved arrangement of the asparagine residue and a conserved glutamic acid, coupled with previous kinetic studies, suggests these enzymes may use an unusual proton shuttle to coordinate effective general acid and base catalysis to aid cleavage of the glycosidic bond. These results collectively provide a blueprint that may be used to facilitate protein engineering of these enzymes to improve their function as biocatalysts for synthesizing glycoproteins having defined glycoforms and also may serve as a guide for generating inhibitors of GH85 enzymes.
Intramolecular transfer of radiation damage in γ-irradiated nucleotides: 8,5'-cyclonucleotides
International Nuclear Information System (INIS)
Fuciarelli, A.F.; Raleigh, J.A.
1984-01-01
The transfer of radiation damage initiated in the sugar phosphate moiety to a nucleotide base as exemplified by 8,5'-cyclonucleotide formation may be important in double-stranded nucleic acids where the bases are shielded to direct hydroxyl attack. With this in mind the authors have renewed a study of the radiation chemistry of cyclonucleotides including further development of an in situ immunochemical assay for their formation in nucleic acids. 8,5'-cycloadenosine 5'-monophosphate has been prepared by radiation chemical synthesis for this purpose. The authors have discovered that the Erlanger and Bieser technique in which the cyclonucleotide hapten is attached to bovine serum albumin (BSA) through the sugar moiety may not be the best approach for preparing cyclonucleotide-containing immunogens as conformational changes may occur in the cyclonucleotide structure during this procedure. The authors are presently using an alternate approach in which the cyclonucleotide hapten is linked to BSA through the phosphate group of the nucleotide. The authors report on these experiments as well as on the basic radiation chemistry of 8,5'-cyclonucleotides
The R85m President Brand joint metallurgical complex
International Nuclear Information System (INIS)
Payne, Adam.
1977-01-01
The uranium plant at President Brand, which was built in 1971 and opened last year, is now being extended. The plant forms only part of the extensive joint metallurgical complex being developed by Anglo American Corp. in the Free State, costing a total R85million. This article examines technical details of the recovery processes involved
International Nuclear Information System (INIS)
Janardhanan, S.; Swaminathan, N.; John, Jacob; Kutty, K.N.; Wattamwar, S.B.; Gopalan, C.S.; Menezes, C.M.
1982-01-01
Design, development and calibration of a scintillation type detector for environmental monitoring of low levels of 85 Kr activity in off-line effluents or plant areas in presence of gamma background are reported. Calibration of the system was done using NBS 85 Kr standard. (author)
Encapsulation of krypton-85 in zeolite molecular sieve with a hot isostatic press
International Nuclear Information System (INIS)
Christensen, A.B.; DelDebbio, J.A.; Knecht, D.A.; Tanner, J.E.
1986-01-01
This paper describes pilot and full-scale experiments which demonstrated the feasibility of immobilizing Kr-85 in a zeolite 5A/glass mixture and compacting it before disposal. The full volume of a one-liter hot isostatic press (HIP) was used to trap argon in zeolite 5A. For radioactive krypton the HIP was modified to isolate the Kr-85 in the work zone. Details of the HIP modifications, experimental procedure, and sample analysis are reported
Krypton-85 enrichment by adsorption-desorption process
International Nuclear Information System (INIS)
Khan, A.A.; Deshingkar, D.S.; Ramarathinam, K.
1975-01-01
The use of activated charcoal columns in conjunction with cryogenic distillation system for concentration of krypton-85 in fuel reprocessing process off-gas stream is reported. Dynamic adsorption of krypton on activated charcoals and its subsequent desorption by applying vacuum were studied. The possible reduction in the quantity of carrier gas to be liquified in the cryogenic system by utilising this process has been discussed on the basis of results of laboratory evaluations. The possibility of elimination of air and oxygen to avoid explosion hazards associated with radiolytic formation and concentration of ozone has also been considered. (author)
g-Factors of magnetic-rotational states in {sup 85}Zr
Energy Technology Data Exchange (ETDEWEB)
Yuan Daqing; Zheng Yongnan; Zhou Dongmei; Zuo Yi; Fan Ping; Liu Meng; Wu Xiaoguang; Zhu Lihua; Li Guangsheng; Xu Guoji; Fan Qiewen; Zhang Xizhen; Zhu Shengyun, E-mail: zhusy@ciae.ac.cn [China Institute of Atomic Energy (China)
2007-11-15
The g-factors of the magnetic-rotational intra-band states in {sup 85}Zr have been measured by the TMF-IMPAD method for the first time. The configuration {pi} (g{sub 9/2}){sub 8}{sup 2} x {nu} ( f{sub 7/2}) is established for the band. The measured g-factors are in good agreement with those calculated by the semi-classical model. The decrease of both g-factors and shears angles along the band shows that the total angular momentum is generated by the sheras effect of a step-by-step alignment of the valence protons and neutrons. The rapid neutron alignment leads to a decrease of g-factors along the band. The shears angle of the band-head is great than 90{sup o}, which implies that the spin-dependent interaction as well as the residul interaction might be involved in the shears mechanism in {sup 85}Zr.
Effects of the Bacterial Extract OM-85 on Phagocyte Functions and the Stress Response
Baladi, S.; Kantengwa, S.; Donati, Y. R. A.; Polla, B. S.
1994-01-01
The effects of the bacterial extract OM-85 on the respiratory burst, intracellular calcium and the stress response have been investigated in human peripheral blood monocytes from normal donors. Activation of the respiratory burst during bacterial phagocytosis has been previously associated with heat shock/stress proteins synthesis. Whereas OM-85 stimulated superoxide production and increased Ca2+ mobilization, it fared to induce synthesis of classical HSPs. The lack of stress protein induction was observed even in the presence of iron which potentiates both oxidative injury and stress protein induction during bacterial phagocytosis. However OM-85 induced a 75–78 kDa protein, which is likely to be a glucose regulated protein (GRP78), and enhanced intracellular expression of interleukin-lβ precursor. PMID:18472933
38 CFR 8.5 - Authorization for deduction of premiums from compensation, retirement pay, or pension.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Authorization for deduction of premiums from compensation, retirement pay, or pension. 8.5 Section 8.5 Pensions, Bonuses, and... Authorization for deduction of premiums from compensation, retirement pay, or pension. Deductions from benefits...
Laser cooling of 85Rb atoms to the recoil-temperature limit
Huang, Chang; Kuan, Pei-Chen; Lan, Shau-Yu
2018-02-01
We demonstrate the laser cooling of 85Rb atoms in a two-dimensional optical lattice. We follow the two-step degenerate Raman sideband cooling scheme [Kerman et al., Phys. Rev. Lett. 84, 439 (2000), 10.1103/PhysRevLett.84.439], where a fast cooling of atoms to an auxiliary state is followed by a slow cooling to a dark state. This method has the advantage of independent control of the heating rate and cooling rate from the optical pumping beam. We operate the lattice at a Lamb-Dicke parameter η =0.45 and show the cooling of spin-polarized 85Rb atoms to the recoil temperature in both dimensions within 2.4 ms with the aid of adiabatic cooling.
Evaluation of a Hypocrea jecorina Enzyme Preparation for Hydrolysis of Tifton 85 Bermudagrass
Ximenes, E. A.; Brandon, S. K.; Doran-Peterson, J.
Tifton 85 bermudagrass, developed at the ARS-USDA in Tifton, GA, is grown on over ten million acres in the USA for hay and forage. Of the bermudagrass cultivars, Tifton 85 exhibits improved digestibility because the ratio of ether- to ester-linked phenolic acids has been lowered using traditional plant breeding techniques. A previously developed pressurized batch hot water (PBHW) method was used to treat Tifton 85 bermudagrass for enzymatic hydrolysis. Native grass (untreated) and PBHW-pretreated material were compared as substrates for fungal cultivation to produce enzymes. Cellulase activity, measured via the filter paper assay, was higher for fungi cultivated on PBHW-pretreated grass, whereas the other nine enzyme assays produced higher activities for the untreated grass. Ferulic acid and vanillin levels increased significantly for the enzyme preparations produced using PBHW-pretreated grass and the release of these phenolic compounds may have contributed to the observed reduction in enzyme activities. Culture supernatant from Tifton 85 bermudagrass-grown fungi were combined with two commercial enzyme preparations and the enzyme activity profiles are reported. The amount of reducing sugar liberated by the enzyme mixture from Hypocrea jecorina (after 192 h incubation with untreated bermudagrass) individually or in combination with feruloyl esterase was 72.1 and 84.8%, respectively, of the commercial cellulase preparation analyzed under the same conditions.
50 CFR 85.12 - Information collection, recordkeeping, and reporting requirements.
2010-10-01
... VESSEL ACT GRANT PROGRAM General § 85.12 Information collection, recordkeeping, and reporting... CFR 12.80), and financial reporting (43 CFR 12.81). (c) Reporting requirements include retention and... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Information collection, recordkeeping, and...
40 CFR 85.2230 - Steady state test dynamometer-EPA 91.
2010-07-01
... PROGRAMS (CONTINUED) CONTROL OF AIR POLLUTION FROM MOBILE SOURCES Emission Control System Performance... applicability. The requirements of § 85.2229 apply concurrently for tests conducted under Emission Performance... capable of applying a load to the vehicle's driving tire surfaces at the horsepower and speed levels...
Directory of Open Access Journals (Sweden)
Christine Bodemer
Full Text Available Environmental factors play a major role on atopic dermatitis (AD which shows a constant rise in prevalence in western countries over the last decades. The Hygiene Hypothesis suggesting an inverse relationship between incidence of infections and the increase in atopic diseases in these countries, is one of the working hypothesis proposed to explain this trend.This study tested the efficacy and safety of oral administration of the bacterial lysate OM-85 (Broncho-Vaxom®, Broncho-Munal®, Ommunal®, Paxoral®, Vaxoral®, in the treatment of established AD in children.Children aged 6 months to 7 years, with confirmed AD diagnosis, were randomized in a double-blind, placebo-controlled trial to receive, in addition to conventional treatment with emollients and topical corticosteroids, 3.5mg of the bacterial extract OM-85 or placebo daily for 9 months. The primary end-point was the difference between groups in the occurrence of new flares (NF during the study period, evaluated by Hazard Ratio (HR derived from conditional Cox proportional hazard regression models accounting for repeated events.Among the 179 randomized children, 170 were analysed, 88 in the OM-85 and 82 in the placebo group. As expected most children in both treatment groups experienced at least 1 NF during the study period (75 (85% patients in the OM-85 group and 72 (88% in the placebo group. Patients treated with OM-85 as adjuvant therapy had significantly fewer and delayed NFs (HR of repeated flares = 0.80; 95% confidence interval (CI: 0.67-0.96, also when potential confounding factors, as family history of atopy and corticosteroids use, were taken into account (HR = 0.82; 95% CI: 0.69-0.98. No major side effect was reported, with comparable and good tolerability for OM-85 and placebo.Results show an adjuvant therapeutic effect of a well standardized bacterial lysate OM-85 on established AD.
Dun, C.A.J.; Hol, M.K.S.; Mylanus, E.A.M.; Cremers, C.W.R.J.
2011-01-01
OBJECTIVES: We present indications and clinical outcomes of fitting an 8.5-mm abutment for bone conduction devices. METHODS: In 39 cases with a follow-up time of more than 12 months after fitting of an 8.5-mm abutment, the preintervention and postintervention courses were retrospectively evaluated.
33 CFR 110.85 - Niagara River, Youngstown, N.Y.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niagara River, Youngstown, N.Y... ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.85 Niagara River, Youngstown, N.Y. (a) Area 1... of the Niagara River at latitude 43°14′33″ N, longitude 79°03′7.5″ W; thence westerly to a point at...
Operation and control of an ion-implantation/sputtering storage device for 85Kr
International Nuclear Information System (INIS)
McClanahan, E.D.; Moss, R.W.; Greenwell, E.N.
1986-01-01
The design and operation of a device for implanting 85 Kr in a sputtered Cu-Y alloy for long-term storage tests are described. A total of approx.400 Ci of 85 Kr, in a 4.2% mixture with nonradioactive isotopes, was implanted in three batches at a rate of 6.1 sccm. A triode discharge operating at a pressure of 0.4 Pa with a plasma current of 4.5 A was maintained with a potential of 67 V. The target and substrate potentials were 2400 and 290, respectively, with an ion current density of approx.100 A/m 2 . The discharge and pumping action was started with nonradioactive Kr, then was switched to the radioactive gas until all in the reservoir was consumed, then again was switched to the nonradioactive gas to apply a closeout layer. The control feature used made it possible to empty the 85 Kr reservoir without use of an auxiliary pumping system. 13 refs., 4 figs
Capture and immobilization of krypton-85
International Nuclear Information System (INIS)
Whitmell, D.S.; Geens, L.; Penzhorn, R.D.; Smith, M.J.S.
1985-01-01
It may become necessary to contain the krypton-85 released from nuclear fuel during reprocessing in order to reduce the exposure to the local population and the radioactive background throughout the world. A brief description is given of studies being carried out in the Indirect Action Programme. The separation of krypton from other off-gases by cryogenic distillation in the presence of oxygen is being studied at SCK/CEN Mol, together with the behavior of ozone in the distillation column. Two processes for the immobilization of krypton in solid forms have been successfully developed and demonstrated. At KfK Karlsruhe, krypton is encapsulated in vitrified zeolites; at AERE Harwell, krypton is immobilized within a metallic matrix. These processes offer excellent gas retention and either could be adopted for a reprocessing plant
2010-07-01
... being offered for sale be withdrawn and approved for donation? 102-37.85 Section 102-37.85 Public... MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.85 Can surplus property being offered for sale be withdrawn and approved for donation...
2010-07-01
... services for cleaning, mechanical operation, and maintenance identified in an OA? 102-85.175 Section 102-85... of Service § 102-85.175 Are the standard level services for cleaning, mechanical operation, and maintenance identified in an OA? Unless specified otherwise in the OA, standard level services for cleaning...
International Nuclear Information System (INIS)
Sturelid, S.; Bergman, R.
1976-01-01
Induction of chromatid aberrations in S-phase Chinese hamster fibroblasts has been studied for irradiation by 60 Co gamma rays and neutrons of average energy 8.5, 45, 83, 200 and 500 keV. At 10 per cent aberration level the relative biological afficiency varied between 2.2 +- 0.6 (at 8.5 keV) and a maximum of 47 +- 9 (at 200 keV). The neutron generated recoils have short range in comparison to chromosomal dimensions. The strong variation with neutron energy is therefore not necessarily reflecting variations in the average linear energy transfer. Good agreement between experimental and predicted response was obtained when effects ascribed to range were considered. A critical volume within which primary lesions should occur in order to make chromosomal aberrations probable was derived. The corresponding site radius was estimated to be 1-3 μm. (author)
40 CFR 85.1907 - Responsibility under other legal provisions preserved.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Responsibility under other legal... Requirements § 85.1907 Responsibility under other legal provisions preserved. The filing of any report under the provisions of this subpart shall not affect a manufacturer's responsibility to file reports or...
Mohan, S.B.; Schmid, M.C.; Jetten, M.S.M.; Cole, J.
2004-01-01
Degenerate primers to detect nrfA were designed by aligning six nrfA sequences including Escherichia coli K-12, Sufurospirillum deleyianum and Wolinella succinogenes. These primers amplified a 490 by fragment of nrfA. The ability of these primers to detect nrfA was tested with chromosomal DNA
34 CFR 85.325 - What happens if I do business with an excluded person in a covered transaction?
2010-07-01
... person, we may disallow costs, annul or terminate the transaction, issue a stop work order, debar or... in a covered transaction? 85.325 Section 85.325 Education Office of the Secretary, Department of... Regarding Transactions Doing Business with Other Persons § 85.325 What happens if I do business with an...
Radiotherapy for patients with malignant diseases aged 85 years or older
International Nuclear Information System (INIS)
Asakura, Hirofumi; Mizumoto, Masashi; Zenda, Sadamoto
2007-01-01
The purpose of this study was to assess the efficacy and problems of radiotherapy for patients aged 85 or older. Forty-five patients were assessed (oldest old group): They were 85 years of age or older and had received radiotherapy between September 2002 and September 2005. Sixty-nine patients, 75 years of age at the start of radiotherapy, were also assessed (old group). In the oldest old group, there were 21 men and 24 women, and median age was 87 years (range; 85-99). The sites of disease were: 10 in head and neck, 5 in lung, 5 in malignant lymphoma, 4 in skin, 4 in esophagus, 2 in breast, 2 in uterine cervix, 2 in rectum, 2 in soft tissue, 2 in metastatic bone tumor, 7 in others. The treatment was deemed curative in 49%, palliative in 40%, and others in 11%. Treatment fields were limited due to performance status (PS) or age in 13 patients. The rate of treatment completion was 91% (41/45). Eleven of 26 inpatients were admitted because of difficulty in hospital visit. Seventeen of 19 outpatients needed familial escort. Of patients completed radiotherapy, 47% of the patients achieved complete response (CR), 37% achieved partial response (PR), and 16% achieved no change (NC) in the group of curative radiotherapy, and 88% of the patients achieved effective response, and only 2 cases resulted in ineffective response in the group of palliative radiotherapy. While only one patient received grade 3 dermatitis and mucositis, other patients received grade 2 and below adverse events. Three patients resulted in deterioration of PS, and 2 patients deteriorated dementia. Although higher rates in female patients, worse PS, and limitation of treatment field were seen in the oldest old group, there were no significant difference in terms of the rate of treatment completion, effectiveness, and adverse events between the two groups. Our study showed radiotherapy is effective and well tolerated in patients aged 85 or older. Considering the oldest old requiring radiotherapy
Improvements in the equipment for determination of Kr-85 with the reference method
International Nuclear Information System (INIS)
Heras Iniquez, M.C.; Perez Garcia, M.M.
1983-01-01
A new equipment for Kr-85 separation and their cryogenic chromatographic concentration is described, which presents some advantages respect the equipment used as reference. The new apparatus, made with metallic elements, is based on the method of concentration and separation previously described but presents easier control, faster chromatographic separations and without loosed of efficiency and reproducibility that the previous one. The concentration and separation procedure for Kr-85 and a comparative study between both apparatus is described. Also the efficiency of the method is obtained experimentally. (Author)
Comparison of transfer factors of Sr-85 and Cs-134 for soils and crops of Greece
International Nuclear Information System (INIS)
Skarlou, V.; Papanicolaou, E. P.; Nobeli, C.
1994-01-01
The transfer of Sr-85 and Cs-134 from soil to plant (CR) was studied in two successive and similar in design glasshouse experiments. Six plant species (wheat, alfalfa, radish, string bean, cucumber, lettuce - only for Sr-85 - and endives - only for Cs-134), were grown in pots on eight Greek soils differing significantly in their physical and chemical properties. After the necessary measurements and analyses, big differences were detected in the transfer factors of both radionuclides with the soil types. The CRs of Sr-85 were higher than those of Cs-134 and for the tested crops and soils ranged between 0.3 and 36.5 for Sr-85 and between < 0.01 and 1.72 for Cs-134. The CRs of grains and seeds were much lower than those of leafy material for Sr-85 while the difference was not so high for Cs-134. The correlation between CRs and pH, negative in all cases, was significant or highly significant for all tested crops or plant parts (for Sr-85 r-bar = - 0.89, for Cs-134 r-bar = - 0.82). The values of CRs indicated a trend for negative correlation with other soil properties (cation exchange capacity-CEC, clay %). From exchangeable cations, exchangeable (Ca + Mg) as well as exchangeable bases, expressed as percentages of CEC, gave a significant or highly significant correlation with CRs of both radionuclides. (author)
International Nuclear Information System (INIS)
Bengtsson, G.B.
1992-01-01
The recovery of superficially applied 134 Cs + and 85 Sr 2+ in apple branches protected from precipitation decreased with time. Translocation of 134 Cs to uncontaminated branches declined rapidly with the distance from the contaminated branches. Extensive translocation of 134 Cs from foliage to fruits occurred within the same branch: after 84 d, 50% of the recovered activity was found in fruits and most of it in the edible part (excluding peel). On the other hand, 85 Sr was less mobile and in virtually all fruit 85 Sr was in the peel. Rinsing leaves removed 30% of both radionuclides 1 d after contamination and decreasing fractions later on. Rinsing fruits removed up to 62% of the peel radionuclides. Further rinses and washes (plus detergent) of fruits showed that 134 Cs had the same distribution in the outer skin as 85 Sr and that the ratio of the two nuclides was close to the ratio in the contamination solution. This indicates that apple skin is a barrier not only to 85 Sr, but probably also to 134 Cs. Unaccounted for disappearance of radioactivity from fruits and leaves could have been a result to field losses of small superficial particles. (author)
Liang, Yan; Zhang, Junxian; Yang, Yourong; Bai, Xuejuan; Yu, Qi; Li, Ning; Hou, Ying; Shi, Yingchang; Wang, Lan; Wu, Xueqiong
2017-07-13
The immune function of tuberculosis (TB) patients is disordered. By using immune regulators to assist chemotherapy for TB the curative effect might be improved. In this study, a vaccine containing Mycobacterium tuberculosis (M. tuberculosis) recombinant Ag85AB fusion protein (rAg85AB) was constructed and evaluated. The mice were immunized intramuscularly three times at two-week intervals with Ag85AB fusion protein combined with Corynebacterium parvum adjuvant (rAg85AB+CP). In comparison to control mice that received either CP alone or saline, the mice that received rAg85AB+CP had significantly higher number of T cells secreting IFN-γ and higher levels of specific antibodies of IgG, IgG1 and IgG2a isotypes in sera. The specific antibodies also had higher ratios of IgG2a to IgG1, indicating a predominant Th1 immune response. To test for immunotherapy of TB, M. tuberculosis infected mice were given three intramuscular doses of 20μg, 40μg or 60μg of rAg85AB in rAg85AB+CP, or phosphate-buffered saline (PBS), or CP or Mycobacterium phlei (M. Phlei) F.U.36. Compared with the PBS group, 20µg, 40µg and 60µg rAg85AB+CP and M. phlei F.U.36 groups reduced the pulmonary bacterial loads by 0.13, 0.15, 0.42 and 0.40 log 10 , and the liver bacterial loads by 0.64, 0.64, 0.53 and 0.61 log 10 , respectively. Pathological changes of lungs were less, and the lesions were limited to a certain extent in 40µg and 60µg rAg85AB+CP and M. phlei F.U.36 groups. These results showed that rAg85AB+CP had immunotherapeutic effect on TB, significantly increasing the cellular immune response, and inhibiting the growth of M. tuberculosis. Copyright © 2017 Elsevier Ltd. All rights reserved.
46 CFR 67.85 - Change in general partners of partnership.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Change in general partners of partnership. 67.85 Section... partners of partnership. When the general partners of a partnership owning a documented vessel change by addition, deletion, or substitution without dissolution of the partnership, the change must be established...
Design for a Remote Monitoring Equipment of Krypton-85
Institute of Scientific and Technical Information of China (English)
LUXue-sheng; LIUGuo-rong; YEFeng; JINHui-min; TANGPei-jia
2003-01-01
A prototype equipment for monitoring Krypton-85 in situ is designed and set up. A series of relevant software is also developed for remote control, data acquirement and data analysis. Weight of the system is about 300 kg, which is composed of NaI(T1) detector, digi DART, Marillin measurement container and lead shield. The whole system is placed on a homemade go-cart.
Energy Technology Data Exchange (ETDEWEB)
Heras, M. M.; Perez, M. M.
1983-07-01
A new equipment for Kr-85 separation and their cryogenic chromatographic concentration is described, which presents some advantages respect the equipment used as reference. The new apparatus, made with metallic elements, is based on the method of concentration and separation previously described but presents easier control, faster chromatographic separations and without loosed of efficiency and reproducibility that the previous one. The concentration and separation procedure for Kr-85 and a comparative study between both apparatus is described. Also the efficiency of the method is obtained experimentally. (Author)
Begnini, Karine Rech; Rizzi, Caroline; Campos, Vinicius Farias; Borsuk, Sibele; Schultze, Eduarda; Yurgel, Virginia Campello; Nedel, Fernanda; Dellagostin, Odir Antônio; Collares, Tiago; Seixas, Fabiana Kömmling
2013-02-01
BCG therapy remains at the forefront of immunotherapy for treating patients with superficial bladder cancer. The high incidence of local side effects and the presence of non-responder diseases have led to efforts to improve the therapy. Hence, we proposed that an auxotrophic recombinant BCG strain overexpressing Ag85B (BCG ∆leuD/Ag85B), could enhance the cytotoxicity to the human bladder carcinoma cell line 5637. The rBCG was generated using an expression plasmid encoding the mycobacterial antigen Ag85B to transform a BCG ∆leuD strain. The inhibitory effect of BCG ∆leuD/Ag85B on 5637 cells was determined by the MTT method, morphology observation and a LIVE/DEAD assay. Gene expression profiles for apoptotic, cell cycle-related and oxidative stress-related genes were investigated by qRT-PCR. Bax, bcl-2 and p53 induction by BCG ∆leuD/Ag85B treatment was evaluated by Western blotting. BCG ∆leuD/Ag85B revealed a superior cytotoxicity effect compared to the control strains used in this study. The results showed that the expression level of pro-apoptotic and cell cycle-related genes increased after BCG ∆leuD/Ag85B treatment, whereas the mRNA levels of anti-apoptotic genes decreased. Interestingly, BCG ∆leuD/Ag85B also increased the mRNA level of antioxidant enzymes in the bladder cancer cell line. Bax and p53 proteins levels increased following treatment. In conclusion, these results suggest that treatment with BCG ∆leuD/Ag85B enhances cytotoxicity for superficial bladder cancer cells in vitro. Therefore, rBCG therapy may have potential benefits in the treatment of bladder cancer.
Determination of distribution ratio for 60Co, 85Sr and 134Cs in loess medium
International Nuclear Information System (INIS)
Tanaka, Tadao; Ogawa, Hiromichi; Zhentang Li; Hui Wang; Kamiyama, Hideo.
1994-06-01
Distribution ratio R for 60 Co, 85 Sr and 134 Cs between loess and ground water was measured by using 16 loess samples taken from the field test site of China Institute for Radiation Protection, in which the field test of radionuclide migration had been performed. The R of each radionuclide was taken nearly constant value among 16 samples. This revealed that the site can be regarded as uniform loess medium from the view point of sorption ability. The sorption ability between the three radionuclides was the order of 134 Cs > 60 Co >> 85 Sr. The 85 Sr was an available nuclide for examining the migration phenomena, because 85 Sr might easily migrate in the loess medium due to its low sorption ability. The results of parametric check suggested that it is necessary to select the valid temperature and pH for determining the R value. The sorption of Sr on the loess was dominated by reversible ion-exchange reaction, while that of Co and Cs was dominated by irreversible one. (author)
The gold-rich indide Sr{sub 5}Au{sub 13.5}In{sub 8.5}
Energy Technology Data Exchange (ETDEWEB)
Muts, Ihor [Ivan Franko National Univ. of Lviv (Ukraine). Inorganic Chemistry Dept.; Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Rodewald, Ute C.; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie; Zaremba, Vasyl' I. [Ivan Franko National Univ. of Lviv (Ukraine). Inorganic Chemistry Dept.
2011-11-15
The orthorhombic indide Sr{sub 5}Au{sub 13.5}In{sub 8.5} was obtained during phase-analytical studies of the Sr-Au-In system. This new indide is formed upon melting of the elements in a sealed tantalum tube. Sr{sub 5}Au{sub 13.5}In{sub 8.5} was characterized on the basis of powder and single-crystal X-ray diffraction: Pmmn, a = 476.37(9), b = 2927.5(9), c = 894.9(2) pm, wR2 = 0.056, 2355 F{sup 2} values, 87 variables. The structure is of a new type. The gold and indium atoms build up a complex three-dimensional [Au{sub 13.5}In{sub 8.5}] polyanionic network in which the strontium atoms fill channels which extend in the a direction. One site within the polyanion shows Au/In mixing. The Sr{sub 5}Au{sub 13.5}In{sub 8.5} structure is composed of SrAu{sub 3}In{sub 3-} and SrAu-related slabs. (orig.)
Analyzing Trends in the U.S. and Danish Gender Wage Gaps in the 1980s and 1990s
DEFF Research Database (Denmark)
Smith, Nina; Datta Gupta, Nabanita; Oaxaca, Ronald L.
2006-01-01
Trends in US and Danish gender wage gaps in the 1980s and 1990s are analysed within the framework of simple auto-regressive time-series models. Results show a saturation effect in the wage progress of women in Denmark at a level of 85% but no similar signs of stabilization in the USA. Also......, no evidence is found that business cycle variables can explain the development of the gender wage gap in either country during this time period....
22 CFR 92.85 - Service of legal process usually prohibited.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Service of legal process usually prohibited. 92... RELATED SERVICES Quasi-Legal Services § 92.85 Service of legal process usually prohibited. The service of process and legal papers is not normally a Foreign Service function. Except when directed by the...
Study of skin cancer incidence in Nagasaki atomic bomb survivors, 1958-85
International Nuclear Information System (INIS)
Sadamori, Naoki; Otake, Masanori; Honda, Takeo.
1993-03-01
The effects of exposure to ionizing radiation on skin cancer incidence in a cohort of atomic bomb (A-bomb) survivors in the Nagasaki Extended Life Span Study (LSS-E85) sample have been investigated. Among 25,942 exposed survivors at risk whose DS86 dose estimates were available, 47 cases of skin cancer including malignant melanoma were confirmed in the Nagasaki Tumor Registry during the period from 1 April 1958 to 31 December 1985. The dose-response relationship of skin cancer based on an additive relative risk model showed linearity without threshold, not a linear-quadratic curve. The excess relative risk (ERR) of 2.2 per gray in the LSS-E85 sample was highly significant (95% confidence limits: 0.5 to 5.0). In addition, the ERR of 3.1 per gray in the Adult Health Study (AHS) sample was also significant (95% confidence limits: 0.6 to 20.3). When dose equivalents based on a relative biological effectiveness of neutrons of 10 were used, the ERR in the former sample decreased to 2.0 per sievert (95% confidence limits: 0.7-4.5), and the risk in the latter group also declined, to 2.7 per sievert (95% confidence limits: 0.6-17.8). The ERRs did not differ significantly between males and females in the LSS-E85 and AHS samples, but a highly significant increase was observed for the ERR of age at exposure and time trend since exposure. The ERR of skin cancer cases including and excluding 4 malignant melanoma cases for the LSS-E85 sample (there were no malignant melanoma cases in the AHS sample) showed almost the same linear dose response. This is the first report to demonstrate a highly significant dose-response relationship between A-bomb exposure and skin cancer incidence. (author)
Foliar uptake of 134Cs and 85Sr in strawberry as function by leaf age
International Nuclear Information System (INIS)
Fortunati, P.; Brambilla, M.; Speroni, F.; Carini, F.
2004-01-01
In this paper a study of the foliar uptake and translocation of 134 Cs and 85 Sr in a herbaceous fruit plant is presented. In particular, absorption, translocation and loss of these radionuclides in strawberry plants have been studied in relation to the age of contaminated leaves. Strawberry plants were contaminated by distributing droplets of an aqueous solution containing 134 CsCl and 85 SrCl 2 on the surface of two leaves per plant. One half of the plants was contaminated through two young leaves, a second half through two old leaves. Sets of plants were collected 1 day, 7 days and 15 days after contamination. One half of them was rinsed with double distilled water before gamma analysis. Rinsing contaminated leaves removes on average 55% of the applied 134 Cs and 45% of 85 Sr. The activity removed decreases during the 15 days of the experimental study, both for 134 Cs and for 85 Sr, suggesting an increase in foliar absorption during this period. The activity removed does not differ between old and young leaves. 'External loss' is lower for young than old contaminated leaves. 'Internal loss' through translocation occurs mainly for 134 Cs. Translocation coefficients from contaminated leaves to fruits are two orders of magnitude higher for 134 Cs (4.0%), than for 85 Sr (0.05%). Leaf to fruit translocation coefficients for 134 Cs are higher from young leaves (5.8%), than from old leaves (2.3%)
Risk factors for falls and fall-related injuries in adults 85 years of age and older.
Grundstrom, Anna C; Guse, Clare E; Layde, Peter M
2012-01-01
Falls are a leading cause of morbidity and mortality in older adults. No previous studies on risk factors for falls have focused on adults 85 years and older, the most rapidly growing segment of adults. We examined demographic, health, and behavioral risk factors for falls and fall-related injuries in adults 65 years and older, with a particular focus on adults 85 years and older. We analyzed self-reported information from the Behavioral Risk Factor Surveillance System (BRFSS) for 2008. Data was available for 120,923 people aged 65 or older and 12,684 people aged 85 or older. Of those aged 85 or older, 21.3% reported at least one fall in the past 3 months and 7.2% reported at least one fall related injury requiring medical care or limiting activity for a day or longer. Below average general health, male sex, perceived insufficient sleep, health problems requiring assistive devices, alcohol consumption, increasing body mass index and history of stroke were all independently associated with a greater risk of falls or fall related injuries. The greater risk of falling in those 85 years and older appeared to be due to the deterioration of overall health status with age; among those with excellent overall health status, there was no greater risk of falling in adults 85 years and older compared to those 65-84 years of age. Our results suggest that those with risk factors for falls and fall-related injuries may be appropriate targets for evidence-based fall prevention programs. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Krypton-85 hydrofracture engineering feasibility and safety evaluation
Energy Technology Data Exchange (ETDEWEB)
Peretz, F.J.; Muller, M.E.; Pan, P.Y.
1981-07-01
Engineering studies have been made to determine the hazards associated with the disposal of /sup 85/Kr using the hydrofracture process. To assess the hazards, an effort has been made to identify the equipment required to entrain and dissolve the noble gas into the grout stream at hydrofracture pressure (up to 350 bar). Off-the-shelf or slightly modified equipment has been identified for safe and effective compression and gas-grout mixing. Each monthly injection disposes of 1.6 x 10/sup 6/ Ci of /sup 85/Kr. By connecting only one gas cylinder to the injection system at a time, the maximum amount of krypton likely to be released as a result of equipment failure is limited to 128,000 Ci. An evaluation by Los Alamos Technical Associates shows that releasing this amount of gas in less than one hour under worst-case meteorological conditions through a 30-m stack would result in a whole-body dose of 170 millirem at a distance of 1 km from the facility. A krypton collection and recovery system can further reduce this dose to 17 millirem; increasing the distance to the site boundary to 3 km can also reduce the dose by a factor of ten. Lung and skin dose estimates are 1.6 and 120 times the whole-body dose, respectively. These are all worst-case values; releases under more typical conditions would result in a significantly lower dose. No insurmountable safety or engineering problems have been identified.
Krypton-85 hydrofracture engineering feasibility and safety evaluation
International Nuclear Information System (INIS)
Peretz, F.J.; Muller, M.E.; Pan, P.Y.
1981-07-01
Engineering studies have been made to determine the hazards associated with the disposal of 85 Kr using the hydrofracture process. To assess the hazards, an effort has been made to identify the equipment required to entrain and dissolve the noble gas into the grout stream at hydrofracture pressure (up to 350 bar). Off-the-shelf or slightly modified equipment has been identified for safe and effective compression and gas-grout mixing. Each monthly injection disposes of 1.6 x 10 6 Ci of 85 Kr. By connecting only one gas cylinder to the injection system at a time, the maximum amount of krypton likely to be released as a result of equipment failure is limited to 128,000 Ci. An evaluation by Los Alamos Technical Associates shows that releasing this amount of gas in less than one hour under worst-case meteorological conditions through a 30-m stack would result in a whole-body dose of 170 millirem at a distance of 1 km from the facility. A krypton collection and recovery system can further reduce this dose to 17 millirem; increasing the distance to the site boundary to 3 km can also reduce the dose by a factor of ten. Lung and skin dose estimates are 1.6 and 120 times the whole-body dose, respectively. These are all worst-case values; releases under more typical conditions would result in a significantly lower dose. No insurmountable safety or engineering problems have been identified
Radioactivity 85Kr in krypton enriched with light isotope
International Nuclear Information System (INIS)
Kuz'minov, V.V.; Novikov, V.M.; Pomanskij, A.A.
1992-01-01
85 Kr content in krypton enriched with 78 Kr is measured within the frames of experiment for search of binary position decay and conversion of atomic electron into 78 Kr. Voluminous activity in krypton enriched up to 98% 78 Kr equal to 0.206 -0.004 +0.001 Bq/L is obtained which is by 4000 less as compared to natural krypton. 7 refs.; 1 fig.; 1 tab
48 CFR 1852.216-85 - Estimated cost and award fee.
2010-10-01
... and Clauses 1852.216-85 Estimated cost and award fee. As prescribed in 1816.406-70(e), insert the following clause: Estimated Cost and Award Fee (SEP 1993) The estimated cost of this contract is $___. The... cost, base fee, and maximum award fee are $___. (End of clause) Alternate I (SEP 1993). As prescribed...
Bollhöfer, A; Schlosser, C; Ross, J O; Sartorius, H; Schmid, S
2014-01-01
Krypton-85 activity concentrations in surface air have been measured at Darwin, which is located in northern Australia and is influenced by seasonal monsoonal activity. Measurements between August 2007 and May 2010 covered three wet seasons. The mean activity concentration of krypton-85 measured during this period was 1.31±0.02Bqm(-3). A linear model fitted to the average monthly data, using month and monsoon as predictors, shows that krypton-85 activity concentration measured during the sampling period has declined by 0.01Bqm(-3) per year. Although there is no statistically significant difference in mean activity concentration of krypton-85 between wet and dry season, the model implies that activity concentration is higher by about 0.015Bqm(-3) during months influenced by the monsoon when a north westerly flow prevails. Backward dispersion runs using the Lagrangian particle dispersion model Hysplit4 highlight possible source regions during an active monsoon located deep in the northern hemisphere, and include reprocessing facilities in Japan and India. However, the contribution of these facilities to krypton-85 activity concentrations in Darwin would be less than 0.003Bqm(-3). Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Patrícia Guimarães Pimentel
2009-07-01
tamanhos de 5mm e partícula inteira não afetaram o pH ruminal (P>0,05, registrando-se valores médios de pH 6,14 e 6,61, respectivamente. Verificou-se redução linear no pH ruminal dos novilhos alimentados com a dieta constituída com partícula de 10mm e constatou-se efeito quadrático para a dieta constituída com tamanho de partícula de feno de Tifton 7mm, apresentando pH mínimo de 5,39 a 8:00 horas após o fornecimento da alimentação. As concentrações de N-NH3 foram influenciadas quadraticamente pelos tempos de coleta, registrando concentrações máximas, de 15,55; 15,83; 18,32; 12,00mg/100mL de N-NH3 às 4:28; 3:58; 2:99 e 2:80 horas após alimentação, para as dietas constituídas de feno de Tifton 85 inteiro, picado em 5mm, 7mm e 10mm, respectivamente. Concluiu-se que todas as dietas permitiram padrões nictemerais normais de fermentação.
Effect of S186 for decoporated radiostrontium compared with BADE in rats
International Nuclear Information System (INIS)
Zhang Meizhen; Luo Meichu; Chen Guibao; Liu Shijing; Tong Shungao; Sun Meizhen
1995-01-01
The efficacy of S186 for decorporated radiostrontium compared with BADE in rats was studied. The experimental results showed that administered S186 (in 100∼800 mg/kg) increased the 85+89 Sr excretion in urine and reduced 85+89 Sr retention in body being distinctly superior to that of the equal dose BADE (P<0.05). When administered the dose of S186 that was the half dose of BADE could produce the same effect of BADE for removing radiostrontium
Tanaka, Natsuki; Izawa, Takeshi; Takenaka, Shigeo; Yamate, Jyoji; Kuwamura, Mitsuru
2015-07-01
Coiled-coil domain containing 85c (Ccdc85c) is a causative gene for spontaneous mutant mouse with non-obstructive hydrocephalus and subcortical heterotopia. Detailed functions of Ccdc85C protein have not been clarified. To reveal roles of Ccdc85C, we examined the distribution and expression pattern of Ccdc85C in the systemic developing organs in rats. Ccdc85C was expressed in various simple epithelia but not stratified epithelia. In the various epithelia, Ccdc85C was localized at cell-cell junctions and its expression was strong at apical junctions. Furthermore, intense expression was seen at developing period and gradually decreased with advancing development. Distribution of Ccdc85C coincides with that of proliferating epithelial cells. These results suggest that Ccdc85C plays an important role in the proliferative property of simple epithelia.
85Kr and 39Ar background in GENIUS
International Nuclear Information System (INIS)
Klapdor Kleingrothaus, H.V.; Tomei, C.
2003-01-01
GENIUS is a proposal for a large-scale detector of rare events like double beta decay, cold dark matter and low-energy solar neutrinos in real time. The idea of GENIUS is to operate a large amount of 'naked' Ge detectors in liquid nitrogen, with the aim of reducing the background down to a level of 10 -3 counts/kg keV yr. In this work, we investigate the contribution to the background of GENIUS coming from argon ( 39 Ar) and krypton ( 85 Kr) contamination in the liquid nitrogen
Black coal. Australian statistics for 1984-85
Energy Technology Data Exchange (ETDEWEB)
1986-06-01
According to the Joint Coal Board, production of raw black coal in Australia in 1984-85 was 145,137,000 tonnes - 12.1% more than in 1983-84. Saleable coal production was 118,261,000 tonnes, 12% more than the previous year. Raw coal production from open cut mines rose by 20.3% to 96,523,000 tonnes, whilst underground mine production fell by 1.1% to 48,614,000 tonnes. As in the previous year, the growth in coal production was the result of further strong expansion of exports of both metallurgical and steaming coals. Significant production increases were achieved for the year in both coal exporting states: New South Wales and Queensland.
Energy Technology Data Exchange (ETDEWEB)
Janardhanan, S.; Swaminathan, N.; John, J.; Kutty, K.N.; Wattamwar, S.B. (Bhabha Atomic Research Centre, Bombay (India). Health Physics Div.); Gopalan, C.S.; Menezes, C.M. (Bhabha Atomic Research Centre, Bombay (India). Electronics Div.)
Design, development and calibration of a scintillation type detector for environmental monitoring of low levels of /sup 85/Kr activity in off-line effluents or plant areas in presence of gamma background are reported. Calibration of the system was done using NBS /sup 85/Kr standard.
Solid state reactions of MoO3 and Na2MoO4 with (U.85,Ce.15)O2x
International Nuclear Information System (INIS)
Dahale, N.D.; Keskar, Meera; Singh Mudher, K.D.; Chawla, K.L.
1999-01-01
(U .85 ,Ce .15 )MoO 6-x was prepared by the solid state reactions of (U .85 ,Ce .15 )O 2±x with MoO 3 in air at 600 deg C. Solid state reactions of Na 2 MoO 4 with (U .85 ,Ce .15 )MoO 6.x up to 550 deg C in air led to the formation of Na 2 (U .85 ,Ce .15 )Mo 2 O 10-x and Na 2 (U .85 , Ce .15 ) 2 Mo 3 O 16-x . These compounds were characterised by x-ray and thermal methods. The x-ray powder data of (U .85 , Ce .15 ) MoO 6-x were indexed on monoclinic system whereas, data of Na 2 (U .85 ,Ce .15 ) Mo 2 O 10-x and Na 2 (U .85 ,Ce .15 ) 2 Mo 3 O 16-x were indexed on orthorhombic and monoclinic system respectively. (author)
An unusually brilliant transient in the galaxy M85.
Kulkarni, S R; Ofek, E O; Rau, A; Cenko, S B; Soderberg, A M; Fox, D B; Gal-Yam, A; Capak, P L; Moon, D S; Li, W; Filippenko, A V; Egami, E; Kartaltepe, J; Sanders, D B
2007-05-24
Historically, variable and transient sources have both surprised astronomers and provided new views of the heavens. Here we report the discovery of an optical transient in the outskirts of the lenticular galaxy Messier 85 in the Virgo cluster. With a peak absolute R magnitude of -12, this event is distinctly brighter than novae, but fainter than type Ia supernovae (which are expected in a population of old stars in lenticular galaxies). Archival images of the field do not show a luminous star at that position with an upper limit in the g filter of about -4.1 mag, so it is unlikely to be a giant eruption from a luminous blue variable star. Over a two-month period, the transient source emitted radiation energy of almost 10(47) erg and subsequently faded in the optical sky. It is similar to, but six times more luminous at peak than, an enigmatic transient in the galaxy M31 (ref. 1). A possible origin of M85 OT2006-1 is a stellar merger. If so, searches for similar events in nearby galaxies will not only allow study of the physics of hyper-Eddington sources, but also probe an important phase in the evolution of stellar binary systems.
Krypton-85 and other airborne radioactivity measurements throughout Ireland
International Nuclear Information System (INIS)
Smith, K.J.; Murray, M.; Wong, J.; Sequeira, S.; Long, S.C.; Rafferty, B.
2004-01-01
In compliance with articles 35 and 36 of the EURATOM Treaty, the Radiological Protection Institute of Ireland (RPII) undertakes a comprehensive programme of radioactivity monitoring in the Irish terrestrial environment. Radioactivity is present in the terrestrial environment due to natural processes, the testing of nuclear weapons in the atmosphere, accidents such as the Chernobyl accident and the routine discharge of radionuclides from nuclear installations. The RPII monitors airborne radioactivity concentrations at ten stations throughout Ireland, of which, nine are equipped with low volume particulate samplers and one, in Dublin, with a high volume particulate sampler. The low volume particulate samples are assessed for total beta activity and high volume samples for gamma emitting radionuclides such as caesium-137 and beryllium-7. In addition, air sampled at the RPII laboratory in Dublin, is monitored for krypton-85, a radioactive noble gas, released into the environment primarily as a result of the reprocessing of nuclear fuel at installations such as Sellafield in the UK and La Hague in France. Since the inception of the krypton measurements in 1993 a trend of increasing atmospheric concentrations has been observed. The results of the krypton-85 monitoring, as well as the airborne radioactivity concentration measurements, will be presented and discussed in this paper. (author)
International Nuclear Information System (INIS)
Castillo-Martinez, E.; Schoenleber, A.; Smaalen, S. van; Arevalo-Lopez, A.M.; Alario-Franco, M.A.
2008-01-01
The strontium chromium oxide [Sr 2 O 2 ][CrO 2 ] 1.85 misfit layer compound has been synthesised at high-pressure and high-temperature conditions. Electron diffraction patterns and high-resolution transmission electron microscopy images along [001] show the misfit character of the different layers composing the structure with a supercell along the incommensurate parameter b∼7b 1 ∼13b 2 . The modulated crystal structure has been refined within the superspace formalism against single-crystal X-ray diffraction data, employing the (3+1)-dimensional superspace group C'nmb(0σ 2 0)0 0 s. The compound has a composite structure with lattice parameters a 1 =5.182(1) A, b 1 =5.411(1) A, c 1 =18.194(3) A for the first, SrO, subsystem and the same a and c, but with b 2 =2.925(1) A for the second, CrO 2 , subsystem. The layer stacking is similar to that of orthorhombic PbS(TiS 2 ) 1.18 , but with a much stronger intersubsytem bonding in the case of the oxide. The intersubsystem lattice mismatch is mainly handled by displacement modulations of the Sr atoms, correlated with modulations of the valence, the coordination and the anisotropic displacement parameters. - Graphical abstract: A strontium chromium oxide, [Sr 2 O 2 ][CrO 2 ] 1.85 , with an orthorhombic misfit layer structure has been synthesised under high pressure. Mainly modulations on the Sr position, ADPs and coordination save the subsystems lattice mismatch
41 CFR 102-85.35 - What definitions apply to this part?
2010-07-01
... Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 85-PRICING POLICY FOR... systems, and the finished common areas (building common and floor common) of a building that bound the... means, such as by contract, barter, license, easement, permit, requisition, or condemnation. Such...
40 CFR 96.85 - NOX Budget opt-in permit contents.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false NOX Budget opt-in permit contents. 96... (CONTINUED) NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS FOR STATE IMPLEMENTATION PLANS Individual Unit Opt-ins § 96.85 NOX Budget opt-in permit contents. (a) Each NOX Budget opt-in permit...
40 CFR 97.85 - NOX Budget opt-in permit contents.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false NOX Budget opt-in permit contents. 97... (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Individual Unit Opt-ins. § 97.85 NOX Budget opt-in permit contents. (a) Each NOX Budget opt-in permit will contain all elements...
Anatolij Svidzynskyj's 85th birthday
Directory of Open Access Journals (Sweden)
Editorial Board
2014-06-01
Full Text Available This year a prominent Ukrainian theoretical physicist and public leader Anatolij Svidzynskyj marks his 85th birthday. Anatolij Svidzynskyj was born on 1 March 1929 in Mohyliv-Podilskyy (Ukraine to a family of a physics teacher and an economist. Since 1939 and to the end of WWII Svidzynskyj's family lived in Kiev. In 1945 they moved to Lviv, where A. Svidzynskyj graduated from the Faculty of Physics and Mathematics of the Lviv State University. Vasyl Milyanchuk was his first supervisor. Due to his advice A. Svidzynskyj moved to Moscow State University where Mykola Boholiubov worked at the time. Under Bogoliubov's supervision the PhD thesis ``On the method of functional averaging in the theory of Green's function'' was written, which was defended in 1956 at Lviv State University. One of the most important results obtained in the thesis is an exact solution of Bloch-Nordsieck model that describes an infrared asymptotic of the electron Green's function in a realistic theory - quantum electrodynamics. In this way, a non-analytical dependence of this function on a coupling constant was obtained, and the nature of infrared divergences in quantum electrodynamics was clarified.
41 CFR 102-85.160 - How does a customer agency know how much to budget for Rent?
2010-07-01
... PROPERTY 85-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Rent Charges § 102-85.160 How does a customer agency... pricing due to changes in scope of proposed projects or repair and/or replacement of building components ...
Hydrogen absorption kinetics and structural properties of Mg85Ni10Ca5 and Mg90Ni10
International Nuclear Information System (INIS)
Aoki, Masakazu; Saito, Katsushi; Towata, Shin-ichi
2005-01-01
Mg 85 Ni 10 Ca 5 and Mg 90 Ni 10 were prepared by melting mixtures of the elements in mild steel crucibles and pouring them into copper molds. Hydrogen absorption kinetics and structural properties of the alloys were characterized by the volumetric method using a Sievert's apparatus, X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The crystallite size of Mg in Mg 85 Ni 10 Ca 5 , which is evaluated by XRD peak broadening, is about 50% smaller than that in Mg 90 Ni 10 . In addition, the nanometer-scale structure composed of Mg, Mg 2 Ni, Mg 2 Ca was observed in Mg 85 Ni 10 Ca 5 . Mg 85 Ni 10 Ca 5 shows better hydrogen absorption kinetics than Mg 90 Ni 10 in the temperature range of room temperature to 573 K. The better absorption kinetics of Mg 85 Ni 10 Ca 5 is mainly attributed to the nanometer-scale structure
Zou, Hua; Zhu, Xiaoqin; Hu, Yifeng; Sui, Yongxing; Sun, Yuemei; Zhang, Jianhao; Zheng, Long; Song, Zhitang
2016-12-01
In general, there is a trade off between the phase change speed and thermal stability in chalcogenide phase change materials, which leads to sacrifice the one in order to ensure the other. For improving the performance, doping is a widely applied technological process. Here, we fabricated Er doped Sn15Sb85 thin films by magnetron sputtering. Compared with the pure Sn15Sb85, we show that Er doped Sn15Sb85 thin films exhibit simultaneous improvement over the thermal stability and the phase change speed. Thus, our results suggest that Er doping provides the opportunity to solve the contradiction. The main reason for improvement of both thermal stability and crystallization speed is due to the existence of Er-Sb and Er-Sn bonds in Er doped Sn15Sb85 films. Hence, Er doped Sn15Sb85 thin films are promising candidates for the phase change memory application, and this method could be extended to other lanthanide-doped phase change materials.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false New York Harbor, adjacent to the Stapleton Naval Station, Staten Island, New York; restricted area. 334.85 Section 334.85 Navigation and... RESTRICTED AREA REGULATIONS § 334.85 New York Harbor, adjacent to the Stapleton Naval Station, Staten Island...
Directory of Open Access Journals (Sweden)
Jakubowska D.
2016-06-01
Full Text Available The aim of the present paper was to investigate microstructure and texture evolution of two single crystals and polycrystal of Cu-8.5%at.Al material. All of mentioned samples were deformed by HE to achieve true strain ε = 1.17. For microstructure analyzes observations by transmission electron microscope (STEM were done. Crystalline size for samples after SPD were determine using XRD method. The global texture measurements were done using Bruker D8 Discover diffractometer equipped in Cr radiation. Microstructure investigations revealed nanocrystalline structure in single crystals with initial orientations and and polycrystalline Cu-8.5%at.Al material after SPD. The global texture measurements have shown the stability of initial orientation of Cu-8.5%at.Al single crystal after HE, whereas the same SPD process strongly brakes up the orientation Cu-8.5%at. Al single crystal.
Energy Technology Data Exchange (ETDEWEB)
Heras, M C; Perez, M M; Grau, A
1983-07-01
The method used in the Laboratory of the JEN for the determination of Kr-85 levels in gaseous effluents of nuclear power and in the atmosphere is described. Samples of air, collected in metallic cylinders, are introduced into a gas-solid chromatographic separation system which resolves Kr from the other air components. The separated Kr ia dissolved in a toluene based scintillation cocktail, and the Kr-85 content is determined by liquid scintillation counting. (Author)
Directory of Open Access Journals (Sweden)
S. Sugiharto
2014-08-01
Full Text Available Measurement of vapor flow in geothermal pipe faces great challenges due to fast fluids flow in high-temperature and high-pressure environment. In present study the flow rate measurement has been performed to characterization the geothermal vapor flow in a pipe. The experiment was carried out in a pipe which is connected to a geothermal production well, KMJ-14. The pipe has a 10” outside diameter and contains dry vapor at a pressure of 8 kg/cm2 and a temperature of 170 oC. Krypton-85 gas isotope (85Kr has been injected into the pipe. Three collimated radiation detectors positioned respectively at 127, 177 and 227m from injection point were used to obtain experimental data which represent radiotracer residence time distribution (RTD in the pipe. The last detector at the position of 227 m did not respond, which might be due to problems in cable connections. Flow properties calculated using mean residence time (MRT shows that the flow rate of the vapor in pipe is 10.98 m/s, much faster than fluid flow commonly found in various industrial process plants. Best fitting evaluated using dedicated software developed by IAEA expert obtained the Péclet number Pe as 223. This means that the flow of vapor of geothermal fluids in pipe is plug flow in character. The molecular diffusion coefficient is 0.45 m2/s, calculated from the axial dispersion model.
Directory of Open Access Journals (Sweden)
Zhengzhong Xu
2017-06-01
Full Text Available The Ag85 complex functions as the main secretory protein of Mycobacterium tuberculosis (M. tuberculosis and BCG. This complex is composed of the proteins, Ag85A, Ag85B, and Ag85C, with Ag85A thought to play the largest role within the complex. However, the lack of commercially available monoclonal antibodies (mAbs against Ag85A still hinders the biological and applicative research on this protein. In this study, we developed and identified anti-Ag85A mAbs, and five hybridoma cells were established. Using the indirect immunofluorescence test, we found that two anti-Ag85A mAbs did not cross-react with Ag85B and/or Ag85C. In addition, we showed that all of the mAbs tested in this study are able to react with endogenous Ag85A protein in BCG and rBCG:Ag85A using indirect ELISA and Western blot analyses. A competitive ELISA (cELISA based on mAb 3B8 was developed, the analyses of clinic serum samples from cattle with bovine tuberculosis (TB and healthy cattle demonstrated that the sensitivity of the cELISA was 54.2% (26/48 and the specificity was 83.5% (167/200. This study demonstrated that the mAbs against Ag85A will provide useful reagents for further investigation into the function of the Ag85 complex and can be used for serodiagnosis of bovine TB.
National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0100075 includes chemical, meteorological, physical and time series data collected from MOORING STRATUS_85W_20S in the South Pacific Ocean from...
Si0.85Ge0.15 oxynitridation in nitric oxide/nitrous oxide ambient
International Nuclear Information System (INIS)
Dasgupta, Anindya; Takoudis, Christos G.; Lei Yuanyuan; Browning, Nigel D.
2003-01-01
Low temperature, nitric oxide (NO)/nitrous oxide (N 2 O) aided, sub-35 Aa Si 0.85 Ge 0.15 oxynitrides have been grown at 550 and 650 deg. C, while the oxynitridation feed gases have been preheated to 900 and 1000 deg. C, respectively, before entering the reaction zone. X-ray photoelectron spectroscopy and secondary ion mass spectroscopy (SIMS) data suggest that NO-assisted oxynitridation incorporates more nitrogen than the N 2 O-assisted one, while there is minimal Ge segregation towards the dielectric/substrate interface in both oxynitridation processes. Moreover, SIMS results suggest that nitrogen is distributed throughout the film in contrast to high temperature Si oxynitridation, where nitrogen incorporation takes place near the dielectric/substrate interface. Z-contrast imaging with scanning transmission electron microscopy shows that the oxynitride grown in NO at 650 degree sign C has a sharp interface with the bulk Si 0.85 Ge 0.15 , while the roughness of the dielectric/Si 0.85 Ge 0.15 substrate interface is less than 2 Aa. These results are discussed in the context of an overall mechanism of SiGe oxynitridation
Li, Yang; Fu, Jiayuan; Cui, Shuai; Meng, Fanfeng; Cui, Zhizhong; Fan, Jianhua; Chang, Shuang; Zhao, Peng
2017-05-01
To compare the genetic diversity and quasispecies evolution of avian leukosis virus (ALV) among different individuals, 5 chickens, raised in Shandong Provice of China, were randomly selected from a local chicken flock associated with serious tumor cases. Blood samples were collected and inoculated into chicken embryo fibroblast and DF-1 cell lines for virus isolation and identification, respectively, of Marek's disease virus (MDV), reticuloendotheliosis virus (REV), and ALV. Five strains of ALV subgroup J (ALV-J) were identified, and the gp85 gene from each strain was amplified and cloned. For each strain, about 20 positive clones of gp85 gene were selected for sequence analyses and the variability of the quasispecies of the 5 strains was compared. The results showed that the nuclear acid length of gp85 gene of 5 ALV-J isolates is 921 bp, 921 bp, 924 bp, 918 bp, and 912 bp respectively, and amino acid homologies of different gp85 clones from the 5 ALV-J strains were 99.3 to 100%, 99.3 to 100%, 99.4 to 100%, 98.4 to 100%, 99.0 to 100%, respectively. The proportions of dominant quasispecies were 65.0%, 85.0%, 85.0%, 50.0%, 84.2%, respectively, and homology of the gp85 among these dominant quasispecies was 89.2 to 92.5%. These data demonstrated the composition of the ALV-J quasispecies varied among infected individuals even within the same flock, and the dominant quasispecies continued to evolve both for their proportion and gene mutation. © 2016 Poultry Science Association Inc.
A T8.5 BROWN DWARF MEMBER OF THE ξ URSAE MAJORIS SYSTEM
International Nuclear Information System (INIS)
Wright, Edward L.; Mace, Gregory; McLean, Ian S.; Skrutskie, M. F.; Nelson, M. J.; Borish, H. J.; Kirkpatrick, J. Davy; Gelino, Christopher R.; Griffith, Roger L.; Jarrett, Tom; Marsh, Kenneth A.; Mainzer, Amanda K.; Eisenhardt, Peter R.; Tobin, John J.; Cushing, Michael C.
2013-01-01
The Wide-field Infrared Survey Explorer has revealed a T8.5 brown dwarf (WISE J111838.70+312537.9) that exhibits common proper motion with a solar-neighborhood (8 pc) quadruple star system—ξ Ursae Majoris. The angular separation is 8.'5, and the projected physical separation is ≈4000 AU. The sub-solar metallicity and low chromospheric activity of ξ UMa A argue that the system has an age of at least 2 Gyr. The infrared luminosity and color of the brown dwarf suggests the mass of this companion ranges between 14 and 38 M J for system ages of 2 and 8 Gyr, respectively.
International Nuclear Information System (INIS)
Kahlert, H.; Boysen, H.; Frey, F.
1998-01-01
In situ neutron powder investigations of cubic stabilized zirconia [Zr 0.85 Ca 0.15 O 1.85 (CSZ15)] sinter material were performed at room temperature without an applied direct-current electric field and at 1100 K with and without an applied field, i.e. lasting ionic current. Experimental conditions (temperature, oxidizing atmosphere etc.) were chosen as close as possible to 'working conditions' of zirconia oxygen sensoric devices. To learn about field-induced structural changes and most probable ionic pathways, atomic displacement parameters were derived in the frame of a non-Gaussian Debye-Waller factor formalism for the oxygens. Probability-density-function maps and pseudo-potential (V eff ) maps indicate curved diffusion pathways of the oxygens close to the left angle 100 right angle directions. The action of the applied field is to lower the effective potential barriers. (orig.)
Development of the dyed-track method for Kodak CN-85 detector
International Nuclear Information System (INIS)
Somogyi, G.; Toth-Szilagyi, M.; Varga, Z.; Monnin, M.; Lferde, M.
1984-01-01
The dyed-track method has been successfully developed for cellulose derivatives. The track parameters (width, colouration deepness, contrast, registration sensitivity), however, proved to be very dependent on the detector material and on the track processing conditions. In our previous works optimum conditions were presented mostly for cellulose acetate sheets. In the present work we have studied the influence of track processing parameters on the dyed-track formation in Kodak cellulose nitrate detector called CN-85. It is found that in this material optimum dyed-tracks can be produced with using no swelling but with a thermal annealing at 100 deg C for 1 hour after particle irradiation. For sensitization a treatment with 15% HCl at 22 deg C for 20 hours and for dyeing 0.3 wt% Rhodamine-B at 100 deg C for 1 hour proved to be the best. For better understanding the track dyeing phenomenon we have studied the colouration behaviour of electron-irradiated CN-85 detectors. (author)
Development of the dyed-track method for Kodak CN-85 detector
Energy Technology Data Exchange (ETDEWEB)
Somogyi, G.; Toth-Szilagyi, M.; Varga, Z. (Magyar Tudomanyos Akademia, Debrecen. Atommag Kutato Intezete); Monnin, M.; Lferde, M. (Clermont-Ferrand-2 Univ., 63 - Aubiere (France). Lab. de Physique Corpusculaire)
1984-01-01
The dyed-track method has been successfully developed for cellulose derivatives. The track parameters (width, colouration deepness, contrast, registration sensitivity), however, proved to be very dependent on the detector material and on the track processing conditions. In our previous works optimum conditions were presented mostly for cellulose acetate sheets. In the present work we have studied the influence of track processing parameters on the dyed-track formation in Kodak cellulose nitrate detector called CN-85. It is found that in this material optimum dyed-tracks can be produced with using no swelling but with a thermal annealing at 100 deg C for 1 hour after particle irradiation. For sensitization a treatment with 15% HCl at 22 deg C for 20 hours and for dyeing 0.3 wt% Rhodamine-B at 100 deg C for 1 hour proved to be the best. For better understanding the track dyeing phenomenon we have studied the colouration behaviour of electron-irradiated CN-85 detectors.
Demirci, Selami; Doğan, Ayşegül; Türkmen, Neşe Başak; Telci, Dilek; Rizvanov, Albert A; Şahin, Fikrettin
2017-02-01
Prostate cancer is a multistep and complicated cancer type that is regulated by androgens at the cellular level and remains the second commonest cause of death among men. Discovery and development of novel chemotherapeutic agents enabling rapid tumor cell death with minimal toxic effects to healthy tissues might greatly improve the safety of chemotherapy. The present study evaluates the anti-cancer activity of a novel heterodinuclear copper(II)Mn(II) complex (Schiff base) in combination with poly(ethylene oxide) and poly(propylene oxide) block copolymer (Pluronic) P85. We used assays for cell proliferation, apoptosis, cell migration and invasion, DNA binding and cleavage to elucidate the molecular mechanisms of action, in addition to the anti-inflammatory potency of the new combination. The combined treatment of Schiff base and P85 lead to a remarkable anti-cancer effect on prostate cancer cell lines. Cell proliferation was inhibited in Schiff base-P85 treatment. The activity of this formulation is on DNA binding and cleavage and prevents inflammation in in vitro conditions. This is the first study presenting the anti-cancer activity of the present Schiff base derivative and its combination with P85 to treat prostate cancer in vitro. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
H. Sun
2014-09-01
Full Text Available An in vitro experiment was conducted to evaluate the effects of Aspergillus oryzae culture (AOC and 2-hydroxy-4-(methylthio-butanoic acid (HMB on rumen fermentation and microbial populations between different roughage sources. Two roughage sources (Chinese wild rye [CWR] vs corn silage [CS] were assigned in a 2×3 factorial arrangement with HMB (0 or 15 mg and AOC (0, 3, or 6 mg. Gas production (GP, microbial protein (MCP and total volatile fatty acid (VFA were increased in response to addition of HMB and AOC (p<0.01 for the two roughages. The HMB and AOC showed inconsistent effects on ammonia-N with different substrates. For CWR, neither HMB nor AOC had significant effect on molar proportion of individual VFA. For CS, acetate was increased (p = 0.02 and butyrate was decreased (p<0.01 by adding HMB and AOC. Increase of propionate was only occurred with AOC (p<0.01. Populations of protozoa (p≤0.03 and fungi (p≤0.02 of CWR were differently influenced by HMB and AOC. Percentages of F. succinogenes, R. albus, and R. flavefaciens (p<0.01 increased when AOC was added to CWR. For CS, HMB decreased the protozoa population (p = 0.01 and increased the populations of F. succinogenes and R. albus (p≤0.03. Populations of fungi, F. succinogenes (p = 0.02 and R. flavefacien (p = 0.03 were increased by adding AOC. The HMB×AOC interactions were noted in MCP, fungi and R. flavefacien for CWR and GP, ammonia-N, MCP, total VFA, propionate, acetate/propionate (A/P and R. albus for CS. It is inferred that addition of HMB and AOC could influence rumen fermentation of forages by increasing the number of rumen microbes.
Sun, H; Wu, Y M; Wang, Y M; Liu, J X; Myung, K H
2014-09-01
An in vitro experiment was conducted to evaluate the effects of Aspergillus oryzae culture (AOC) and 2-hydroxy-4-(methylthio)-butanoic acid (HMB) on rumen fermentation and microbial populations between different roughage sources. Two roughage sources (Chinese wild rye [CWR] vs corn silage [CS]) were assigned in a 2×3 factorial arrangement with HMB (0 or 15 mg) and AOC (0, 3, or 6 mg). Gas production (GP), microbial protein (MCP) and total volatile fatty acid (VFA) were increased in response to addition of HMB and AOC (p<0.01) for the two roughages. The HMB and AOC showed inconsistent effects on ammonia-N with different substrates. For CWR, neither HMB nor AOC had significant effect on molar proportion of individual VFA. For CS, acetate was increased (p = 0.02) and butyrate was decreased (p<0.01) by adding HMB and AOC. Increase of propionate was only occurred with AOC (p<0.01). Populations of protozoa (p≤0.03) and fungi (p≤0.02) of CWR were differently influenced by HMB and AOC. Percentages of F. succinogenes, R. albus, and R. flavefaciens (p<0.01) increased when AOC was added to CWR. For CS, HMB decreased the protozoa population (p = 0.01) and increased the populations of F. succinogenes and R. albus (p≤0.03). Populations of fungi, F. succinogenes (p = 0.02) and R. flavefacien (p = 0.03) were increased by adding AOC. The HMB×AOC interactions were noted in MCP, fungi and R. flavefacien for CWR and GP, ammonia-N, MCP, total VFA, propionate, acetate/propionate (A/P) and R. albus for CS. It is inferred that addition of HMB and AOC could influence rumen fermentation of forages by increasing the number of rumen microbes.
International Nuclear Information System (INIS)
Li Guangzuo
1989-01-01
Using a simplified method, the concentrations of 85 Kr leaking into the air of a workshop and its surroundings, where a neon lamp production line was to be installed, were calculated. The doses to the workers and inhabitants nearby were also estimated. Thus, the evaluation of 85 Kr enviromental contamination caused by imported equipments was made feasible
Martensitic phase transitions in Co-0.85 at % Fe
International Nuclear Information System (INIS)
Prem, M.
1997-12-01
Co-0.85at%Fe shows the two martensitic phase transitions hcp-dhcp and dhcp-fcc. The lattice dynamics of Co-0.85at%Fe was investigated by the means of inelastic neutron scattering at a series of temperatures up to 750K in order to understand the two martensitic phase transitions of this system. In all of the measured phonon branches anomalies were neither found near the hcp-dhcp phase transition nor going through the dhcp-fcc transition. Lattice-parameter scans were performed through the whole temperature range. Diffuse neutron scattering revealed a lattice parameter shift between the dhcp and fcc phase of ∼0.4 % measured at the same temperature. This was possible because the system shows a wide temperature hysteresis at the two phase transitions. In the temperature region of coexistence of dhcp and fcc phase diffuse satellites arose near the (111)fcc Bragg peak (which is equivalent to the (00.2)dhcp peak). Their intensity varied in accordance to the volume fraction of the phases but vanished on changing wavelength. The elastic measurements were performed at the Austrian triple axis spectrometer VALSE located at the Laboratoire Leon Brillouin (LLB) in Saclay (F); the inelastic measurements were performed at the spectrometers IN3 and INS of the Institute Laue Langevin (ILL) in Grenoble (F). (author)
Dating of the 85 degrees E Ridge (northeastern Indian Ocean) using marine magnetic anomalies
Digital Repository Service at National Institute of Oceanography (India)
Michael, L.; Krishna, K.S.
underneath the eastern Con- rad Rise on the Antarctic plate. Subsequent geophysical RESEARCH ARTICLES CURRENT SCIENCE, VOL. 100, NO. 9, 10 MAY 2011 1315 studies 5,8 opined that short-lived volcanic activity had ini- tiated the 85°E Ridge in Mahanadi.... Satellite-derived free-air gravity anomaly map of the north- eastern Indian Ocean 24 . Curved strip line indicates continuity of the 85°E Ridge from the Mahanadi Basin to ANS. Few bathymetry con- tours derived from ETOPO5 data are shown in the map. N...
Evaluation and application of alumina-based Rb-82 generators charged with high levels of Sr-82/85
International Nuclear Information System (INIS)
Yano, Y.; Budinger, T.F.; Chiang, G.; O'Brien, H.A.; Grant, P.M.
1979-01-01
Generator-produced Rb-82, a 75-sec positron emitter with potential for myocardial blood-flow imaging, was studied with various ion-exchange columns to evaluate the characteristics of alumina as an adsorber for the 25-day Sr-82 parent. Test columns of alumina, Bio Rex 70, and Chelex 100 were loaded with multimillicurie amounts of no-carrier-added Sr-82/Sr-85 (Sr-85 is a production contaminant). The breakthrough of Sr-82/Sr-85, and the yield of Rb-82, were determined for long-term elutions from each column with up to 4 liter of 2% NaCl solution at pH 8 to 9. The breakthrough of Sr-82/85 was 10 -6 to 10 -5 from alumina and 10 -6 to 10 -4 from Chelex 100 and Bio Rex 70. The effects of eluent flow rate and concentration, and of alumina volume, on the breakthrough and yield were also studied. An improved and automated Rb-82 generator was used for myocardial and brain blood-flow studies in experimental animals and in man; it was equipped with solenoid flow-control valves and five in. of lead shielding for the alumina columns, which were charged with 25 to 50 mCi Sr-82 (100 to 150 mCi Sr-85). The Rb-82 generator with alumina column provided up to 20 to 40 mCi of Rb-82 as often as every 5 to 10 min with -5 breakthrough of Sr-82/85 over the 2- to 3-mo, useful life of the generator
International Nuclear Information System (INIS)
Heras Iniquez, M.C.; Perez Garcia, M.M.; Grau Malonda, A.
1983-01-01
The method used in the Laboratory of the JEN for the determination of Kr-85 levels in gaseous effluents of nuclear power and in the atmosphere is described. Samples of air, collected in metallic cylinders, are introduced into a gas-solid chromatographic separation system which resolves Kr from the other air components. The separated Kr ia dissolved in a toluene based scintillation cocktail, and the Kr-85 content is determined by liquid scintillation counting. (Author)