WorldWideScience

Sample records for facilitated communication fc

  1. Evaluation of the Facilitated Communication Pilot

    Science.gov (United States)

    Cooper-Martin, Elizabeth

    2014-01-01

    The Office of Special Education and Student Services asked the Office of Shared Accountability to evaluate the "Facilitated Communication Pilot." In facilitated communication (FC), people with communication impairments express themselves by typing with the aid of a communication partner, called a facilitator, who provides physical (and…

  2. Facilitating leadership team communication

    OpenAIRE

    Hedman, Eerika

    2015-01-01

    The purpose of this study is to understand and describe how to facilitate competent communication in leadership teamwork. Grounded in the premises of social constructionism and informed by such theoretical frameworks as coordinated management of meaning theory (CMM), dialogic organization development (OD), systemic-constructionist leadership, communication competence, and reflexivity, this study seeks to produce further insights into understanding leadership team communicati...

  3. Facilitated Communication in Mainstream Schools.

    Science.gov (United States)

    Remington-Gurney, Jane; Crossley, Rosemary

    Facilitated communication is described as a method of training communication partners or facilitators to provide physical assistance to communication aid users, to help them overcome physical and emotional problems in using their aids. In Melbourne (Victoria, Australia), the DEAL (Dignity, Education and Language) Centre has identified 96 people…

  4. Fcγ receptor IIb strongly regulates Fcγ receptor-facilitated T cell activation by dendritic cells

    NARCIS (Netherlands)

    N. van Montfoort (Nadine); P.A.C. 't Hoen (Peter); S.M. Mangsbo (Sara); M. Camps (Marcel); P. Boross (Peter); C.J.M. Melief (Cornelis); F. Ossendorp (Ferry); J.S. Verbeek (Sjef)

    2012-01-01

    textabstractFcγR ligation by Ag-Ab immune complexes (IC) not only mediates effective Ag uptake, but also strongly initiates dendritic cell (DC) maturation, a requirement for effective T cell activation. Besides the activating FcγRI, FcγRIII, and FcγRIV, the inhibitory FcγRIIb is expressed on DCs. It

  5. The Impact of Facilitated Communication on the Educational Lives of Students with Autism Spectrum Disorders: Four Case Studies

    Science.gov (United States)

    Knox, Michael

    2013-01-01

    This action qualitative study with a case research design investigated the impact of facilitated communication (FC) on the educational lives of high school students with autism spectrum disorders (ASD). The effect of FC on nonverbal students and schools' reactions to FC were also examined. The results from the four case studies indicate that FC…

  6. The Role of Touch in Facilitated Communication.

    Science.gov (United States)

    Kezuka, Emiko

    1997-01-01

    A study investigated the role of touch in the use of facilitated communication with Japanese individuals with autism. Five experiments were conducted involving a "telepathy game" using a rod with an attached strain gauge. Results found the facilitator's contact controlled the motor responses of the subjects. (Author/CR)

  7. Live online communication facilitating collaborative learning

    DEFF Research Database (Denmark)

    Kjær, Christopher

    2010-01-01

    , new applications and devices are simply making blended learning eaiser than before and therefore support a strongere focus on the learning activities Most web conference systems provide presentation functions enabling users to show slides, share files and engage in oral and visual communication...... a multitude of activities. It is, however, tempting for teachers to simply transfer the well known models and practices of the physical class room to the virtual environment thus maintaining traditional lectures and individual, written assignments as teaching activities. This leaves the teacher in control...... becomes an exchange of information between teacher and student in a formal class room. This presentation stresses that the use of web conference systems for teaching must be based on a didactic model that views learning as an active and social process thus expanding the learning context and opportunities...

  8. Facilitating a generic communication interface to distributed energy resources

    DEFF Research Database (Denmark)

    Pedersen, Anders Bro; Hauksson, Einar Bragi; Andersen, Peter Bach

    2010-01-01

    As the power system evolves into a smarter and more flexible state, so must the communication technologies that support it. A key requirement for facilitating the distributed production of future grids is that communication and information are standardized to ensure interoperability. The IEC 61850...... standard, which was originally aimed at substation automation, has been expanded to cover the monitoring and control of Distributed Energy Resources (DERs). By having a consistent and well-defined data model the standard enables a DER aggregator, such as a Virtual Power Plant (VPP), in communicating...... with a broad array of DERs. If the data model of IEC 61850 is combined with a set of contemporary web protocols, it can result in a major shift in how DERs can be accessed and coordinated. This paper describes how IEC 61850 can benefit from the REpresentational State Transfer (REST) service concept and how...

  9. Facilitating interaction, communication and collaboration in online courses

    Science.gov (United States)

    McNeil, Sara G.; Robin, Bernard R.; Miller, Robert M.

    2000-07-01

    As the Internet evolves into a truly world wide communications medium, the roles of faculty and students at institutions of higher learning are changing. Traditional face-to-face classes are being converted to an online setting, where materials from syllabi to lectures to assignments are available at the click of a mouse. New technological options are challenging and changing the very nature of teaching as faculty migrate from being deliverers of information to facilitators and mentors. Students are also undergoing a transformation from passive recipients to participants in an active learning environment. Interactions are at the heart of this revolution as students and faculty create new methodologies for the online classroom. New types of interactions are emerging between faculty and students, between students and other students and between students and the educational resources they are exploring. As the online teaching and learning environment expands and matures, new social and instructional interactions are replacing the traditional occurrences in face-to-face classrooms. New communication options are also evolving as a critical component of the online classroom. The shift from a synchronous to an asynchronous communication structure has also had a significant impact on the way students and faculty interact. The use of e-mail, listservs and web-based conferencing has given teachers and learners new flexibility and has fostered a climate where learning takes place wherever and whenever it is convenient. HyperGroups, a communication tool that was developed at the University of Houston, allows students and faculty to seamlessly participate in course-related discussions and easily share multimedia resources. This article explores the many issues associated with facilitating interaction, communication and collaboration in online courses.

  10. Facilitating tolerance of delayed reinforcement during functional communication training.

    Science.gov (United States)

    Fisher, W W; Thompson, R H; Hagopian, L P; Bowman, L G; Krug, A

    2000-01-01

    Few clinical investigations have addressed the problem of delayed reinforcement. In this investigation, three individuals whose destructive behavior was maintained by positive reinforcement were treated using functional communication training (FCT) with extinction (EXT). Next, procedures used in the basic literature on delayed reinforcement and self-control (reinforcer delay fading, punishment of impulsive responding, and provision of an alternative activity during reinforcer delay) were used to teach participants to tolerate delayed reinforcement. With the first case, reinforcer delay fading alone was effective at maintaining low rates of destructive behavior while introducing delayed reinforcement. In the second case, the addition of a punishment component reduced destructive behavior to near-zero levels and facilitated reinforcer delay fading. With the third case, reinforcer delay fading was associated with increases in masturbation and head rolling, but prompting and praising the individual for completing work during the delay interval reduced all problem behaviors and facilitated reinforcer delay fading.

  11. Knowledge base navigator facilitating regional analysis inter-tool communication.

    Energy Technology Data Exchange (ETDEWEB)

    Hampton, Jeffery Wade; Chael, Eric Paul; Hart, Darren M.; Merchant, Bion John; Chown, Matthew N.

    2004-08-01

    To make use of some portions of the National Nuclear Security Administration (NNSA) Knowledge Base (KB) for which no current operational monitoring applications were available, Sandia National Laboratories have developed a set of prototype regional analysis tools (MatSeis, EventID Tool, CodaMag Tool, PhaseMatch Tool, Dendro Tool, Infra Tool, etc.), and we continue to maintain and improve these. Individually, these tools have proven effective in addressing specific monitoring tasks, but collectively their number and variety tend to overwhelm KB users, so we developed another application - the KB Navigator - to launch the tools and facilitate their use for real monitoring tasks. The KB Navigator is a flexible, extensible java application that includes a browser for KB data content, as well as support to launch any of the regional analysis tools. In this paper, we will discuss the latest versions of KB Navigator and the regional analysis tools, with special emphasis on the new overarching inter-tool communication methodology that we have developed to make the KB Navigator and the tools function together seamlessly. We use a peer-to-peer communication model, which allows any tool to communicate with any other. The messages themselves are passed as serialized XML, and the conversion from Java to XML (and vice versa) is done using Java Architecture for XML Binding (JAXB).

  12. La comunicación digital del FC Barcelona y del Real Madrid CF y su percepción por los periodistas deportivos / Digital communication of FC Barcelona and Real Madrid CF and its perception by sports journalists

    Directory of Open Access Journals (Sweden)

    Fernando Olabe Sánchez

    2012-12-01

    Full Text Available ResumenEl FC Barcelona y el Real Madrid CF han cambiado su modelo de gestión comunicativa, especialmente en su relación con los medios de comunicación. Favorecidos por la implantación de las TIC, los departamentos de Comunicación de estas entidades se constituyen en gatekeeper al controlar y emitir, a través de sus propios medios de comunicación, como las televisiones y radios propias y los soportes online, las informaciones que ellos mismos generan. De este modo, controlan los mensajes y los emiten directamente a sus públicos objetivos sin la intermediación de los medios convencionales, condicionando las rutinas productivas de los periodistas deportivos.El objetivo de este trabajo es mostrar la percepción que estos profesionales tienen sobre las diferentes herramientas y soportes online que los departamentos de Comunicación de estos clubes emplean en su actividad diaria con los medios.AbstractThe FC Barcelona and Real Madrid CF have changed their communicative management model, especially in its relationship with the media. Favored by the introduction of ICT, Communication departments of these entities constitute gatekeeper to control and issue, through their own media, such as television and radio stations and media own online, the information that they generate. Thus, controlling broadcast messages and their target audiences directly without the intermediation of the mainstream media, conditioning routines productive sports journalists.The aim of this paper is to show the perception that these professionals have about the different tools and online media Communication departments to use these clubs in their daily activities with the media.

  13. Perceived barriers and facilitators for general practitioner-patient communication in palliative care: a systematic review

    NARCIS (Netherlands)

    Slort, W.; Schweitzer, B.P.M.; Blankenstein, A.H.; Abarshi, E.A.; Riphagen, I.I.; Echteld, M.A.; Aaronson, N.K.; van der Horst, H.E.; Deliens, L.

    2011-01-01

    While effective general practitioner (GP)-patient communication is required for the provision of good palliative care, barriers and facilitators for this communication are largely unknown. We aimed to identify barriers and facilitators for GP-patient communication in palliative care. In a systematic

  14. Nursing the patient with complex communication needs: time as a barrier and a facilitator to successful communication in hospital.

    Science.gov (United States)

    Hemsley, Bronwyn; Balandin, Susan; Worrall, Linda

    2012-01-01

    Effective nurse-patient communication is an essential aspect of health care. Time to communicate, however, is limited and subject to workload demands. Little is known about how nurses manage this 'lack of time' when caring for patients with developmental disability and complex communication needs, who typically communicate at a slow rate. The aim of this study was to investigate nurses' expressed concepts of 'time' in stories about communicating with patients with developmental disability and complex communication needs in hospital. In 2009, 15 hospital nurses from a range of wards in two metropolitan hospitals participated in interviews about barriers to and strategies for successful communication with patients with developmental disability and complex communication needs in hospital. The data were analysed using narrative inquiry methodology and the stories verified with the participants. Nurses identified 'time' as a barrier and a facilitator to successful communication. Time as a barrier was related thematically to avoiding direct communication and preferring that family or paid carers communicated on behalf of the patient. Time as a facilitator was related to valuing communication, investing extra time, and to applying a range of adaptive communication strategies to establish successful communication. Time is perceived by nurses as both an enemy and friend for improving communication. Nurses who perceive that communication takes too long may avoid communication and miss opportunities to improve communication through increased familiarity with the person's communication methods. Those who take time to communicate narrate applying a range of strategies to achieve success in basic needs communication. © 2011 Blackwell Publishing Ltd.

  15. Facilitating communication with patients for improved migraine outcomes.

    Science.gov (United States)

    Buse, Dawn C; Lipton, Richard B

    2008-06-01

    Effective communication is integral to good medical care. Medical professional groups, regulatory agencies, educators, researchers, and patients recognize its importance. Quality of medical communication is directly related to patient satisfaction, improvement in medication adherence, treatment compliance, other outcomes, decreased risk of malpractice, and increase in health care providers' levels of satisfaction. However, skill level and training remain problematic in this area. Fortunately, research has shown that medical communication skills can be successfully taught and acquired, and that improvement in communication skills improves outcomes. The American Migraine Communication Studies I and II evaluated the current state of health care provider-patient communication in headache care and tested a simple educational intervention. They found problematic issues but demonstrated that these areas could be improved. We review theoretical models of effective communication and discuss strategies for improving communication, including active listening, interviewing strategies, and methods for gathering information about headache-related impairment, mood, and quality of life.

  16. Millennials Need Training Too: Using Communication Technology to Facilitate Teamwork

    Science.gov (United States)

    Charsky, Dennis; Kish, Mary L.; Briskin, Jessica; Hathaway, Sarah; Walsh, Kira; Barajas, Nicolas

    2009-01-01

    Human Communication in Organizations (HCO) is an introductory college course at Ithaca College, typically taken in the freshman year, in which students from a wide variety of majors examine the basic concepts, issues, and uses of organizational communication including communication theory, superior-subordinate and peer relationships, leadership,…

  17. Millennials Need Training Too: Using Communication Technology to Facilitate Teamwork

    Science.gov (United States)

    Charsky, Dennis; Kish, Mary L.; Briskin, Jessica; Hathaway, Sarah; Walsh, Kira; Barajas, Nicolas

    2009-01-01

    Human Communication in Organizations (HCO) is an introductory college course at Ithaca College, typically taken in the freshman year, in which students from a wide variety of majors examine the basic concepts, issues, and uses of organizational communication including communication theory, superior-subordinate and peer relationships, leadership,…

  18. Facilitating Communication for Business. National Business Education Yearbook, No. 26.

    Science.gov (United States)

    Scott, James Calvert, Ed.

    This yearbook suggests that businesspersons need to enhance their communication skills and that business educators have opportunities to fulfill that need. The yearbook contains 15 chapters organized in 5 parts. Part I discusses the importance of communication skills in the business world and identifies aspects of communication that…

  19. mCell: Facilitating Mobile Communication of Small Groups

    Directory of Open Access Journals (Sweden)

    Jyri Virtanen

    2008-01-01

    Full Text Available Mobile communication technology offers a potential platform for new types of communication applications. Here, we describe the development and experiences with a mobile group communication application, mCell, that runs on a mobile phone. We present the underlying design implications, the application implementation, and a user study, where three groups used the application for one month. The findings of the user study reveal general user experiences with the application and show different patterns of usage depending on the social setting of the group and how the preferred features vary accordingly.

  20. Membrane filter method based on FC-5-bromo-4-chloro-3-indolyl-beta-D-glucuronide medium facilitates enumeration of Escherichia coli in foods and poultry carcass rinses.

    Science.gov (United States)

    Sharpe, A N; Parrington, L J

    1998-03-01

    Three enumeration methods for Escherichia coli in foods, the Health Protection Branch most-probable-number (MPN) method MFHPB-19, a hydrophobic grid membrane filter method MFHPB-26 (HGMF-indole), and a hydrophobic grid membrane filter method utilizing 5-bromo-4-chloro-3-indolyl-beta-D-glucuronide in a (modified) mFC agar (HGMF-FC-BCIG) were compared in 80 food samples that included naturally and artificially contaminated raw vegetables, mung bean and alfalfa sprouts, raw meats, and chicken carcass rinses. The number of samples confirmed as positive for E. coli were 44, 36, and 42 for the MPN, HGMF-indole, and HGMF-BCIG methods, respectively. By the MPN method, E. coli was detected in 3 samples at levels below the limits of detection of the HGMFs; but the MPN method was very time-consuming. With the HGMF-indole procedure E. coli was missed in 4 artificially contaminated samples. With the HGMF-FC-BCIG method E. coli was enumerated in 1 sample of bean sprouts missed by both the MPN and HGMF-indole procedures. High levels of indole-positive Klebsiella spp. in bean sprouts interfered with the HGMF-indole method, but the blue colonies of E. coli were easily observed in the HGMF-FC-BCIG method. Specificity of the HGMF-FC-BCIG method is high enough that routine confirmation should be unnecessary; however, confirmation of presumptive E. coli is easier since no lethal indole-staining step is involved. It appears to be a very simple method for quantifying E. coli in foods or carcass rinses.

  1. Facilitating Service Learning in the Online Technical Communication Classroom

    Science.gov (United States)

    Nielsen, Danielle

    2016-01-01

    Drawing from the author's experience teaching online technical communication courses with an embedded service-learning component, this essay opens the discussion to the potential problems involved in designing online service-learning courses and provides practical approaches to integrating service learning into online coursework. The essay…

  2. Facilitating Communicative Competence in Young Children: Techniques for Parents & Teachers.

    Science.gov (United States)

    Harmon, Geraldine

    A practicum was implemented by a licensed speech-language pathologist working in a clinical and instructional program in a predominantly black, inner-city community in northeastern Indiana. The practicum was designed to improve the communicative competence of young children in a kindergarten-first grade setting. It was implemented because…

  3. Facilitating Service Learning in the Online Technical Communication Classroom

    Science.gov (United States)

    Nielsen, Danielle

    2016-01-01

    Drawing from the author's experience teaching online technical communication courses with an embedded service-learning component, this essay opens the discussion to the potential problems involved in designing online service-learning courses and provides practical approaches to integrating service learning into online coursework. The essay…

  4. Facilitating Postdivorce Adjustment among Women: A Communication Skills Training Approach.

    Science.gov (United States)

    Thiessen, Jake D.; And Others

    1980-01-01

    Examined the effects of communication skills training on adjustment to divorce and separation among women. Results indicated that the experimental group significantly increased in overall divorce adjustment and in empathy skills. No significant differences were found in perceived social support or self-disclosure skill. (Author)

  5. Facilitating EFL Learners' Oral Communication through Effective Feedback

    Institute of Scientific and Technical Information of China (English)

    李俊芬

    2002-01-01

    Feedback is an indispensable component of teaching process.Research finding shows that one of the keys to successful language learning lies in the feedback learner receives from others.This paper proposed some solutions to feedback problems in oral communication of non-English majors.The author finds that feedback can work effectively only when learners willingly internalize teacher feedback after their affective filter.

  6. Three Perspectives of Facilitated Communication: Unexpected Literacy, Clever Hans, or Enigma?

    Science.gov (United States)

    Topics in Language Disorders, 1992

    1992-01-01

    The validity of facilitated communication's effects are viewed from three perspectives, labeled as the plausible perspective, which is unexpected literacy; the skeptical perspective, which claims that social-communicative variables unintentionally influence intervention outcomes; and the enigmatic perspective, which neither rejects outright the…

  7. Facilitation of risk communication during the anthrax attacks of 2001: the organizational backstory.

    Science.gov (United States)

    Chess, Caron; Clarke, Lee

    2007-09-01

    The anthrax attacks of 2001 created risk communication problems that cannot be fully understood without appreciating the dynamics among organizations. Case studies of communication in New Jersey, consisting of interviews with a range of participants, found that existing organizational and professional networks facilitated trust among decisionmakers. This interpersonal trust improved communication among agencies and thereby risk communication with the public. For example, "white powder scares" were a problem even in places without contamination. Professionals' trust in each other was vital for responding productively. Conversely, organizational challenges, including conflict among agencies, hindered communication with key audiences. Although centralization and increased control are often seen as the remedy for communicative confusion, they also can quash the improvisational responses needed during crises.

  8. Your word is my command: Oxytocin facilitates the understanding of appeal in verbal communication.

    Science.gov (United States)

    Pfundmair, Michaela; Lamprecht, Franziska; von Wedemeyer, Florentine M; Frey, Dieter

    2016-11-01

    The hormone oxytocin is known to facilitate positive communication behaviors. In the current study, we aimed to examine how it affects the interpretation of verbal information during communication. We predicted oxytocin to promote the understanding of the socially most effortful dimension of appeal. After intranasal administration of oxytocin or a placebo, participants responded to a "four-ear communication" questionnaire. Results revealed that participants under oxytocin not only chose the dimension of appeal as first choice significantly more often than participants under placebo but also preferred it over most of the other dimensions of interpretation. The findings add to our knowledge of oxytocin as a facilitator of social approach and indicate how oxytocin might work in communicative settings. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Biological nomenclature terms for facilitating communication in the naming of organisms

    Directory of Open Access Journals (Sweden)

    John David

    2012-05-01

    Full Text Available A set of terms recommended for use in facilitating communication in biological nomenclature is presented as a table showing broadly equivalent terms used in the traditional Codes of nomenclature. These terms are intended to help those engaged in naming across organism groups, and are the result of the work of the International Committee on Bionomenclature, whose aim is to promote harmonisation and communication amongst those naming life on Earth.

  10. A sequential analysis of procedural meeting communication: How teams facilitate their meetings

    NARCIS (Netherlands)

    Lehmann-Willenbrock, N.K.; Allen, J.A.; Kauffeld, S.

    2013-01-01

    How do teams facilitate their own meetings? Unmanaged (or free) social interaction often leads to poor decision-making, unnecessary conformity, social loafing, and ineffective communication processes, practices, and products. The purpose of this paper is to investigate the potential benefits of

  11. Person-Centered Planning: Strategies to Encourage Participation and Facilitate Communication

    Science.gov (United States)

    Wells, Jenny C.; Sheehey, Patricia H.

    2012-01-01

    Person-centered planning is a process that allows individuals, family members, and friends an opportunity to share information to develop a personal profile and a future vision for an individual. This article describes strategies and technology that teachers can use to promote parents' participation and facilitate communication while maintaining…

  12. A sequential analysis of procedural meeting communication: How teams facilitate their meetings

    NARCIS (Netherlands)

    Lehmann-Willenbrock, N.K.; Allen, J.A.; Kauffeld, S.

    2013-01-01

    How do teams facilitate their own meetings? Unmanaged (or free) social interaction often leads to poor decision-making, unnecessary conformity, social loafing, and ineffective communication processes, practices, and products. The purpose of this paper is to investigate the potential benefits of proc

  13. The use of extemporizing in music therapy to facilitate communication in a person with dementia

    DEFF Research Database (Denmark)

    Ridder, Hanne Mette Ochsner; Gummesen, Elisabeth

    2015-01-01

    A person who has dementia may also have aphasia and severe communicative disabilities with the risk of leading to social isolation. This study explored the music therapeutic process with a person with dementia and aphasia in order to understand how music therapy may facilitate communication...... and dialogue. In an explorative hermeneutic case study, new understandings to the music therapy process were added and led to the identification of the improvisation method known as extemporizing described by Tony Wigram. In a subsequent literature review extemporization was explored and is suggested...... as a valuable method for providing a safe ground for the person with dementia and hereby facilitating engagement in communicative dialogues and in this way meeting psychosocial needs....

  14. African-American Fathers' Perspectives on Facilitators and Barriers to Father-Son Sexual Health Communication.

    Science.gov (United States)

    Randolph, Schenita D; Coakley, Tanya; Shears, Jeffrey; Thorpe, Roland J

    2017-02-21

    African-American males ages 13 through 24 are disproportionately affected by sexually transmitted infections (STIs) and human immunodeficiency virus (HIV), accounting for over half of all HIV infections in this age group in the United States. Clear communication between African-American parents and their youth about sexual health is associated with higher rates of sexual abstinence, condom use, and intent to delay initiation of sexual intercourse. However, little is known about African-American fathers' perceptions of what facilitates and inhibits sexual health communication with their preadolescent and adolescent sons. We conducted focus groups with 29 African-American fathers of sons ages 10-15 to explore perceived facilitators and barriers for father-son communication about sexual health. Participants were recruited from barbershops in metropolitan and rural North Carolina communities highly affected by STIs and HIV, and data were analyzed using content analysis. Three factors facilitated father-son communication: (a) fathers' acceptance of their roles and responsibilities; (b) a positive father-son relationship; and (c) fathers' ability to speak directly to their sons about sex. We also identified three barriers: (a) fathers' difficulty in initiating sexual health discussions with their sons; (b) sons' developmental readiness for sexual health information; and (c) fathers' lack of experience in talking with their own fathers about sex. These findings have implications for father-focused prevention interventions aimed at reducing risky sexual behaviors in adolescent African-American males. © 2017 Wiley Periodicals, Inc.

  15. Facilitating climate change adaptation through communication: Insights from the development of a visualization tool

    DEFF Research Database (Denmark)

    Glaas, Erik; Ballantyne, Anne Gammelgaard; Neset, Tina

    2015-01-01

    Climate change communication on anticipated impacts and adaptive responses is frequently presented as an effective means to facilitate implementation of adaptation to mitigate risks to residential buildings. However, it requires that communication is developed in a way that resonates...... with the context of the target audience, provides intelligible information and addresses perceived barriers to adaptation. In this paper we reflect upon criteria for useful climate change communication gained over a three year development process of a web-based tool - VisAdaptTM – aimed at increasing the adaptive...... capacity among Nordic homeowners. Based on the results from continuous user-testing and focus group interviews we outline lessons learned and key aspects to consider in the design of tools for communicating complex issues such as climate change effects and adaptive response measures....

  16. Supporting Communication for Parents with Intellectual Impairments: Communication Facilitation in Social Work Led Parenting Meetings

    Science.gov (United States)

    Matthews, Alison; Stansfield, Jois

    2014-01-01

    People with intellectual impairments are recognised as having communication difficulties and even people with mild intellectual impairments can be challenged by complex language and limited literacy. The focus of this paper is parents who have learning disabilities, outlining a novel approach to support them in stressful case conference…

  17. Barriers and facilitating communication skills for breaking bad news: from the specialists’ practice perspective

    Directory of Open Access Journals (Sweden)

    Enna Catalina Payán

    2009-06-01

    Full Text Available Introduction: Breaking bad news is one of a physician’s most difficult duties. There are several studies related to the patient’s needs, but few reflect on the doctors’ experience.Materials and method: A descriptive, cross-sectional research was carried out to study issues related to the process of delivering bad news which might act as barriers and facilitating skills from the doctor’s point of view. These issues were identified through a self-administered survey.Results: Participant doctors use different strategies to communicate bad news to their patients. Examples of these strategies are: to be familiar with the patients’ medical history, to ensure that there is enough time, to know the patient’s caregivers and/or relatives, to determine the patient’s level of knowledge about his/her condition, to use non-technical words, to give information in small pieces, to assess the patient’s understanding, to devise a joint action plan, among others.Conclusion: The communication barriers that were identified focused on the emotional issues of the communication process, particularly those related to the recognition of own emotions, and the limited training about communication strategies available to doctors. Consequently, there is a need to implement training programs that provide doctors with tools to facilitate the bad news communication process.

  18. Digital Interactive Narrative Tools for Facilitating Communication with Children During Counseling

    DEFF Research Database (Denmark)

    Baceviciute, Sarune; Albæk, Katharina R.R.; Arsovski, Aleksandar

    2012-01-01

    In this article we explore the means by which state-of-the-art knowledge on children counseling techniques can be combined with digital interactive narrative tools to facilitate communication with children during counseling sessions. The field of “narrative play therapy” could profit from...... an adult professional counselor (or therapists) needs to establish a trustful and efficient communication with children. Furthermore, the tool was specifically customized to pediatric audiology counseling. Our evaluation shows that the tool maintains the centrality of the child‟s perspective thanks...

  19. Verbal communication of story facilitators in multi-player role-playing games

    DEFF Research Database (Denmark)

    Tychsen, Anders; Brolund, Thea; Hitchens, Michael

    2008-01-01

    Multi-player role-playing games form one of the key examples of interactive, emergent and collaborative storytelling systems available. These games and the collaborative stories that they create, are commonly facilitated by a specialized participant, the game master. In the current study, the ver......Multi-player role-playing games form one of the key examples of interactive, emergent and collaborative storytelling systems available. These games and the collaborative stories that they create, are commonly facilitated by a specialized participant, the game master. In the current study......, the verbal communication of game masters in a series of role-playing game sessions is categorized and analyzed depending on form and content, using protocol analysis, establishing a model for the verbal communication of game masters. © 2008 Springer Berlin Heidelberg....

  20. Verbal communication of story facilitators in multi-player role-playing games

    DEFF Research Database (Denmark)

    Tychsen, Anders; Brolund, Thea; Hitchens, Michael

    2008-01-01

    Multi-player role-playing games form one of the key examples of interactive, emergent and collaborative storytelling systems available. These games and the collaborative stories that they create, are commonly facilitated by a specialized participant, the game master. In the current study, the ver......, the verbal communication of game masters in a series of role-playing game sessions is categorized and analyzed depending on form and content, using protocol analysis, establishing a model for the verbal communication of game masters.......Multi-player role-playing games form one of the key examples of interactive, emergent and collaborative storytelling systems available. These games and the collaborative stories that they create, are commonly facilitated by a specialized participant, the game master. In the current study...

  1. The Effect of Software Facilitated Communication on Student Outcomes in Online Classes.

    Directory of Open Access Journals (Sweden)

    Stuart S. Gold

    2004-07-01

    Full Text Available This research project examined the question of the relationship between the frequency and method of software-facilitated communication employed and the student outcomes achieved in online university courses. This question directly addressed the issues of 1 the increasing focus by businesses on maximizing their employees’ educational outcomes and leveraging the corporation’s investment and 2 identifying Management Information Systems that support improved student outcomes. The research project was comprised of three related research studies, a preliminary proof of concept, a large-scale study and a validation study to provide a further measure of reliability and validity. The three studies combined incorporated data from 116 online courses and over 1700 students. The results indicate that there is a statistically significant relationship between the method of software-facilitated communication utilized (basic or advanced and the student final exam grade. The results of the research project indicated that the use of advanced software facilitated communication features, which provide an environment that fosters more sophisticated and feature rich interaction, is important in terms of determining student outcomes. It is not sufficient to create online interaction; rather it is the inherent quality of that interaction which is important in determining student outcomes.

  2. Hidden Communicative Competence: Case Study Evidence Using Eye-Tracking and Video Analysis

    Science.gov (United States)

    Grayson, Andrew; Emerson, Anne; Howard-Jones, Patricia; O'Neil, Lynne

    2012-01-01

    A facilitated communication (FC) user with an autism spectrum disorder produced sophisticated texts by pointing, with physical support, to letters on a letterboard while their eyes were tracked and while their pointing movements were video recorded. This FC user has virtually no independent means of expression, and is held to have no literacy…

  3. The importance of communication in collaborative decision making: facilitating shared mind and the management of uncertainty.

    Science.gov (United States)

    Politi, Mary C; Street, Richard L

    2011-08-01

    Quality medical decision making requires that clinicians and patients incorporate the best available clinical evidence with the patients' values and preferences to develop a mutually agreed upon treatment plan. The interactive process involved in medical decision making is complex and requires patients and clinicians to use both cognitive and communicative skills to reach a shared understanding of the decision. The purpose of this paper is to present a communication model to help better understand quality medical decision making, and how patient-centered, collaborative communication enhances the decision-making process. We present research on shared mind and cognitive and communicative skills to highlight how they can facilitate the management of uncertainty during the interactive process involved in medical decision making. We provide simple examples about how to frame messages to achieve shared mind and foster uncertainty tolerance. Strategies such as providing clear explanations, checking for understanding, eliciting the patient's values, concerns, needs, finding common ground, reaching consensus on a treatment plan, and establishing a mutually acceptable follow-up plan can facilitate collaborative decision making. Future research should explore ways to implement collaborative decision-making processes in existing health care systems. © 2010 Blackwell Publishing Ltd.

  4. Development of the EMAP tool facilitating existential communication between general practitioners and cancer patients

    DEFF Research Database (Denmark)

    Assing Hvidt, Elisabeth; Hansen, Dorte Gilså; Ammentorp, Jette

    2017-01-01

    BACKGROUND: General practice recognizes the existential dimension as an integral part of multidimensional patient care alongside the physical, psychological and social dimensions. However, general practitioners (GPs) report substantial barriers related to communication with patients about...... existential concerns. OBJECTIVES: To describe the development of the EMAP tool facilitating communication about existential problems and resources between GPs and patients with cancer. METHODS: A mixed-methods design was chosen comprising a literature search, focus group interviews with GPs and patients (n...... dimension. The tool utilized the acronym and mnemonic EMAP (existential communication in general practice) indicating the intention of the tool: to provide a map of possible existential problems and resources that the GP and the patient can discuss to find points of reorientation in the patient's situation...

  5. Facilitating awareness of philosophy of science, ethics and communication through manual skills training in undergraduate education.

    Science.gov (United States)

    Kordahl, Hilde Lund; Fougner, Marit

    2017-03-01

    Professional health science education includes a common theoretical basis concerning the theory of science, ethics and communication. Former evaluations by first-year students of the bachelor physiotherapy program at Oslo and Akershus University College of Applied Sciences (HiOA) show that they find it hard to understand the relation between these particular topics and future professional practice. This challenge is the starting point for a pedagogical development project that aims to develop learning contexts that highlight the relevance of these theoretical concepts. The aim of the study is to explore and present findings on the value of using Sykegrep manual skills classes as an arena in which students can be encouraged to think about, reflect on and appreciate the role and value of the philosophical perspectives that inform their practice and contributes to practise knowledge. A qualitative study with data collection through focus groups was performed and analyzed using thematic content analysis. Eighteen first-year undergraduate students, who had completed the manual skills course, participated in the study. Analysis of the data yielded three categories of findings that can be associated with aspects of philosophy of science, ethics and communication. These are as follows: 1) preconceived understanding of physiotherapy; 2) body knowledge perspectives; and 3) relational aspects of interactions. Undergraduate students' understanding and experience of philosophy of science, ethics and communication may be facilitated by peer collaboration, reflection on intimacy and touch and the ethical aspects of interaction during manual skills training. Practical classes in Sykegrep provide a basis for students' discussions about the body as well as their experiences with the body in the collaborative learning context. The students' reflections on their expectations of manual skills in physiotherapy and experiences of touch and being touched can facilitate an awareness of

  6. Digital Interactive Narrative Tools for Facilitating Communication with Children During Counseling

    DEFF Research Database (Denmark)

    Baceviciute, Sarune; Albæk, Katharina R.R.; Arsovski, Aleksandar

    2012-01-01

    In this article we explore the means by which state-of-the-art knowledge on children counseling techniques can be combined with digital interactive narrative tools to facilitate communication with children during counseling sessions. The field of “narrative play therapy” could profit from...... the reconciliation between free-play and narratives afforded by interactive digital tools in order to promote children‟s engagement. We present a digital interactive narrative application integrated with a “step-by-step” guide to the counselor, which could be adapted to many different situations and contexts where...... an adult professional counselor (or therapists) needs to establish a trustful and efficient communication with children. Furthermore, the tool was specifically customized to pediatric audiology counseling. Our evaluation shows that the tool maintains the centrality of the child‟s perspective thanks...

  7. Using Communication Technology to Facilitate Scientific Literacy: A Framework for Engaged Learning

    Science.gov (United States)

    VanBuskirk, Shireen Adele

    The purpose of this research project is to describe how existing communication technologies are used to foster scientific literacy for secondary students. This study develops a new framework as an analytic tool to categorize the activities of teachers and students involved in scientific literacy to describe what elements of scientific literacy are facilitated by such technologies. Four case studies are analyzed using the framework to describe the scientific literacy initiatives. Data collection at each site included interviews with the teacher, student focus groups, student surveys, and classroom observations. Qualitative analysis of the data provided insight into the learning activities and student experiences in the four cases. This study intentionally provides a platform for student voice. Very few previous empirical studies in the area of scientific literacy include the student experience. This represents a significant gap in the current literature on scientific literacy. An interpretation of scientific literacy that promotes student engagement, interaction, and initiative corresponds to a need to listen to students' perspectives on these experiences. Findings of the study indicated that the classroom activities depended on the teacher's philosophy regarding scientific literacy. Communication technology was ubiquitous; where the teacher did not initiate the use of social media in the classroom, the students did. The goal of supporting scientific literacy in students is an objective that extends beyond the boundaries of classroom walls, and it can be facilitated by technologies that seem both abundant and underutilized. Technology-enhanced pedagogy altered the classroom practices and resulted in more student participation and engagement.

  8. Barriers and facilitators to effective communication experienced by patients with malignant lymphoma at all stages after diagnosis.

    Science.gov (United States)

    van Bruinessen, Inge Renske; van Weel-Baumgarten, Evelyn M; Gouw, Hans; Zijlstra, Josée M; Albada, Akke; van Dulmen, Sandra

    2013-12-01

    This study aims to gain insight into patient-perceived communication barriers and facilitators at different stages after the diagnosis of malignant lymphoma. We have detected patterns to explain when these factors influence communication predominantly. A qualitative approach was applied, derived from the context mapping framework. A total of 28 patients completed a set of assignments about their experiences with provider-patient communication during medical consultations. Subsequently, these patients and nine companions shared their experiences during a semistructured (group) interview, which was recorded on audiotape. The audiotapes and assignments were analysed with MAXQDA software. From the patients' viewpoint, communicating effectively appears to depend on their own attributes (e.g. emotions), the health care professionals' attributes (e.g. attitude) and external factors (e.g. time pressure). Three patient communication states were identified: (i) overwhelmed, passive; (ii) pro-active, self-motivated; and (iii) proficient, empowered. Patients seem to behave differently in the three communication states. This study lists patient-perceived communication barriers and facilitators and identifies three different communication states, which indicate when certain barriers and facilitators are encountered. These findings may support health care professionals to tailor the provision of support and information and remove communication barriers accordingly. Additionally, they provide input for interventions to support patients in effective communication. Copyright © 2013 John Wiley & Sons, Ltd.

  9. Barriers and facilitators to effective communication experienced by patients with malignant lymphoma at all stages after diagnosis

    NARCIS (Netherlands)

    Bruinessen, I.R. van; Weel-Baumgarten, E.M. van; Gouw, H.; Zijlstra, J.M.; Albada, A.; Dulmen, S. van

    2013-01-01

    OBJECTIVE: This study aims to gain insight into patient-perceived communication barriers and facilitators at different stages after the diagnosis of malignant lymphoma. We have detected patterns to explain when these factors influence communication predominantly. METHOD: A qualitative approach was

  10. Barriers and facilitators to effective communication experienced by patients with malignant lymphoma at all stages after diagnosis.

    NARCIS (Netherlands)

    Bruinessen, I.R. van; Weel, E.M. van; Gouw, H.; Zijlstra, J.M.; Albada, A.; Dulmen, S. van

    2013-01-01

    Objective: This study aims to gain insight into patient-perceived communication barriers and facilitators at different stages after the diagnosis of malignant lymphoma. We have detected patterns to explain when these factors influence communication predominantly. Method: A qualitative approach was

  11. Barriers and facilitators to effective communication experienced by patients with malignant lymphoma at all stages after diagnosis.

    NARCIS (Netherlands)

    Bruinessen, I.R. van; Weel, E.M. van; Gouw, H.; Zijlstra, J.M.; Albada, A.; Dulmen, S. van

    2013-01-01

    Objective: This study aims to gain insight into patient-perceived communication barriers and facilitators at different stages after the diagnosis of malignant lymphoma. We have detected patterns to explain when these factors influence communication predominantly. Method: A qualitative approach was a

  12. [2-COM: presentation of an instrument facilitating communication between physicians and carers in daily practice].

    Science.gov (United States)

    Robert, P H; Michel, E; Van Os, J; Altamura, A C; Bobes, J; Gerlach, J; Hellewell, J S E; Kasper, S; Nabel, D

    2007-01-01

    Communication between the patient and the professional carer lies at the heart of all decisions regarding diagnosis and treatment. However, patients and doctors often have divergent views on care needs; 2-COM (for 2-communication) is a simple patient-completed self-report instrument designed in order to facilitate patient-professional carer communication. Aims - To present 2-COM and to examine whether providing patients with an opportunity to identify and discuss their needs would improve communication and induce changes in care. Methods - The 2-COM is a simple list of 20 common problems, or areas of perceived need, that might be experienced by patients with severe mental illness. The list includes problems with housing, relationships, money, lack of activities, psychological distress, sexuality, symptoms and treatment side effects; 2-COM has shown adequate test-retest reliability and is well accepted by patients as a valued aid to communication with their doctor; 134 patients in a clinical diagnosis of schizophrenia or schizoaffective disorder were recruited at seven European centres: Maastricht, Oviedo, Gijon, Hamburg, Copenhagen, Milan and Nice. The assessment took place over 3 out patient clinic visits; at visit 1, the clinician recorded a list of all current interventions, including medication and non-medical treatments, together with demographic information and an assessment of current level of functioning, using the Global Assessment of Functioning scale. Prior to the second visit, patients were randomised to receive either 2-COM or "standard care" - a routine appointment without 2-COM. Immediately after the interview, all patients, whether they had completed 2-COM or not, completed a confidential questionnaire in which they could indicate the perceived quality of communication. Similarly, clinicians completed a repeat of the list of all current interventions, together with an assessment of any changes to the treatment plan implemented after the interview

  13. Fc-fusion mimetics

    OpenAIRE

    2016-01-01

    The Fc-fusion mimetic RpR 2 was prepared by disulfide bridging conjugation using a PEG in the place of the Fc. RpR 2 displayed higher affinity for VEGF than aflibercept caused primarily by a slower dissociation rate, which can prolong a drug at its site of action. RpRs have considerable potential for development as stable, organ specific therapeutics.

  14. IgG1 Fc N-glycan galactosylation as a biomarker for immune activation

    NARCIS (Netherlands)

    De Jong, Sanne E.; Selman, Maurice H J; Adegnika, Ayola A.; Adegnika, Ayola A.; Adegnika, Ayola A.; Amoah, Abena S.; Amoah, Abena S.; Van Riet, Elly; Kruize, Yvonne C M; Raynes, John G.; Rodriguez, Alejandro; Boakye, Daniel; Von Mutius, Erika; Von Mutius, Erika; Knulst, André C.; Genuneit, Jon; Cooper, Philip J.; Cooper, Philip J.; Hokke, Cornelis H.; Wuhrer, Manfred; Yazdanbakhsh, Maria

    2016-01-01

    Immunoglobulin G (IgG) Fc N-glycosylation affects antibody-mediated effector functions and varies with inflammation rooted in both communicable and non-communicable diseases. Worldwide, communicable and non-communicable diseases tend to segregate geographically. Therefore, we studied whether IgG Fc

  15. A genetic counseling intervention to facilitate family communication about inherited conditions.

    Science.gov (United States)

    Gaff, Clara; Hodgson, Jan

    2014-10-01

    This paper describes the development and implementation of the first intervention to facilitate family communication of genetic information based on a genetic counseling model of practice. The intervention is telephone-based and therefore designed to complement face-to-face genetic counseling consultations. It was developed by firstly reviewing the literature and a model of genetic counseling practice, leading to definition of seven core principles underpinning the intervention. A counseling framework based on these principles was developed through iterative role playing and review, tested for consistency with good practice and piloted on ten study participants. It was found to be feasible to implement and consistent with good genetic counseling practice. Implementation included training of the genetic counselors who would deliver the intervention as part of a randomized controlled trial. Noteworthy deviations from good genetic counseling practice were observed, with unexpected additional insights into the 'black box' of genetic counseling that may have wider implications and would benefit from further investigation. The intervention is currently being evaluated in a randomized controlled trial, to assess its impact on the number of family members attending genetic services.

  16. The Role of Government Public Relations As Facilitators Communication in Bureau of Public Relation at South Kalimantan Province

    Directory of Open Access Journals (Sweden)

    Belinda Devi Larasati Siswanto

    2016-07-01

    Full Text Available As the windows of information, communication facilitator role in Government Public Relation (GPR serve as all-in-and-out of information from or to publics. For that, this research be held to find about the communication facilitator role on GPR of South Kalimantan Provincial Government. This research intends to knowing communication facilitator role to provide information to people and otherwise. This research uses qualitative approach with descriptive case study method, the data collection through observation and depth interview with informants purposively selection. The research result showing the communication facilitator role in GPR Bureau is not optimal, caused by unavailable information who can be accessed by the public or the otherwise. Government Information which should can be accessed at government official website or at the social media not be optimized by the GPR Bureau well as the Main Information Management and Documentation Officer (IMDO whose role is held by the GPR Bureau of the information that should be accessible through the website, is not available. This contrasts with some Local Work Unit function only a Subsidiary IMDO, but they were ready to provide information to the public through a website managed

  17. Identifying Strategies that Facilitate EFL Learners' Oral Communication: A Classroom Study Using Multiple Data Collection Procedures

    Science.gov (United States)

    Nakatani, Yasuo

    2010-01-01

    This article considers whether the use of specific communication strategies can improve learners' English proficiency in communicative tasks. Japanese college students (n= 62) participated in a 12-week course of English lessons using a communicative approach with strategy training. To investigate the influence of specific strategy use, their…

  18. Going straight to the source: A pilot study of bereaved parent-facilitated communication training for pediatric subspecialty fellows.

    Science.gov (United States)

    Snaman, Jennifer M; Kaye, Erica C; Cunningham, Melody J; Sykes, April; Levine, Deena R; Mahoney, Daniel; Baker, Justin N

    2017-01-01

    Medical trainees consistently report suboptimal instruction and poor self-confidence in communication skills. Despite this deficit, few established training programs provide comprehensive, pediatric-specific communication education, particularly in the provision of "bad news." To our knowledge, no programs currently use bereaved parent educators to facilitate communication training for pediatric subspecialty trainees. The authors designed and implemented a pilot communication training seminar in which bereaved parent educators and faculty facilitators led small groups in interactive, role-play scenarios. Surveys incorporating a retrospective preprogram assessment item to account for response-shift bias were used to assess short- and long-term changes in trainee comfort with delivering "bad news." Fifteen pediatric fellowship trainees participated in the communication seminar; complete data were available for 12 participants. After accounting for response-shift bias, participants reported significant improvement in overall preparedness, breaking bad news to a patient and family, and including the adolescent or young adult patient in conversations. Additionally, participants reported a significant improvement in their ability to address a patient and family's need for information, emotional suffering at the end of life (EOL), if and when a patient should be included in the conversation, and EOL care decisions. The participant's self-perceived improvement in comfort and preparedness persisted over time. Communication training for pediatric subspecialty trainees using bereaved parent educators is feasible and effective. Both medical trainee and bereaved parent participants benefited from involvement in this pilot study. Further iterations of this training will be modified to assess objective measures of improvement in trainees' communication skills. © 2016 Wiley Periodicals, Inc.

  19. Communication, The Essence of Science Facilitating Information Exchange Among Librarians, Scientists, Engineers and Students

    CERN Document Server

    Garvey, W D

    1979-01-01

    Communication: The Essence of Science provides information pertinent to the fundamental aspects of scientific communication. This book focuses on those information-exchange activities that take place mainly among scientists actively involved on the research front. Organized into five chapters, this book begins with an overview of the psychologists' description of the communication structure of science. This text then examines the relationship among spanning, connecting, and integrating the various streams of activities involved in the production of information. Other chapters consider some of

  20. Efficacy of Cancer Care Communication Between Clinicians and Latino Patients in a Rural US-Mexico Border Region: a Qualitative Study of Barriers and Facilitators to Better Communication.

    Science.gov (United States)

    Ko, Eunjeong; Zúñiga, María Luisa; Peacher, Diana; Palomino, Helen; Watson, Mercedes

    2016-08-25

    Quality of clinician-patient cancer communication is vital to cancer care and survivorship. Racial/ethnic minority patients in rural regions may have unique characteristics including cultural beliefs, language barriers, and low health literacy which require effective cross-cultural cancer communication. Despite the growing US population of racial/ethnic minorities and widespread emphasis on culturally appropriate health communication, little is known about challenges and facilitators of cancer communication among underserved rural Latino cancer patients in the US-Mexico border region. This study conducted secondary data analysis of interview data collected from 22 individual cancer patients living on the US side of the US-Mexico border. Thematic analysis was conducted to explore a priori questions regarding patient experiences with cancer care communication with their providers. Emerging themes included lack of language concordance, patient perspectives on clarity and accuracy of information provided, patient perceptions on provider sensitivity in giving cancer diagnosis, and improving the clinical interpersonal relationship. Practice guidelines are suggested and discussed. These findings illuminate the importance of advancing improvement of cancer communication between clinicians and Spanish language-dominant Latinos.

  1. Listening for Details of Talk: Early Childhood Parent-Teacher Conference Communication Facilitators

    Science.gov (United States)

    Cheatham, Gregory A.; Ostrosky, Michaelene M.

    2009-01-01

    In this article, the authors present parent-educator conversations, which were selected to illustrate common communication patterns and provide links to some of the Division for Early Childhood of the Council for Exceptional Children's recommended practices for communicating and collaborating with parents. Using conversation analysis, researchers…

  2. Providing Alternative Reinforcers to Facilitate Tolerance to Delayed Reinforcement Following Functional Communication Training

    Science.gov (United States)

    Austin, Jillian E.; Tiger, Jeffrey H.

    2015-01-01

    The earliest stages of functional communication training (FCT) involve providing immediate and continuous reinforcement for a communicative response (FCR) that is functionally equivalent to the targeted problem behavior. However, maintaining immediate reinforcement is not practical, and the introduction of delays is associated with increased…

  3. Using Modality Replacement to Facilitate Communication between Visually and Hearing-Impaired People

    DEFF Research Database (Denmark)

    Moustakas, K.; Tzovaras, D.; Dybkjaer, L.

    2011-01-01

    Using sign language, speech, and haptics as communication modalities, a virtual treasure-hunting game serves as an entertainment and educational tool for visually-and hearing-impaired users.......Using sign language, speech, and haptics as communication modalities, a virtual treasure-hunting game serves as an entertainment and educational tool for visually-and hearing-impaired users....

  4. Using Television Sitcoms to Facilitate Asynchronous Discussions in the Online Communication Course

    Science.gov (United States)

    Tolman, Elizabeth; Asbury, Bryan

    2012-01-01

    Asynchronous discussions are a useful instructional resource in the online communication course. In discussion groups students have the opportunity to actively participate and interact with students and the instructor. Asynchronous communication allows for flexibility because "participants can interact with significant amounts of time between…

  5. Promoting Parent-Adolescent Communication To Facilitate Healthy Sexual Socialization of Youth.

    Science.gov (United States)

    Filomeno, Arlynn H.

    2002-01-01

    Reviews relevant research to identify strengths and weaknesses of parent-adolescent communication patterns relating to adolescent sexual behaviors. Studies show the positive effects of parent-adolescent communication patterns and adolescent sexuality, though man parents fail to address the most critical sexual risks faced by adolescents (sexually…

  6. Facilitating Interdisciplinary Competence: Collaboration between Undergraduate Baccalaureate Nursing Students and Graduate Students Specializing in Communication Disorders

    Science.gov (United States)

    McMillan, Libba Reed; Burrus, Embry; Willis, Laura; Grabowsky, Adelia

    2016-01-01

    The fast-paced nature of the healthcare setting, coupled with the number of allied professionals involved, demands accurate and concise written communication. It is imperative that written communication between nursing and allied professionals be clear to ensure that the highest quality of care is provided and that patient safety is maintained.…

  7. Using the Theory of Planned Behaviour and implementation intentions to predict and facilitate upward family communication about mammography.

    Science.gov (United States)

    Browne, J L; Chan, A Y C

    2012-01-01

    Regular mammography facilitates early detection of breast cancer, and thus increases the chances of survival from this disease. Daughter-initiated (i.e. upward) communication about mammography within mother-daughter dyads may promote mammography to women of screening age. The current study examined this communication behaviour within the context of the Theory of Planned Behaviour (TPB), and aimed to bridge the intention-behaviour gap by trialling an implementation intention (II) intervention that aimed to facilitate upward family communication about mammography. Young women aged 18-39 (N=116) were assigned to either a control or experimental condition, and the latter group formed IIs about initiating a conversation with an older female family member about mammography. Overall, those who formed IIs were more likely to engage in the target communication behaviour, however the intervention was most effective for those who reported low levels of intention at baseline. Perceived behavioural control emerged as the most important variable in predicting the target behaviour. The altruistic nature of this behaviour, and the fact that it is not wholly under volitional control, may have contributed to this finding. Future studies that systematically explore the relative roles of intention and perceived behavioural control in behaviours of this nature are warranted.

  8. Opportunities and Challenges in Using Research to Facilitate Climate Communication Collaborations

    Science.gov (United States)

    Akerlof, K.; Johnson, B. B.; Nackerman, C. J.; Maibach, E.

    2014-12-01

    Climate change represents the worst of wicked environmental problems, requiring collaborations among individuals and groups that cross public, private and voluntary sectors on a global scale to reduce greenhouse gas emissions and prepare for impacts. The Climate Communication Consortium of Maryland represents such a collaboration on a state level for the purpose of supporting governments, non-profits, businesses and universities in communicating with the public about climate and energy within the context of multiple frames, such as public health, extreme weather, and coastal resilience. The collaboration was developed using communication research as an organizational framework - providing data from yearly public opinion surveys on Marylanders' attitudes, behaviors and policy support, and a variety of other qualitative and quantitative studies. In this presentation, we will highlight four dimensions of the use of research within collaborative organizational climate communication that can lead to success, or impediments: 1) individual organizational ability and resources for using audience data; 2) the linking of research questions to programmatic development goals and processes; 3) the weighing of audience- versus communicator-oriented values and priorities; and 4) identification of overarching communication objectives that span individual organizational interests. We will illustrate these dimensions using findings from surveys of our member organizations describing the types of barriers organizations face in communicating about climate change effectively, including their use of formative and evaluative research, and will discuss some of the findings from our public opinion and experimental research, illustrating the ways in which these findings influenced programmatic development and were used by Consortium member organizations.

  9. The spread of communications technology may facilitate increases in levels of anti-government violence

    OpenAIRE

    Garica, Blake; Wimpy, Camron

    2015-01-01

    Communications technology has developed at an almost bewildering pace since the development of the internet, with first mobiles and then smartphones ensuring that we are in near constant contact with our peers. But what impact has this had on violence, and more specifically anti-government violence. Blake E. Garcia and Cameron Wimpy argue that there is a correlation between access to communications technology and aggression directed at the state and its proxies.

  10. Utilization of Concurrent Buffers to Facilitate Seamless Data Transition in Tactical Cellular Communications

    Science.gov (United States)

    2015-09-01

    stations and end-user devices with components that govern or assist in service handovers. These base stations have antennas , servers, and...used with GRE to ensure the tunnel is not reconfigured when addressing service connectivity changes in an end-user device (Applied Communication...configuration of operation there is a central base station (BS), multiple subscriber stations (SS), and antennas by which devices communicate (Pinho, 2008

  11. Facilitating communication about sexual health between aging women and their health care providers.

    Science.gov (United States)

    Hughes, Anne K; Lewinson, Terri D W

    2015-04-01

    Many women experience changes in sexual health as they age, and discussing these changes with health care providers is an essential component of optimal health management. The purpose of this study was to understand aging women's perspectives about communicating with providers about sexual health. We used the integrative model of behavioral prediction as a theoretical lens to explore women's attitudes, perceived norms, and perceived self-efficacy that promote or inhibit the likelihood of communicating about sexual health. In this theory-based qualitative study, we interviewed 28 community-dwelling older women in the Midwestern United States. Through thematic analysis, we identified both positive and negative attitudes about communicating with providers. Women seemed most inclined to discuss sexual health if they perceived that important patient-provider conditions, such as trust and rapport, were in place. Despite situational obstacles and perceived norms, these women held strong beliefs about their abilities to discuss sexual health topics with providers.

  12. Assessing the Use of Metaphors to Facilitate and Improve the Effectiveness of Climate Change Communication

    Science.gov (United States)

    Walsh-Thomas, J.; Maibach, E.

    2014-12-01

    Metaphors are sometimes used in science communication to explain unfamiliar scientific concepts and processes in more familiar terms. Empirical research has shown that metaphors can help audiences better understand complicated scientific concepts. A growing number of metaphors are used to explain various climate science concepts, but the only empirical evaluation of climate metaphors to date (van der Linden et al, 2014, Climatic Change) found that medical and bridge safety metaphors did not enhance the effectiveness of a simple corrective statement about the scientific consensus on human-caused climate change. Drawing on a recent meta-analysis by Sopory and Dillard (2002, Hum Commun. Res.), we will briefly review what is known about appropriate metaphor usage in communicating scientific concepts. We will also present preliminary findings from an experiment currently underway to further explain the conditions in which metaphors are likely to help in communicating climate science concepts. We hypothesize that metaphors will be more effective in communicating high complexity climate science concepts that are less easily understood by the public than more easily understood low complexity concepts (such as scientific consensus on climate change). We also hypothesize that the more familiar people are with the referent (performance enhancing drugs in baseball is a metaphor about "the climate system on steroids"), the more effective the metaphor will be. To test these hypotheses, we are randomly assigning ~1000 adults - approximately representative of the US adult population - to read one brief passage in which one of four relatively simple or complex climate concepts is presented and explained with or without a metaphor. The outcome measures will include climate change belief, concern, knowledge, and involvement. This study is intended to add to the knowledge base about use of metaphors in science communication, and provide practical advice to climate communicators.

  13. Risk communication considerations to facilitate the screening of mass populations for potential contamination with radioactive material.

    Science.gov (United States)

    Emery, R J; Sprau, D D; Morecook, R C

    2008-11-01

    Experience gained during a field training exercise with a Medical Reserve Corps unit on the screening of large groups of individuals for possible contamination with radioactive material revealed that while exercise participants were generally attentive to the proper use of protective equipment and detectors, they tended to overlook important basic risk communications aspects. For example, drill participants did not actively communicate with the persons waiting in line for screening, a step which would provide re-assurance, possibly minimize apprehension, and would clarify expectations. When questioned on this issue of risk communication, drill participants were often able to craft ad hoc messages, but the messages were inconsistent and likely would not have significantly helped diminish anxiety and maintain crowd control. Similar difficulties were encountered regarding messaging for persons determined to be contaminated, those departing the screening center, and those to be delivered to the media. Based on these experiences, the need for a suggested list of risk communication points was identified. To address this need, a set of risk communication templates were developed that focused on the issues likely to be encountered in a mass screening event. The points include issues such as the importance of remaining calm, steps for minimizing possible intake or uptake, considerations for those exhibiting acute injuries, expected screening wait times, the process to be followed and the information to be collected, the process to be undertaken for those exhibiting contamination, and symptoms to watch for after departure. Drill participants indicated in follow-up discussions that such pre-established risk communication templates would serve to enhance their ability to assist in times of emergency and noted the potential broader applicably of the approach for use in responses for other disasters types as well.

  14. Crystal structure of the HSV-1 Fc receptor bound to Fc reveals a mechanism for antibody bipolar bridging.

    Directory of Open Access Journals (Sweden)

    Elizabeth R Sprague

    2006-06-01

    Full Text Available Herpes simplex virus type-1 expresses a heterodimeric Fc receptor, gE-gI, on the surfaces of virions and infected cells that binds the Fc region of host immunoglobulin G and is implicated in the cell-to-cell spread of virus. gE-gI binds immunoglobulin G at the basic pH of the cell surface and releases it at the acidic pH of lysosomes, consistent with a role in facilitating the degradation of antiviral antibodies. Here we identify the C-terminal domain of the gE ectodomain (CgE as the minimal Fc-binding domain and present a 1.78-angstroms CgE structure. A 5-angstroms gE-gI/Fc crystal structure, which was independently verified by a theoretical prediction method, reveals that CgE binds Fc at the C(H2-C(H3 interface, the binding site for several mammalian and bacterial Fc-binding proteins. The structure identifies interface histidines that may confer pH-dependent binding and regions of CgE implicated in cell-to-cell spread of virus. The ternary organization of the gE-gI/Fc complex is compatible with antibody bipolar bridging, which can interfere with the antiviral immune response.

  15. The Disposable Blog: Using the Weblog to Facilitate Classroom Learning and Communications

    Science.gov (United States)

    Pimpare, Stephen; Fast, Jonathan

    2008-01-01

    This article describes two case studies: one is from a graduate course in social work practice evaluation taught by the second author; the other is from an undergraduate political science course in media and politics taught by the first author. These cases describe the way blogs, created by students and the professors, facilitate communications…

  16. Productive Figurative Communication: Conventional Metaphors Facilitate the Comprehension of Related Novel Metaphors

    Science.gov (United States)

    Thibodeau, Paul; Durgin, Frank H.

    2008-01-01

    Three experiments explored whether conceptual mappings in conventional metaphors are productive, by testing whether the comprehension of novel metaphors was facilitated by first reading conceptually related conventional metaphors. The first experiment, a replication and extension of Keysar et al. [Keysar, B., Shen, Y., Glucksberg, S., Horton, W.…

  17. Facilitating Peer-Group Entry in Kindergartners with Impairments in Social Communication.

    Science.gov (United States)

    Beilinson, Jill Selber; Olswang, Lesley B.

    2003-01-01

    Case studies of three kindergarten students with social difficulties illustrate an intervention program emphasizing a sequential peer-entry hierarchy in which children move from low-risk strategies to high-risk strategies and use props to facilitate the production of high-risk verbal statements. Increases were found in use of props and verbal…

  18. Structure and dynamics of IgE-receptor interactions: FcεRI and CD23/FcεRII.

    Science.gov (United States)

    Sutton, Brian J; Davies, Anna M

    2015-11-01

    Immunoglobulin E (IgE) is well known for its role in allergic disease, the manifestations of which are mediated through its two Fc receptors, FcεRI and CD23 (FcεRII). IgE and its interactions with these receptors are therefore potential targets for therapeutic intervention, and exciting progress has been made in this direction. Furthermore, recent structural studies of IgE-Fc, the two receptors, and of their complexes, have revealed a remarkable degree of plasticity at the IgE-CD23 interface and an even more remarkable degree of dynamic flexibility within the IgE molecule. Indeed, there is allosteric communication between the two receptor-binding sites, which we now know are located at some distance from each other in IgE-Fc (at opposite ends of the Cε3 domain). The conformational changes associated with FcεRI and CD23 binding to IgE-Fc ensure that their interactions are mutually incompatible, and it may be that this functional imperative has driven IgE to evolve such a dynamic structure. Appreciation of these new structural data has revised our view of IgE structure, shed light on the co-evolution of antibodies and their receptors, and may open up new therapeutic opportunities.

  19. Facilitating Cooperative Learning in Online and Blended Courses: An Example from an Integrated Marketing Communications Course

    Science.gov (United States)

    Johnson, Katryna

    2013-01-01

    Employers today expect that students will be able to work in teams. Cooperative learning theory addresses how skills such as decision making, problem solving and communication can be learned by individuals in group settings. This paper discusses how cooperative learning can be used in an online and blended environment to increase active learning…

  20. Student Response Systems and Facilitating the Large Lecture Basic Communication Course: Assessing Engagement and Learning

    Science.gov (United States)

    Denker, Katherine J.

    2013-01-01

    Instructors of large lecture classes face a variety of challenges, including student engagement and participation. With budget cuts and increasing class sizes, more schools may turn to large lecture/lab formats for the basic communication course (Stanley & Porter, 2002); instructors must understand how these classes engage students. One viable…

  1. How Research and Development on Educational Roles and Institutional Structures Can Facilitate Communication

    Science.gov (United States)

    Hood, Paul

    1973-01-01

    The objectives of this article, which emanate from a concern for returns on educational research and development investment, are to review and comment on types of research and development efforts to improve educational R&D communication and to indicate roughly the state-of-the-art and some needed developments. (Author/RK)

  2. Training Teaching Staff to Facilitate Spontaneous Communication in Children with Autism: Adult Interactive Style Intervention (AISI)

    Science.gov (United States)

    Kossyvaki, Lila; Jones, Glenys; Guldberg, Karen

    2016-01-01

    Previous research has demonstrated that the way adults interact with children with autism can have a great impact on their spontaneous communication. However, to date, few studies have focused on modifying adults' behaviour and even fewer have been conducted in school settings which actively involve teaching staff in designing the intervention.…

  3. An Evaluation Of A Communication, Facilitation And Project Management Tool To Enhance The Effectiveness Of Project Execution

    Directory of Open Access Journals (Sweden)

    Schalk van der Merwe

    2006-11-01

    Full Text Available Project managers are in desparate need of a tool to help them save time and bridge the gap between different interfaces which they use to document, present to the business and manage their projecs. Mindmanager x5 Pro appears to be a viable solution. But it is of utmost importance that before rolling out the solution in the business that the solution be evaluated in the specific environment. Mindmanager x5 Pro makes certain claims that must be confirmed. Furthermore the software will be evaluated against best practices criteria in the field of change communication, facilitation and project management.

  4. Teaching educational assistants to facilitate the multisymbol message productions of young students who require augmentative and alternative communication.

    Science.gov (United States)

    Binger, Cathy; Kent-Walsh, Jennifer; Ewing, Cai; Taylor, Stacy

    2010-05-01

    Many classroom educational assistants (EAs) have a significant amount of responsibility in carrying out educational plans for children who use augmentative and alternative communication (AAC), but they receive little instruction on how to do so (Kent-Walsh & Light, 2003). This study investigates the impact of using a communication partner instructional program to teach EAs how to teach their students to produce symbol combinations on their speech-generating devices. A single-subject multiple-probe-across-participants design was used to evaluate the effectiveness of the instructional program on (a) the EAs' implementation of an interaction strategy with their students who used AAC and (b) the rates of multisymbol message productions for the students who used AAC. All 3 participating EAs learned to use the interaction strategy appropriately, and all 3 participating students who used AAC increased their multisymbol message production rates. Results provide further evidence (a) of the viability of using a communication partner instructional program for teaching partners how to facilitate the communication skills of children who use AAC and (b) that the interaction strategy can be an effective tool for increasing expressive multisymbol message rates for children who use AAC.

  5. Communication between hearing impaired and normal hearing students: a facilitative proposal of learning in higher education

    Directory of Open Access Journals (Sweden)

    Krysne Kelly de França Oliveira

    2014-09-01

    Full Text Available Introduction: There has been an increase in the number of hearing impaired people with access to higher education. Most of them are young people from a different culture who present difficulties in communication, inter-relationship, and learning in a culture of normal hearing people, because they use a different language, the Brazilian Sign Language - LIBRAS. Objective: The present study aimed to identify the forms of communication used between hearing impaired and normal hearing students, verifying how they can interfere with the learning process of the first. Methods: A qualitative study that used the space of a private university in the city of Fortaleza, Ceará state, Brazil, from February to April 2009. We carried out semi-structured interviews with three hearing impaired students, three teachers, three interpreters, and three normal hearing students. The content of the speeches was categorized and organized by the method of thematic analysis. Results: We verified that the forms of communication used ranged from mime and gestures to writing and drawing, but the most accepted by the hearing impaired students was LIBRAS. As a method of communication, it supports the learning of hearing impaired students, and with the mediation of interpreters, it gives them conditions to settle in their zones of development, according to the precepts of Vygotsky. Conclusion: Thus, we recognize the importance of LIBRAS as predominant language, essential to the full academic achievement of hearing impaired students; however, their efforts and dedication, as well as the interest of institutions and teachers on the deaf culture, are also important for preparing future professionals.

  6. Hidden communicative competence: case study evidence using eye-tracking and video analysis.

    Science.gov (United States)

    Grayson, Andrew; Emerson, Anne; Howard-Jones, Patricia; O'Neil, Lynne

    2012-01-01

    A facilitated communication (FC) user with an autism spectrum disorder produced sophisticated texts by pointing, with physical support, to letters on a letterboard while their eyes were tracked and while their pointing movements were video recorded. This FC user has virtually no independent means of expression, and is held to have no literacy skills. The resulting data were subjected to a variety of analyses aimed at describing the relationship between the FC user's looking and pointing behaviours, in order to make inferences about the complex question of 'authorship'. The eye-tracking data present a challenge to traditional 'facilitator influence' accounts of authorship, and are consistent with the proposition that this FC user does indeed author the sophisticated texts that are attributed to him; he looks for longer at to-be-typed letters before typing them, and looks ahead to subsequent letters of words before the next letter of the word is typed.

  7. How live online communication can facilitate collaborative learning by providing a space for shared knowledge construction

    DEFF Research Database (Denmark)

    Kjær, Christopher

    2009-01-01

    Fast net connections are rapidly becoming available to people and organizations around the world. At the same time, prices on computers and related equipment is dropping. This has paved the way for web conference systems that provide users with easy access to live online communication but that also...... of Southern Denmark, the didactic model applied and best practice cases. Dialogue with the session participants will be promoted: • Before the presentation by posing questions that investigate the knowledge and experience of the participants on the use web conference systems in teaching and on live, online...

  8. Using the World-Wide Web to Facilitate Communications of Non-Destructive Evaluation

    Science.gov (United States)

    McBurney, Sean

    1995-01-01

    The high reliability required for Aeronautical components is a major reason for extensive Nondestructive Testing and Evaluation. Here at Langley Research Center (LaRC), there are highly trained and certified personal to conduct such testing to prevent hazards from occurring in the workplace and on the research projects for the National Aeronautics and Space Administration (NASA). The purpose of my studies was to develop a communication source to educate others of the services and equipment offered here. This was accomplished by creating documents that are accessible to all in the industry via the World Wide Web.

  9. Bursty communication patterns facilitate spreading in a threshold-based epidemic dynamics

    CERN Document Server

    Takaguchi, Taro; Holme, Petter

    2015-01-01

    Records of social interactions provide us with new sources of data for understanding how interaction patterns affect collective dynamics. Such human activity patterns are often bursty, i.e., they consist of short periods of intense activity followed by long periods of silence. This burstiness has been shown to affect spreading phenomena; it accelerates epidemic spreading in some cases and slows it down in other cases. We investigate a model of history-dependent contagion. In our model, repeated interactions between susceptible and infected individuals in a short period of time is needed for a susceptible individual to contract infection. We carry out numerical simulations on real temporal network data to find that bursty activity patterns facilitate epidemic spreading in our model.

  10. Communication: Surface-facilitated softening of ordinary and vapor-deposited glasses

    Science.gov (United States)

    Cubeta, Ulyana; Bhattacharya, Deepanjan; Sadtchenko, Vlad

    2017-08-01

    A common distinction between the ordinary glasses formed by melt cooling and the stable amorphous films formed by vapor deposition is the apparent mechanism of their devitrification. Using quasi-adiabatic, fast scanning calorimetry that is capable of heating rates in excess of 105 K s-1, we have investigated the softening kinetics of micrometer-scale, ordinary glass films of methylbenzene and 2-propanol. At the limit of high heating rates, the transformation mechanism of ordinary glasses is identical to that of their stable vapor-deposited counterparts. In both cases, softening is likely to begin at the sample surface and progress into its bulk via a transformation front. Furthermore, such a surface-facilitated mechanism complies with zero-order, Arrhenius rate law. The activation energy barriers for the softening transformation imply that the kinetics must be defined, at least in part, by the initial thermodynamic and structural state of the samples.

  11. Bursty communication patterns facilitate spreading in a threshold-based epidemic dynamics.

    Directory of Open Access Journals (Sweden)

    Taro Takaguchi

    Full Text Available Records of social interactions provide us with new sources of data for understanding how interaction patterns affect collective dynamics. Such human activity patterns are often bursty, i.e., they consist of short periods of intense activity followed by long periods of silence. This burstiness has been shown to affect spreading phenomena; it accelerates epidemic spreading in some cases and slows it down in other cases. We investigate a model of history-dependent contagion. In our model, repeated interactions between susceptible and infected individuals in a short period of time is needed for a susceptible individual to contract infection. We carry out numerical simulations on real temporal network data to find that bursty activity patterns facilitate epidemic spreading in our model.

  12. An Innovative Use of Information & Communication Technology (ICT in Trade Facilitation in India

    Directory of Open Access Journals (Sweden)

    V. S. Rana

    2012-07-01

    Full Text Available Directorate General of Foreign Trade, a department ofMinistry of Commerce and Industry, Govt. of India, isresponsible to formulate, regulate and implement the ForeignTrade Policy through its 36 Port Offices through India.: Thisis the case study of best e-governance project. This project ishighlighted in various e-governance seminars /workshops. Thisis the first govt. project in which ICT was implemented in 1998.It is soon equipped with Digital Signature and Electronic FundTransfer facility. The present study is an example of innovativeuse of Information and communication technology (ICT foron-line delivery. The present services in the DirectorateGeneral of Foreign Trade (DGFT: e-licensing, e-BRC, etendering,e-monitoring, e-meeting e-delivery, e-PRC, egrievancere-addressal etc. The web has been played adynamic role for reengineering and transformation of tradeprocesses for an efficient, cost effective and seamless tradefacilitation.

  13. Using OAI and other light-weight protocols to facilitate scholarly communication

    CERN Document Server

    CERN. Geneva

    2005-01-01

    This presentation describes how we share and harvest sets of various OAI metadata, repurpose it through the Ockham Library Network, and demonstrate an alternative to traditional scholarly communication. The Ockham Library Network is a sponsored National Science Foundation Digital Library grant with co-PI's at Emory University, Virginia Tech, Oregon State University, and the University of Notre Dame. One of the purposes of Ockham is to exploit modular, light-weight protocols (such as OAI-PMH and SRW/U) into systems for learning, teaching, and scholarship. To date we have implemented a number of such services: * Ockham Digital Library Services Registry - A distributed directory of digital library services, collections, and agents. The contents of the Registry are described using the same XML schema articulated by the Information Environment Service Registry (IESR), and the records are shared among participating institutions on a peer-to-peer network utilizing OAI to propagate registry records amongst the distri...

  14. Connective Auxin Transport in the Shoot Facilitates Communication between Shoot Apices.

    Science.gov (United States)

    Bennett, Tom; Hines, Geneviève; van Rongen, Martin; Waldie, Tanya; Sawchuk, Megan G; Scarpella, Enrico; Ljung, Karin; Leyser, Ottoline

    2016-04-01

    The bulk polar movement of the plant signaling molecule auxin through the stem is a long-recognized but poorly understood phenomenon. Here we show that the highly polar, high conductance polar auxin transport stream (PATS) is only part of a multimodal auxin transport network in the stem. The dynamics of auxin movement through stems are inconsistent with a single polar transport regime and instead suggest widespread low conductance, less polar auxin transport in the stem, which we term connective auxin transport (CAT). The bidirectional movement of auxin between the PATS and the surrounding tissues, mediated by CAT, can explain the complex auxin transport kinetics we observe. We show that the auxin efflux carriers PIN3, PIN4, and PIN7 are major contributors to this auxin transport connectivity and that their activity is important for communication between shoot apices in the regulation of shoot branching. We propose that the PATS provides a long-range, consolidated stream of information throughout the plant, while CAT acts locally, allowing tissues to modulate and be modulated by information in the PATS.

  15. An Enterprise 2.0 project management approach to facilitate participation, transparency, and communication

    Directory of Open Access Journals (Sweden)

    Andreas Auinger

    2013-01-01

    Full Text Available The use of current interactive and collaborative Web 2.0 concepts and technologies has great potential for flexible, loosely-coupled integration and ad-hoc information exchange within and between organizations. However, stakeholders’ readiness, willingness and ability to participate need to be continuously factored in. The successful implementation of common strategies, systems and processes in the course of Enterprise 2.0 projects is crucial. To increase the probability of success and to enhance the intensity of cooperation and trust in such projects, the constructs of transparency, communication and participation need to be addressed through an integrated project methodology. To bridge the gap between existing scientific models and requirements for Enterprise 2.0 projects, this paper proposes and describes a project methodology to support the main objectives for Enterprise 2.0 implementations. Selected results from two pilot projects within Austrian companies are presented and matched with critical success factors, which are derived from the literature. These provide elaborative insights into key characteristics of certain Enterprise 2.0 tools and project management for Enterprise 2.0 projects.

  16. Do gender-specific and high-resolution three dimensional body charts facilitate the communication of pain for women?

    DEFF Research Database (Denmark)

    Egsgaard, Line Lindhardt; Christensen, Trine Søby; Petersen, Ida Munk

    2016-01-01

    BACKGROUND: Chronic pain is more prevalent among women; however, the majority of standardized pain drawings are often collected using male-like androgynous body representations. OBJECTIVE: The purpose of this study was to assess whether gender-specific and high-resolution three-dimensional (3D......) body charts facilitate the communication of pain for women. METHODS: Using mixed-methods and a cross-over design, female patients with chronic pain were asked to provide detailed drawings of their current pain on masculine and feminine two-dimensional (2D) body schemas (N=41, Part I) or on female 2D...... enabled a more accurate expression of their pain due to the detailed contours of the musculature and bone structure, however, patients also reported the 3D body chart was too human and believed that skin-like appearance limited 'deep pain' expressions. CONCLUSIONS: Providing gender-specific body charts...

  17. The Role of Communication and Interpersonal Skills in Clinical Ethics Consultation: The Need for a Competency in Advanced Ethics Facilitation.

    Science.gov (United States)

    Shelton, Wayne; Geppert, Cynthia; Jankowski, Jane

    2016-01-01

    Clinical ethics consultants (CECs) often face some of the most difficult communication and interpersonal challenges that occur in hospitals, involving stressed stakeholders who express, with strong emotions, their preferences and concerns in situations of personal crisis and loss. In this article we will give examples of how much of the important work that ethics consultants perform in addressing clinical ethics conflicts is incompletely conceived and explained in the American Society of Bioethics and Humanities Core Competencies for Healthcare Ethics Consultation and the clinical ethics literature. The work to which we refer is best conceptualized as a specialized type of interviewing, in which the emotional barriers of patients and their families or surrogates can be identified and addressed in light of relevant ethical obligations and values within the context of ethics facilitation.

  18. Health information technology to facilitate communication involving health care providers, caregivers, and pediatric patients: a scoping review.

    Science.gov (United States)

    Gentles, Stephen James; Lokker, Cynthia; McKibbon, K Ann

    2010-06-18

    Pediatric patients with health conditions requiring follow-up typically depend on a caregiver to mediate at least part of the necessary two-way communication with health care providers on their behalf. Health information technology (HIT) and its subset, information communication technology (ICT), are increasingly being applied to facilitate communication between health care provider and caregiver in these situations. Awareness of the extent and nature of published research involving HIT interventions used in this way is currently lacking. This scoping review was designed to map the health literature about HIT used to facilitate communication involving health care providers and caregivers (who are usually family members) of pediatric patients with health conditions requiring follow-up. Terms relating to care delivery, information technology, and pediatrics were combined to search MEDLINE, EMBASE, and CINAHL for the years 1996 to 2008. Eligible studies were selected after three rounds of duplicate screening in which all authors participated. Data regarding patient, caregiver, health care provider, HIT intervention, outcomes studied, and study design were extracted and maintained in a Microsoft Access database. Stage of research was categorized using the UK's Medical Research Council (MRC) framework for developing and evaluating complex interventions. Quantitative and qualitative descriptive summaries are presented. We included 104 eligible studies (112 articles) conducted in 17 different countries and representing 30 different health conditions. The most common conditions were asthma, type 1 diabetes, special needs, and psychiatric disorder. Most studies (88, 85%) included children 2 to 12 years of age, and 73 (71%) involved home care settings. Health care providers operated in hospital settings in 96 (92%) of the studies. Interventions featured 12 modes of communication (eg, Internet, intranets, telephone, video conferencing, email, short message service [SMS], and

  19. A novel human immunoglobulin Fc gamma Fc epsilon bifunctional fusion protein inhibits Fc epsilon RI-mediated degranulation.

    Science.gov (United States)

    Zhu, Daocheng; Kepley, Christopher L; Zhang, Min; Zhang, Ke; Saxon, Andrew

    2002-05-01

    Human mast cells and basophils that express the high-affinity immunoglobulin E (IgE) receptor, Fc epsilon receptor 1 (Fc epsilon RI), have key roles in allergic diseases. Fc epsilon RI cross-linking stimulates the release of allergic mediators. Mast cells and basophils co-express Fc gamma RIIb, a low affinity receptor containing an immunoreceptor tyrosine-based inhibitory motif and whose co-aggregation with Fc epsilon RI can block Fc epsilon RI-mediated reactivity. Here we designed, expressed and tested the human basophil and mast-cell inhibitory function of a novel chimeric fusion protein, whose structure is gamma Hinge-CH gamma 2-CH gamma 3-15aa linker-CH epsilon 2-CH epsilon 3-CH epsilon 4. This Fc gamma Fc epsilon fusion protein was expressed as the predicted 140-kappa D dimer that reacted with anti-human epsilon- and gamma-chain specific antibodies. Fc gamma Fc epsilon bound to both human Fc epsilon RI and Fc gamma RII. It also showed dose- and time-dependent inhibition of antigen-driven IgE-mediated histamine release from fresh human basophils sensitized with IgE directed against NIP (4-hydroxy-3-iodo-5-nitrophenylacetyl). This was associated with altered Syk signaling. The fusion protein also showed increased inhibition of human anti-NP (4-hydroxy-3-nitrophenylacetyl) and anti-dansyl IgE-mediated passive cutaneous anaphylaxis in transgenic mice expressing human Fc epsilon RI alpha. Our results show that this chimeric protein is able to form complexes with both Fc epsilon RI and Fc gamma RII, and inhibit mast-cell and basophil function. This approach, using a Fc gamma Fc epsilon fusion protein to co-aggregate Fc epsilon RI with a receptor containing an immunoreceptor tyrosine-based inhibition motif, has therapeutic potential in IgE- and Fc epsilon RI-mediated diseases.

  20. A novel human immunoglobulin Fcγ–Fcε bifunctional fusion protein inhibits FcεRI-mediated degranulation

    OpenAIRE

    Zhu, Daocheng; Kepley, Christopher L.; Zhang, Min; Zhang, Ke; Saxon, Andrew

    2002-01-01

    Human mast cells and basophils that express the high-affinity immunoglobulin E (IgE) receptor, Fcε receptor 1 (FcεRI), have key roles in allergic diseases. FcεRI cross-linking stimulates the release of allergic mediators1. Mast cells and basophils co-express FcγRIIb, a low affinity receptor containing an immunoreceptor tyrosine-based inhibitory motif and whose co-aggregation with FcεRI can block FcεRI-mediated reactivity2–4. Here we designed, expressed and tested the human basophil and mast-c...

  1. The Development of a Communication Tool to Facilitate the Cancer Trial Recruitment Process and Increase Research Literacy among Underrepresented Populations.

    Science.gov (United States)

    Torres, Samantha; de la Riva, Erika E; Tom, Laura S; Clayman, Marla L; Taylor, Chirisse; Dong, Xinqi; Simon, Melissa A

    2015-12-01

    Despite increasing need to boost the recruitment of underrepresented populations into cancer trials and biobanking research, few tools exist for facilitating dialogue between researchers and potential research participants during the recruitment process. In this paper, we describe the initial processes of a user-centered design cycle to develop a standardized research communication tool prototype for enhancing research literacy among individuals from underrepresented populations considering enrollment in cancer research and biobanking studies. We present qualitative feedback and recommendations on the prototype's design and content from potential end users: five clinical trial recruiters and ten potential research participants recruited from an academic medical center. Participants were given the prototype (a set of laminated cards) and were asked to provide feedback about the tool's content, design elements, and word choices during semi-structured, in-person interviews. Results suggest that the prototype was well received by recruiters and patients alike. They favored the simplicity, lay language, and layout of the cards. They also noted areas for improvement, leading to card refinements that included the following: addressing additional topic areas, clarifying research processes, increasing the number of diverse images, and using alternative word choices. Our process for refining user interfaces and iterating content in early phases of design may inform future efforts to develop tools for use in clinical research or biobanking studies to increase research literacy.

  2. Imaging and measuring the biophysical properties of Fc gamma receptors on single macrophages using atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Li, Mi [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Liu, Lianqing, E-mail: lqliu@sia.cn [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); Xi, Ning [Department of Mechanical and Biomedical Engineering, City University of Hong Kong, Hong Kong (China); Wang, Yuechao [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); Xiao, Xiubin [Department of Lymphoma, Affiliated Hospital of Military Medical Academy of Sciences, Beijing 100071 (China); Zhang, Weijing, E-mail: zhangwj3072@163.com [Department of Lymphoma, Affiliated Hospital of Military Medical Academy of Sciences, Beijing 100071 (China)

    2013-09-06

    Highlights: •Nanoscale cellular ultra-structures of macrophages were observed. •The binding affinities of FcγRs were measured directly on macrophages. •The nanoscale distributions of FcγRs were mapped on macrophages. -- Abstract: Fc gamma receptors (FcγR), widely expressed on effector cells (e.g., NK cells, macrophages), play an important role in clinical cancer immunotherapy. The binding of FcγRs to the Fc portions of antibodies that are attached to the target cells can activate the antibody-dependent cell-mediated cytotoxicity (ADCC) killing mechanism which leads to the lysis of target cells. In this work, we used atomic force microscopy (AFM) to observe the cellular ultra-structures and measure the biophysical properties (affinity and distribution) of FcγRs on single macrophages in aqueous environments. AFM imaging was used to obtain the topographies of macrophages, revealing the nanoscale cellular fine structures. For molecular interaction recognition, antibody molecules were attached onto AFM tips via a heterobifunctional polyethylene glycol (PEG) crosslinker. With AFM single-molecule force spectroscopy, the binding affinities of FcγRs were quantitatively measured on single macrophages. Adhesion force mapping method was used to localize the FcγRs, revealing the nanoscale distribution of FcγRs on local areas of macrophages. The experimental results can improve our understanding of FcγRs on macrophages; the established approach will facilitate further research on physiological activities involved in antibody-based immunotherapy.

  3. Rural electrification, climate change, and local economies: Facilitating communication in development policy and practice on Nicaragua's Atlantic Coast

    Science.gov (United States)

    Casillas, Christian E.

    I explore the role of information and communication in the world of institution-led development. Through a series of case studies from the Atlantic Coast of Nicaragua, I present several projects and their implications for uncovering information that may lead to greater local benefit from externally-planned development projects. In order to construct policies and implement projects, development institutions collect, analyze, and simplify information, collapsing messy physical and social realities into narrow sets of metrics. In addition, local stakeholders often aren't privy to the analysis and assumptions of the "expert" planners. An evolved set of methods for dialogue and planning, which focus on sharing available information, can help facilitate outcomes that are more beneficial for targeted groups. Carbon abatement cost curves provide a clear example where the relations of complex social, economic, and environmental systems are reduced to a narrow set of metrics, specifically the cost of carbon mitigation and the total tons reduced. When the carbon abatement cost curve is applied to the community level, it reveals information and allows for conclusions obscured by aggregated national level studies. I show that there are opportunities for augmenting the limited metrics of these cost curves to include those that relate to welfare, beginning to highlight how costs and savings are distributed among stakeholders. In particular, the benefits to the most marginalized groups are heavily dependent on planners taking a pro-poor approach. However, planners typically remain blind to the priorities, capabilities, and values of the target stakeholders. There is a dearth of methods that effectively open up the development expert's black box of project designs, allowing their proposed solutions to be transparent to the target beneficiaries. I address this challenge through the presentation of a participatory modeling process that was utilized with groups of artisanal fishers

  4. A strategy for bacterial production of a soluble functional human neonatal Fc receptor.

    Science.gov (United States)

    Andersen, Jan Terje; Justesen, Sune; Berntzen, Gøril; Michaelsen, Terje E; Lauvrak, Vigdis; Fleckenstein, Burkhard; Buus, Søren; Sandlie, Inger

    2008-02-29

    The major histocompatibility complex (MHC) class I related receptor, the neonatal Fc receptor (FcRn), rescues immunoglobulin G (IgG) and albumin from lysosomal degradation by recycling in endothelial cells. FcRn also contributes to passive immunity by mediating transport of IgG from mother to fetus (human) or newborn (rodents), and may translocate IgG over mucosal surfaces. FcRn interacts with the Fc-region of IgG and domain III of albumin with binding at pH 6.0 and release at pH 7.4. Knowledge of these interactions has facilitated design of recombinant proteins with altered serum half-lives and/or altered biodistribution. To generate further research in this field, there is a great need for large amounts of soluble human FcRn (shFcRn) for in vitro interaction studies. In this report, we describe a novel laboratory scale production of functional shFcRn in Escherichia coli (E. coli) at milligram level. Truncated wild type hFcRn heavy chains were expressed, extracted, purified from inclusion bodies under denaturing non-reducing conditions, and subsequently refolded in the presence of human beta(2)-microglobulin (hbeta(2)m). The secondary structural elements of refolded heterodimeric shFcRn were correctly formed as demonstrated by circular dichroism (CD). Furthermore, functional and stringent pH dependent binding to IgG and human serum albumin were demonstrated by ELISA and surface plasmon resonance (SPR). This method may be easily adapted for the expression of large amounts of other FcRn species and MHC class I related molecules.

  5. The TEDxLSU Student Creative Communications Team: Integrating High-Impact Practices to Increase Engagement, Facilitate Deep Learning, and Advance Communication Skills

    Science.gov (United States)

    Burdette, Rebecca; Galeucia, Annemarie; Liggett, Sarah; Thompson, Melissa

    2016-01-01

    This article provides background on Louisiana State University's Communication across the Curriculum (CxC) program and details the history and logistics of its experiential learning and community outreach event--TEDxLSU. In particular, the authors provide details on the Student Creative Communications Team (SCCT) which conceptualizes, plans, and…

  6. Teaching Educational Assistants to Facilitate the Multisymbol Message Productions of Young Students Who Require Augmentative and Alternative Communication

    Science.gov (United States)

    Binger, Cathy; Kent-Walsh, Jennifer; Ewing, Cai; Taylor, Stacy

    2010-01-01

    Purpose: Many classroom educational assistants (EAs) have a significant amount of responsibility in carrying out educational plans for children who use augmentative and alternative communication (AAC), but they receive little instruction on how to do so (Kent-Walsh & Light, 2003). This study investigates the impact of using a communication partner…

  7. Primary care physician attitudes towards using a secure web-based portal designed to facilitate electronic communication with patients

    Directory of Open Access Journals (Sweden)

    Anne Kittler

    2004-11-01

    Conclusions Physicians’ fears about being overwhelmed with messages were not realised. While physicians were generally enthusiastic about the application, none used it directly to communicate with patients. Over three-quarters of respondents indicated that they would be more enthusiastic about electronic communication with patients if this time were compensated.

  8. A Programme-Wide Training Framework to Facilitate Scientific Communication Skills Development amongst Biological Sciences Masters Students

    Science.gov (United States)

    Divan, Aysha; Mason, Sam

    2016-01-01

    In this article we describe the effectiveness of a programme-wide communication skills training framework incorporated within a one-year biological sciences taught Masters course designed to enhance the competency of students in communicating scientific research principally to a scientific audience. In one class we analysed the numerical marks…

  9. A Programme-Wide Training Framework to Facilitate Scientific Communication Skills Development amongst Biological Sciences Masters Students

    Science.gov (United States)

    Divan, Aysha; Mason, Sam

    2016-01-01

    In this article we describe the effectiveness of a programme-wide communication skills training framework incorporated within a one-year biological sciences taught Masters course designed to enhance the competency of students in communicating scientific research principally to a scientific audience. In one class we analysed the numerical marks…

  10. A Novel Factor H-Fc Chimeric Immunotherapeutic Molecule against Neisseria gonorrhoeae.

    Science.gov (United States)

    Shaughnessy, Jutamas; Gulati, Sunita; Agarwal, Sarika; Unemo, Magnus; Ohnishi, Makoto; Su, Xia-Hong; Monks, Brian G; Visintin, Alberto; Madico, Guillermo; Lewis, Lisa A; Golenbock, Douglas T; Reed, George W; Rice, Peter A; Ram, Sanjay

    2016-02-15

    Neisseria gonorrhoeae, the causative agent of the sexually transmitted infection gonorrhea, has developed resistance to almost every conventional antibiotic. There is an urgent need to develop novel therapies against gonorrhea. Many pathogens, including N. gonorrhoeae, bind the complement inhibitor factor H (FH) to evade complement-dependent killing. Sialylation of gonococcal lipooligosaccharide, as occurs in vivo, augments binding of human FH through its domains 18-20 (FH18-20). We explored the use of fusing FH18-20 with IgG Fc (FH18-20/Fc) to create a novel anti-infective immunotherapeutic. FH18-20 also binds to select host glycosaminoglycans to limit unwanted complement activation on host cells. To identify mutation(s) in FH18-20 that eliminated complement activation on host cells, yet maintained binding to N. gonorrhoeae, we created four mutations in domains 19 or 20 described in atypical hemolytic uremic syndrome that prevented binding of mutated fH to human erythrocytes. One of the mutant proteins (D to G at position 1119 in domain 19; FHD1119G/Fc) facilitated complement-dependent killing of gonococci similar to unmodified FH18-20/Fc but, unlike FH18-20/Fc, did not lyse human erythrocytes. FHD1119G/Fc bound to all (100%) of 15 sialylated clinical N. gonorrhoeae isolates tested (including three contemporary ceftriaxone-resistant strains), mediated complement-dependent killing of 10 of 15 (67%) strains, and enhanced C3 deposition (≥10-fold above baseline levels) on each of the five isolates not directly killed by complement. FHD1119G/Fc facilitated opsonophagocytic killing of a serum-resistant strain by human polymorphonuclear neutrophils. FHD1119G/Fc administered intravaginally significantly reduced the duration and burden of gonococcal infection in the mouse vaginal colonization model. FHD1119G/Fc represents a novel immunotherapeutic against multidrug-resistant N. gonorrhoeae.

  11. How NASA is building and sustaining a community of scientist-communicators through virtual technology, graphic facilitation and other community-building tools

    Science.gov (United States)

    DeWitt, S.; Bovaird, E.; Stewart, N.; Reaves, J.; Tenenbaum, L. F.; Betz, L.; Kuchner, M. J.; Dodson, K. E.; Miller, A.

    2013-12-01

    In 2013 NASA launched its first agency-wide effort to cultivate and support scientist-communicators. The multiple motivations behind this effort are complex and overlapping, and include a desire to connect the agency's workforce to its mission and to each other in the post-Space Shuttle era; a shift in how the agency and the world communicates about science; the current public perception of science and of NASA, and a desire to share the stories of the real people behind the agency's technical work. Leaders in the NASA science, communications and public outreach communities partnered with the agency's training and leadership development organization to: identify and fully characterize the need for training and development in science communication, experiment with various learning models, and invite early-adopter scientists to evaluate these models for future agency investment. Using virtual collaboration technology, graphic facilitation, and leadership development methods, we set out to create an environment where scientist-communicators can emerge and excel. First, we asked scientists from across the agency to identify their motivations, opportunities, barriers and areas of interest in science communication. Scientists identified a need to go beyond traditional media training, a need for continuous practice and peer feedback, and a need for agency incentives and sustained support for this kind of work. This community-driven approach also uncovered a serious need for communication support in the wake of diminishing resources for travel and conference attendance. As a first step, we offered a series of virtual learning events - highly collaborative working sessions for scientists to practice their communication technique, develop and apply new skills to real-world situations, and gain valuable feedback from external subject matter experts and fellow scientists from across the agency in a supportive environment. Scientists from ten NASA centers and a broad range of

  12. HAL/S-FC compiler system specifications

    Science.gov (United States)

    1976-01-01

    This document specifies the informational interfaces within the HAL/S-FC compiler, and between the compiler and the external environment. This Compiler System Specification is for the HAL/S-FC compiler and its associated run time facilities which implement the full HAL/S language. The HAL/S-FC compiler is designed to operate stand-alone on any compatible IBM 360/370 computer and within the Software Development Laboratory (SDL) at NASA/JSC, Houston, Texas.

  13. FC-NIRS: A Functional Connectivity Analysis Tool for Near-Infrared Spectroscopy Data

    Directory of Open Access Journals (Sweden)

    Jingping Xu

    2015-01-01

    Full Text Available Functional near-infrared spectroscopy (fNIRS, a promising noninvasive imaging technique, has recently become an increasingly popular tool in resting-state brain functional connectivity (FC studies. However, the corresponding software packages for FC analysis are still lacking. To facilitate fNIRS-based human functional connectome studies, we developed a MATLAB software package called “functional connectivity analysis tool for near-infrared spectroscopy data” (FC-NIRS. This package includes the main functions of fNIRS data preprocessing, quality control, FC calculation, and network analysis. Because this software has a friendly graphical user interface (GUI, FC-NIRS allows researchers to perform data analysis in an easy, flexible, and quick way. Furthermore, FC-NIRS can accomplish batch processing during data processing and analysis, thereby greatly reducing the time cost of addressing a large number of datasets. Extensive experimental results using real human brain imaging confirm the viability of the toolbox. This novel toolbox is expected to substantially facilitate fNIRS-data-based human functional connectome studies.

  14. Information technology as a facilitator of suppliers’ collaborative communication, network governance and relationship longevity in supply chains

    Directory of Open Access Journals (Sweden)

    Richard Chinomona

    2013-05-01

    Full Text Available There is an increasing awareness about the paramount importance of information technology within business in the context of large businesses. However, research about the investigation of the role of information technology resources in fostering collaborative communication, network governance and relationship longevity in the small and medium enterprise sector has remained scant. The primary objective of this study was to investigate the influence of information technology on collaborative communication, network governance and relationship longevity in Zimbabwe’s SME sector. Five research hypotheses were posited and sample data from 162 small and medium enterprise suppliers were collected and used to empirically test the hypotheses. The results of this study showed that information technology resources positively influenced small and medium enterprise suppliers’ collaborative communication, network governance and consequential relationship longevity with their buyers in a significant way. Overall, the current study findings provided tentative support to the proposition that information technology resources, collaborative communication and network governance should be recognised as significant antecedents for improved relationship longevity between suppliers and their buyers in the SME setting. Therefore, managers in the small and medium enterprise sector and small and medium enterprise owners need to pay attention to both collaborative communication and network governance in order to optimise information technology resource impact on their relationship longevity with their business counterparts. Limitations and future research directions were also indicated.

  15. Communication

    NARCIS (Netherlands)

    Sigafoos, J.; Lancioni, G.E.; O'Reilly, M.F.; Lang, R.; Singh, N.N.; Didden, H.C.M.; Green, V.A.; Marschik, P.B.

    2016-01-01

    Communication disorders are common among people with intellectual disabilities. Consequently, enhancing the communication skills of such individuals is a major intervention priority. This chapter reviews the nature and prevalence of the speech, language, and communication problems associated with

  16. Efficient production and purification of extracellular domain of human FGFR-Fc fusion proteins from Chinese hamster ovary cells.

    Science.gov (United States)

    Sokolowska-Wedzina, Aleksandra; Borek, Aleksandra; Chudzian, Julia; Jakimowicz, Piotr; Zakrzewska, Malgorzata; Otlewski, Jacek

    2014-07-01

    The family of fibroblast growth factor receptors (FGFRs) plays an important role in cell growth, survival, differentiation and angiogenesis. The three immunoglobulin-like extracellular domains of FGFR (D1, D2, and D3) are critical for ligand binding and specificity towards fibroblast growth factor and heparan sulfate. Fibroblast growth factor receptors are overexpressed in a wide variety of tumors, such as breast, bladder, and prostate cancer, and therefore they are attractive targets for different types of anticancer therapies. In this study, we have cloned, expressed in CHO cells and purified Fc-fused extracellular domains of different types of FGFRs (ECD_FGFR1a-Fc, ECD_FGFR1b-Fc, ECD_FGFR2a-Fc, ECD_FGFR2b-Fc, ECD_FGFR3a-Fc, ECD_FGFR3b-Fc, ECD_FGFR4a-Fc, ECD_FGFR4b-Fc), which could be used as molecular targets for the selection of specific antibodies. The fusion proteins were analyzed using gel electrophoresis, Western blotting and mass spectrometry. To facilitate their full characterization, the fusion proteins were deglycosylated using PNGase F enzyme. With an optimized transient transfection protocol and purification procedure we were able to express the proteins at a high level and purify them to homogeneity.

  17. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  18. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  19. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  20. Dicty_cDB: FC-AI11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI11 (Link to dictyBase) - - - Contig-U15122-1 FC-AI11E (Li...nk to Original site) - - - - - - FC-AI11E 1040 Show FC-AI11 Library FC (Link to library) Clone ID FC-AI11 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI11Q.Seq.d/ Representative seq. ID FC-AI...11E (Link to Original site) Representative DNA sequence >FC-AI11 (FC-AI11Q) /CSM/FC/FC-AI/FC-AI11Q.Seq...VLSPEIKKGSWDEAEEELLFQLVDKHGQSWKNVAIEIKTRTDIQCRYQYFKAI MSRQTEWNQLEDDILTKKIKLMTQNNEKISFQQVSKHLARAKTTKIPRTALECK

  1. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  2. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  3. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  4. Using the Communication in Science Inquiry Project Professional Development Model to Facilitate Learning Middle School Genetics Concepts

    Science.gov (United States)

    Baker, Dale R.; Lewis, Elizabeth B.; Uysal, Sibel; Purzer, Senay; Lang, Michael; Baker, Perry

    2011-01-01

    This study describes the effect of embedding content in the Communication in Inquiry Science Project professional development model for science and language arts teachers. The model uses four components of successful professional development (content focus, active learning, extended duration, participation by teams of teachers from the same school…

  5. A Daily Goals Tool to Facilitate Indirect Nurse-Physician Communication During Morning Rounds on a Medical-Surgical Unit.

    Science.gov (United States)

    Perry, Veronica; Christiansen, Mollie; Simmons, Angela

    2016-01-01

    Interprofessional bedside rounds are essential for patient-centered care. However, it may be difficult for nurses to round with physicians on medical-surgical units. Using a daily goals tool for indirect rounds improved nurse-physician communication and interprofessional care for patients.

  6. Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening.

    Directory of Open Access Journals (Sweden)

    Hye-Ji Choi

    Full Text Available Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A with mutations in one CH3 domain (CH3A on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B with mutations in the other CH3 domain (CH3B. In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90% with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.

  7. Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening.

    Science.gov (United States)

    Choi, Hye-Ji; Kim, Ye-Jin; Choi, Dong-Ki; Kim, Yong-Sung

    2015-01-01

    Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A) with mutations in one CH3 domain (CH3A) on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B) with mutations in the other CH3 domain (CH3B). In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90%) with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.

  8. Enabling participation of SMEs in international trade and production networks: Trade facilitation, trade finance and communication technology

    OpenAIRE

    Duval, Yann; Utoktham, Chorthip

    2014-01-01

    This study aimed at identifying key factors affecting SME participation in direct export and international production networks (IPNs), both globally and in Asia and the Pacific. A global dataset of firm-level data from developing countries was analyzed to identify the main obstacles to establishment and operation of direct and indirect small and medium size exporters. Logit models of SME export and IPN participation revealed the importance of several trade facilitation and related factors. Th...

  9. Monoclonal antibodies and Fc fragments for treating solid tumors

    Directory of Open Access Journals (Sweden)

    Eisenbeis AM

    2012-01-01

    Full Text Available Andrea M Eisenbeis, Stefan J GrauDepartment of Neurosurgery, University Hospital of Cologne, Cologne, GermanyAbstract: Advances in biotechnology, better understanding of pathophysiological processes, as well as the identification of an increasing number of molecular markers have facilitated the use of monoclonal antibodies and Fc fragments in various fields in medicine. In this context, a rapidly growing number of these substances have also emerged in the field of oncology. This review will summarize the currently approved monoclonal antibodies used for the treatment of solid tumors with a focus on their clinical application, biological background, and currently ongoing trials.Keywords: targeted therapy, monoclonal antibodies, cancer, biological therapy

  10. Important nonurgent imaging findings: use of a hybrid digital and administrative support tool for facilitating clinician communication.

    Science.gov (United States)

    Johnson, Evan; Sanger, Joseph; Rosenkrantz, Andrew B

    2015-01-01

    A departmental tool that provides a digital/administrative solution for communication of important imaging findings was evaluated. The tool allows the radiologist to click a button to mark an examination for ordering physician follow-up with subsequent fax and confirmation. The tool's log was reviewed. Of 466 entries; 99.4% were successfully faxed with phone confirmation. Most common reasons for usage were lung nodule/mass (29.2%) and osseous fracture (12.4%). Subsequent clinical action was documented in 41.0% of entries. Our data show the reliability of the tool in assisting the communication of findings, as well as providing documentation of notification, with minimal workflow disruption.

  11. Technology and Communications Coursework: Facilitating the Progression of Students with Learning Disabilities through High School Science and Math Coursework.

    Science.gov (United States)

    Shifrer, Dara; Callahan, Rebecca

    2010-09-01

    Students identified with learning disabilities experience markedly lower levels of science and mathematics achievement than students who are not identified with a learning disability. Seemingly compounding their disadvantage, students with learning disabilities also complete more credits in non-core coursework-traditionally considered non-academic coursework-than students who are not identified with a learning disability. The Education Longitudinal Study of 2002, a large national dataset with both regular and special education high school students, is utilized to determine whether credit accumulation in certain types of non-core coursework, such as Technology and Communications courses, is associated with improved science and math course-taking outcomes for students with learning disabilities. Results show that credit accumulation in Technology and Communications coursework uniquely benefits the science course-taking, and comparably benefits the math course-taking, of students identified with learning disabilities in contrast to students who are not identified with a learning disability.

  12. Medication Discussion Questions (MedDQ): developing a guide to facilitate patient-clinician communication about heart medications.

    Science.gov (United States)

    Garavalia, Linda; Garavalia, Brian; Spertus, John A; Decker, Carole

    2011-01-01

    Adherence to evidence-based therapies has emerged as one of the great challenges of translating discoveries to clinical care to optimize patient outcomes. In particular, nonadherence to lifesaving medications continues to trouble health care systems. We conducted a series of studies to investigate why cardiac patients stop life-sustaining medications and to develop a tool to proactively address medication adherence issues. We could find no available preventive tools for communicating with patients about their medications in the clinical setting. In this article, we summarize the process of developing such a tool. We used a mixed-methods approach in a series of studies that included examining quantitative data from a large patient registry, conducting in-depth qualitative patient interviews, creating items representative of the qualitative findings, pilot testing items with heart patients, surveying an expert panel to establish content validity, and conducting in-depth interviews with health care providers to assess implementation opportunities. Patient interviews revealed that patients' values and beliefs, barriers to treatment, and prior medication-taking behavior were of primary importance in understanding medication discontinuance. Pilot testing, expert panel review, and an implementation feasibility evaluation resulted in an 11-item communication guide to be used in a variety of health care settings. Clinicians need an efficient way of systematically communicating with patients about heart medications to identify barriers and to initiate preventive interventions when patients report barriers or challenges to medication adherence. Copyright © 2011 Lippincott Williams & Wilkins.

  13. Review of foreign approaches to development of communication in children with autistic spectrum disorders

    Directory of Open Access Journals (Sweden)

    Soldatenkova E.N.

    2015-03-01

    Full Text Available The article presents a generalized overview of international approaches to the evaluation and formation of communication in children with autism spectrum disor ders (ASD. Described radicals communication disorders in children with ASD. Analyzed foreign approaches (Communication system for the exchange of images (PECS Lori Frost and Andrew Bondy; options piktogramme6ideogrammic communication (bliss6symbolism, Loeb system, a system of sign language; Program in Applied verbal behavior; a Method of facilitating communication (FC and others used for the development of communication in children with ASD and donditions underlying these approaches. Examined differences in focus for the development of communication in children with ASD in domestic and foreign schools. The main conditions for the development of communication in children with ASD described in the framework of cultural historical psychology and activity approach, ensuring the inclusion of children with ASD in education.

  14. Use of podcast technology to facilitate education, communication and dissemination in palliative care: the development of the AmiPal podcast.

    Science.gov (United States)

    Nwosu, Amara Callistus; Monnery, Daniel; Reid, Victoria Louise; Chapman, Laura

    2017-06-01

    Podcasts have the potential to facilitate communication about palliative care with researchers, policymakers and the public. Some podcasts about palliative care are available; however, this is not reflected in the academic literature. Further study is needed to evaluate the utility of podcasts to facilitate knowledge-transfer about subjects related to palliative care. The aims of this paper are to (1) describe the development of a palliative care podcast according to international recommendations for podcast quality and (2) conduct an analysis of podcast listenership over a 14-month period. The podcast was designed according to internationally agreed quality indicators for medical education podcasts. The podcast was published on SoundCloud and was promoted via social media. Data were analysed for frequency of plays and geographical location between January 2015 and February 2016. 20 podcasts were developed which were listened to 3036 times (an average of 217 monthly plays). The Rich Site Summary feed was the most popular way to access the podcast (n=1937; 64%). The mean duration of each podcast was 10 min (range 3-21 min). The podcast was listened to in 68 different countries and was most popular in English-speaking areas, of which the USA (n=1372, 45.2%), UK (n=661, 21.8%) and Canada (n=221, 7.3%) were most common. A palliative care podcast is a method to facilitate palliative care discussion with global audience. Podcasts offer the potential to develop educational content and promote research dissemination. Future work should focus on content development, quality metrics and impact analysis, as this form of digital communication is likely to increase and engage wider society. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  15. Fc gamma receptor IIIB (Fc gamma RIIIB) polymorphisms are associated with clinical malaria in Ghanaian children

    DEFF Research Database (Denmark)

    Adu, Bright; Dodoo, Daniel; Adukpo, Selorme;

    2012-01-01

    Plasmodium falciparum malaria kills nearly a million people annually. Over 90% of these deaths occur in children under five years of age in sub-Saharan Africa. A neutrophil mediated mechanism, the antibody dependent respiratory burst (ADRB), was recently shown to correlate with protection from...... clinical malaria. Human neutrophils constitutively express Fc gamma receptor-Fc¿RIIA and Fc¿RIIIB by which they interact with immunoglobulin (Ig) G (IgG)-subclass antibodies. Polymorphisms in exon 4 of FCGR2A and exon 3 of FCGR3B genes encoding Fc¿RIIA and Fc¿RIIIB respectively have been described to alter...... malaria and provides justification for further functional characterization of variants of the classical Fc¿RIIIB allotypes. This would be crucial to the improvement of neutrophil mediated functional assays such as the ADRB assay aimed at assessing the functionality of antibodies induced by candidate...

  16. Dicty_cDB: FC-BS10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS10 (Link to dictyBase) - - - Contig-U16283-1 FC-BS10Z (Li...nk to Original site) - - FC-BS10Z 720 - - - - Show FC-BS10 Library FC (Link to library) Clone ID FC-BS10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS10Q.Seq.d/ Representative seq. ID FC-BS10...Z (Link to Original site) Representative DNA sequence >FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq.d/

  17. Dicty_cDB: FC-BS11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS11 (Link to dictyBase) - - - Contig-U16517-1 FC-BS11Z (Li...nk to Original site) - - FC-BS11Z 683 - - - - Show FC-BS11 Library FC (Link to library) Clone ID FC-BS11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS11Q.Seq.d/ Representative seq. ID FC-BS1...1Z (Link to Original site) Representative DNA sequence >FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS11Q.Seq....s producing significant alignments: (bits) Value FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS1

  18. Dicty_cDB: FC-BS16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS16 (Link to dictyBase) - - - Contig-U15105-1 FC-BS16E (Li...nk to Original site) - - - - - - FC-BS16E 671 Show FC-BS16 Library FC (Link to library) Clone ID FC-BS16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS16Q.Seq.d/ Representative seq. ID FC-BS1...6E (Link to Original site) Representative DNA sequence >FC-BS16 (FC-BS16Q) /CSM/FC/FC-BS/FC-BS16Q.Seq....VSH7-A/VSH720Q.Seq.d/ 1241 0.0 VSE854 (VSE854Q) /CSM/VS/VSE8-C/VSE854Q.Seq.d/ 1241 0.0 FC-BS16 (FC-BS16Q) /CSM/FC/FC-BS/FC-BS1

  19. Dicty_cDB: FC-BS19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS1...9E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/

  20. Dicty_cDB: FC-AL16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AL16 (Link to dictyBase) - - - Contig-U15130-1 FC-AL16E (Li...nk to Original site) - - - - - - FC-AL16E 648 Show FC-AL16 Library FC (Link to library) Clone ID FC-AL16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AL/FC-AL16Q.Seq.d/ Representative seq. ID FC-AL1...6E (Link to Original site) Representative DNA sequence >FC-AL16 (FC-AL16Q) /CSM/FC/FC-AL/FC-AL16Q.Seq....ences producing significant alignments: (bits) Value FC-AL16 (FC-AL16Q) /CSM/FC/FC-AL/FC-AL16Q.Seq.d/ 1241 0

  1. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  2. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  3. Chemoenzymatic Fc Glycosylation via Engineered Aldehyde Tags

    OpenAIRE

    2014-01-01

    Glycoproteins with chemically defined glycosylation sites and structures are important biopharmaceutical targets and critical tools for glycobiology. One approach toward constructing such molecules involves chemical glycosylation of aldehyde-tagged proteins. Here, we report the installation of a genetically encoded aldehyde tag at the internal glycosylation site of the crystallizable fragment (Fc) of IgG1. We replaced the natural Fc N-glycosylation sequon with a five amino-acid sequence that ...

  4. Importance of the Side Chain at Position 296 of Antibody Fc in Interactions with FcγRIIIa and Other Fcγ Receptors.

    Directory of Open Access Journals (Sweden)

    Yuya Isoda

    Full Text Available Antibody-dependent cellular cytotoxicity (ADCC is an important effector function determining the clinical efficacy of therapeutic antibodies. Core fucose removal from N-glycans on the Fc portion of immunoglobulin G (IgG improves the binding affinity for Fcγ receptor IIIa (FcγRIIIa and dramatically enhances ADCC. Our previous structural analyses revealed that Tyr-296 of IgG1-Fc plays a critical role in the interaction with FcγRIIIa, particularly in the enhanced FcγRIIIa binding of nonfucosylated IgG1. However, the importance of the Tyr-296 residue in the antibody in the interaction with various Fcγ receptors has not yet been elucidated. To further clarify the biological importance of this residue, we established comprehensive Tyr-296 mutants as fucosylated and nonfucosylated anti-CD20 IgG1s rituximab variants and examined their binding to recombinant soluble human Fcγ receptors: shFcγRI, shFcγRIIa, shFcγRIIIa, and shFcγRIIIb. Some of the mutations affected the binding of antibody to not only shFcγRIIIa but also shFcγRIIa and shFcγRIIIb, suggesting that the Tyr-296 residue in the antibody was also involved in interactions with FcγRIIa and FcγRIIIb. For FcγRIIIa binding, almost all Tyr-296 variants showed lower binding affinities than the wild-type antibody, irrespective of their core fucosylation, particularly in Y296K and Y296P. Notably, only the Y296W mutant showed improved binding to FcγRIIIa. The 3.00 Å-resolution crystal structure of the nonfucosylated Y296W mutant in complex with shFcγRIIIa harboring two N-glycans revealed that the Tyr-to-Trp substitution increased the number of potential contact atoms in the complex, thus improving the binding of the antibody to shFcγRIIIa. The nonfucosylated Y296W mutant retained high ADCC activity, relative to the nonfucosylated wild-type IgG1, and showed greater binding affinity for FcγRIIa. Our data may improve our understanding of the biological importance of human IgG1-Fc Tyr-296

  5. 高压注射FLT3L-hIgGFc表达质粒诱导小鼠体内树突状细胞扩增的研究%Hydrodynamic delivery of FLT3L-hIgG Fc plasmid DNA facilitate dendritic cells development in mouse

    Institute of Scientific and Technical Information of China (English)

    卢信良; 王盛典; 任欢

    2015-01-01

    Objective Construct PTT3-FLT3L-hIgG Fc plasmid DNA,detect its protein expression levels in peripheral blood,identify the proportion and number of dendritic cells (DCs) in peripheral lymphoid organs,and evaluate the feasibility of hydrodynamic delivery instead of normal injection of protein.Methods FLT3L gene was amplified by PCR from P815 mast cell lines,and was inserted into PTT3-hIgG Fc vector.The PTT3-FLT3L-hIgG Fc plasmid was analysed by enzyme digestion and sequencing.Lymph node and spleen were harvested 9 days after hydrodynamic tail vein injection of PTT3-FLT3L-hIgG Fc and PTT3-hIgG Fc plasmids.The proportion and number of DCs were identified by flow cytometry.Results The PTT3-FLT3L-hIgG Fc plasmid was proven correctly by enzyme digestion and sequencing.High levels of FLT3L-hIgG Fc protein can be detected in peripheral blood by ELISA after hydrodynamic tail vein injection.Besides,spleen was larger in mouse and CD11 c + MHC-Ⅱ + DCs showed significant increase in peripheral lymphoid organs.Conclusion We constructed PTT3-FLT3L-hIgG Fc plasmid successfully and demonstrated that hydrodynamic tail vein injection of PTT3-FLT3L-hIgG Fc plasmids can increase DCs numbers greatly.What' s more,the effect of hydrodynamic delivery was comparable to injection of protein reported before.It indicated that we can use hydrodynamic delivery approach to achieve almost the same effect in experiments.The results further provided a foundation to produce FLT3L-hIgG Fc protein.%目的 构建重组真核表达质粒PTT3-FLT3L-hIgG Fc,鉴定其诱导机体表达蛋白FLT3L-hIgG Fc的水平以及诱导小鼠淋巴结脾脏树突状细胞(DCs)的功能,探索体内注射质粒代替注射蛋白诱导DCs方法的可行性.方法 用PCR方法从小鼠肥大细胞P815细胞系中扩增出FLT3L基因片段,连接到PTT3-hIgG Fc载体上,得到重组真核表达质粒PTT3-FLT3L-hIgG Fc;通过酶切鉴定和测序检测目的基因核苷酸序列;尾静脉高压注射PTT3-FLT3L-hIgG Fc

  6. Parenting Across the Social Ecology Facilitated by Information and Communications Technology: Implications for Research and Educational Design

    Directory of Open Access Journals (Sweden)

    Susan K. Walker

    2014-06-01

    Full Text Available To inform parenting research and aid educators seeking to deliver programs that support effective parenting, this study explored types of information and communications technology (ICT used to fulfill childrearing goals. Mothers’ (N = 1,804 reports of ICT activity frequency were examined from data collected from an online survey. Results suggest that mothers’ ICT use for parenting is less frequent than general use in adulthood. Mothers employ ICT to fulfill parenting goals within and across five domains of the parenting social ecology: (a parent development, (b parent-child relationships, (c child development, (d, family development, and (e culture and community. Several types of ICT activities may strengthen parenting in a single domain, and a single ICT activity may help fulfill multiple domains. Implications for research and for promoting and selecting ICT for effective parent learning and education design are discussed.

  7. Fcγ receptor antigen targeting potentiates cross-presentation by human blood and lymphoid tissue BDCA-3+ dendritic cells.

    Science.gov (United States)

    Flinsenberg, Thijs W H; Compeer, Ewoud B; Koning, Dan; Klein, Mark; Amelung, Femke J; van Baarle, Debbie; Boelens, Jaap Jan; Boes, Marianne

    2012-12-20

    The reactivation of human cytomegalovirus (HCMV) poses a serious health threat to immune compromised individuals. As a treatment strategy, dendritic cell (DC) vaccination trials are ongoing. Recent work suggests that BDCA-3(+) (CD141(+)) subset DCs may be particularly effective in DC vaccination trials. BDCA-3(+) DCs had however been mostly characterized for their ability to cross-present antigen from necrotic cells. We here describe our study of human BDCA-3(+) DCs in elicitation of HCMV-specific CD8(+) T-cell clones. We show that Fcgamma-receptor (FcγR) antigen targeting facilitates antigen cross-presentation in several DC subsets, including BDCA-3(+) DCs. FcγR antigen targeting stimulates antigen uptake by BDCA-1(+) rather than BDCA-3(+) DCs. Conversely, BDCA-3(+) DCs and not BDCA-1(+) DCs show improved cross-presentation by FcγR targeting, as measured by induced release of IFNγ and TNF by antigen-specific CD8(+) T cells. FcγR-facilitated cross-presentation requires antigen processing in both an acidic endosomal compartment and by the proteasome, and did not induce substantial DC maturation. FcγRII is the most abundantly expressed FcγR on both BDCA-1(+) and BDCA-3(+) DCs. Furthermore we show that BDCA-3(+) DCs express relatively more stimulatory FcγRIIa than inhibitory FcγRIIb in comparison with BDCA-1(+) DCs. These studies support the exploration of FcγR antigen targeting to BDCA-3(+) DCs for human vaccination purposes.

  8. The long elusive IgM Fc receptor, FcμR.

    Science.gov (United States)

    Kubagawa, Hiromi; Oka, Satoshi; Kubagawa, Yoshiki; Torii, Ikuko; Takayama, Eiji; Kang, Dong-Won; Jones, Dewitt; Nishida, Naonori; Miyawaki, Toshio; Bertoli, Luigi F; Sanders, Sheila K; Honjo, Kazuhito

    2014-07-01

    IgM exists as both a monomer on the surface of B cells and a pentamer secreted by plasma cells. Both pre-immune "natural" and antigen-induced "immune" IgM antibodies are important for protective immunity and for immune regulation of autoimmune processes by recognizing pathogens and self-antigens. Effector proteins interacting with the Fc portion of IgM, such as complement and complement receptors, have thus far been proposed but fail to fully account for the IgM-mediated protection and regulation. A major reason for this deficit in our understanding of IgM function seems to be lack of data on a long elusive Fc receptor for IgM (FcμR). We have recently identified a bona fide FcμR in both humans and mice. In this article we briefly review what we have learned so far about FcμR.

  9. The impact of a faculty learning community on professional and personal development: the facilitator training program of the American Academy on Communication in Healthcare.

    Science.gov (United States)

    Chou, Calvin L; Hirschmann, Krista; Fortin, Auguste H; Lichstein, Peter R

    2014-07-01

    Relationship-centered care attends to the entire network of human relationships essential to patient care. Few faculty development programs prepare faculty to teach principles and skills in relationship-centered care. One exception is the Facilitator Training Program (FTP), a 25-year-old training program of the American Academy on Communication in Healthcare. The authors surveyed FTP graduates to determine the efficacy of its curriculum and the most important elements for participants' learning. In 2007, surveys containing quantitative and narrative elements were distributed to 51 FTP graduates. Quantitative data were analyzed using descriptive statistics. The authors analyzed narratives using Burke's dramatistic pentad as a qualitative framework to delineate how interrelated themes interacted in the FTP. Forty-seven respondents (92%) identified two essential acts that happened in the program: an iterative learning process, leading to heightened personal awareness and group facilitation skills; and longevity of learning and effect on career. The structure of the program's learning community provided the scene, and the agents were the participants, who provided support and contributed to mutual success. Methods of developing skills in personal awareness, group facilitation, teaching, and feedback constituted agency. The purpose was to learn skills and to join a community to share common values. The FTP is a learning community that provided faculty with skills in principles of relationship-centered care. Four further features that describe elements of this successful faculty-based learning community are achievement of self-identified goals, distance learning modalities, opportunities to safely discuss workplace issues outside the workplace, and self-renewing membership.

  10. Dicty_cDB: FC-BS13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS13 (Link to dictyBase) - - - Contig-U15818-1 FC-BS13P (Li...nk to Original site) FC-BS13F 636 FC-BS13Z 565 FC-BS13P 1201 - - Show FC-BS13 Library FC (Link to library) Clone ID FC-BS1...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS13Q.Seq.d/ Repr...esentative seq. ID FC-BS13P (Link to Original site) Representative DNA sequence >FC-BS13 (FC-BS13Q) /CSM/FC/FC-BS/FC-BS1...tiii*skr*rnn**ekiiifwkiint *idinqkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BS1

  11. Several Factors of Library Publishing Services Facilitate Scholarly Communication Functions. A Review of: Park, J.-H., & Shim, J. (2011. Exploring how library publishing services facilitate scholarly communication. Journal of Scholarly Publishing, 43(1, 76-89. doi: 10.1353/scp.2011.0038

    Directory of Open Access Journals (Sweden)

    Leslie Bussert

    2012-12-01

    Full Text Available Objective – To identify and examine thefactors of library publishing services thatfacilitate scholarly communication.Design – Analysis of library publishing serviceprograms.Setting – North American research libraries.Subjects – Eight research libraries selectedfrom the signatories for the Compact for Open-Access Publishing Equity (COPE CornellUniversity Library’s Center for InnovativePublishing; Dartmouth College Library’sDigital Publishing Program and ScholarsPortal Project; MIT Libraries’ Office ofScholarly Publishing and Licensing; ColumbiaUniversity Libraries’ Center for DigitalResearch and Scholarship; University ofMichigan Library’s Scholarly PublishingOffice; Duke University Library’s Office ofScholarly Communications; University ofCalgary Libraries and Cultural Resources’Centre for Scholarly Communication; andSimon Fraser University Library’s ScholarlyPublishing.Methods – The authors used Roosendaal andGeurt’s (1997 four functions of scholarlycommunication to analyze and categorizelibrary publishing services provided bylibraries included in the study. The fourfunctions of scholarly communication includeregistration, certification, awareness, andarchiving.Main Results – Analysis of the registration functions provided by library publishing services in this study revealed three types of facilitating factors: intellectual property, licensing, and publishing. These include services such as repositories for digital scholarly work and research, ISBN/ISSN registration, and digital publishing. Analysis of archiving functions demonstrated that most programs in the study focus on repository-related services in support of digital content preservation of papers, datasets, technical reports, etc. Analysis of certification functions provided by these services exposed a focus on expert review and research support. These include services like professional assessment of information sources, consultation on appropriate

  12. Training facilitators and supervisors

    DEFF Research Database (Denmark)

    Kjær, Louise Binow; O Connor, Maja; Krogh, Kristian;

    At the Master’s program in Medicine at Aarhus University, Denmark, we have developed a faculty development program for facilitators and supervisors in 4 progressing student modules in communication, cooperation, and leadership. 1) A course for module 1 and 3 facilitators inspired by the apprentic...

  13. Analysis and characterization of aggregation of a therapeutic Fc-fusion protein.

    Science.gov (United States)

    Wang, Tian; Fodor, Szilan; Hapuarachchi, Suminda; Jiang, Xinzhao Grace; Chen, Ken; Apostol, Izydor; Huang, Gang

    2013-01-01

    Protein aggregation was observed in a purification intermediate of a therapeutic Fc-fusion protein stored at -30 °C, even though the protein was stable at 4 and -80 °C. The protein was expressed in Escherichia coli as an inclusion body, refolded, and purified using chromatography columns. To study the nature of this aggregation, a series of experiments were conducted to investigate factors that contributed to the protein instability during freezing. We found that the presence of free thiols in the protein is the intrinsic cause. The free thiol cross-linking sites were determined to be at the peptide moiety of the Fc-fusion protein using LC-MS. Partially frozen accompanied by the elevated pH and increased salt and protein concentrations were identified as extrinsic factors that facilitated the aggregation. These results provided important insights into purification process improvement and solution storage of this Fc-fusion protein.

  14. An intracellular traffic jam: Fc receptor-mediated transport of immunoglobulin G.

    Science.gov (United States)

    Tesar, Devin B; Björkman, Pamela J

    2010-04-01

    Recent advances in imaging techniques along with more powerful in vitro and in vivo models of receptor-mediated ligand transport are facilitating advances in our understanding of how cells efficiently direct receptors and their cargo to target destinations within the cytoplasm and at the plasma membrane. Specifically, light and 3D electron microscopy studies examining the trafficking behavior of the neonatal Fc receptor (FcRn), a transport receptor for immunoglobulin G (IgG), have given us new insights into the dynamic interplay between the structural components of the cytosolic trafficking machinery, its protein regulators, and the receptors it directs to various locations within the cell. These studies build upon previous biochemical characterizations of FcRn transport and are allowing us to begin formulation of a more complete model for the intracellular trafficking of receptor-ligand complexes.

  15. Revisiting Field Capacity (FC: variation of definition of FC and its estimation from pedotransfer functions

    Directory of Open Access Journals (Sweden)

    Theophilo Benedicto Ottoni Filho

    2014-12-01

    Full Text Available Taking into account the nature of the hydrological processes involved in in situ measurement of Field Capacity (FC, this study proposes a variation of the definition of FC aiming not only at minimizing the inadequacies of its determination, but also at maintaining its original, practical meaning. Analysis of FC data for 22 Brazilian soils and additional FC data from the literature, all measured according to the proposed definition, which is based on a 48-h drainage time after infiltration by shallow ponding, indicates a weak dependency on the amount of infiltrated water, antecedent moisture level, soil morphology, and the level of the groundwater table, but a strong dependency on basic soil properties. The dependence on basic soil properties allowed determination of FC of the 22 soil profiles by pedotransfer functions (PTFs using the input variables usually adopted in prediction of soil water retention. Among the input variables, soil moisture content θ (6 kPa had the greatest impact. Indeed, a linear PTF based only on it resulted in an FC with a root mean squared residue less than 0.04 m³ m-3 for most soils individually. Such a PTF proved to be a better FC predictor than the traditional method of using moisture content at an arbitrary suction. Our FC data were compatible with an equivalent and broader USA database found in the literature, mainly for medium-texture soil samples. One reason for differences between FCs of the two data sets of fine-textured soils is due to their different drainage times. Thus, a standardized procedure for in situ determination of FC is recommended.

  16. Dicty_cDB: FC-BS14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS14 (Link to dictyBase) - - - Contig-U16399-1 FC-BS14E (Li...nk to Original site) - - - - - - FC-BS14E 534 Show FC-BS14 Library FC (Link to library) Clone ID FC-BS14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS14Q.Seq.d/ Representative seq. ID FC-BS1...4E (Link to Original site) Representative DNA sequence >FC-BS14 (FC-BS14Q) /CSM/FC/FC-BS/FC-BS14Q.Seq.... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BS14 (FC-BS1

  17. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  18. Dicty_cDB: FC-AS12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS12 (Link to dictyBase) - - - Contig-U15984-1 FC-AS12P (Li...nk to Original site) FC-AS12F 486 FC-AS12Z 445 FC-AS12P 931 - - Show FC-AS12 Library FC (Link to library) Clone ID FC-AS...12 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15984-1 Origin...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS12Q.Seq.d/ Representative seq. ID FC-AS...12P (Link to Original site) Representative DNA sequence >FC-AS12 (FC-AS12Q) /CSM/FC/FC-AS/FC-AS

  19. Dicty_cDB: FC-AS17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS17 (Link to dictyBase) - - - Contig-U15985-1 FC-AS17P (Li...nk to Original site) FC-AS17F 390 FC-AS17Z 158 FC-AS17P 548 - - Show FC-AS17 Library FC (Link to library) Clone ID FC-AS...17 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15985-1 Origin...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS17Q.Seq.d/ Representative seq. ID FC-AS...17P (Link to Original site) Representative DNA sequence >FC-AS17 (FC-AS17Q) /CSM/FC/FC-AS/FC-AS

  20. Dicty_cDB: FC-AS20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS20 (Link to dictyBase) - - - Contig-U15987-1 FC-AS20P (Li...nk to Original site) FC-AS20F 620 FC-AS20Z 287 FC-AS20P 907 - - Show FC-AS20 Library FC (Link to library) Clone ID FC-AS...20 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15987-1 Origin...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS20Q.Seq.d/ Representative seq. ID FC-AS...20P (Link to Original site) Representative DNA sequence >FC-AS20 (FC-AS20Q) /CSM/FC/FC-AS/FC-AS

  1. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  2. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  3. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  4. Dicty_cDB: FC-AI02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI02 (Link to dictyBase) - - - Contig-U16513-1 FC-AI02E (Li...nk to Original site) - - - - - - FC-AI02E 535 Show FC-AI02 Library FC (Link to library) Clone ID FC-AI02 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI02Q.Seq.d/ Representative seq. ID FC-AI...02E (Link to Original site) Representative DNA sequence >FC-AI02 (FC-AI02Q) /CSM/FC/FC-AI/FC-AI02Q.Seq....ogy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AI02 (FC-AI

  5. Simultaneous Targeting of FcγRs and FcαRI Enhances Tumor Cell Killing

    NARCIS (Netherlands)

    Brandsma, Arianne M; Ten Broeke, Toine; Nederend, Maaike; Meulenbroek, Laura A P M; van Tetering, Geert; Meyer, Saskia; Jansen, J H Marco; Beltrán Buitrago, M Alejandra; Nagelkerke, Sietse Q; Németh, István; Ubink, Ruud; Rouwendal, Gerard; Lohse, Stefan; Valerius, Thomas; Leusen, Jeanette H W; Boross, Peter

    2015-01-01

    Efficacy of anticancer monoclonal antibodies (mAb) is limited by the exhaustion of effector mechanisms. IgG mAbs mediate cellular effector functions through FcγRs expressed on effector cells. IgA mAbs can also induce efficient tumor killing both in vitro and in vivo. IgA mAbs recruit FcαRI-expressin

  6. Transepithelial Transport of Fc -Targeted Nanoparticles by the Neonatal Fc Receptor for Oral Delivery

    Science.gov (United States)

    Pridgen, Eric M.; Alexis, Frank; Kuo, Timothy T.; Levy-Nissenbaum, Etgar; Karnik, Rohit; Blumberg, Richard S.; Langer, Robert; Farokhzad, Omid C.

    2014-01-01

    Nanoparticles are poised to have a tremendous impact on the treatment of many diseases, but their broad application is limited because currently they can only be administered by parenteral methods. Oral administration of nanoparticles is preferred but remains a challenge because transport across the intestinal epithelium is limited. Here, we show that nanoparticles targeted to the neonatal Fc receptor (FcRn), which is known to mediate the transport of IgG antibodies across epithelial barriers, are efficiently transported across the intestinal epithelium using both in vitro and in vivo models. In mice, orally administered FcRn-targeted nanoparticles crossed the intestinal epithelium and reached systemic circulation with a mean absorption efficiency of 13.7%*h compared with only 1.2%*h for non-targeted nanoparticles. In addition, targeted nanoparticles containing insulin as a model nanoparticle-based therapy for diabetes were orally administered at a clinically relevant insulin dose of 1.1 U/kg and elicited a prolonged hypoglycemic response in wild-type mice. This effect was abolished in FcRn knockout mice, indicating the enhanced nanoparticle transport was due specifically to FcRn. FcRn-targeted nanoparticles may have a major impact on the treatment of many diseases by enabling drugs currently limited by low bioavailability to be efficiently delivered though oral administration. PMID:24285486

  7. Communications

    Science.gov (United States)

    Bailenson, Jeremy; Buzzanell, Patrice; Deetz, Stanley; Tewksbury, David; Thompson, Robert J.; Turow, Joseph; Bichelmeyer, Barbara; Bishop, M. J.; Gayeski, Diane

    2013-01-01

    Scholars representing the field of communications were asked to identify what they considered to be the most exciting and imaginative work currently being done in their field, as well as how that work might change our understanding. The scholars included Jeremy Bailenson, Patrice Buzzanell, Stanley Deetz, David Tewksbury, Robert J. Thompson, and…

  8. IgG-Fc-glycosylation in immune-mediated cytopenias

    NARCIS (Netherlands)

    Sonneveld, M.E.

    2017-01-01

    Antibody Fc-glycosylation affects allo- and autoimmunity towards blood cells. Low Fc-fucosylation increases IgG-binding affinity to FcγRIIIa/b, thereby contributing to enhanced cell breakdown and hence, a worse clinical outcome. In this thesis we contribute to the development of new diagnostic assay

  9. Dicty_cDB: FC-BS17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BS17 (Link to dictyBase) - - - Contig-U16491-1 FC-BS17Z (Li...nk to Original site) - - FC-BS17Z 725 - - - - Show FC-BS17 Library FC (Link to library) Clone ID FC-BS17 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS17Q.Seq.d/ Representative seq. ID FC-BS1...7Z (Link to Original site) Representative DNA sequence >FC-BS17 (FC-BS17Q) /CSM/FC/FC-BS/FC-BS17Q.Seq....-cDNA Score E Sequences producing significant alignments: (bits) Value VSF675 (VSF675Q) /CSM/VS/VSF6-D/VSF67

  10. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  11. Dicty_cDB: FC-AS10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS10 (Link to dictyBase) - - - Contig-U16538-1 FC-AS10Z (Li...nk to Original site) - - FC-AS10Z 549 - - - - Show FC-AS10 Library FC (Link to library) Clone ID FC-AS10 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16538-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS10Q.Seq.d/ Representative seq. ID FC-AS...10Z (Link to Original site) Representative DNA sequence >FC-AS10 (FC-AS10Q) /CSM/FC/FC-AS/FC-AS10Q.Seq.

  12. Dicty_cDB: FC-AS15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS15 (Link to dictyBase) - - - Contig-U16090-1 FC-AS15E (Li...nk to Original site) - - - - - - FC-AS15E 616 Show FC-AS15 Library FC (Link to library) Clone ID FC-AS15 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16090-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS15Q.Seq.d/ Representative seq. ID FC-AS...15E (Link to Original site) Representative DNA sequence >FC-AS15 (FC-AS15Q) /CSM/FC/FC-AS/FC-AS15Q.Seq.

  13. Dicty_cDB: FC-AS03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS03 (Link to dictyBase) - - - - FC-AS03Z (Link to Original site) - - FC-AS...03Z 540 - - - - Show FC-AS03 Library FC (Link to library) Clone ID FC-AS03 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS...03Q.Seq.d/ Representative seq. ID FC-AS03Z (Link to Original s...ite) Representative DNA sequence >FC-AS03 (FC-AS03Q) /CSM/FC/FC-AS/FC-AS03Q.Seq.d/ XXXXXXXXXXACAAAAGATTACAAT

  14. Dicty_cDB: FC-AS07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS07 (Link to dictyBase) - - - Contig-U14940-1 FC-AS07E (Li...nk to Original site) - - - - - - FC-AS07E 730 Show FC-AS07 Library FC (Link to library) Clone ID FC-AS07 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14940-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS07Q.Seq.d/ Representative seq. ID FC-AS...07E (Link to Original site) Representative DNA sequence >FC-AS07 (FC-AS07Q) /CSM/FC/FC-AS/FC-AS07Q.Seq.

  15. Dicty_cDB: FC-AS06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS06 (Link to dictyBase) - - - Contig-U15075-1 FC-AS06Z (Li...nk to Original site) - - FC-AS06Z 367 - - - - Show FC-AS06 Library FC (Link to library) Clone ID FC-AS06 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15075-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS06Q.Seq.d/ Representative seq. ID FC-AS...06Z (Link to Original site) Representative DNA sequence >FC-AS06 (FC-AS06Q) /CSM/FC/FC-AS/FC-AS06Q.Seq.

  16. Dicty_cDB: FC-AS08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS08 (Link to dictyBase) - - - Contig-U16491-1 FC-AS08Z (Li...nk to Original site) - - FC-AS08Z 572 - - - - Show FC-AS08 Library FC (Link to library) Clone ID FC-AS08 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16491-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS08Q.Seq.d/ Representative seq. ID FC-AS...08Z (Link to Original site) Representative DNA sequence >FC-AS08 (FC-AS08Q) /CSM/FC/FC-AS/FC-AS08Q.Seq.

  17. Dicty_cDB: FC-AS01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS01 (Link to dictyBase) - - - Contig-U16172-1 FC-AS01Z (Li...nk to Original site) - - FC-AS01Z 583 - - - - Show FC-AS01 Library FC (Link to library) Clone ID FC-AS01 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16172-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS01Q.Seq.d/ Representative seq. ID FC-AS...01Z (Link to Original site) Representative DNA sequence >FC-AS01 (FC-AS01Q) /CSM/FC/FC-AS/FC-AS01Q.Seq.

  18. Dicty_cDB: FC-AS23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS23 (Link to dictyBase) - - - Contig-U15550-1 FC-AS23Z (Li...nk to Original site) - - FC-AS23Z 519 - - - - Show FC-AS23 Library FC (Link to library) Clone ID FC-AS23 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15550-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS23Q.Seq.d/ Representative seq. ID FC-AS...23Z (Link to Original site) Representative DNA sequence >FC-AS23 (FC-AS23Q) /CSM/FC/FC-AS/FC-AS23Q.Seq.

  19. Dicty_cDB: FC-AS24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS24 (Link to dictyBase) - - - Contig-U15127-1 FC-AS24Z (Li...nk to Original site) - - FC-AS24Z 454 - - - - Show FC-AS24 Library FC (Link to library) Clone ID FC-AS24 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15127-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS24Q.Seq.d/ Representative seq. ID FC-AS...24Z (Link to Original site) Representative DNA sequence >FC-AS24 (FC-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.

  20. Dicty_cDB: FC-BL11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BL11 (Link to dictyBase) - - - Contig-U15198-1 FC-BL11Z (Li...nk to Original site) - - FC-BL11Z 671 - - - - Show FC-BL11 Library FC (Link to library) Clone ID FC-BL11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BL/FC-BL11Q.Seq.d/ Representative seq. ID FC-BL1...1Z (Link to Original site) Representative DNA sequence >FC-BL11 (FC-BL11Q) /CSM/FC/FC-BL/FC-BL11Q.Seq....ALDNSCSLVDGTEDVYQQIFYSPSFQ*in*ifeitikkkkk Homology vs CSM-cDNA Score E Sequences producing significant align

  1. Dicty_cDB: FC-BF11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BF11 (Link to dictyBase) - - - Contig-U16455-1 FC-BF11Z (Li...nk to Original site) - - FC-BF11Z 718 - - - - Show FC-BF11 Library FC (Link to library) Clone ID FC-BF11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BF/FC-BF11Q.Seq.d/ Representative seq. ID FC-BF1...1Z (Link to Original site) Representative DNA sequence >FC-BF11 (FC-BF11Q) /CSM/FC/FC-BF/FC-BF11Q.Seq....: (bits) Value N X55973 |X55973.1 D. discoideum EF1-I gene for elongation factor 1 alpha. 1292 0.0 1 X55972

  2. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  3. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  4. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  5. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  6. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  7. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  8. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  9. Dicty_cDB: FC-BC24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BC24 (Link to dictyBase) - - - Contig-U15479-1 FC-BC24Z (Li...nk to Original site) - - FC-BC24Z 578 - - - - Show FC-BC24 Library FC (Link to library) Clone ID FC-BC24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BC/FC-BC24Q.Seq.d/ Representative seq. ID FC-BC2...4Z (Link to Original site) Representative DNA sequence >FC-BC24 (FC-BC24Q) /CSM/FC/FC-BC/FC-BC24Q.Seq....m mRNA for ribosomal acidic phosphoprotein P0. 1068 0.0 2 CD681220 |CD681220.1 tac23d06.y1 Hydra EST -IV Hyd

  10. Dicty_cDB: FC-IC1118 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1118 (Link to dictyBase) - - - - FC-IC1118E (Link to Original site) FC-IC... to library) Clone ID FC-IC1118 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Ori...re E Sequences producing significant alignments: (bits) Value FC-IC1118 (FC-IC1118Q) /CSM/FC-IC/FC-IC...%: extracellular, including cell wall 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-IC1118 is cyt 5' end seq. ID FC-IC...1118F 398 FC-IC1118Z 400 FC-IC1118P 778 FC-IC1118E 390 Show FC-IC1118 Library FC-IC (Link

  11. Dicty_cDB: FC-IC0790 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0790 (Link to dictyBase) - - - Contig-U14940-1 FC-IC07... (Link to library) Clone ID FC-IC0790 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U14940-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0790 (FC-IC0790Q) /CSM/FC-IC/FC-IC...90E (Link to Original site) FC-IC0790F 305 FC-IC0790Z 305 FC-IC0790P 590 FC-IC0790E 295 Show FC-IC0790 Library FC-IC

  12. Dicty_cDB: FC-IC1261 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1261 (Link to dictyBase) - - - - FC-IC1261E (Link to Original site) FC-IC... to library) Clone ID FC-IC1261 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Ori...SM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC1760Q) /CSM/FC-IC/FC-IC...etal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC1261 is end 5' end seq. ID FC-IC...1261F 255 FC-IC1261Z 439 FC-IC1261P 674 FC-IC1261E 429 Show FC-IC1261 Library FC-IC (Link

  13. Dicty_cDB: FC-IC0142 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0142 (Link to dictyBase) - G24282 DDB0231822 Contig-U03313-1 FC-IC...tig Contig-U03313-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...E Sequences producing significant alignments: (bits) Value FC-IC0142 (FC-IC0142Q) /CSM/FC-IC/FC-IC0142Q.Seq....les of secretory system >> prediction for FC-IC0142 is cyt 5' end seq. ID FC-IC0142F 5' end seq. >FC-IC...0142F (Link to Original site) FC-IC0142F 280 - - - - - - Show FC-IC0142 Library FC-IC (Link to library) Clone ID FC-IC

  14. Characterization of the rabbit neonatal Fc receptor (FcRn) and analyzing the immunophenotype of the transgenic rabbits that overexpresses FcRn.

    Science.gov (United States)

    Catunda Lemos, Ana Paula; Cervenak, Judit; Bender, Balázs; Hoffmann, Orsolya Ivett; Baranyi, Mária; Kerekes, Andrea; Farkas, Anita; Bosze, Zsuzsanna; Hiripi, László; Kacskovics, Imre

    2012-01-01

    The neonatal Fc receptor (FcRn) regulates IgG and albumin homeostasis, mediates maternal IgG transport, takes an active role in phagocytosis, and delivers antigen for presentation. We have previously shown that overexpression of FcRn in transgenic mice significantly improves the humoral immune response. Because rabbits are an important source of polyclonal and monoclonal antibodies, adaptation of our FcRn overexpression technology in this species would bring significant advantages. We cloned the full length cDNA of the rabbit FcRn alpha-chain and found that it is similar to its orthologous analyzed so far. The rabbit FcRn - IgG contact residues are highly conserved, and based on this we predicted pH dependent interaction, which we confirmed by analyzing the pH dependent binding of FcRn to rabbit IgG using yolk sac lysates of rabbit fetuses by Western blot. Using immunohistochemistry, we detected strong FcRn staining in the endodermal cells of the rabbit yolk sac membrane, while the placental trophoblast cells and amnion showed no FcRn staining. Then, using BAC transgenesis we generated transgenic rabbits carrying and overexpressing a 110 kb rabbit genomic fragment encoding the FcRn. These transgenic rabbits--having one extra copy of the FcRn when hemizygous and two extra copies when homozygous--showed improved IgG protection and an augmented humoral immune response when immunized with a variety of different antigens. Our results in these transgenic rabbits demonstrate an increased immune response, similar to what we described in mice, indicating that FcRn overexpression brings significant advantages for the production of polyclonal and monoclonal antibodies.

  15. A model of facilitative communication for the support of general hospital nurses nursing mentally ill people. Part I: background, problem statement and research methodology.

    Science.gov (United States)

    Mavundla, T R; Poggenpoel, M; Gmeiner, A

    2001-03-01

    The impressive growth in the extent and range of psychiatric services provided by general hospitals in South Africa creates stress among nurses employed in these settings who are not psychiatric trained. This manifests itself in negative attitudes displayed towards mentally ill people. The aim of this paper is to discuss the process followed in the development of the model of facilitative communication. A theory generative design was used. The research methods were dealt with in four steps of theory generation as set out below. Step 1 entailed concept analysis. This step was dealt with in two phases, namely concept identification and concept definition. During concept identification, a qualitative research strategy that is explorative, descriptive and contextual was used. This was achieved through field research conducted in an urban general hospital. A sample of twelve professional nurses was selected from a population of 800 professional nurses employed in a general hospital using the purposive sampling technique. This sample size was determined by saturation of data in themes. Both semi-structured individual phenomenological interviews and observations were used as methods of data collection. Giorgi's method of descriptive data analysis (1985) was used. Four themes emerged from the results of the study. The main concepts of the model were identified and classified using a survey list of Dickoff et al. (1968). Step 2 dealt with the creation of interrelationship statements between concepts identified in Step 1, while Step 3 dealt with the description of the model using strategies proposed by Chinn and Kramer (1991). In Step 4, the description of guidelines for operationalizing in practice was ensured. To ensure valid results, a model for trustworthiness proposed by Guba (Lincoln & Guba, 1985) was used. The following criteria for trustworthiness were applied in all the steps of theory generation: truth value, applicability, consistency and neutrality.

  16. Fcγ Receptor Heterogeneity in Leukocyte Functional Responses

    Science.gov (United States)

    Rosales, Carlos

    2017-01-01

    Antibodies participate in defense of the organism from all types of pathogens, including viruses, bacteria, fungi, and protozoa. IgG antibodies recognize their associated antigen via their two Fab portions and are in turn recognized though their Fc portion by specific Fcγ receptors (FcγRs) on the membrane of immune cells. Multiple types and polymorphic variants of FcγR exist. These receptors are expressed in many cells types and are also redundant in inducing cell responses. Crosslinking of FcγR on the surface of leukocytes activates several effector functions aimed toward the destruction of pathogens and the induction of an inflammatory response. In the past few years, new evidence on how the particular IgG subclass and the glycosylation pattern of the antibody modulate the IgG–FcγR interaction has been presented. Despite these advances, our knowledge of what particular effector function is activated in a certain cell and in response to a specific type of FcγR remains very limited today. On one hand, each immune cell could be programmed to perform a particular cell function after FcγR crosslinking. On the other, each FcγR could activate a particular signaling pathway leading to a unique cell response. In this review, I describe the main types of FcγRs and our current view of how particular FcγRs activate various signaling pathways to promote unique leukocyte functions. PMID:28373871

  17. REGULATION OF Fc RECEPTOR ENDOCYTIC TRAFFICKING BY UBIQUITINATION

    Directory of Open Access Journals (Sweden)

    Rosa eMolfetta

    2014-09-01

    Full Text Available Most immune cells, particularly phagocytes, express various receptors for the Fc-portion of the different immunoglobulin isotypes (Fc receptors, FcRs. By binding to the antibody, they provide a link between the adaptive immune system and the powerful effector functions triggered by innate immune cells such as mast cells, neutrophils, macrophages, and NK cells. Upon ligation of the immune complexes, the downstream signalling pathways initiated by the different receptors are quite similar for different FcR classes leading to the secretion of preformed and de novo synthesized pro-inflammatory mediators. FcR engagement also promotes negative signals through the combined action of several molecules that limit the extent and duration of positive signalling. To this regard, ligand-induced ubiquitination of Fc receptors for IgE (FcεR and IgG (FcγR has become recognized as a key modification that generates signals for the internalization and/or delivery of engaged receptor complexes to lysosomes or cytoplasmic proteasomes for degradation, providing negative-feedback regulation of Fc receptor activity.In this review, we discuss recent advances in our understanding of the molecular mechanisms that ensure the clearance of engaged Fcε and Fcγ receptor complexes from the cell surface with an emphasis given to the cooperation between the ubiquitin pathway and endosomal adaptors including the endosomal sorting complex required for transport (ESCRT in controlling receptor internalization and sorting along the endocytic compartments.

  18. Fc gamma RI blockade and modulation for immunotherapy.

    Science.gov (United States)

    Wallace, P K; Keler, T; Guyre, P M; Fanger, M W

    1997-01-01

    Splenectomy and corticosteroids are the treatment of choice for patients with immune thrombocytopenic purpura (ITP). However, for the 10%-15% of patients who do not respond to conventional therapy, high-dose i.v. IgG can induce life-saving transient responses. The benefits of i.v. IgG have been attributed to Fc receptor blockade; however, the involvement of the individual Fc receptors for IgG (Fc gamma R) in ITP remain to be more completely defined. Recently a mAb, designated mAb H22, which recognizes an epitope on Fc gamma RI (CD64) outside the ligand-binding domain, was humanized. Because mAb H22 is a human IgG1 and Fc gamma RI has a high affinity for human IgG1 antibodies, we predicted that mAb H22 would bind to the Fc gamma RI ligand-binding site through its Fc domain and to its external Fc gamma RI epitope through both Fab domains. These studies demonstrate that mAb H22 blocked Fc gamma RI-mediated phagocytosis of opsonized red blood cells more effectively than an irrelevant IgG. Moreover, cross-linking Fc gamma RI with mAb H22 down-modulated Fc gamma RI expression on monocytes, an effect seen within 2 h.

  19. FC-normal and extended stratified logic program

    Institute of Scientific and Technical Information of China (English)

    许道云; 丁德成

    2002-01-01

    This paper investigates the consistency property of FC-normal logic program and presentsan equivalent deciding condition whether a logic program P is an FC-normal program. The decidingcondition describes the characterizations of FC-normal program. By the Petri-net presentation ofa logic program, the characterizations of stratification of FC-normal program are investigated. Thestratification of FC-normal program motivates us to introduce a new kind of stratification, extendedstratification, over logic program. It is shown that an extended (locally) stratified logic program isan FC-normal program. Thus, an extended (locally) stratified logic program has at least one stablemodel. Finally, we have presented algorithms about computation of consistency property and a fewequivalent deciding methods of the finite FC-normal program.

  20. COMMUNICATIONS

    CERN Document Server

    A. Petrilli

    2013-01-01

    The organisation of the Open Days at the end of September was the single biggest effort of the CMS Communications Group this year. We would like to thank all volunteers for their hard work to show our Point 5 facilities and explain science and technology to the general public. During two days more than 5,000 people visited the CMS detector underground and profited from the surface activities, which included an exhibition on CMS, a workshop on superconductivity, and an activity for our younger visitors involving wooden Kapla blocks. The Communications Group took advantage of the preparations to produce new CMS posters that can be reused at other venues. Event display images have been produced not just for this occasion but also for other exhibits, education purposes, publications etc. During the Open Days, Gilles Jobin, 2012 winner of CERN Collide@CERN prize, performed his Quantum show in Point 5, with the light installation of German artist Julius von Bismarck. Image 3: CERN Open Days at CMS wel...

  1. COMMUNICATIONS

    CERN Multimedia

    L. Taylor and D. Barney

    2010-01-01

    CMS Centres, Outreach and the 7 TeV Media Event The new CMS Communications group is now established and is addressing three areas that are critical to CMS as it enters the physics operations phase: - Communications Infrastructure, including almost 50 CMS Centres Worldwide, videoconferencing systems, and CERN meeting rooms - Information systems, including the internal and external Web sites as well as the document preparation and management systems - Outreach and Education activities, including working with print, radio and TV media, visits to CMS, and exhibitions. The group has been active in many areas, with the highest priority being accorded to needs of CMS operations and preparations for the major media event planned for 7 TeV collisions. Unfortunately the CMS Centre@CERN suffered a major setback when, on 21st December, a cooling water pipe froze and burst on the floor above the CMS Centre main room. Water poured through the ceiling, flooding the floor and soaking some of the consoles, before e...

  2. Site-selective conjugation of an anticoagulant aptamer to recombinant albumins and maintenance of neonatal Fc receptor binding

    Science.gov (United States)

    Schmøkel, Julie; Voldum, Anders; Tsakiridou, Georgia; Kuhlmann, Matthias; Cameron, Jason; Sørensen, Esben S.; Wengel, Jesper; Howard, Kenneth A.

    2017-05-01

    Aptamers are an attractive molecular medicine that offers high target specificity. Nucleic acid-based aptamers, however, are prone to nuclease degradation and rapid renal excretion that require blood circulatory half-life extension enabling technologies. The long circulatory half-life, predominately facilitated by engagement with the cellular recycling neonatal Fc receptor (FcRn), and ligand transport properties of albumin promote it as an attractive candidate to improve the pharmacokinetic profile of aptamers. This study investigates the effect of Cys34 site-selective covalent attachment of a factor IXa anticoagulant aptamer on aptamer functionality and human FcRn (hFcRn) engagement using recombinant human albumin (rHA) of either a wild type (WT) or an engineered human FcRn high binding variant (HB). Albumin-aptamer conjugates, connected covalently through a heterobifunctional succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate linker, were successfully prepared and purified by high performance liquid chromatography as confirmed by gel electrophoresis band-shift analysis and matrix-assisted laser desorption/ionization time of flight. Minimal reduction (∼25%) in activity of WT-linked aptamer to that of aptamer alone was found using an anticoagulant activity assay measuring temporal levels of activated partial thrombin. Covalent albumin-aptamer conjugation, however, substantially compromized binding to hFcRn, to 10% affinity of that of non-conjugated WT, determined by biolayer interferometry. Binding could be rescued by aptamer conjugation to recombinant albumin engineered for higher FcRn affinity (HB) that exhibited an 8-fold affinity compared to WT alone. This work describes a novel albumin-based aptamer delivery system whose hFcRn binding can be increased using a HB engineered albumin.

  3. Dicty_cDB: FC-AS18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS18 (Link to dictyBase) - G03233 DDB0231612 Contig-U15937-1 FC-AS... to library) Clone ID FC-AS18 (Link to dictyBase) Atlas ID - NBRP ID G03233 dictyBase ID DDB0231612 Link to ...18P (Link to Original site) FC-AS18F 508 FC-AS18Z 542 FC-AS18P 1050 - - Show FC-AS18 Library FC (Link...Contig Contig-U15937-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS...18Q.Seq.d/ Representative seq. ID FC-AS18P (Link to Original site) Representative DNA sequence >FC-AS18 (FC-AS

  4. Dicty_cDB: FC-AS21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS21 (Link to dictyBase) - - - Contig-U15326-1 FC-AS21P (Li... %: nuclear 12.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for FC-AS21 is mit 5' end seq. ID FC-AS...nk to Original site) FC-AS21F 506 FC-AS21Z 184 FC-AS21P 690 - - Show FC-AS21 Library FC (Link to library) Clone ID FC-AS...21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15326-1 Origin...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS21Q.Seq.d/ Representative seq. ID FC-AS

  5. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  6. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  7. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  8. Dicty_cDB: FC-IC0282 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0282 (Link to dictyBase) - - - Contig-U16527-1 - (Link to Original site) FC-IC...(Link to library) Clone ID FC-IC0282 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig ...Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...ogy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC1760Q) /CSM/FC-IC/FC-IC...0282F 255 FC-IC0282Z 429 FC-IC0282P 673 FC-IC0282E 429 Show FC-IC0282 Library FC-IC

  9. Dicty_cDB: FC-IC0374 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0374 (Link to dictyBase) - - - Contig-U12354-1 FC-IC03... (Link to library) Clone ID FC-IC0374 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U12354-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...les of secretory system >> prediction for FC-IC0374 is end 5' end seq. ID FC-IC0374F 5' end seq. >FC-IC...74E (Link to Original site) FC-IC0374F 223 FC-IC0374Z 324 FC-IC0374P 547 FC-IC0374E 324 Show FC-IC0374 Library FC-IC

  10. Dicty_cDB: FC-IC1268 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1268 (Link to dictyBase) - - - Contig-U16527-1 FC-IC12...ink to library) Clone ID FC-IC1268 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...lpy*iw Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC1760Q) /CSM/FC-IC/FC-IC...68P (Link to Original site) FC-IC1268F 231 FC-IC1268Z 250 FC-IC1268P 461 - - Show FC-IC1268 Library FC-IC (L

  11. Fcγ receptors and ligands and cardiovascular disease.

    Science.gov (United States)

    Tanigaki, Keiji; Sundgren, Nathan; Khera, Amit; Vongpatanasin, Wanpen; Mineo, Chieko; Shaul, Philip W

    2015-01-16

    Fcγ receptors (FcγRs) classically modulate intracellular signaling on binding of the Fc region of IgG in immune response cells. How FcγR and their ligands affect cardiovascular health and disease has been interrogated recently in both preclinical and clinical studies. The stimulation of activating FcγR in endothelial cells, vascular smooth muscle cells, and monocytes/macrophages causes a variety of cellular responses that may contribute to vascular disease pathogenesis. Stimulation of the lone inhibitory FγcR, FcγRIIB, also has adverse consequences in endothelial cells, antagonizing NO production and reparative mechanisms. In preclinical disease models, activating FcγRs promote atherosclerosis, whereas FcγRIIB is protective, and activating FcγRs also enhance thrombotic and nonthrombotic vascular occlusion. The FcγR ligand C-reactive protein (CRP) has undergone intense study. Although in rodents CRP does not affect atherosclerosis, it causes hypertension and insulin resistance and worsens myocardial infarction. Massive data have accumulated indicating an association between increases in circulating CRP and coronary heart disease in humans. However, Mendelian randomization studies reveal that CRP is not likely a disease mediator. CRP genetics and hypertension warrant further investigation. To date, studies of genetic variants of activating FcγRs are insufficient to implicate the receptors in coronary heart disease pathogenesis in humans. However, a link between FcγRIIB and human hypertension may be emerging. Further knowledge of the vascular biology of FcγR and their ligands will potentially enhance our understanding of cardiovascular disorders, particularly in patients whose greater predisposition for disease is not explained by traditional risk factors, such as individuals with autoimmune disorders.

  12. FC vehicle hybridisation: an affordable solution for an energy-efficient FC powered drive train

    Science.gov (United States)

    Pede, G.; Iacobazzi, A.; Passerini, S.; Bobbio, A.; Botto, G.

    Fuel cells (FCs) have potential as clean and efficient energy sources for automotive applications without sacrifice in performance or driving range. However, the complete FC system must operate as efficiently as possible over the range of driving conditions that may be encountered while maintaining a low cost. To achieve this target, a storage unit can be introduced in the FC system to reduce the size of the fuel cell that is the most expensive component. This "hybrid" concept would not only reduce the drive train total cost but it also allow the recover of the braking energy and the operation at the voltage-current point of maximum efficiency for the FC system. Pro-and-cons of the "full-power" versus the "hybrid" configuration are shown in this work. The "Hybridisation rate" or "Hybridisation degree", a parameter expressed by the relationship between two installed powers, the generation power and the traction power, is also introduced and it is demonstrated that for each category of hybrid vehicles there is an optimal value of hybridisation degree. The storage systems considered are based on high power batteries or ultra capacitors (UCs) or a combination of them. A preliminary design of a sport utility vehicle (SUV) using a combined storage system and a FC energy source (called Triple Hybrid), is proposed. Finally, the experience of the Italian industry in this field is also reviewed.

  13. Fc fusion as a platform technology: potential for modulating immunogenicity.

    Science.gov (United States)

    Levin, Ditza; Golding, Basil; Strome, Scott E; Sauna, Zuben E

    2015-01-01

    The platform technology of fragment crystallizable (Fc) fusion, in which the Fc region of an antibody is genetically linked to an active protein drug, is among the most successful of a new generation of bioengineering strategies. Immunogenicity is a critical safety concern in the development of any protein therapeutic. While the therapeutic goal of generating Fc-fusion proteins has been to extend half-life, there is a critical mass of literature from immunology indicating that appropriate design of the Fc component has the potential to engage the immune system for product-specific outcomes. In the context of Fc-fusion therapeutics, a review of progress in understanding Fc biology suggests the prospect of engineering products that have an extended half-life and are able to modulate the immune system.

  14. Dicty_cDB: FC-AS13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS13 (Link to dictyBase) - - - Contig-U15149-1 FC-AS13P (Li...racellular, including cell wall 32.0 %: plasma membrane 20.0 %: endoplasmic reticulum 12.0 %: Golgi >> prediction for FC-AS...nk to Original site) FC-AS13F 390 FC-AS13Z 534 FC-AS13P 924 - - Show FC-AS13 Library FC (Link to library) Clone ID FC-AS...13 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15149-1 Origin...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS13Q.Seq.d/ Representative seq. ID FC-AS

  15. Dicty_cDB: FC-AS19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS19 (Link to dictyBase) - - - Contig-U15986-1 FC-AS19P (Li...00 m_ : 1.00 76.0 %: nuclear 12.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: cytoskeletal >> prediction for FC-AS...nk to Original site) FC-AS19F 136 FC-AS19Z 295 FC-AS19P 431 - - Show FC-AS19 Library FC (Link to library) Clone ID FC-AS...19 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15986-1 Origin...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS19Q.Seq.d/ Representative seq. ID FC-AS

  16. Dicty_cDB: FC-IC0618 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0618 (Link to dictyBase) - - - Contig-U07877-1 FC-IC06...ink to library) Clone ID FC-IC0618 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U07877-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...les of secretory system >> prediction for FC-IC0618 is cyt 5' end seq. ID FC-IC0618F 5' end seq. >FC-IC...18P (Link to Original site) FC-IC0618F 583 FC-IC0618Z 169 FC-IC0618P 732 - - Show FC-IC0618 Library FC-IC (L

  17. Dicty_cDB: FC-IC1558 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1558 (Link to dictyBase) - - - Contig-U15578-1 FC-IC15...ink to library) Clone ID FC-IC1558 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U15578-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...y system 4.0 %: peroxisomal >> prediction for FC-IC1558 is cyt 5' end seq. ID FC-IC1558F 5' end seq. >FC-IC1...58P (Link to Original site) FC-IC1558F 205 FC-IC1558Z 298 FC-IC1558P 483 - - Show FC-IC1558 Library FC-IC (L

  18. Dicty_cDB: FC-IC1004 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1004 (Link to dictyBase) - G24305 DDB0232093 Contig-U13941-1 FC-IC... (Link to library) Clone ID FC-IC1004 (Link to dictyBase) Atlas ID - NBRP ID G24305 dic...mrvimmwlinkl*i*slkvvhylllvw*hslracv Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC... 4.0 %: mitochondrial >> prediction for FC-IC1004 is cyt 5' end seq. ID FC-IC1004F 5' end seq. >FC-IC...1004E (Link to Original site) FC-IC1004F 187 FC-IC1004Z 187 FC-IC1004P 354 FC-IC1004E 177 Show FC-IC1004 Library FC-IC

  19. Dicty_cDB: FC-IC1504 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1504 (Link to dictyBase) - - - Contig-U07877-1 FC-IC15... (Link to library) Clone ID FC-IC1504 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link ...to Contig Contig-U07877-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...0104Q) /CSM/FC-IC/FC-IC0104Q.Seq.d/ 533 e-151 own update 2001.11.19 Homology vs DNA Score E Sequences producing signific...04E (Link to Original site) FC-IC1504F 581 FC-IC1504Z 583 FC-IC1504P 1144 FC-IC1504E 573 Show FC-IC1504 Library FC-IC

  20. Dicty_cDB: FC-IC0422 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0422 (Link to dictyBase) - - - Contig-U16233-1 FC-IC04...22Z (Link to Original site) - - FC-IC0422Z 549 - - - - Show FC-IC0422 Library FC-IC (Link to library) Clone ID FC-IC... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0422 (FC-IC0422Q) /CSM/FC-IC/FC-IC...0422 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16233-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0422Q.Seq.d/ Representative seq. ID FC-IC

  1. Dicty_cDB: FC-IC1498 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1498 (Link to dictyBase) - - - Contig-U16527-1 FC-IC14... (Link to library) Clone ID FC-IC1498 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...xiyldilxlrnhxk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...98E (Link to Original site) FC-IC1498F 438 FC-IC1498Z 439 FC-IC1498P 857 FC-IC1498E 429 Show FC-IC1498 Library FC-IC

  2. Dicty_cDB: FC-IC1278 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1278 (Link to dictyBase) - - - Contig-U12354-1 FC-IC12... (Link to library) Clone ID FC-IC1278 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U12354-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC... 16.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: plasma membrane >> prediction for FC-IC1278 is cyt 5' end seq. ID FC-IC...78E (Link to Original site) FC-IC1278F 334 FC-IC1278Z 334 FC-IC1278P 648 FC-IC1278E 324 Show FC-IC1278 Library FC-IC

  3. Dicty_cDB: FC-IC0929 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0929 (Link to dictyBase) - - - Contig-U16527-1 FC-IC09...ink to library) Clone ID FC-IC0929 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...les of secretory system >> prediction for FC-IC0929 is end 5' end seq. ID FC-IC0929F 5' end seq. >FC-IC...29P (Link to Original site) FC-IC0929F 313 FC-IC0929Z 320 FC-IC0929P 613 - - Show FC-IC0929 Library FC-IC (L

  4. Dicty_cDB: FC-IC1321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1321 (Link to dictyBase) - - - Contig-U15335-1 FC-IC13... (Link to library) Clone ID FC-IC1321 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U15335-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> prediction for FC-IC1321 is cyt 5' end seq. ID FC-IC...21E (Link to Original site) FC-IC1321F 194 FC-IC1321Z 194 FC-IC1321P 368 FC-IC1321E 184 Show FC-IC1321 Library FC-IC

  5. Dicty_cDB: FC-IC0181 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0181 (Link to dictyBase) - - - Contig-U03326-1 FC-IC01...81F (Link to Original site) FC-IC0181F 553 - - - - - - Show FC-IC0181 Library FC-IC (Link to library) Clone ID FC-IC... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0181 (FC-IC0181Q) /CSM/FC-IC/FC-IC...ulum >> prediction for FC-IC0181 is cyt 5' end seq. ID FC-IC0181F 5' end seq. >FC-IC...0181 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03326-1 Original site URL http://dic

  6. Dicty_cDB: FC-IC0175 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0175 (Link to dictyBase) - - - Contig-U13957-1 FC-IC01...75F (Link to Original site) FC-IC0175F 212 - - - - - - Show FC-IC0175 Library FC-IC (Link to library) Clone ID FC-IC...e E Sequences producing significant alignments: (bits) Value FC-IC0175 (FC-IC0175Q) /CSM/FC-IC/FC-IC0175Q.Se...letal 4.0 %: vacuolar >> prediction for FC-IC0175 is cyt 5' end seq. ID FC-IC0175F 5' end seq. >FC-IC0175F.S...0175 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13957-1 Original site URL http://dic

  7. Dicty_cDB: FC-IC0169 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0169 (Link to dictyBase) - - - Contig-U15064-1 FC-IC01...69F (Link to Original site) FC-IC0169F 288 - - - - - - Show FC-IC0169 Library FC-IC (Link to library) Clone ID FC-IC...0169 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15064-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0169Q.Seq.d/ Representative seq. ID FC-IC...0169F (Link to Original site) Representative DNA sequence >FC-IC0169 (FC-IC0169Q) /CSM/FC-IC/FC-IC

  8. The expression of Fcγ receptors in Hashimoto's thyroiditis.

    Science.gov (United States)

    Liu, Yalei; Liu, Mingming; Zhang, Yang; Qu, Chenxue; Lu, Guizhi; Huang, Youyuan; Zhang, Hong; Yu, Nan; Yuan, Shanshan; Gao, Ying; Gao, Yanming; Guo, Xiaohui

    2015-03-01

    The pathophysiological mechanism underlying Hashimoto's thyroiditis (HT) is still unclear. Thyroglobulin antibody (TgAb) and thyroid peroxidase antibody (TPOAb) are diagnostic hallmarks of HT. These IgG antibodies regulate the balance of immunologic tolerance and autoimmunity via Fcγ receptors (FcγRs). The aim of our study was to investigate the role of FcγRs in the pathogenesis of HT. The percentage of peripheral blood mononuclear cells (PBMCs) from HT patients bearing FcγRII was significantly lower than that seen in healthy donors, and the mean fluorescence intensity (MFI) value of FcγRII on PBMCs from HT patients was significantly higher. The percentage of PBMCs positive for FcγRIII also was significantly higher in HT patients, and the percentage of B cells bearing FcγRIIB in HT patients was significantly lower than that seen in healthy donors. Our study therefore provides evidence for FcγRs, especially FcγRIIB, being involved in the pathogenesis of HT.

  9. Signalling through neutrophil Fc gamma RIII, Fc gamma RII, and CD59 is not impaired in active rheumatoid arthritis.

    OpenAIRE

    1996-01-01

    OBJECTIVE: To compare neutrophil Fc receptor (Fc gamma R) and CD59 signalling responses in normal healthy subjects and patients with active rheumatoid arthritis (RA). METHODS: Intracellular free calcium concentrations were measured in neutrophils loaded with the fluorescent calcium indicator fura-2, using a spectrofluorimeter. RESULTS: Basal intracellular calcium ion concentrations were similar in both groups when no primary antibody, CD59, or CD32 (Fc gamma RIII) antibody was added. When CD1...

  10. Characterization of human CD8+TCR- facilitating cells in vitro and in vivo in a NOD/SCID/IL2rγnull mouse model

    Science.gov (United States)

    Huang, Y.; Elliott, M. J.; Yolcu, E. S.; Miller, T. O.; Ratajczak, J.; Bozulic, L. D.; Wen, Y.; Xu, H.; Ratajczak, M. Z.; Ildstad, S. T.

    2017-01-01

    CD8+/TCR- facilitating cells (FC) in mouse BM significantly enhance engraftment of hematopoietic stem/progenitor cells (HSPC). Human FC phenotype and mechanism of action remain to be defined. We report for the first time the phenotypic characterization of human FC and correlation of phenotype with function. Approximately half of human FC are CD56neg; the remainder CD56bright. The CD56neg FC subpopulation significantly promotes homing of HSPC to BM in NSG mouse recipients and enhances hematopoietic colony formation in vitro. The CD56neg FC subpopulation promotes rapid reconstitution of donor HSPC without GVHD. However, recipients of CD56bright FC plus HSPC exhibit low donor chimerism early after transplantation but the level of chimerism significantly increases with time. Recipients of HSPC plus CD56neg or CD56bright FC showed durable donor chimerism at significantly higher levels in BM. The majority of both FC subpopulations express CXCR4. Co-culture of CD56bright FC with HSPC up-regulates cathelicidin and beta defensin-2, factors that prime responsiveness of HSPC to SDF-1. Both FC subpopulations significantly up-regulated mRNA expression of the HSPC growth factors and Flt3-Ligand. These results indicate that human FC exert a direct effect on HSPC to enhance engraftment. Human FC offer a potential regulatory cell-based therapy for enhancement of engraftment and prevention of GVHD. PMID:26550777

  11. Dicty_cDB: FC-IC1367 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1367 (Link to dictyBase) - - - - FC-IC1367E (Link to Original site) FC-IC... to library) Clone ID FC-IC1367 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Ori...cytoskeletal 8.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> prediction for FC-IC1367 i...1367F 271 FC-IC1367Z 271 FC-IC1367P 522 FC-IC1367E 261 Show FC-IC1367 Library FC-IC (Link...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1367Q.Seq.d/ Rep

  12. Dicty_cDB: FC-IC1728 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1728 (Link to dictyBase) - - - - - (Link to Original site) - - FC-IC...1728Z 373 - - - - Show FC-IC1728 Library FC-IC (Link to library) Clone ID FC-IC1728 (Link to dic...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1785 (FC-IC1785Q) /CSM/FC-IC/FC-IC...6.0 %: plasma membrane 12.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC

  13. Dicty_cDB: FC-IC1667 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1667 (Link to dictyBase) - - - Contig-U16382-1 FC-IC16... (Link to library) Clone ID FC-IC1667 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1667 (FC-IC1667Q) /CSM/FC-IC/FC-IC...%: mitochondrial 8.0 %: nuclear >> prediction for FC-IC1667 is mit 5' end seq. ID FC-IC1667F 5' end seq. >FC-IC

  14. Dicty_cDB: FC-IC0107 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0107 (Link to dictyBase) - - - - FC-IC0107F (Link to Original site) FC-IC...0107F 430 - - - - - - Show FC-IC0107 Library FC-IC (Link to library) Clone ID FC-IC0107 (Link to dic...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.bi...ore E Sequences producing significant alignments: (bits) Value FC-IC0107 (FC-IC0107Q) /CSM/FC-IC/FC-IC0107Q.Seq.d/ 258 6e-68 FC-IC...asma membrane 12.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC

  15. Dicty_cDB: FC-IC1423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1423 (Link to dictyBase) - - - Contig-U16122-1 FC-IC14... (Link to library) Clone ID FC-IC1423 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16122-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for FC-IC14...23E (Link to Original site) FC-IC1423F 250 FC-IC1423Z 254 FC-IC1423P 484 FC-IC1423E 244 Show FC-IC1423 Library FC-IC

  16. Dicty_cDB: FC-IC1251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1251 (Link to dictyBase) - - - Contig-U08307-1 FC-IC12...Link to library) Clone ID FC-IC1251 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig C...ontig-U08307-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC... 4.0 %: plasma membrane >> prediction for FC-IC1251 is mit 5' end seq. ID FC-IC...51P (Link to Original site) FC-IC1251F 648 FC-IC1251Z 650 FC-IC1251P 1278 - - Show FC-IC1251 Library FC-IC (

  17. Dicty_cDB: FC-IC1707 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1707 (Link to dictyBase) - - - Contig-U13402-1 FC-IC17... (Link to library) Clone ID FC-IC1707 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link ...to Contig Contig-U13402-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...tracellular, including cell wall 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for FC-IC...07E (Link to Original site) FC-IC1707F 532 FC-IC1707Z 533 FC-IC1707P 1045 FC-IC1707E 523 Show FC-IC1707 Library FC-IC

  18. Dicty_cDB: FC-IC0095 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0095 (Link to dictyBase) - G24277 DDB0231825 Contig-U03300-1 FC-IC...tig Contig-U03300-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0095 (FC-IC0095Q) /CSM/FC-IC/FC-IC...0095F (Link to Original site) FC-IC0095F 288 - - - - - - Show FC-IC0095 Library FC-IC (Link to library) Clone ID FC-IC...0095 (Link to dictyBase) Atlas ID - NBRP ID G24277 dictyBase ID DDB0231825 Link to Con

  19. Dicty_cDB: FC-IC0932 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0932 (Link to dictyBase) - - - - - (Link to Original site) - - FC-IC...0932Z 239 - - - - Show FC-IC0932 Library FC-IC (Link to library) Clone ID FC-IC0932 (Link to dic...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC... 8.0 %: extracellular, including cell wall 4.0 %: cytoskeletal >> prediction for FC-IC0932 is mit 5' ...te) Representative DNA sequence >FC-IC0932 (FC-IC0932Q) /CSM/FC-IC/FC-IC0932Q.Seq.d/ XXXXXXXXXXTCACCAATGTTGA

  20. Dicty_cDB: FC-IC1144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1144 (Link to dictyBase) - - - Contig-U15215-1 FC-IC11...Link to library) Clone ID FC-IC1144 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig C...ontig-U15215-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...tochondrial 32.0 %: nuclear 16.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for FC-IC1144 is mit 5' end seq. ID FC-IC...44P (Link to Original site) FC-IC1144F 715 FC-IC1144Z 681 FC-IC1144P 1376 - - Show FC-IC1144 Library FC-IC (

  1. Dicty_cDB: FC-IC1678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1678 (Link to dictyBase) - - - Contig-U16583-1 FC-IC16... (Link to library) Clone ID FC-IC1678 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16583-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...s Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1678 (FC-IC1678Q) /CSM/FC-IC/FC-IC... 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-IC1678 is nuc 5' end seq. ID FC-IC1678F 5' end seq. >FC-IC

  2. Dicty_cDB: FC-IC0522 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0522 (Link to dictyBase) - G24294 DDB0169466 Contig-U03376-1 FC-IC... (Link to library) Clone ID FC-IC0522 (Link to dictyBase) Atlas ID - NBRP ID G24294 dic...tnfski*ki rniyklsislc Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0522 (FC-IC... 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: vacuolar >> prediction for FC-IC...0522E (Link to Original site) FC-IC0522F 215 FC-IC0522Z 215 FC-IC0522P 430 FC-IC0522E 215 Show FC-IC0522 Library FC-IC

  3. Dicty_cDB: FC-IC0335 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0335 (Link to dictyBase) - - - Contig-U08330-1 FC-IC03... (Link to library) Clone ID FC-IC0335 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U08330-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...0 m_ : 1.00 44.0 %: cytoplasmic 40.0 %: nuclear 12.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for FC-IC...35E (Link to Original site) FC-IC0335F 270 FC-IC0335Z 270 FC-IC0335P 540 FC-IC0335E 270 Show FC-IC0335 Library FC-IC

  4. Dicty_cDB: FC-IC1095 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1095 (Link to dictyBase) - - - Contig-U10067-1 FC-IC10... (Link to library) Clone ID FC-IC1095 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U10067-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1156 (FC-IC...%: cytoskeletal 12.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: Golgi >> prediction for FC-IC

  5. Fc receptor inside-out signaling and possible impact on antibody therapy

    NARCIS (Netherlands)

    Brandsma, Arianne M; Jacobino, Shamir R; Meyer, Saskia; ten Broeke, Toine; Leusen, Jeanette H W

    2015-01-01

    Fc receptors (FcR) are expressed on immune cells and bind to the Fc tail of antibodies. This interaction is essential for FcR-mediated signaling and triggering of cellular effector functions. FcR activation is tightly regulated to prevent immune responses by non-antigen bound antibodies or in the ab

  6. ON COLLECTIVELY FIXED POINT THEOREMS ON FC-SPACES

    Institute of Scientific and Technical Information of China (English)

    Yongjie Piao

    2010-01-01

    Based on a KKM type theorem on FC-space,some new fixed point theorems for Fan-Browder type are established,and then some collectively fixed point theorems for a family of Φ-maps defined on product space of FC-spaees are given.These results generalize and improve many corresponding results.

  7. Certolizumab pegol does not bind the neonatal Fc receptor (FcRn): Consequences for FcRn-mediated in vitro transcytosis and ex vivo human placental transfer.

    Science.gov (United States)

    Porter, Charlene; Armstrong-Fisher, Sylvia; Kopotsha, Tim; Smith, Bryan; Baker, Terry; Kevorkian, Lara; Nesbitt, Andrew

    2016-08-01

    Antibodies to tumor necrosis factor (anti-TNF) are used to treat inflammatory diseases, which often affect women of childbearing age. The active transfer of these antibodies across the placenta by binding of the Fc-region to the neonatal Fc receptor (FcRn) may result in adverse fetal or neonatal effects. In contrast to other anti-TNFs, certolizumab pegol lacks an Fc-region. The objective of this study was to determine whether the structure of certolizumab pegol limits active placental transfer. Binding affinities of certolizumab pegol, infliximab, adalimumab and etanercept to human FcRn and FcRn-mediated transcytosis were determined using in vitro assays. Human placentas were perfused ex vivo to measure transfer of certolizumab pegol and positive control anti-D IgG from the maternal to fetal circulation. FcRn binding affinity (KD) was 132nM, 225nM and 1500nM for infliximab, adalimumab and etanercept, respectively. There was no measurable certolizumab pegol binding affinity, similar to that of the negative control. FcRn-mediated transcytosis across a cell layer (mean±SD; n=3) was 249.6±25.0 (infliximab), 159.0±20.2 (adalimumab) and 81.3±13.1ng/mL (etanercept). Certolizumab pegol transcytosis (3.2±3.4ng/mL) was less than the negative control antibody (5.9±4.6ng/mL). No measurable transfer of certolizumab pegol from the maternal to the fetal circulation was observed in 5 out of 6 placentas that demonstrated positive-control IgG transport in the ex vivo perfusion model. Together these results support the hypothesis that the unique structure of certolizumab pegol limits its transfer through the placenta to the fetus and may be responsible for previously reported differences in transfer of other anti-TNFs from mother to fetus.

  8. Cytotoxicity mediated by human Fc receptors for IgG.

    Science.gov (United States)

    Fanger, M W; Shen, L; Graziano, R F; Guyre, P M

    1989-03-01

    The Fc receptors for IgG(Fc gamma R) play a major role in the removal of antibody-coated infectious agents and may be important molecules for triggering cytotoxicity of tumor cells; they may also serve as an entry for infection of Fc gamma R-bearing cells by viral (including HIV and Dengue), and perhaps other infectious agents. Although central to immune defense, an understanding of the role of these Fc gamma R in cytotoxicity has been complicated in part by the presence of several biochemically distinct types of receptor that have different distributions, specificities, affinities and modes of activation for killing. The development of monoclonal antibodies specific for Fc gamma R on human leukocytes has established the existence of three distinct Fc gamma R and furthermore has helped clarify the function of each of these receptors. In this review, Michael Fanger and colleagues discuss the use of Fc gamma R-specific mAb and the hybridoma cell lines that produce them in examining the ability of each of these unique receptors to mediate killing of tumor and red cell targets. In particular, the use of self-directed hybridoma cells as a model of tumor-cell killing and of bi-specific antibodies to link target cells to effector cells through the different Fc gamma R is discussed. The results of these studies suggest that the ability of a given Fc gamma R to trigger killing is sometimes dependent on the type of Fc gamma R, but is also markedly influenced by the type of target cell and by the nature and state of activation of the effector cell.

  9. 沟通对知识共享的促进机制研究%Study on Medchanism for Communication to Facilitate toward Knowledge Sharing

    Institute of Scientific and Technical Information of China (English)

    史江涛

    2012-01-01

    Based on the dimensions of communication and KS, the paper discusses three driving routes from communication to KS. By taking organizational identification, self-worth and empathy as the mediators, the paper indicates that the three variables work complementarily and transmit the promotive influence from communication to KS jointly.%在明确沟通及知识共享维度划分的基础上,本文探讨了沟通对知识共享的驱动路径,提出组织认同感、自我价值感和移情性三个中介变量发挥着互不相同又相互补充的作用,共同传导了沟通对知识共享意愿的促进作用。

  10. Characterization of the ligand binding site of the bovine IgA Fc receptor (bFc alpha R).

    Science.gov (United States)

    Morton, H Craig; Pleass, Richard J; Woof, Jenny M; Brandtzaeg, Per

    2004-12-24

    Recently, we identified a bovine IgA Fc receptor (bFc alpha R), which shows high homology to the human myeloid Fc alpha R, CD89. IgA binding has previously been shown to depend on several specific residues located in the B-C and F-G loops of the membrane-distal extracellular domain 1 of CD89. To compare the ligand binding properties of these two Fc alpha Rs, we have mapped the IgA binding site of bFc alpha R. We show that, in common with CD89, Tyr-35 in the B-C loop is essential for IgA binding. However, in contrast to earlier observations on CD89, mutation of residues in the F-G loop did not significantly inhibit IgA binding.

  11. Dicty_cDB: FC-AS11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS11 (Link to dictyBase) - - - - FC-AS11Z (Link to Original site) - - FC-AS...11Z 593 - - - - Show FC-AS11 Library FC (Link to library) Clone ID FC-AS11 (Link to dictyBase) Atlas... ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS...ytoskeletal 4.0 %: vacuolar 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for FC-AS11 is cyt 5' en...11Q.Seq.d/ Representative seq. ID FC-AS11Z (Link to Original s

  12. Dicty_cDB: FC-AS09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS09 (Link to dictyBase) - G24051 DDB0191911 Contig-U15148-1 FC-AS...mic 4.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for FC-AS09 is nuc 5' end seq. ID FC-AS...09F (Link to Original site) FC-AS09F 448 - - - - - - Show FC-AS09 Library FC (Link to library) Clone ID FC-AS...09 (Link to dictyBase) Atlas ID - NBRP ID G24051 dictyBase ID DDB0191911 Link to Contig Contig-U1514...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS09Q.Se

  13. Dicty_cDB: FC-IC0564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0564 (Link to dictyBase) - - - Contig-U16036-1 FC-IC05...ink to library) Clone ID FC-IC0564 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U16036-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC... Score E Sequences producing significant alignments: (bits) Value FC-IC0564 (FC-IC0564Q) /CSM/FC-IC/FC-IC056...lar, including cell wall 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-IC0564 is cyt 5' end seq. ID FC-IC

  14. Dicty_cDB: FC-IC0216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0216 (Link to dictyBase) - G24287 DDB0201591 Contig-U0... (Link to library) Clone ID FC-IC0216 (Link to dictyBase) Atlas ID - NBRP ID G24287 dictyBase I...D DDB0201591 Link to Contig Contig-U03331-1 Original site URL http://dictycdb.bio... 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for FC-IC0216 is nuc 5' end seq. ID FC-IC0216F 5' end seq. >FC-IC...3331-1 - (Link to Original site) FC-IC0216F 315 FC-IC0216Z 315 FC-IC0216P 630 FC-IC0216E 315 Show FC-IC0216 Library FC-IC

  15. Dicty_cDB: FC-IC0364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0364 (Link to dictyBase) - - - Contig-U01120-1 - (Link to Original site) FC-IC...(Link to library) Clone ID FC-IC0364 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig ...Contig-U01120-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...re E Sequences producing significant alignments: (bits) Value FC-IC0364 (FC-IC0364Q) /CSM/FC-IC/FC-IC0364Q.S...24.0 %: nuclear 8.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for FC-IC0364 is mit 5' end seq. ID FC-IC

  16. Dicty_cDB: FC-IC0491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0491 (Link to dictyBase) - - - Contig-U12373-1 FC-IC04... (Link to library) Clone ID FC-IC0491 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link ...to Contig Contig-U12373-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1285 (FC-IC1285Q) /CSM/FC-IC/FC-IC...ear 12.0 %: cytoskeletal 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for FC-IC0491 is cyt 5' end seq. ID FC-IC

  17. Dicty_cDB: FC-IC1222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1222 (Link to dictyBase) - - - Contig-U11840-1 FC-IC12...ink to library) Clone ID FC-IC1222 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U11840-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...equences producing significant alignments: (bits) Value FC-IC1222 (FC-IC1222Q) /CSM/FC-IC/FC-IC1222Q.Seq.d/ ...%: Golgi 4.0 %: plasma membrane 4.0 %: vesicles of secretory system >> prediction for FC-IC1222 is end 5' end seq. ID FC-IC

  18. Dicty_cDB: FC-IC1569 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1569 (Link to dictyBase) - - - Contig-U16026-1 FC-IC15... (Link to library) Clone ID FC-IC1569 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16026-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1569 (FC-IC1569Q) /CSM/FC-IC/FC-IC...les of secretory system >> prediction for FC-IC1569 is end 5' end seq. ID FC-IC

  19. Dicty_cDB: FC-IC1756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1756 (Link to dictyBase) - - - Contig-U16026-1 FC-IC17...ink to library) Clone ID FC-IC1756 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U16026-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...isomal 4.0 %: extracellular, including cell wall 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for FC-IC...56P (Link to Original site) FC-IC1756F 156 FC-IC1756Z 284 FC-IC1756P 420 - - Show FC-IC1756 Library FC-IC (L

  20. Dicty_cDB: FC-IC1753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1753 (Link to dictyBase) - - - - - (Link to Original site) - - FC-IC...1753Z 284 - - - - Show FC-IC1753 Library FC-IC (Link to library) Clone ID FC-IC1753 (Link to dic...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...te) Representative DNA sequence >FC-IC1753 (FC-IC1753Q) /CSM/FC-IC/FC-IC1753Q.Seq.d/ XXXXXXXXXXTGTGTTTTGGAGT...vllvlgwlelvllvle*lelvwlvlvwlelv*lelgllfl eykeehp*ihllgnmnmklqiyldilslrnhmk Homology vs CSM-cDNA Score E Sequences producing signific

  1. Dicty_cDB: FC-IC0417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0417 (Link to dictyBase) - - - Contig-U03353-1 FC-IC04...17F (Link to Original site) FC-IC0417F 285 - - - - - - Show FC-IC0417 Library FC-IC (Link to library) Clone ID FC-IC... %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-IC0417 is nuc 5' end seq. ID FC-IC...0417 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03353-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0417Q.Seq.d/ Representative seq. ID FC-IC

  2. THE EFFECT OF FLUOROCARBON ARTIFICIAL BLOOD (FC-34 IN ACUTE VASOGENIC BRAIN EDEMA

    Directory of Open Access Journals (Sweden)

    M NEEMATBAKHSH

    2000-03-01

    Full Text Available Background. Oxygen transport to tissue after an acute ischemia is strongly important. Fluorocarbon liquids are able to facilitated the oxygen transport. An animal experiment was designed to study the effect of FC-34 in acute brain ischemia. Methods. The left common carotid arteries were ligated in three groups of anesthetized animals for 30 minutes to obtain acute brain edema. The animals were subjected to received 15 ml/kg saline (group 1, 10% monitol (group 2 or FC-43 (group 3. All animals were recovered, and they monitored for two weeks. The electrolytes, BUN, and creatinine were measured before (all animals and after two weeks (survived animals. Pathological investigation was obtained by light and electron microscope via pathological process. Findings. The group 1 animals were died during first five days, but one and four animals were survived by two weeks in groups 2 & 3 respectively (P < 0.05. The pathological determinations indicate less cellular damages in group 3. No significant differences were detected in potassium, calcium, BUN, and creatinine before and after the experiment. Conclusion. The particle size and oxygen solubility in FC-43 is the major factors for better oxygen transport in ischem

  3. Program Facilitates Distributed Computing

    Science.gov (United States)

    Hui, Joseph

    1993-01-01

    KNET computer program facilitates distribution of computing between UNIX-compatible local host computer and remote host computer, which may or may not be UNIX-compatible. Capable of automatic remote log-in. User communicates interactively with remote host computer. Data output from remote host computer directed to local screen, to local file, and/or to local process. Conversely, data input from keyboard, local file, or local process directed to remote host computer. Written in ANSI standard C language.

  4. Barriers and Facilitators to the Use of High-Technology Augmentative and Alternative Communication Devices: A Systematic Review and Qualitative Synthesis

    Science.gov (United States)

    Baxter, Susan; Enderby, Pam; Evans, Philippa; Judge, Simon

    2012-01-01

    Background: There has been a rapid growth in recent years of available technologies for individuals with communication difficulties. Research in the area is currently underdeveloped with practitioners having a limited body of work on which to draw to guide the process of intervention. Concerns have been raised that this newly developed technology…

  5. Facilitating Positive Psychosocial Adaptation in Children with Cystic Fibrosis by Increasing Family Communication and Problem-Solving Skills. A Research Report to the Cystic Fibrosis Foundation.

    Science.gov (United States)

    Stabler, Brian; And Others

    This study tested the effects of two group-oriented supportive and educational approaches on the parents of children with cystic fibrosis (CF). Thirteen families were randomly assigned either to a group which received information on medical and technical aspects of CF or to a group which received instruction in communication skills in addition to…

  6. Content Analysis of Student Essays after Attending a Problem-Based Learning Course: Facilitating the Development of Critical Thinking and Communication Skills in Japanese Nursing Students.

    Science.gov (United States)

    Itatani, Tomoya; Nagata, Kyoko; Yanagihara, Kiyoko; Tabuchi, Noriko

    2017-08-22

    The importance of active learning has continued to increase in Japan. The authors conducted classes for first-year students who entered the nursing program using the problem-based learning method which is a kind of active learning. Students discussed social topics in classes. The purposes of this study were to analyze the post-class essay, describe logical and critical thinking after attended a Problem-Based Learning (PBL) course. The authors used Mayring's methodology for qualitative content analysis and text mining. In the description about the skills required to resolve social issues, seven categories were extracted: (recognition of diverse social issues), (attitudes about resolving social issues), (discerning the root cause), (multi-lateral information processing skills), (making a path to resolve issues), (processivity in dealing with issues), and (reflecting). In the description about communication, five categories were extracted: (simple statement), (robust theories), (respecting the opponent), (communication skills), and (attractive presentations). As the result of text mining, the words extracted more than 100 times included "issue," "society," "resolve," "myself," "ability," "opinion," and "information." Education using PBL could be an effective means of improving skills that students described, and communication in general. Some students felt difficulty of communication resulting from characteristics of Japanese.

  7. Information Communication Technology in the Form of an Expert System Shell as a Cognitive Tool to Facilitate Higher-Order Thinking

    Science.gov (United States)

    Collins, Gary W.; Knoetze, Johan G.

    2014-01-01

    Information communication technology is capable of contributing supplementary teaching and learning strategies that can be used to address various educational challenges faced by higher education. Students who enter South African higher education institutions are often academically under-prepared and have not developed the cognitive skills…

  8. Information Communication Technology in the Form of an Expert System Shell as a Cognitive Tool to Facilitate Higher-Order Thinking

    Science.gov (United States)

    Collins, Gary W.; Knoetze, Johan G.

    2014-01-01

    Information communication technology is capable of contributing supplementary teaching and learning strategies that can be used to address various educational challenges faced by higher education. Students who enter South African higher education institutions are often academically under-prepared and have not developed the cognitive skills…

  9. Significance of soluble Fc epsilon receptor II (sFc epsilon RII/CD23) in serum and possible application of sFc epsilon RII for the prevention of allergic reactions.

    Science.gov (United States)

    Suemura, M; Kikutani, H; Sugiyama, K; Uchibayashi, N; Aitani, M; Kuritani, T; Barsumian, E L; Yamatodani, A; Kishimoto, T

    1991-01-01

    The significance of sFc epsilon RII in IgE-mediated allergic disease was examined. sFc epsilon RII in serum was found to decrease following clinical improvement, suggesting sFc epsilon RII in serum may be an indicator of allergic diseases. Significant proportions of sFc epsilon RII in serum were present as complexes with IgE in normals as well as in atopic patients, and these complexes were more prominent in the former than in the latter group. From these observations, attempts were made to inhibit IgE-mediated allergic reactions in vitro employing recombinant sFc epsilon RII. sFc epsilon RII inhibited IgE-binding as well as IgE-mediated release of chemical mediators from Fc epsilon RI and Fc epsilon RII expressing cells. These results show the functional significance of sFc epsilon RII in the negative regulation of IgE-mediated allergic reactions.

  10. Computational modeling of the Fc αRI receptor binding in the Fc α domain of the human antibody IgA: Normal Modes Analysis (NMA) study

    Science.gov (United States)

    Jayasinghe, Manori; Posgai, Monica; Tonddast-Navaei, Sam; Ibrahim, George; Stan, George; Herr, Andrew; George Stan Group Collaboration; Herr's Group Team

    2014-03-01

    Fc αRI receptor binding in the Fc α domain of the antibody IgA triggers immune effector responses such as phagocytosis and antibody-dependent cell-mediated cytotoxicity in eukaryotic cells. Fc α is a dimer of heavy chains of the IgA antibody and each Fc α heavy chain which consisted of two immunoglobulin constant domains, CH2 and CH3, can bind one Fc αRI molecule at the CH2-CH3 interface forming a 2:1 stoichiometry. Experimental evidences confirmed that Fc αRI binding to the Fc α CH2-CH3 junction altered the kinetics of HAA lectin binding at the distant IgA1 hinge. Our focus in this research was to understand the conformational changes and the network of residues which co-ordinate the receptor binding dynamics of the Fc α dimer complex. Structure-based elastic network modeling was used to compute normal modes of distinct Fc α configurations. Asymmetric and un-liganded Fc α configurations were obtained from the high resolution crystal structure of Fc α-Fc αRI 2:1 symmetric complex of PDB ID 1OW0. Our findings confirmed that Fc αRI binding, either in asymmetric or symmetric complex with Fc α, propagated long-range conformational changes across the Fc domains, potentially also impacting the distant IgA1 hinge.

  11. Dicty_cDB: FC-IC1182 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1182 (Link to dictyBase) - - - Contig-U07877-1 FC-IC11...Link to library) Clone ID FC-IC1182 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig C...ontig-U07877-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...kl*s*swfrcctnsycwsffksfncsw **psycmwtlan* Homology vs CSM-cDNA Score E Sequences producing significant align...les of secretory system >> prediction for FC-IC1182 is cyt 5' end seq. ID FC-IC

  12. Dicty_cDB: FC-IC1622 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1622 (Link to dictyBase) - - - Contig-U16527-1 FC-IC16... (Link to library) Clone ID FC-IC1622 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...k tnntssnhpktnntssnhsktnhtssnysktnntspnntspninsysrldfipnsnkrsr tmrimlgic**cst*isl...ghllvvqhlnlvtllnm Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC

  13. Generalized constrained multiobjective games in locally FC-uniform spaces

    Institute of Scientific and Technical Information of China (English)

    DING Xie-ping; LEE Chin-san; YAO Jen-chih

    2008-01-01

    A new class of generalized constrained multiobjective games is introduced and studied in locally FC-uniform spaces without convexity structure where the number of players may be finite or infinite and all payoff functions get their values in an infinite-dimensional space.By using a Himmelberg type fixed point theorem in locally FC-uniform spaces due to author,some existence theorems of weak Pareto equilibria for the generalized constrained multiobjective games are established in locally FC-uniform spaces.These theorems improve,unify and generalize the corresponding results in recent literatares.

  14. Dicty_cDB: FC-AS02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AS02 (Link to dictyBase) - - - Contig-U16382-1 FC-AS02Z (Li...nk to Original site) - - FC-AS02Z 561 - - - - Show FC-AS02 Library FC (Link to library) Clone ID FC-AS02 (Link to dictyBase) Atlas....00 m3a: 0.00 m3b: 0.00 m_ : 1.00 44.0 %: cytoplasmic 44.0 %: nuclear 8.0 %: cytoskeletal 4.0 %: mitochondri... ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http:/.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AS/FC-AS02Q.Seq.d/ Representative seq. ID FC-AS

  15. Dicty_cDB: FC-IC0430 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0430 (Link to dictyBase) - - - Contig-U16271-1 FC-IC04... (Link to library) Clone ID FC-IC0430 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16271-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...ology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0430 (FC-IC...l 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-IC0430 is cyt 5' end seq. ID FC-IC0430F 5' end seq. >FC-IC

  16. Dicty_cDB: FC-IC0649 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0649 (Link to dictyBase) - - - Contig-U16566-1 FC-IC06...ink to library) Clone ID FC-IC0649 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U16566-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC... Score E Sequences producing significant alignments: (bits) Value FC-IC0649 (FC-IC0649Q) /CSM/FC-IC/FC-IC064...ory system 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for FC-IC0649

  17. Dicty_cDB: FC-IC0993 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0993 (Link to dictyBase) - G24303 DDB0220699 Contig-U08379-1 FC-IC... (Link to library) Clone ID FC-IC0993 (Link to dictyBase) Atlas ID - NBRP ID G24303 dic...gi 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: extracellular, including cell wall >> prediction for FC-IC...0993E (Link to Original site) FC-IC0993F 526 FC-IC0993Z 526 FC-IC0993P 1032 FC-IC0993E 516 Show FC-IC0993 Library FC-IC...tyBase ID DDB0220699 Link to Contig Contig-U08379-1 Original site URL http://dic

  18. Dicty_cDB: FC-IC0027 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0027 (Link to dictyBase) - - - Contig-U08312-1 FC-IC00...27F (Link to Original site) FC-IC0027F 578 - - - - - - Show FC-IC0027 Library FC-IC (Link to library) Clone ID FC-IC...0005Q) /CSM/FC-IC/FC-IC0005Q.Seq.d/ 531 e-150 own update 2001.11.18 Homology vs DNA Score E Sequences producing signific...les of secretory system 4.0 %: endoplasmic reticulum >> prediction for FC-IC0027 is nuc 5' end seq. ID FC-IC...0027 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08312-1 Original site URL http://dic

  19. Dicty_cDB: FC-IC0758 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0758 (Link to dictyBase) - - - Contig-U07877-1 FC-IC07...ink to library) Clone ID FC-IC0758 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U07877-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...cldr Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0758 (FC-IC0758Q) /CSM/FC-IC/FC-IC...0 %: mitochondrial 4.0 %: plasma membrane 4.0 %: vesicles of secretory system >> prediction for FC-IC

  20. Dicty_cDB: FC-IC1688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1688 (Link to dictyBase) - - - Contig-U16382-1 - (Link... to Original site) - - FC-IC1688Z 288 - - - - Show FC-IC1688 Library FC-IC (Link to library) Clone ID FC-IC1688 (Link to dic...IV Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1688 (FC-IC...:FC-AG0... 414 e-112 1 ( AU275195 ) Dictyostelium discoideum gamete cDNA clone:FC-IC1... 414 e-112 1 ( AU272515 ) Dic...tyostelium discoideum gamete cDNA clone:FC-IC1... 414 e-112 1 ( AU272386 ) Dic

  1. Dicty_cDB: FC-IC1440 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1440 (Link to dictyBase) - - - Contig-U15453-1 FC-IC14... (Link to library) Clone ID FC-IC1440 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U15453-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...re E Sequences producing significant alignments: (bits) Value FC-IC1440 (FC-IC1440Q) /CSM/FC-IC/FC-IC...clear 36.0 %: cytoplasmic 8.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: vacuolar >> prediction for FC-IC14

  2. Dicty_cDB: FC-IC0501 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0501 (Link to dictyBase) - - - Contig-U16382-1 FC-IC05... (Link to library) Clone ID FC-IC0501 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...y vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0501 (FC-IC...les of secretory system >> prediction for FC-IC0501 is nuc 5' end seq. ID FC-IC0501F 5' end seq. >FC-IC

  3. Dicty_cDB: FC-IC0954 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0954 (Link to dictyBase) - - - Contig-U16382-1 FC-IC09... (Link to library) Clone ID FC-IC0954 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...SM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0954 (FC-IC0954Q) /CSM/FC-IC/FC-IC.../FC-IC1696Q.Seq.d/ 761 0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing signific

  4. Dicty_cDB: FC-IC1149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1149 (Link to dictyBase) - - - Contig-U16271-1 - (Link to Original site) FC-IC...1149F 272 - - - - - - Show FC-IC1149 Library FC-IC (Link to library) Clone ID FC-IC1149 (Link to dic...tyostelium discoideum gamete cDNA clone:FC-IC1... 519 e-143 1 ( AU272187 ) Dictyostelium discoideu...m gamete cDNA clone:FC-IC1... 519 e-143 1 ( AU272185 ) Dictyostelium discoideum gamete cDNA clone:FC-IC1... ...elium discoideum gamete cDNA clone:FC-IC1... 517 e-143 1 ( AU275192 ) Dictyostelium discoideum gamete cDNA clone:FC-IC

  5. Dicty_cDB: FC-IC1236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1236 (Link to dictyBase) - - - Contig-U12406-1 - (Link... to Original site) - - FC-IC1236Z 497 - - - - Show FC-IC1236 Library FC-IC (Link to library) Clone ID FC-IC1236 (Link to dic...xxxlvxslcfxw Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1236 (FC-IC1236Q) /CSM/FC-IC...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12406-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1236Q.Seq.d/ Representative se

  6. Dicty_cDB: FC-IC0067 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0067 (Link to dictyBase) - - - Contig-U16382-1 FC-IC00...67F (Link to Original site) FC-IC0067F 267 - - - - - - Show FC-IC0067 Library FC-IC (Link to library) Clone ID FC-IC...tochondrial 8.0 %: Golgi 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for FC-IC...0067 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0067Q.Seq.d/ Representative seq. ID FC-IC

  7. Dicty_cDB: FC-IC0162 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0162 (Link to dictyBase) - - - Contig-U10099-1 FC-IC01...62F (Link to Original site) FC-IC0162F 358 - - - - - - Show FC-IC0162 Library FC-IC (Link to library) Clone ID FC-IC...DGPDDEALPVVDGPDDEALP-- - Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0162 (FC-IC...%: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC0162 is end 5' end seq. ID FC-IC...0162 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10099-1 Original site URL http://dic

  8. Dicty_cDB: FC-IC1178 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1178 (Link to dictyBase) - - - Contig-U16026-1 - (Link... to Original site) - - FC-IC1178Z 442 - - - - Show FC-IC1178 Library FC-IC (Link to library) Clone ID FC-IC1178 (Link to dic... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1178 (FC-IC1178Q) /CSM/FC-IC/FC-IC...les of secretory system >> prediction for FC-IC1178 is end 5' end seq. ID - 5' end seq. - Length ...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16026-1 Original site URL http://dic

  9. GENERALIZED VECTOR VARIATIONAL-TYPE INEQUALITIES IN FC-SPACES

    Institute of Scientific and Technical Information of China (English)

    FANG Min; DING Xie-ping

    2006-01-01

    A class of generalized vector variational-type inequality problems (GVVTIP) are studied in FC-spaces, which includes the most of vector equilibrium problems, vector variational inequality problems, generalized vector equilibrium problems and generalized vector variational inequality problem as special cases. By using F-KKM theorem,some new existence results for GVVTIP are established in noncompact FC-space. As consequences, some recent known results in literature are obtained under much weaker assumption.

  10. Consistency Property of Finite FC-Normal Logic Programs

    Institute of Scientific and Technical Information of China (English)

    Yi-Song Wang; Ming-Yi Zhang; Yu-Ping Shen

    2007-01-01

    Marek's forward-chaining construction is one of the important techniques for investigating the non-monotonic reasoning. By introduction of consistency property over a logic program, they proposed a class of logic programs, FC-normal programs, each of which has at least one stable model. However, it is not clear how to choose one appropriate consistency property for deciding whether or not a logic program is FC-normal. In this paper, we firstly discover that, for any finite logic program ∏, there exists the least consistency property LCon(∏) over ∏, which just depends on ∏ itself, such that, ∏ is FC-normal if and only if ∏ is FC-normal with respect to (w.r.t.) LCon(∏). Actually, in order to determine the FC-normality of a logic program, it is sufficient to check the monotonic closed sets in LCon(∏) for all non-monotonic rules, that is LFC(∏). Secondly, we present an algorithm for computing LFC(∏). Finally, we reveal that the brave reasoning task and cautious reasoning task for FC-normal logic programs are of the same difficulty as that of normal logic programs.

  11. Past makes future: role of pFC in prediction.

    Science.gov (United States)

    Fuster, Joaquín M; Bressler, Steven L

    2015-04-01

    The pFC enables the essential human capacities for predicting future events and preadapting to them. These capacities rest on both the structure and dynamics of the human pFC. Structurally, pFC, together with posterior association cortex, is at the highest hierarchical level of cortical organization, harboring neural networks that represent complex goal-directed actions. Dynamically, pFC is at the highest level of the perception-action cycle, the circular processing loop through the cortex that interfaces the organism with the environment in the pursuit of goals. In its predictive and preadaptive roles, pFC supports cognitive functions that are critical for the temporal organization of future behavior, including planning, attentional set, working memory, decision-making, and error monitoring. These functions have a common future perspective and are dynamically intertwined in goal-directed action. They all utilize the same neural infrastructure: a vast array of widely distributed, overlapping, and interactive cortical networks of personal memory and semantic knowledge, named cognits, which are formed by synaptic reinforcement in learning and memory acquisition. From this cortex-wide reservoir of memory and knowledge, pFC generates purposeful, goal-directed actions that are preadapted to predicted future events.

  12. Molecular determinants of dengue virus 2 envelope protein important for virus entry in FcγRIIA-mediated antibody-dependent enhancement of infection

    Energy Technology Data Exchange (ETDEWEB)

    Chotiwan, Nunya; Roehrig, John T. [Arboviral Diseases Branch, Division of Vector-Borne Disease, Centers for Disease Control and Prevention, Fort Collins, CO 80521 (United States); Schlesinger, Jacob J. [Department of Medicine, University of Rochester, Rochester, NY 14642 (United States); Blair, Carol D. [Arthropod-borne and Infectious Diseases Laboratory, Department of Microbiology, Immunology and Pathology, Colorado State University, Fort Collins, CO 80523 (United States); Huang, Claire Y.-H., E-mail: yxh0@cdc.gov [Arboviral Diseases Branch, Division of Vector-Borne Disease, Centers for Disease Control and Prevention, Fort Collins, CO 80521 (United States)

    2014-05-15

    Antibody-dependent enhancement (ADE) of infection may cause severe illness in patients suffering a secondary infection by a heterologous dengue virus (DENV) serotype. During ADE of infection, cross-reactive non- or poorly-neutralizing antibodies form infectious virus-Ab complexes with the newly infecting serotype and enhance virus infection by binding to the Fcγ receptors (FcγR) on FcγR-bearing cells. In this study, we determined that molecular determinants of DENV2 envelope protein critical for virus entry during non-ADE infection are also required for ADE infection mediated by FcγRIIA, and binding of virus-Ab complexes with FcγRIIA alone is not sufficient for ADE of infection. The FcγRIIA mainly plays an auxiliary role in concentrating the virus–Ab complex to the cell surface, and other primary cellular receptors are required for virus entry. Understanding the viral entry pathway in ADE of DENV infection will greatly facilitate rational designs of anti-viral therapeutics against severe dengue disease associated with ADE. - Highlights: • KKK305/307/310 in DENV2 E-DIII is critical for virus attachment in ADE and non-ADE infection. • Binding of DENV2–Ab complex with FcγRII alone is not sufficient for virus entry in ADE infection. • Other primary receptors were required for DENV2 internalization during FcγRII–mediated ADE. • G104 and L135 of DENV2 E are critical for virus-mediated membrane fusion. • DENV2 virus-mediated membrane fusion is required for both ADE and non-ADE infection.

  13. Recombinant factor VIII Fc (rFVIIIFc) fusion protein reduces immunogenicity and induces tolerance in hemophilia A mice.

    Science.gov (United States)

    Krishnamoorthy, Sriram; Liu, Tongyao; Drager, Douglas; Patarroyo-White, Susannah; Chhabra, Ekta Seth; Peters, Robert; Josephson, Neil; Lillicrap, David; Blumberg, Richard S; Pierce, Glenn F; Jiang, Haiyan

    2016-03-01

    Anti-factor VIII (FVIII) antibodies is a major complication of FVIII replacement therapy for hemophilia A. We investigated the immune response to recombinant human factor VIII Fc (rFVIIIFc) in comparison to BDD-rFVIII and full-length rFVIII (FL-rFVIII) in hemophilia A mice. Repeated administration of therapeutically relevant doses of rFVIIIFc in these mice resulted in significantly lower antibody responses to rFVIII compared to BDD-rFVIII and FL-rFVIII and reduced antibody production upon subsequent challenge with high doses of rFVIIIFc. The induction of a tolerogenic response by rFVIIIFc was associated with higher percentage of regulatory T-cells, a lower percentage of pro-inflammatory splenic T-cells, and up-regulation of tolerogenic cytokines and markers. Disruption of Fc interactions with either FcRn or Fcγ receptors diminished tolerance induction, suggesting the involvement of these pathways. These results indicate that rFVIIIFc reduces immunogenicity and imparts tolerance to rFVIII demonstrating that recombinant therapeutic proteins may be modified to influence immunogenicity and facilitate tolerance.

  14. FcγRI mediates serum amyloid P inhibition of fibrocyte differentiation.

    Science.gov (United States)

    Crawford, Jeffrey R; Pilling, Darrell; Gomer, Richard H

    2012-10-01

    Fibrotic diseases, such as cardiac and pulmonary fibrosis, have a poor prognosis with no FDA approved therapies. Monocyte-derived, fibroblast-like cells, called fibrocytes, participate in the formation of fibrotic lesions. The conserved pentraxin protein SAP inhibits fibrocyte differentiation in cell culture, and injections of SAP significantly reduce fibrosis in several animal models. SAP binds to the receptors for the Fc portion of IgG (FcγR) and has been crystallized bound to FcγRIIa (CD32a). The in vivo activity of SAP appears to be dependent on the FcRγ. We find that mutagenesis of the residues critical for SAP binding to FcγRIIa only moderately decreases the ability of SAP to inhibit fibrocyte differentiation. In murine cells, deletion of FcRγ or FcγRI (CD64) significantly reduced sensitivity to SAP. Deletion of the combination of FcγRIIb, FcγRIIIa, and FcγRIV did not significantly affect sensitivity to SAP, whereas deletion of just the inhibitory receptor FcγRIIb (CD32b) increased sensitivity to SAP. In human cells, siRNA-mediated reduction of FcRγ or FcγRI levels significantly decreased sensitivity to SAP, whereas reduction of FcγRIIb levels increased sensitivity to SAP. These observations suggest that SAP, at least in part, uses FcγRI and FcRγ to inhibit fibrocyte differentiation.

  15. In vivo Cytotoxicity of Type I CD20 Antibodies Critically Depends on Fc Receptor ITAM Signaling

    NARCIS (Netherlands)

    de Haij, Simone; Jansen, J. H. Marco; Boross, Peter; Beurskens, Frank J.; Bakema, Jantine E.; Bos, Desiree L.; Martens, Anton; Verbeek, J. Sjef; Parren, Paul W. H. I.; van de Winkel, Jan G. J.; Leusen, Jeanette H. W.

    2010-01-01

    Antibody-Fc receptor (FcR) interactions play an important role in the mechanism of action of most therapeutic antibodies against cancer. Effector cell activation through FcR triggering may induce tumor cell killing via antibody-dependent cellular cytotoxicity (ADCC). Reciprocally, FcR cross-linking

  16. Dicty_cDB: FC-AW02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AW02 (Link to dictyBase) - - - Contig-U16151-1 FC-AW02F (Li...nk to Original site) FC-AW02F 576 - - - - - - Show FC-AW02 Library FC (Link to library) Clone ID FC-AW02 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...TWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLSGSDPKEVGTYYMDVTVPTG TTCTGTNGICTLQAYTESSGWYS...VTFKLATNGGTTEGDFTTTLTSKVLSGSDPKEVGTYYMDVTVPTG TTCTGTNGICTLQAYTESSGWYSCSAIKLDSSACD

  17. Dicty_cDB: FC-IC1404 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1404 (Link to dictyBase) - - - Contig-U08328-1 FC-IC14... (Link to library) Clone ID FC-IC1404 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U08328-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...in*h*hqll Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1453 (FC-IC1453Q) /CSM/FC-IC... 32.0 %: nuclear 8.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi >> prediction for FC-IC140

  18. Dicty_cDB: FC-IC0538 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0538 (Link to dictyBase) - - - Contig-U16271-1 - (Link to Original site) FC-IC...(Link to library) Clone ID FC-IC0538 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig ...Contig-U16271-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...itfggcnrttcewfctfcewgatsfs*tt*f Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC....0 %: mitochondrial 4.0 %: peroxisomal >> prediction for FC-IC0538 is cyt 5' end seq. ID FC-IC0538F 5' end seq. >FC-IC

  19. Dicty_cDB: FC-IC1348 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1348 (Link to dictyBase) - - - Contig-U13052-1 FC-IC13... (Link to library) Clone ID FC-IC1348 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U13052-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...qvivhyqriihnqd Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1348 (FC-IC...les of secretory system >> prediction for FC-IC1348 is cyt 5' end seq. ID FC-IC

  20. Dicty_cDB: FC-IC1091 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1091 (Link to dictyBase) - - - Contig-U16382-1 - (Link to Original site) FC-IC...1091F 428 - - - - - - Show FC-IC1091 Library FC-IC (Link to library) Clone ID FC-IC1091 (Link to dic...skeletal 8.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> prediction for FC-IC1091 is cyt 5' end seq. ID FC-IC...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1091Q.Seq.d/ Representative se

  1. Dicty_cDB: FC-IC0129 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0129 (Link to dictyBase) - - - Contig-U07963-1 FC-IC01...29F (Link to Original site) FC-IC0129F 160 - - - - - - Show FC-IC0129 Library FC-IC (Link to library) Clone ID FC-IC.../FC-IC0401Q.Seq.d/ 281 2e-75 own update 2004.12.25 Homology vs DNA Score E Sequences producing signific... 4.0 %: peroxisomal >> prediction for FC-IC0129 is nuc 5' end seq. ID FC-IC...0129 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07963-1 Original site URL http://dic

  2. Dicty_cDB: FC-IC0911 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0911 (Link to dictyBase) - - - Contig-U15103-1 FC-IC09... (Link to library) Clone ID FC-IC0911 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link ...to Contig Contig-U15103-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...rwwifv**snfdciw*s*ksipk**n yntliw Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC... of secretory system >> prediction for FC-IC0911 is nuc 5' end seq. ID FC-IC0911F 5' end seq. >FC-IC0911F.Se

  3. Dicty_cDB: FC-IC0102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0102 (Link to dictyBase) - - - Contig-U16527-1 FC-IC01...02F (Link to Original site) FC-IC0102F 434 - - - - - - Show FC-IC0102 Library FC-IC (Link to library) Clone ID FC-IC...dtxisxpllnm--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0102 (FC-IC...: cytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for FC-IC...0102 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dic

  4. Dicty_cDB: FC-IC0854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0854 (Link to dictyBase) - - - Contig-U16142-1 FC-IC08...ink to library) Clone ID FC-IC0854 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U16142-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...nllkkkkkksvkyvfck**n Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0854 (FC-IC... 36.0 %: nuclear 16.0 %: mitochondrial 4.0 %: cytoskeletal >> prediction for FC-IC0854 is cyt 5' end seq. ID FC-IC

  5. Dicty_cDB: FC-IC1202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1202 (Link to dictyBase) - - - Contig-U16527-1 FC-IC12... (Link to library) Clone ID FC-IC1202 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...**cst*islpy*iw Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...20.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for FC-IC1202 is cyt 5' end seq. ID FC-IC

  6. Dicty_cDB: FC-IC1239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1239 (Link to dictyBase) - - - Contig-U16527-1 FC-IC12... (Link to library) Clone ID FC-IC1239 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...qiyldilslrnhmk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC1239 is end 5' end seq. ID FC-IC

  7. Dicty_cDB: FC-IC1122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1122 (Link to dictyBase) - - - Contig-U16527-1 FC-IC11... (Link to library) Clone ID FC-IC1122 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...**cst*islpy*iw Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...20.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for FC-IC1122 is cyt 5' end seq. ID FC-IC

  8. Dicty_cDB: FC-IC1127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1127 (Link to dictyBase) - - - Contig-U16527-1 FC-IC11... (Link to library) Clone ID FC-IC1127 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...**cst*islpy*iw Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...20.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for FC-IC1127 is cyt 5' end seq. ID FC-IC

  9. Dicty_cDB: FC-IC1173 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1173 (Link to dictyBase) - - - Contig-U16527-1 FC-IC11... (Link to library) Clone ID FC-IC1173 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...qiyldilslrnhmk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC1173 is end 5' end seq. ID FC-IC

  10. Dicty_cDB: FC-IC0826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0826 (Link to dictyBase) - - - Contig-U08366-1 FC-IC08... (Link to library) Clone ID FC-IC0826 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U08366-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...CFALIDLHLISGYWWWFDGAYFTVLEI Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0826 (FC-IC...ne 12.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC0826 is end 5' end seq. ID FC-IC

  11. Dicty_cDB: FC-IC1048 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1048 (Link to dictyBase) - - - Contig-U07467-1 - (Link to Original site) FC-IC...1048F 172 - - - - - - Show FC-IC1048 Library FC-IC (Link to library) Clone ID FC-IC1048 (Link to dic...: cytoskeletal 4.0 %: plasma membrane 4.0 %: peroxisomal >> prediction for FC-IC1048 is mit 5' end seq. ID FC-IC...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07467-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1048Q.Seq.d/ Representative se

  12. Dicty_cDB: FC-IC1462 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1462 (Link to dictyBase) - G24314 DDB0202795 Contig-U08394-1 FC-IC... (Link to library) Clone ID FC-IC1462 (Link to dictyBase) Atlas ID - NBRP ID G24314 dic...fhiflvygkeilqq Homology vs CSM-cDNA Score E Sequences producing significant align...1462E (Link to Original site) FC-IC1462F 268 FC-IC1462Z 268 FC-IC1462P 516 FC-IC1462E 258 Show FC-IC1462 Library FC-IC...tyBase ID DDB0202795 Link to Contig Contig-U08394-1 Original site URL http://dic

  13. Dicty_cDB: FC-IC1198 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1198 (Link to dictyBase) - - - Contig-U16527-1 FC-IC11... (Link to library) Clone ID FC-IC1198 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...qiyldilslrnhmk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC1198 is end 5' end seq. ID FC-IC

  14. Dicty_cDB: FC-IC1539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1539 (Link to dictyBase) - - - Contig-U16278-1 - (Link to Original site) FC-IC...1539F 679 - - - - - - Show FC-IC1539 Library FC-IC (Link to library) Clone ID FC-IC1539 (Link to dic...skkk*nkknxxxf*stxkkkkkkvcplgxnxpkpnf--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC... >> prediction for FC-IC1539 is mit 5' end seq. ID FC-IC1539F 5' end seq. >FC-IC1539F.S...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16278-1 Original site URL http://dic

  15. Dicty_cDB: FC-IC0874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0874 (Link to dictyBase) - - - Contig-U16382-1 FC-IC08... (Link to library) Clone ID FC-IC0874 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...kpstpqpc Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC...cytoskeletal 4.0 %: peroxisomal >> prediction for FC-IC0874 is nuc 5' end seq. ID FC-IC0874F 5' end seq. >FC-IC

  16. Dicty_cDB: FC-IC0897 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0897 (Link to dictyBase) - - - Contig-U10119-1 FC-IC08... (Link to library) Clone ID FC-IC0897 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U10119-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...dklelkrtyiqd*irlpqypglrnyklskhfsw Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC...0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for FC-IC0897 is nuc 5' end seq. ID FC-IC0897F 5' end seq. >FC-IC

  17. Protocol for a cluster randomised trial of a communication skills intervention for physicians to facilitate survivorship transition in patients with lymphoma

    Science.gov (United States)

    Parker, Patricia A; Banerjee, Smita C; Matasar, Matthew J; Bylund, Carma L; Franco, Kara; Li, Yuelin; Levin, Tomer T; Jacobsen, Paul B; Astrow, Alan B; Leventhal, Howard; Horwitz, Steven; Kissane, David W

    2016-01-01

    Introduction Survivors of cancer often describe a sense of abandonment post-treatment, with heightened worry, uncertainty, fear of recurrence and limited understanding of what lies ahead. This study examines the efficacy of a communication skills training (CST) intervention to help physicians address survivorship issues and introduce a new consultation focused on the use of a survivorship care plan for patients with Hodgkin's lymphoma and diffuse large B-cell lymphoma. Methods and analysis Specifically, this randomised, 4-site trial will test the efficacy of a survivorship planning consultation (physicians receive CST and apply these skills in a new survivorship-focused office visit using a survivorship plan) with patients who have achieved complete remission after completion of first-line therapy versus a control arm in which physicians are trained to subsequently provide a time-controlled, manualised wellness rehabilitation consultation focused only on discussion of healthy nutrition and exercise as rehabilitation postchemotherapy. The primary outcome for physicians will be uptake and usage of communication skills and maintenance of these skills over time. The primary outcome for patients is changes in knowledge about lymphoma and adherence to physicians’ recommendations (eg, pneumococcus and influenza vaccinations); secondary outcomes will include perceptions of the doctor–patient relationship, decreased levels of cancer worry and depression, quality of life changes, satisfaction with care and usage of healthcare. This study will also examine the moderators and mediators of change within our theoretical model derived from Leventhal's Common-Sense Model of health beliefs. Ethics and dissemination This study was approved by the Institutional Review Boards at Memorial Sloan Kettering Cancer Centers and all other participating sites. This work is funded by the National Cancer Institute (R01 CA 151899 awarded to DWK and SH as coprincipal investigators). The

  18. Facilitating Learning at Conferences

    DEFF Research Database (Denmark)

    Ravn, Ib; Elsborg, Steen

    2011-01-01

    and facilitate a variety of simple learning techniques at thirty one- and two-day conferences of up to 300 participants each. We present ten of these techniques and data evaluating them. We conclude that if conference organizers allocate a fraction of the total conference time to facilitated processes......The typical conference consists of a series of PowerPoint presentations that tend to render participants passive. Students of learning have long abandoned the transfer model that underlies such one-way communication. We propose an al-ternative theory of conferences that sees them as a forum...... for learning, mutual inspiration and human flourishing. We offer five design principles that specify how conferences may engage participants more and hence increase their learning. In the research-and-development effort reported here, our team collaborated with conference organizers in Denmark to introduce...

  19. Falloff curves for the recombination reaction Cl + FC(O)O + M --> FC(O)OCl + M.

    Science.gov (United States)

    Badenes, María P; Croce, Adela E; Cobos, Carlos J

    2006-03-09

    The pressure dependence of the recombination reaction Cl + FC(O)O + M --> FC(O)OCl + M has been investigated at 296 K. FC(O)O radicals and Cl atoms were generated by laser flash photodissociation of FC(O)OO(O)CF at 193 nm in mixtures with Cl2 and He or SF6 over the total pressure range 8-645 Torr. The measured FC(O)O radical and F atom yields in the photolysis are 0.33 +/- 0.06 and 0.67 +/- 0.06. The reaction lies in the falloff range approaching the high-pressure limit. The extrapolations toward the limiting low- and high-pressure ranges were carried out using a reduced falloff curves formalism, which includes a recent implementation for the strong-collision broadening factors. The resulting values for the low-pressure rate coefficients are (2.2 +/- 0.4) x 10(-28)[He], (4.9 +/- 0.9) x 10(-28)[SF6], (1.9 +/- 0.3) x 10(-28)[Cl2] and (5.9 +/- 1.1) x 10(-28)[FC(O)OO(O)CF] cm3 molecule(-1) s(-1). The derived high-pressure rate coefficient is (4.4 +/- 0.8) x 10(-11) cm3 molecule(-1) s(-1). For the reaction Cl + FC(O)OCl --> Cl2 + FC(O)O a rate coefficient of (1.6 +/- 0.3) x 10(-11) cm3 molecule(-1) s(-1) was determined. The high-pressure rate coefficient was theoretically interpreted using SACM/CT calculations on an ab initio electronic potential computed at the G3S level of theory. Standard heat of formation values of -99.9 and -102.5 kcal mol(-1) were computed at the G3//B3LYP/6-311++G(3df,3pd) level of theory for cis-FC(O)OCl and trans-FC(O)OCl, respectively. The computed electronic barrier for the conversion between the trans and cis conformers is 8.9 kcal mol(-1). On the basis of the present results, the above reactions are expected to have a negligible impact on stratospheric ozone levels.

  20. Rapid desensitization of mice with anti-FcγRIIb/FcγRIII mAb safely prevents IgG-mediated anaphylaxis.

    Science.gov (United States)

    Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Clay, Corey D; Morris, Suzanne C; Finkelman, Fred D

    2013-12-01

    Stimulatory IgG receptors (FcγRs) on bone marrow-derived cells contribute to the pathogenesis of several autoimmune and inflammatory disorders. Monoclonal antibodies that block FcγRs might suppress these diseases, but they can induce anaphylaxis. We wanted to determine whether a rapid desensitization approach can safely suppress IgG/FcγR-mediated anaphylaxis. Mice were injected with serially increasing doses of 2.4G2, a rat mAb that blocks the inhibitory FcγR, FcγRIIb, and the stimulatory receptor, FcγRIII. Rectal temperature was used to detect the development of anaphylaxis. Passive and active IgG-mediated anaphylaxis were evaluated in mice that had been rapidly desensitized with 2.4G2 or mock-desensitized in mice in which monocyte/macrophages, basophils, or neutrophils had been depleted or desensitized and in mice in which FcγRI, FcγRIII, and/or FcγRIV had been deleted or blocked. Rapid desensitization with 2.4G2 prevented 2.4G2-induced shock and completely suppressed IgG-mediated anaphylaxis. Rapid desensitization of ovalbumin-sensitized mice with 2.4G2 was safer and more effective than rapid desensitization with ovalbumin. 2.4G2 treatment completely blocked FcγRIII and removed most FcγRI and FcγRIV from nucleated peripheral blood cells. Because IgG(2a)-mediated anaphylaxis was partially FcγRI and FcγRIV dependent, the effects of 2.4G2 on FcγRI and FcγRIV were probably crucial for its complete inhibition of IgG(2a)-mediated anaphylaxis. IgG(2a)-mediated anaphylaxis was partially inhibited by depletion or desensitization of monocyte/macrophages, basophils, or neutrophils. IgG-mediated anaphylaxis can be induced by ligation of FcγRI, FcγRIII, or FcγRIV on monocycte/macrophages, basophils, or neutrophils and can be safely suppressed by rapid desensitization with anti-FcγRII/RIII mAb. A similar approach may safely suppress other FcγR-dependent immunopathology. Published by Mosby, Inc.

  1. Using GTO-Velo to Facilitate Communication and Sharing of Simulation Results in Support of the Geothermal Technologies Office Code Comparison Study

    Energy Technology Data Exchange (ETDEWEB)

    White, Signe K.; Purohit, Sumit; Boyd, Lauren W.

    2015-01-26

    defined, the problem creator can provide a description using a template on the metadata page corresponding to the benchmark problem folder. Project documents, references and videos of the weekly online meetings are shared via GTO-Velo. A results comparison tool allows users to plot their uploaded simulation results on the fly, along with those of other teams, to facilitate weekly discussions of the benchmark problem results being generated by the teams. GTO-Velo is an invaluable tool providing the project coordinators and team members with a framework for collaboration among geographically dispersed organizations.

  2. Importance of neonatal FcR in regulating the serum half-life of therapeutic proteins containing the Fc domain of human IgG1: a comparative study of the affinity of monoclonal antibodies and Fc-fusion proteins to human neonatal FcR.

    Science.gov (United States)

    Suzuki, Takuo; Ishii-Watabe, Akiko; Tada, Minoru; Kobayashi, Tetsu; Kanayasu-Toyoda, Toshie; Kawanishi, Toru; Yamaguchi, Teruhide

    2010-02-15

    The neonatal FcR (FcRn) binds to the Fc domain of IgG at acidic pH in the endosome and protects IgG from degradation, thereby contributing to the long serum half-life of IgG. To date, more than 20 mAb products and 5 Fc-fusion protein products have received marketing authorization approval in the United States, the European Union, or Japan. Many of these therapeutic proteins have the Fc domain of human IgG1; however, the serum half-lives differ in each protein. To elucidate the role of FcRn in the pharmacokinetics of Fc domain-containing therapeutic proteins, we evaluated the affinity of the clinically used human, humanized, chimeric, or mouse mAbs and Fc-fusion proteins to recombinant human FcRn by surface plasmon resonance analysis. The affinities of these therapeutic proteins to FcRn were found to be closely correlated with the serum half-lives reported from clinical studies, suggesting the important role of FcRn in regulating their serum half-lives. The relatively short serum half-life of Fc-fusion proteins was thought to arise from the low affinity to FcRn. The existence of some mAbs having high affinity to FcRn and a short serum half-life, however, suggested the involvement of other critical factor(s) in determining the serum half-life of such Abs. We further investigated the reason for the relatively low affinity of Fc-fusion proteins to FcRn and suggested the possibility that the receptor domain of Fc-fusion protein influences the structural environment of the FcRn binding region but not of the FcgammaRI binding region of the Fc domain.

  3. Compatibility of Fluorinert, FC-72, with selected materials.

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, James Henry; Sawyer, Patricia Sue

    2006-02-01

    Removable encapsulants have been developed as replacement materials for electronic encapsulation. They can be removed from an electronic assembly in a fairly benign manner. Encapsulants must satisfy a limited number of criteria to be useful. These include processing ease, certain mechanical, thermal, and electrical properties, adhesion to common clean surfaces, good aging characteristics, and compatibility. This report discusses one aspect of the compatibility of removable blown epoxy foams with electronic components. Of interest is the compatibility of the blowing agent, Fluorinert{trademark} (FC-72) electronic fluid with electronic parts, components, and select materials. Excellent compatibility is found with most of the investigated materials. A few materials, such as Teflon{reg_sign} that are comprised of chemicals very similar to FC-72 show substantial absorption of FC-72. No compatibility issues have yet been identified even for the few materials that show substantial absorption.

  4. X-ray Crystal Structures of Monomeric and Dimeric Peptide Inhibitors in Complex with the Human Neonatal Fc Receptor, FcRn

    Energy Technology Data Exchange (ETDEWEB)

    Mezo, Adam R.; Sridhar, Vandana; Badger, John; Sakorafas, Paul; Nienaber, Vicki (Zenobia); (Biogen)

    2010-10-28

    The neonatal Fc receptor, FcRn, is responsible for the long half-life of IgG molecules in vivo and is a potential therapeutic target for the treatment of autoimmune diseases. A family of peptides comprising the consensus motif GHFGGXY, where X is preferably a hydrophobic amino acid, was shown previously to inhibit the human IgG:human FcRn protein-protein interaction (Mezo, A. R., McDonnell, K. A., Tan Hehir, C. A., Low, S. C., Palombella, V. J., Stattel, J. M., Kamphaus, G. D., Fraley, C., Zhang, Y., Dumont, J. A., and Bitonti, A. J. (2008) Proc. Natl. Acad. Sci. U.S.A., 105, 2337-2342). Herein, the x-ray crystal structure of a representative monomeric peptide in complex with human FcRn was solved to 2.6 {angstrom} resolution. The structure shows that the peptide binds to human FcRn at the same general binding site as does the Fc domain of IgG. The data correlate well with structure-activity relationship data relating to how the peptide family binds to human FcRn. In addition, the x-ray crystal structure of a representative dimeric peptide in complex with human FcRn shows how the bivalent ligand can bridge two FcRn molecules, which may be relevant to the mechanism by which the dimeric peptides inhibit FcRn and increase IgG catabolism in vivo. Modeling of the peptide:FcRn structure as compared with available structural data on Fc and FcRn suggest that the His-6 and Phe-7 (peptide) partially mimic the interaction of His-310 and Ile-253 (Fc) in binding to FcRn, but using a different backbone topology.

  5. Dicty_cDB: FC-IC1065 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1065 (Link to dictyBase) - - - Contig-U16527-1 - (Link to Original site) FC-IC...1065F 303 - - - - - - Show FC-IC1065 Library FC-IC (Link to library) Clone ID FC-IC1065 (Link to dic...2.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1065Q.Seq.d/ Representative se

  6. Dicty_cDB: FC-IC0747 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0747 (Link to dictyBase) - - - Contig-U16382-1 - (Link... to Original site) - - FC-IC0747Z 420 - - - - Show FC-IC0747 Library FC-IC (Link to library) Clone ID FC-IC0747 (Link to dic... 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: peroxisomal >> prediction for FC-IC0747 is cyt 5' end seq. ID - ...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0747Q.Seq.d/ Representative se

  7. Dicty_cDB: FC-IC1306 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1306 (Link to dictyBase) - - - Contig-U16527-1 FC-IC13... (Link to library) Clone ID FC-IC1306 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...qiyldilslrnhmk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...itochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC

  8. Dicty_cDB: FC-IC1177 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1177 (Link to dictyBase) - - - Contig-U07878-1 FC-IC11...ink to library) Clone ID FC-IC1177 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Co...ntig-U07878-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...ikpleslklqlviqvgtmqi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1177 (FC-IC....0 %: mitochondrial 16.0 %: nuclear 8.0 %: Golgi 4.0 %: plasma membrane 4.0 %: vesicles of secretory system >> prediction for FC-IC

  9. Dicty_cDB: FC-IC0229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0229 (Link to dictyBase) - - - Contig-U16527-1 FC-IC02... (Link to library) Clone ID FC-IC0229 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...qiyldilslrnhmk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...itochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC

  10. Dicty_cDB: FC-IC0224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0224 (Link to dictyBase) - - - Contig-U07878-1 FC-IC02... (Link to library) Clone ID FC-IC0224 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U07878-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1408 (FC-IC...ial 8.0 %: Golgi 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for FC-IC

  11. Dicty_cDB: FC-IC0806 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0806 (Link to dictyBase) - - - Contig-U16382-1 FC-IC08... (Link to library) Clone ID FC-IC0806 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16382-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...epssisdsttgv*r Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0806 (FC-IC...3b: 0.00 m_ : 1.00 44.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: mitochondrial 8.0 %: cytoskeletal >> prediction for FC-IC

  12. Dicty_cDB: FC-IC0255 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0255 (Link to dictyBase) - - - Contig-U11160-1 FC-IC02... (Link to library) Clone ID FC-IC0255 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link ...to Contig Contig-U11160-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...APTTSSFKIRQSSSYLVTRLS AC Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0255 (FC-IC...3b: 0.00 m_ : 1.00 40.0 %: cytoplasmic 32.0 %: nuclear 24.0 %: mitochondrial 4.0 %: cytoskeletal >> prediction for FC-IC

  13. Dicty_cDB: FC-IC0392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0392 (Link to dictyBase) - - - Contig-U16527-1 FC-IC03... (Link to library) Clone ID FC-IC0392 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link ...to Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...lsqrlshaclsinsc Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC... 4.0 %: vacuolar 4.0 %: Golgi >> prediction for FC-IC0392 is mit 5' end seq. ID FC-IC

  14. Dicty_cDB: FC-IC0893 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0893 (Link to dictyBase) - - - Contig-U16527-1 FC-IC08... (Link to library) Clone ID FC-IC0893 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...rtxxvxlxxxxcxcaails Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0893 (FC-IC...%: mitochondrial 8.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for FC-IC

  15. Dicty_cDB: FC-IC0959 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0959 (Link to dictyBase) - - - Contig-U16527-1 FC-IC09... (Link to library) Clone ID FC-IC0959 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U16527-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...qiyldilslrnhmk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC1760 (FC-IC...ochondrial 4.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: cytoplasmic >> prediction for FC-IC

  16. Dicty_cDB: FC-IC0639 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0639 (Link to dictyBase) - - - Contig-U11835-1 - (Link... to Original site) - - FC-IC0639Z 505 - - - - Show FC-IC0639 Library FC-IC (Link to library) Clone ID FC-IC0639 (Link to dic...m discoideum gamete cDNA clone:FC-IC0... 511 0.0 2 ( C90116 ) Dictyostelium disco...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11835-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0639Q.Seq.d/ Representative se

  17. Dicty_cDB: FC-IC0369 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0369 (Link to dictyBase) - - - Contig-U16271-1 - (Link to Original site) FC-IC...0369F 413 - - - - - - Show FC-IC0369 Library FC-IC (Link to library) Clone ID FC-IC0369 (Link to dic...k--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC...lular, including cell wall 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-IC0369 is cyt 5' end seq. ID FC-IC...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16271-1 Original site URL http://dic

  18. Dicty_cDB: FC-IC0973 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0973 (Link to dictyBase) - - - Contig-U08327-1 - (Link... to Original site) - - FC-IC0973Z 180 - - - - Show FC-IC0973 Library FC-IC (Link to library) Clone ID FC-IC0973 (Link to dic...0 68.0 %: nuclear 24.0 %: cytoplasmic 8.0 %: mitochondrial >> prediction for FC-IC0973 is nuc 5' end seq. ID...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08327-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0973Q.Seq.d/ Representative se

  19. Dicty_cDB: FC-IC1312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1312 (Link to dictyBase) - - - Contig-U10129-1 - (Link... to Original site) - - FC-IC1312Z 382 - - - - Show FC-IC1312 Library FC-IC (Link to library) Clone ID FC-IC1312 (Link to dic...tem 4.0 %: extracellular, including cell wall >> prediction for FC-IC1312 is end 5' end seq. ID - 5' end seq...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10129-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1312Q.Seq.d/ Representative se

  20. Dicty_cDB: FC-IC0579 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0579 (Link to dictyBase) - - - Contig-U16527-1 - (Link to Original site) FC-IC...0579F 179 - - - - - - Show FC-IC0579 Library FC-IC (Link to library) Clone ID FC-IC0579 (Link to dic...0 %: plasma membrane 4.0 %: vesicles of secretory system >> prediction for FC-IC0...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC0579Q.Seq.d/ Representative se

  1. 浅析IP-SAN和FC-SAN解决方案

    Institute of Scientific and Technical Information of China (English)

    林文栋

    2010-01-01

    存储技术发展日新月异,SAN可说是DAS网络化发展趋势下的产物.本文简介绍IP SAN和FC SAN,对IP SAN和FC SAN的架构以及构建成本、可扩展性、易用性、兼容性、稳定性和速度等的比较,认为各有千秋,两者之间应取长补短,互相共存.

  2. Fully human monoclonal antibody inhibitors of the neonatal Fc receptor (FcRn reduce circulating IgG in nonhuman primates

    Directory of Open Access Journals (Sweden)

    Andrew E Nixon

    2015-04-01

    Full Text Available The therapeutic management of antibody mediated autoimmune disease typically involves immunosuppressant and immunomodulatory strategies. However, perturbing the fundamental role of the neonatal Fc receptor (FcRn in salvaging IgG from lysosomal degradation provides a novel approach – depleting the body of pathogenic immunoglobulin by preventing IgG binding to FcRn and thereby increasing the rate of IgG catabolism. Herein, we describe the discovery and preclinical evaluation of fully human monoclonal IgG antibody inhibitors of FcRn. Using phage display, we identified several potent inhibitors of human FcRn in which binding to FcRn is pH independent, with over 1000-fold higher affinity for human FcRn than human IgG-Fc at pH 7.4. FcRn antagonism in vivo using a human-FcRn knock-in transgenic mouse model caused enhanced catabolism of exogenously administered human IgG. In non-human primates we observed reductions in endogenous circulating IgG of > 60% with no changes in albumin, IgM, or IgA. FcRn antagonism did not disrupt the ability of non-human primates to mount IgM/IgG primary and secondary immune responses. Interestingly, the therapeutic anti-FcRn antibodies had a short serum half-life but caused a prolonged reduction in IgG levels. This may be explained by the high affinity of the antibodies to FcRn at both acidic and neutral pH. These results provide important preclinical proof of concept data in support of FcRn antagonism as a novel approach to the treatment of antibody mediated autoimmune diseases.

  3. HAL/S-FC compiler system functional specification

    Science.gov (United States)

    1974-01-01

    Compiler organization is discussed, including overall compiler structure, internal data transfer, compiler development, and code optimization. The user, system, and SDL interfaces are described, along with compiler system requirements. Run-time software support package and restrictions and dependencies are also considered of the HAL/S-FC system.

  4. Fc-mediated immune precipitation. III. Visualization by electron microscopy

    DEFF Research Database (Denmark)

    Møller, NPH; Christiansen, Gunna

    1983-01-01

    Fc-mediated interactions between immune complexes are of major importance for the precipitin reaction. In the present study these interactions were investigated by means of electron microscopy. Keyhole limpet haemocyanin (KLH) was adsorbed to a thin glow charged carbon supporting film and reacted...

  5. Developing the IVIG biomimetic, hexa-Fc, for drug and vaccine applications.

    Science.gov (United States)

    Czajkowsky, Daniel M; Andersen, Jan Terje; Fuchs, Anja; Wilson, Timothy J; Mekhaiel, David; Colonna, Marco; He, Jianfeng; Shao, Zhifeng; Mitchell, Daniel A; Wu, Gang; Dell, Anne; Haslam, Stuart; Lloyd, Katy A; Moore, Shona C; Sandlie, Inger; Blundell, Patricia A; Pleass, Richard J

    2015-04-27

    The remarkable clinical success of Fc-fusion proteins has driven intense investigation for even more potent replacements. Using quality-by-design (QbD) approaches, we generated hexameric-Fc (hexa-Fc), a ~20 nm oligomeric Fc-based scaffold that we here show binds low-affinity inhibitory receptors (FcRL5, FcγRIIb, and DC-SIGN) with high avidity and specificity, whilst eliminating significant clinical limitations of monomeric Fc-fusions for vaccine and/or cancer therapies, in particular their poor ability to activate complement. Mass spectroscopy of hexa-Fc reveals high-mannose, low-sialic acid content, suggesting that interactions with these receptors are influenced by the mannose-containing Fc. Molecular dynamics (MD) simulations provides insight into the mechanisms of hexa-Fc interaction with these receptors and reveals an unexpected orientation of high-mannose glycans on the human Fc that provides greater accessibility to potential binding partners. Finally, we show that this biosynthetic nanoparticle can be engineered to enhance interactions with the human neonatal Fc receptor (FcRn) without loss of the oligomeric structure, a crucial modification for these molecules in therapy and/or vaccine strategies where a long plasma half-life is critical.

  6. Soluble Fc gamma R (sFc gamma R): detection in biological fluids and production of a murine recombinant sFc gamma R biologically active in vitro and in vivo.

    Science.gov (United States)

    Sautès, C; Teillaud, C; Mazières, N; Tartour, E; Bouchard, C; Galinha, A; Jourde, M; Spagnoli, R; Fridman, W H

    1992-08-01

    Soluble forms of receptors for the Fc portion of IgG (sFc gamma R) were detected in biological fluids from mice and humans. In mouse bearing tumors, circulating amounts of sFc gamma R increased concurrently with tumor growth. Tumors secreting IgG2a, IgG2b or IgG3 led to a 5- to 10-fold increase in serum sFc gamma R levels whereas tumors secreting IgG1, IgGA or other types of tumors (non Ig B cell tumors, T cell lymphoma and a melanoma) increased 2- to 3-fold the levels of circulating sFc gamma R. In the human, sFc gamma R were also detected in whole unstimulated saliva. Levels of sFc gamma RII and of sFc gamma RIII were variable and did not seem to depend on the dental status of the individuals. Finally, a murine recombinant sFc gamma R (rsFc gamma R) composed of the two extracellular domains of Fc gamma RII was produced by culture of transfected L cells in bioreactors. The purified rsFc gamma R was found to inhibit antibody production in vitro in anti-SRBC responses and by cultures of small B cells stimulated by anti-IgM antibodies in the presence of IL-4 and IL-5. Moreover, the i.p. injection of this material into adult mice immunized with SRBC led to a decrease of IgG antibody production by splenocytes, as measured by a hemolytic plaque assay, and in serum, as measured by antigen-specific ELISA.

  7. Therapeutic effect of AdCMVCD/5-FC system and metabolism of 5-FC in the treatment of human tongue squamous cell carcinoma

    Institute of Scientific and Technical Information of China (English)

    王安训; 黄洪章; 李苏

    2003-01-01

    Objective To investigate the therapeutic effect and metabolism of 5-fluorocytosine (5-FC ) in human tongue squamous carcinoma cells after treatment with adenovirus-medi ated cytosine deaminase (AdCMVCD)/5-FC system. Methods Human tongue squamous carcinoma cells (Tca8113 cell line) and its xenografts in BALB/c nude mice were treated with AdCMVCD/5-FC system. The killing effect in vitro and bystander effect were detected by microculture tetrazolium (MTT) assay . Tumor inhibition effect and histopathological changes were observed in vivo. High-performance liquid chromatography (HPLC) was performed to determine the metabolism of 5-FC in vitro and in vivo. Results AdCMVCD/5-FC system had strong killing effect and bystander effect on Tca8113 cells. Both condition media and cell extracts showed two peaks identified as 5- FC and 5-fluorouracil (5-FU) by HPLC and a time-dependent generation of 5-FU and concomitant time-dependent decreases of 5-FC. Compared to the control groups, mice treated with AdCMVCD/5-FC system demonstrated significant tumor regr ession (P<0.001); the tumor doubling time prolonged and inhibition rate was 92.62%. There were substantial tumor necrotic areas and infiltrative lymphocy tes around necrotic areas in the AdCMVCD/5-FC treated group under light microscope. There was a significantly low concentration of 5-FC and high concentratio n of 5-FU in tumor tissue, but only 5-FC was found in blood. Conclusion AdCMVCD/5-FC suicide gene system had significant in vitro and in vivo anti-tumor effect on human tongue squamous cell carcinomadue to convert 5-FC into 5-F U.

  8. Dicty_cDB: FC-IC1055 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1055 (Link to dictyBase) - - - Contig-U16382-1 - (Link to Original site) FC-IC...1055F 170 - - - - - - Show FC-IC1055 Library FC-IC (Link to library) Clone ID FC-IC1055 (Link to dic... 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: vesicles of secretory system >> predic...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dic...tycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC1055Q.Seq.d/ Representative se

  9. Dicty_cDB: FC-IC1562 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1562 (Link to dictyBase) - - - Contig-U07878-1 FC-IC15... (Link to library) Clone ID FC-IC1562 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U07878-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...gvsvtv*s Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC... 12.0 %: mitochondrial 8.0 %: Golgi 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for FC-IC

  10. Dicty_cDB: FC-IC0568 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0568 (Link to dictyBase) - - - Contig-U16079-1 - (Link to Original site) FC-IC...0568F 756 - - - - - - Show FC-IC0568 Library FC-IC (Link to library) Clone ID FC-IC0568 (Link to dic...viv*ffftfecdwr*n*initnt cidfisv--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC... 32.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-IC...tyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16079-1 Original site URL http://dic

  11. SYSTEM OF GENERALIZED VECTOR QUASI-EQUILIBRIUM PROBLEMS ON PRODUCT FC-SPACES

    Institute of Scientific and Technical Information of China (English)

    Ding Xieping

    2007-01-01

    By applying a maximal element theorem on product FC-space due to author, some new equilibrium existence theorems for generalized games with fuzzy constraint correspondences are proved in FC-spaces. By using these equilibrium existence theorems, some new existence theorems of solutions for the system of generalized vector quasi-equilibrium problems are established in noncompact product FC-spaces. These results improve and generalize some recent results in literature to product FC-spaces without any convexity structure.

  12. Immunoglobulin Fc gamma receptor promotes immunoglobulin uptake, immunoglobulin-mediated calcium increase, and neurotransmitter release in motor neurons

    Science.gov (United States)

    Mohamed, Habib A.; Mosier, Dennis R.; Zou, Ling L.; Siklos, Laszlo; Alexianu, Maria E.; Engelhardt, Jozsef I.; Beers, David R.; Le, Wei-dong; Appel, Stanley H.

    2002-01-01

    Receptors for the Fc portion of immunoglobulin G (IgG; FcgammaRs) facilitate IgG uptake by effector cells as well as cellular responses initiated by IgG binding. In earlier studies, we demonstrated that amyotrophic lateral sclerosis (ALS) patient IgG can be taken up by motor neuron terminals and transported retrogradely to the cell body and can alter the function of neuromuscular synapses, such as increasing intracellular calcium and spontaneous transmitter release from motor axon terminals after passive transfer. In the present study, we examined whether FcgammaR-mediated processes can contribute to these effects of ALS patient immunoglobulins. F(ab')(2) fragments (which lack the Fc portion) of ALS patient IgG were not taken up by motor axon terminals and were not retrogradely transported. Furthermore, in a genetically modified mouse lacking the gamma subunit of the FcR, the uptake of whole ALS IgG and its ability to enhance intracellular calcium and acetylcholine release were markedly attenuated. These data suggest that FcgammaRs appear to participate in IgG uptake into motor neurons as well as IgG-mediated increases in intracellular calcium and acetylcholine release from motor axon terminals. Copyright 2002 Wiley-Liss, Inc.

  13. Human cytomegalovirus Fcγ binding proteins gp34 and gp68 antagonize Fcγ receptors I, II and III.

    Directory of Open Access Journals (Sweden)

    Eugenia Corrales-Aguilar

    2014-05-01

    Full Text Available Human cytomegalovirus (HCMV establishes lifelong infection with recurrent episodes of virus production and shedding despite the presence of adaptive immunological memory responses including HCMV immune immunoglobulin G (IgG. Very little is known how HCMV evades from humoral and cellular IgG-dependent immune responses, the latter being executed by cells expressing surface receptors for the Fc domain of IgG (FcγRs. Remarkably, HCMV expresses the RL11-encoded gp34 and UL119-118-encoded gp68 type I transmembrane glycoproteins which bind Fcγ with nanomolar affinity. Using a newly developed FcγR activation assay, we tested if the HCMV-encoded Fcγ binding proteins (HCMV FcγRs interfere with individual host FcγRs. In absence of gp34 or/and gp68, HCMV elicited a much stronger activation of FcγRIIIA/CD16, FcγRIIA/CD32A and FcγRI/CD64 by polyclonal HCMV-immune IgG as compared to wildtype HCMV. gp34 and gp68 co-expression culminates in the late phase of HCMV replication coinciding with the emergence of surface HCMV antigens triggering FcγRIII/CD16 responses by polyclonal HCMV-immune IgG. The gp34- and gp68-dependent inhibition of HCMV immune IgG was fully reproduced when testing the activation of primary human NK cells. Their broad antagonistic function towards FcγRIIIA, FcγRIIA and FcγRI activation was also recapitulated in a gain-of-function approach based on humanized monoclonal antibodies (trastuzumab, rituximab and isotypes of different IgG subclasses. Surface immune-precipitation showed that both HCMV-encoded Fcγ binding proteins have the capacity to bind trastuzumab antibody-HER2 antigen complexes demonstrating simultaneous linkage of immune IgG with antigen and the HCMV inhibitors on the plasma membrane. Our studies reveal a novel strategy by which viral FcγRs can compete for immune complexes against various Fc receptors on immune cells, dampening their activation and antiviral immunity.

  14. A strategy for bacterial production of a soluble functional human neonatal Fc receptor

    DEFF Research Database (Denmark)

    Andersen, Jan Terje; Justesen, Sune; Berntzen, Gøril

    2008-01-01

    The major histocompatibility complex (MHC) class I related receptor, the neonatal Fc receptor (FcRn), rescues immunoglobulin G (IgG) and albumin from lysosomal degradation by recycling in endothelial cells. FcRn also contributes to passive immunity by mediating transport of IgG from mother to fetus...

  15. 21 CFR 866.5530 - Immunoglobulin G (Fc fragment specific) immunological test system.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Immunoglobulin G (Fc fragment specific... Test Systems § 866.5530 Immunoglobulin G (Fc fragment specific) immunological test system. (a) Identification. An immunoglobulin G (Fc fragment specific) immunological test system is a device that consists...

  16. Dicty_cDB: FC-AC10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PLING. 42 3e-05 3 BQ104476 |BQ104476.1 fc0497.e Rose Petals (Fragrant Cloud) Lambda Zap Express Library Rosa... hybrid cultivar cDNA clone fc0497.e 5', mRNA sequence. 46 3e-05 2 CF349401 |CF349401.1 fc3079.e Rose Petals (Fragrant Cloud

  17. Sialylation of IgG Fc domain impairs complement-dependent cytotoxicity.

    Science.gov (United States)

    Quast, Isaak; Keller, Christian W; Maurer, Michael A; Giddens, John P; Tackenberg, Björn; Wang, Lai-Xi; Münz, Christian; Nimmerjahn, Falk; Dalakas, Marinos C; Lünemann, Jan D

    2015-11-01

    IgG molecules exert both pro- and antiinflammatory effector functions based on the composition of the fragment crystallizable (Fc) domain glycan. Sialylated IgG Fc domains have antiinflammatory properties that are attributed to their ability to increase the activation threshold of innate effector cells to immune complexes by stimulating the upregulation of the inhibitory Fcγ receptor IIB (FcγRIIB). Here, we report that IgG Fc sialylation of human monoclonal IgG1 molecules impairs their efficacy to induce complement-mediated cytotoxicity (CDC). Fc sialylation of a CD20-targeting antibody had no impact on antibody-dependent cellular cytotoxicity and did not change the affinity of the antibody for activating Fcγ receptors. In contrast, the presence of sialic acid abrogated the increased binding of C1q to Fc-galactosylated IgG1 and resulted in decreased levels of C3b deposition on the cell surface. Similar to monoclonal antibodies, sialic acid inhibited the increased C1q binding to galactosylated Fc fragments in human polyclonal IgG. In sera derived from patients with chronic inflammatory demyelinating polyneuropathy, an autoimmune disease of the peripheral nervous system in which humoral immune responses mediate tissue damage, induction of IgG Fc sialylation was associated with clinical disease remission. Thus, impairment of CDC represents an FcγR-independent mechanism by which Fc-sialylated glycovariants might limit proinflammatory IgG effector functions.

  18. Design of Host Bus Adapter Based on FC-AE-ASM%基于FC-AE-ASM协议主机总线适配器设计

    Institute of Scientific and Technical Information of China (English)

    袁新治

    2016-01-01

    FC-AE-ASM协议是FC-AE网络中的一种上层协议,研究FC-AE-ASM网络的主机总线适配器具有重要的意义.本文对FC-AE协议以及ASM协议进行分析,设计并实现一种FC-AE-ASM网络的主机总线适配器,并从FC-AE协议主机总线适配器的系统结构设计、ASM消息收发机制等方面对该设计说明,最后通过实验验证了系统的可用性.

  19. Design and Implementation of Scheduling Algorithm on FC-AE Network%FC-AE网络数据发送调度算法的设计与实现

    Institute of Scientific and Technical Information of China (English)

    郑小兵; 翟正军; 任岚昆

    2012-01-01

    针对FC-AE (Fibre Channel Avionic Environment)网络中缺乏实时有效的调度算法,提出一种基于位图映射的动态优先级调度算法( Bitmap- based Mapping of Dynamic Priority Scheduling- BMDPS),根据发送任务等待时间动态改变优先级,同时将不同优先级的发送任务映射到位图表中,来实现高优先级任务的发送调度;通过与“先来先服务”和“时间片轮转”两种调度算法进行对比,证明了该算法具有较小的平均响应时间和平均周转时间,且在最差的条件下,能保证FC- AE网络数据传输的实时性.%For the lack of effective real-time scheduling algorithm on FC-AE Network, this paper proposes Bitmap-based Mapping of Dynamic Priority Scheduling Algorithm (BMDPS). The Algorithm dynamic changes priorities according to the task waiting time. And then it maps the different priorities tasks in bitmap array to achieve the high-priority task scheduling. Based on the result of comparison with FCFS and Round- Robin Algorithm, it proved that BMDPS has better average response time and average turnaround time and can ensure the real - time transmission in the FC-AE communication in the worst conditions.

  20. Analytical FcRn affinity chromatography for functional characterization of monoclonal antibodies

    Science.gov (United States)

    Schlothauer, Tilman; Rueger, Petra; Stracke, Jan Olaf; Hertenberger, Hubert; Fingas, Felix; Kling, Lothar; Emrich, Thomas; Drabner, Georg; Seeber, Stefan; Auer, Johannes; Koch, Stefan; Papadimitriou, Apollon

    2013-01-01

    The neonatal Fc receptor (FcRn) is important for the metabolic fate of IgG antibodies in vivo. Analysis of the interaction between FcRn and IgG in vitro might provide insight into the structural and functional integrity of therapeutic IgG that may affect pharmacokinetics (PK) in vivo. We developed a standardized pH gradient FcRn affinity liquid chromatography method with conditions closely resembling the physiological mechanism of interaction between IgG and FcRn. This method allows the separation of molecular IgG isoforms, degradation products and engineered molecules based on their affinity to FcRn. Human FcRn was immobilized on the column and a linear pH gradient from pH 5.5 to 8.8 was applied. FcRn chromatography was used in comparison to surface plasmon resonance to characterize different monoclonal IgG preparations, e.g., oxidized or aggregated species. Wild-type and engineered IgGs were compared in vitro by FcRn chromatography and in vivo by PK studies in huFcRn transgenic mice. Analytical FcRn chromatography allows differentiation of IgG samples and variants by peak pattern and retention time profile. The method can distinguish: 1) IgGs with different Fabs, 2) oxidized from native IgG, 3) aggregates from monomer and 4) antibodies with mutations in the Fc part from wild-type IgGs. Changes in the FcRn chromatographic behavior of mutant IgGs relative to the wild-type IgG correlate to changes in the PK profile in the FcRn transgenic mice. These results demonstrate that FcRn affinity chromatography is a useful new method for the assessment of IgG integrity. PMID:23765230

  1. Facilitering som styringsredskab

    OpenAIRE

    Jørgensen, Karen Overgaard

    2006-01-01

    #This thesis surveys facilitation as a new tool of steering within the public sector in Denmark. It is explored how facilitation is articulated and practiced among facilitators from the public, private and voluntary sector. Furthermore, the facilitator’s challenges by using facilitation are examined. The thesis is based on the presumption that facilitation is articulated by rationalities, which influence how facilitation is practiced and performed. Also, a facilitator is seen as a performer a...

  2. Fcγ receptor-mediated inflammation inhibits axon regeneration.

    Directory of Open Access Journals (Sweden)

    Gang Zhang

    Full Text Available Anti-glycan/ganglioside antibodies are the most common immune effectors found in patients with Guillain-Barré Syndrome, which is a peripheral autoimmune neuropathy. We previously reported that disease-relevant anti-glycan autoantibodies inhibited axon regeneration, which echo the clinical association of these antibodies and poor recovery in Guillain-Barré Syndrome. However, the specific molecular and cellular elements involved in this antibody-mediated inhibition of axon regeneration are not previously defined. This study examined the role of Fcγ receptors and macrophages in the antibody-mediated inhibition of axon regeneration. A well characterized antibody passive transfer sciatic nerve crush and transplant models were used to study the anti-ganglioside antibody-mediated inhibition of axon regeneration in wild type and various mutant and transgenic mice with altered expression of specific Fcγ receptors and macrophage/microglia populations. Outcome measures included behavior, electrophysiology, morphometry, immunocytochemistry, quantitative real-time PCR, and western blotting. We demonstrate that the presence of autoantibodies, directed against neuronal/axonal cell surface gangliosides, in the injured mammalian peripheral nerves switch the proregenerative inflammatory environment to growth inhibitory milieu by engaging specific activating Fcγ receptors on recruited monocyte-derived macrophages to cause severe inhibition of axon regeneration. Our data demonstrate that the antibody orchestrated Fcγ receptor-mediated switch in inflammation is one mechanism underlying inhibition of axon regeneration. These findings have clinical implications for nerve repair and recovery in antibody-mediated immune neuropathies. Our results add to the complexity of axon regeneration in injured peripheral and central nervous systems as adverse effects of B cells and autoantibodies on neural injury and repair are increasingly recognized.

  3. TGEV infection up-regulates FcRn expression via activation of NF-?B signaling

    OpenAIRE

    Jinyue Guo; Fei Li; Shaoju Qian; Dingren Bi; Qigai He; Hui Jin; Rui Luo; Shaowen Li; Xianrong Meng; Zili Li

    2016-01-01

    It has been well characterized that the neonatal Fc receptor (FcRn) transports maternal IgG to a fetus or newborn and protects IgG from degradation. We previously reported that FcRn is expressed in a model of normal porcine intestinal epithelial cells (IPEC-J2). Transmissible gastroenteritis is an acute enteric disease of swine that is caused by transmissible gastroenteritis virus (TGEV). How porcine FcRn (pFcRn) expression is regulated by pathogenic infection remains unknown. Our research sh...

  4. Robust expression of the human neonatal Fc receptor in a truncated soluble form and as a full-length membrane-bound protein in fusion with eGFP.

    Directory of Open Access Journals (Sweden)

    Johan Seijsing

    Full Text Available Studies on the neonatal Fc receptor (FcRn have revealed a multitude of important functions in mammals, including protection of IgG and serum albumin (SA from lysosomal degradation. The pharmacokinetic behavior of therapeutic antibodies, IgG-Fc- and SA-containing drugs is therefore influenced by their interaction with FcRn. Pre-clinical development of such drugs is facilitated if their interaction with FcRn can be studied in vitro. For this reason we have developed a robust system for production of the soluble extracellular domain of human FcRn as well as the full-length receptor as fusion to green fluorescent protein, taking advantage of a lentivirus-based gene delivery system where stable over-expressing cells are easily and rapidly generated. Production of the extracellular domain in multiple-layered culture flasks, followed by affinity purification using immobilized IgG, resulted in capture of milligram amounts of soluble receptor per liter cell culture with retained IgG binding. The receptor was further characterized by SDS-PAGE, western blotting, circular dichroism spectroscopy, ELISA, surface plasmon resonance and a temperature stability assay showing a functional and stable protein of high purity. The full-length receptor was found to be successfully over-expressed in a membrane-bound form with retained pH-dependent IgG- and SA-binding.

  5. Dicty_cDB: FC-IC1643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC1643 (Link to dictyBase) - - - Contig-U10099-1 FC-IC16... (Link to library) Clone ID FC-IC1643 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link t...o Contig Contig-U10099-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC-IC/FC-IC...e. 50 0.011 1 CF589304 |CF589304.1 AGENCOURT_15703765 NICHD_XGC_Swb1N Silurana tropic... 32.0 %: mitochondrial 24.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for FC-IC164

  6. Communicating health.

    Science.gov (United States)

    Chatterjee, A

    1995-01-01

    Routine production of communication materials without paying attention to utilization, field test, and impact analysis is ineffective. The concept of information, education, and communication (IEC) should encompass voluntary activity of health education in a tradition of innovation. One seminal factor may be the communication technologies developed by the National Technology Missions. The missions were participatory by seeking solutions among communities and analyzing health issues from the perspective of those directly involved, rather than from the top down. The prime focus of the national drinking water mission was convenience, hence messages concentrating on health advantages were ignored. At this juncture, influencing health behavior required decentralization reflecting local cultures. Thus community-based partners became the foundation of a strategy of communicating safe water. As national strategies emerged in each of the technology missions, communication addressed advocacy of the need for political will, dissemination of technical information, and influencing patterns of behavior. Despite learning a new understanding, the danger exists that IEC remains just another label of mass communication with posters, advertisements, brochures, radio, and television. Decisions on contraceptive choice and use requires more than just accurate information; it requires the power to make such a decision. A new approach demands a priority for communication skills taking into account people's aspirations. The HIV-AIDS crisis underlines the urgency with which communication has to respond to health challenges. A series of experiments facilitated by the World Conservation Union helped build communication capabilities among environmental groups working in Latin America, Africa, and India. The International Reference Center on Water and Sanitation initiated pilot communication projects in West Africa for community health.

  7. Broadly neutralizing anti-influenza antibodies require Fc receptor engagement for in vivo protection.

    Science.gov (United States)

    DiLillo, David J; Palese, Peter; Wilson, Patrick C; Ravetch, Jeffrey V

    2016-02-01

    In vivo protection by antimicrobial neutralizing Abs can require the contribution of effector functions mediated by Fc-Fcγ receptor (Fc-FcγR) interactions for optimal efficacy. In influenza, broadly neutralizing anti-hemagglutinin (anti-HA) stalk mAbs require Fc-FcγR interactions to mediate in vivo protection, but strain-specific anti-HA head mAbs do not. Whether this rule applies only to anti-stalk Abs or is applicable to any broadly neutralizing Ab (bNAb) against influenza is unknown. Here, we characterized the contribution of Fc-FcγR interactions during in vivo protection for a panel of 13 anti-HA mAbs, including bNAbs and non-neutralizing Abs, against both the stalk and head domains. All classes of broadly binding anti-HA mAbs required Fc-FcγR interactions to provide protection in vivo, including those mAbs that bind the HA head and those that do not neutralize virus in vitro. Further, a broadly neutralizing anti-neuraminidase (anti-NA) mAb also required FcγRs to provide protection in vivo, but a strain-specific anti-NA mAb did not. Thus, these findings suggest that the breadth of reactivity of anti-influenza Abs, regardless of their epitope, necessitates interactions with FcγRs on effector cell populations to mediate in vivo protection. These findings will guide the design of antiviral Ab therapeutics and inform vaccine design to elicit Abs with optimal binding properties and effector functions.

  8. FcRn expression, ligands binding properties and its regulation in human immune cells and hepatocytes

    OpenAIRE

    2007-01-01

    ABSTRACT Expression and diverse functions of MHC class I related neonatal Fc receptor in different tissues is continually reported. To contribute to the understanding of how the receptor functions according to cell type, we investigated the expression and ligands binding properties of FcRn in human immune cells and hepatocytes. Here, we report that heterodimeric FcRn is expressed in these cells as evidenced by RT-PCR, Western immunoblottting and flow cytometry. The receptor expression i...

  9. Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function.

    Science.gov (United States)

    Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F; Mo, Xiaokui; Byrd, John C; Carson, William E; Butchar, Jonathan P; Tridandapani, Susheela

    2016-02-05

    The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. © 2016 by The American Society for Biochemistry

  10. Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function*

    Science.gov (United States)

    Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F.; Mo, Xiaokui; Byrd, John C.; Carson, William E.; Butchar, Jonathan P.; Tridandapani, Susheela

    2016-01-01

    The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N′,N′-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. PMID:26627823

  11. Possible Implication of Fcγ Receptor-Mediated Trogocytosis in Susceptibility to Systemic Autoimmune Disease

    Directory of Open Access Journals (Sweden)

    Sakiko Masuda

    2013-01-01

    Full Text Available Leukocytes can “gnaw away” the plasma membrane of other cells. This phenomenon, called trogocytosis, occurs subsequent to cell-to-cell adhesion. Currently, two mechanisms of trogocytosis, adhesion molecule-mediated trogocytosis and Fcγ receptor-(FcγR- mediated trogocytosis, have been identified. In our earlier study, we established an in vitro model of FcγR-mediated trogocytosis, namely, CD8 translocation model from T cells to neutrophils. By using this model, we demonstrated that the molecules transferred to neutrophils via FcγR-mediated trogocytosis were taken into the cytoplasm immediately. This result suggests that the chance of molecules transferred via FcγR-mediated trogocytosis to play a role on the cell surface could be time-limited. Thus, we consider the physiological role of FcγR-mediated trogocytosis as a means to remove antibodies (Abs that bind with self-molecules rather than to extract molecules from other cells. This concept means that FcγR-mediated trogocytosis can be a defense mechanism to Ab-mediated autoimmune response. Moreover, the activity of FcγR-mediated trogocytosis was revealed to be parallel to the endocytotic activity of neutrophils, which was critically related to the susceptibility to systemic autoimmune diseases. The collective findings suggest that FcγR-mediated trogocytosis could physiologically play a role in removal of Abs bound to self-antigens and prevent autoimmune diseases.

  12. FcRγ-chain deficiency reduces the development of diet-induced obesity.

    Science.gov (United States)

    van Beek, Lianne; Vroegrijk, Irene O C M; Katiraei, Saeed; Heemskerk, Mattijs M; van Dam, Andrea D; Kooijman, Sander; Rensen, Patrick C N; Koning, Frits; Verbeek, J Sjef; Willems van Dijk, Ko; van Harmelen, Vanessa

    2015-12-01

    Pathogenic immunoglobulins are produced during the development of obesity and contribute to the development of insulin resistance (IR). However, the mechanisms by which these antibodies affect IR are largely unknown. This study investigated whether Fc-receptors contribute to the development of diet-induced obesity and IR by studying FcRγ(-/-) mice that lack the γ-subunit necessary for signaling and cell surface expression of FcγR and FcεRI. FcRγ(-/-) and wild-type (WT) mice were fed a high-fat diet (HFD) to induce obesity. At 4 and 11 weeks, body weight and insulin sensitivity were measured, and adipose tissue (AT) inflammation was determined. Furthermore, intestinal triglyceride (TG) uptake and plasma TG clearance were determined, and gut microbiota composition was analyzed. FcRγ(-/-) mice gained less weight after 11 weeks of HFD. They had reduced adiposity, adipose tissue inflammation, and IR. Interestingly, FcRγ(-/-) mice had higher lean mass compared to WT mice, which was associated with increased energy expenditure. Intestinal TG absorption was increased whereas plasma TG clearance was not affected in FcRγ(-/-) mice. Gut microbial composition differed significantly and might therefore have added to the observed phenotype. FcRγ-chain deficiency reduces the development of diet-induced obesity, as well as associated AT inflammation and IR at 11 weeks of HFD. © 2015 The Obesity Society.

  13. Effects of Communication Mode and Salience on Recasts: A First Exposure Study

    Science.gov (United States)

    Yilmaz, Yucel; Yuksel, Dogan

    2011-01-01

    This article reports on a study that investigated whether the extent to which learners benefit from recasts on two Turkish morphemes differ depending on communication mode--i.e. Face-to-Face Communication (F2FC) and text-based Synchronous Computer-Mediated Communication (SCMC)--and/or the salience of the target structure (i.e. salient and…

  14. Investigating the Interaction between the Neonatal Fc Receptor and Monoclonal Antibody Variants by Hydrogen/Deuterium Exchange Mass Spectrometry

    DEFF Research Database (Denmark)

    Jensen, Pernille Foged; Larraillet, Vincent; Schlothauer, Tilman

    2015-01-01

    to map sites perturbed by binding on both partners of the IgG-FcRn complex. Several regions in the antibody Fc region and the FcRn were protected from exchange upon complex formation, in good agreement with previous crystallographic studies of FcRn in complex with the Fc fragment. Interestingly, we found......The recycling of immunoglobulins by the neonatal Fc receptor (FcRn) is of crucial importance in the maintenance of antibody levels in plasma and is responsible for the long half-lives of endogenous and recombinant monoclonal antibodies. From a therapeutic point of view there is great interest...... in understanding and modulating the IgG-FcRn interaction to optimize antibody pharmacokinetics and ultimately improve efficacy and safety. Here we studied the interaction between a full-length human IgG1 and human FcRn via hydrogen/deuterium exchange mass spectrometry and targeted electron transfer dissociation...

  15. Properties and transport behavior of perfluorotripentylamine (FC-70)-doped amorphous teflon AF 2400 films.

    Science.gov (United States)

    Zhang, Hong; Hussam, Abul; Weber, Stephen G

    2010-12-22

    Teflon AF 2400 films are known to imbibe solvents, making films in the presence of solvents less fluorous than they might otherwise be. Herein, we demonstrate that doping films with perfluorotripentylamine (Fluorinert FC-70) maintains the fluorous nature of Teflon AF 2400 and improves transport selectivity for fluorine-containing organic compounds. Density measurements on the FC-70-doped films reveal that free volume decreases dramatically as the dopant concentration increases (0-12 wt %) and then increases to approach that of pure FC-70. Remarkably, films from 0 to 12 wt % FC-70 have the same w/v concentration of Teflon AF 2400, indicating that FC-70 fills the free volume of Teflon AF 2400. This is consistent with the observed increased storage modulus and significant decrease (compared to undoped films) of solute diffusion coefficients in the same range of FC-70 concentrations. In contrast, FC-70 at concentrations greater than 12 wt % dilutes Teflon AF 2400, leading to a decrease of storage modulus and dramatic increase in solute diffusion coefficients. Sorption of chloroform decreases from 11.8 g of chloroform/100 g of film (pure Teflon film) to 3.8 g of chloroform/100 g of film (27 wt % FC-70-doped Teflon film), less than the solubility of chloroform in pure FC-70 (4.06 g of chloroform/100 g of FC-70). Solute partition coefficients from chloroform to FC-70-doped films generally decrease with increased dopant concentration. However, within a series of toluenes and nitrobenzenes, selectivity for F-containing solutes over analogous H-containing solutes increases as dopant concentration increases if the substitution is on the aromatic ring but not if it is on the methyl group (toluene). Transport (partitioning × diffusion) rates, as they involve both thermodynamic and kinetic factors, are not simply related to composition.

  16. A prominent lack of IgG1-Fc fucosylation of platelet alloantibodies in pregnancy.

    Science.gov (United States)

    Kapur, Rick; Kustiawan, Iwan; Vestrheim, Anne; Koeleman, Carolien A M; Visser, Remco; Einarsdottir, Helga K; Porcelijn, Leendert; Jackson, Dave; Kumpel, Belinda; Deelder, André M; Blank, Dennis; Skogen, Björn; Killie, Mette Kjaer; Michaelsen, Terje E; de Haas, Masja; Rispens, Theo; van der Schoot, C Ellen; Wuhrer, Manfred; Vidarsson, Gestur

    2014-01-23

    Immunoglobulin G (IgG) formed during pregnancy against human platelet antigens (HPAs) of the fetus mediates fetal or neonatal alloimmune thrombocytopenia (FNAIT). Because antibody titer or isotype does not strictly correlate with disease severity, we investigated by mass spectrometry variations in the glycosylation at Asn297 in the IgG Fc because the composition of this glycan can be highly variable, affecting binding to phagocyte IgG-Fc receptors (FcγR). We found markedly decreased levels of core fucosylation of anti-HPA-1a-specific IgG1 from FNAIT patients (n = 48), but not in total serum IgG1. Antibodies with a low amount of fucose displayed higher binding affinity to FcγRIIIa and FcγRIIIb, but not to FcγRIIa, compared with antibodies with a high amount of Fc fucose. Consequently, these antibodies with a low amount of Fc fucose showed enhanced phagocytosis of platelets using FcγRIIIb(+) polymorphonuclear cells or FcγRIIIa(+) monocytes as effector cells, but not with FcγRIIIa(-) monocytes. In addition, the degree of anti-HPA-1a fucosylation correlated positively with the neonatal platelet counts in FNAIT, and negatively to the clinical disease severity. In contrast to the FNAIT patients, no changes in core fucosylation were observed for anti-HLA antibodies in refractory thrombocytopenia (post platelet transfusion), indicating that the level of fucosylation may be antigen dependent and/or related to the immune milieu defined by pregnancy.

  17. Modulation of Microglial Cell Fcγ Receptor Expression Following Viral Brain Infection

    Science.gov (United States)

    Chauhan, Priyanka; Hu, Shuxian; Sheng, Wen S.; Prasad, Sujata; Lokensgard, James R.

    2017-01-01

    Fcγ receptors (FcγRs) for IgG couple innate and adaptive immunity through activation of effector cells by antigen-antibody complexes. We investigated relative levels of activating and inhibitory FcγRs on brain-resident microglia following murine cytomegalovirus (MCMV) infection. Flow cytometric analysis of microglial cells obtained from infected brain tissue demonstrated that activating FcγRs were expressed maximally at 5 d post-infection (dpi), while the inhibitory receptor (FcγRIIB) remained highly elevated during both acute and chronic phases of infection. The highly induced expression of activating FcγRIV during the acute phase of infection was also noteworthy. Furthermore, in vitro analysis using cultured primary microglia demonstrated the role of interferon (IFN)γ and interleukin (IL)-4 in polarizing these cells towards a M1 or M2 phenotype, respectively. Microglial cell-polarization correlated with maximal expression of either FcγRIV or FcγRIIB following stimulation with IFNγ or IL-4, respectively. Finally, we observed a significant delay in polarization of microglia towards an M2 phenotype in the absence of FcγRs in MCMV-infected Fcer1g and FcgR2b knockout mice. These studies demonstrate that neuro-inflammation following viral infection increases expression of activating FcγRs on M1-polarized microglia. In contrast, expression of the inhibitory FcγRIIB receptor promotes M2-polarization in order to shut-down deleterious immune responses and limit bystander brain damage. PMID:28165503

  18. Clients' psychosocial communication and midwives' verbal and nonverbal communication during prenatal counseling for anomaly screening

    NARCIS (Netherlands)

    Martin, L.; Gitsels-van der Wal, J.T.; Pereboom, M.T.; Spelten, E.R.; Hutton, E.K.; Dulmen, A.M. van

    2016-01-01

    OBJECTIVES: This study focuses on facilitation of clients' psychosocial communication during prenatal counseling for fetal anomaly screening. We assessed how psychosocial communication by clients is related to midwives' psychosocial and affective communication, client-directed gaze and counseling du

  19. Clients’ psychosocial communication and midwives’ verbal and nonverbal communication during prenatal counseling for anomaly screening.

    NARCIS (Netherlands)

    Martin, L.; Gitsels-van der Wal, J.T.; Pereboom, M.T.R.; Spelten, E.R.; Hutton, E.K.; Dulmen, S. van

    2016-01-01

    Objectives: This study focuses on facilitation of clients’ psychosocial communication during prenatal counseling for fetal anomaly screening. We assessed how psychosocial communication by clients is related to midwives’ psychosocial and affective communication, client-directed gaze and counseling du

  20. Clients’ psychosocial communication and midwives’ verbal and nonverbal communication during prenatal counseling for anomaly screening.

    NARCIS (Netherlands)

    Martin, L.; Gitsels-van der Wal, J.T.; Pereboom, M.T.R.; Spelten, E.R.; Hutton, E.K.; Dulmen, S. van

    2016-01-01

    Objectives: This study focuses on facilitation of clients’ psychosocial communication during prenatal counseling for fetal anomaly screening. We assessed how psychosocial communication by clients is related to midwives’ psychosocial and affective communication, client-directed gaze and counseling du

  1. Learning facilitating leadership

    DEFF Research Database (Denmark)

    Rasmussen, Lauge Baungaard; Hansen, Mette Sanne

    2016-01-01

    in teaching facilitation and the literature. These types of skills are most effectively acquired by combining conceptual lectures, classroom exercises and the facilitation of groups in a real-life context. The paper also reflects certain ‘shadow sides’ related to facilitation observed by the students...

  2. Machine Translation Effect on Communication

    DEFF Research Database (Denmark)

    Jensen, Mika Yasuoka; Bjørn, Pernille

    2011-01-01

    Intercultural collaboration facilitated by machine translation has gradually spread in various settings. Still, little is known as for the practice of machine-translation mediated communication. This paper investigates how machine translation affects intercultural communication in practice. Based...... determines communication process largely, our data indicates communication relies more on a dynamic process where participants establish common ground than on reproducibility and grammatical accuracy.......Intercultural collaboration facilitated by machine translation has gradually spread in various settings. Still, little is known as for the practice of machine-translation mediated communication. This paper investigates how machine translation affects intercultural communication in practice. Based...... on communication in which multilingual communication system is applied, we identify four communication types and its’ influences on stakeholders’ communication process, especially focusing on establishment and maintenance of common ground. Different from our expectation that quality of machine translation results...

  3. New Gateway-compatible vectors for a high-throughput protein-protein interaction analysis by a bimolecular fluorescence complementation (BiFC) assay in plants and their application to a plant clathrin structure analysis.

    Science.gov (United States)

    Nishimura, Kohji; Ishikawa, Syouta; Matsunami, Erika; Yamauchi, Junji; Homma, Keiichi; Faulkner, Christine; Oparka, Karl; Jisaka, Mitsuo; Nagaya, Tsutomu; Yokota, Kazushige; Nakagawa, Tsuyoshi

    2015-01-01

    Protein-protein interactions (PPI) play key roles in various biological processes. The bimolecular fluorescence complementation (BiFC) assay is an excellent tool for routine PPI analyses in living cells. We developed new Gateway vectors for a high-throughput BiFC analysis of plants, adopting a monomeric Venus split just after the tenth β-strand, and analyzed the interaction between Arabidopsis thaliana coated vesicle coatmers, the clathrin heavy chain (CHC), and the clathrin light chain (CLC). In competitive BiFC tests, CLC interacted with CHC through a coiled-coil motif in the middle section of CLC. R1340, R1448, and K1512 in CHC and W94 in CLC are potentially key amino acids underlying the inter-chain interaction, consistent with analyses based on homology modeling. Our Gateway BiFC system, the V10-BiFC system, provides a useful tool for a PPI analysis in living plant cells. The CLC-CHC interaction identified may facilitate clathrin triskelion assembly needed for cage formation.

  4. Of ITIMs, ITAMs, and ITAMis: revisiting immunoglobulin Fc receptor signaling.

    Science.gov (United States)

    Getahun, Andrew; Cambier, John C

    2015-11-01

    Receptors for immunoglobulin Fc regions play multiple critical roles in the immune system, mediating functions as diverse as phagocytosis, triggering degranulation of basophils and mast cells, promoting immunoglobulin class switching, and preventing excessive activation. Transmembrane signaling associated with these functions is mediated primarily by two amino acid sequence motifs, ITAMs (immunoreceptor tyrosine-based activation motifs) and ITIMs (immunoreceptor tyrosine-based inhibition motifs) that act as the receptors' interface with activating and inhibitory signaling pathways, respectively. While ITAMs mobilize activating tyrosine kinases and their consorts, ITIMs mobilize opposing tyrosine and inositol-lipid phosphatases. In this review, we will discuss our current understanding of signaling by these receptors/motifs and their sometimes blurred lines of function.

  5. CT-FC: more Comprehensive Traversal Focused Crawler

    Directory of Open Access Journals (Sweden)

    NFN Kuspriyanto

    2012-03-01

    Full Text Available In today’s world, people depend more on the WWW information, including professionals who have to analyze the data according their domain to maintain and improve their business. A data analysis would require information that is comprehensive and relevant to their domain. Focused crawler as a topical based Web indexer agent is used to meet this application’s information need. In order to increase the precision, focused crawler face the problem of low recall. The study on WWW hyperlink structure characteristics indicates that many Web documents are not strong connected but through co-citation & co-reference. Conventional focused crawler that uses forward crawling strategy could not visit the documents in these characteristics. This study proposes a more comprehensive traversal framework. As a proof, CT-FC (a focused crawler with the new traversal framework ran on DMOZ data that is representative to WWW characteristics. The results show that this strategy can increase the recall significantly.

  6. Dawn FC2 Derived Ceres Mosaics V1.0

    Science.gov (United States)

    Roatsch, T.; Kersten, E.; Matz, K.-D.; Preusker, F.; Scholten, F.; Elgner, S.; Schroeder, S. E.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2016-10-01

    This accumulating data set includes Ceres global mosaics and quadrangles derived from images acquired by the Framing Camera 2 (FC2) on the NASA Dawn spacecraft. Global mosaics are provided in cylindrical and polar stereographic projections. The quadrangle mosaics use Mercator (equatorial), Lambert conformal (mid-latitude) and stereographic projections. Global color filter mosaics are provided for data acquired during the high altitude mapping orbit (HAMO) on volume DWNCHFFC2_2. Global mapping in all filters at low altitude was not possible due to time and downlink limitations. Attempts were made to acquire color imaging of selected Ceres targets but with only limited success because of issues related to ephemeris predictability. Clear filter global mosaics and quadrangle maps are provided for both HAMO (DWNCHCFC2_2) and the low altitude mapping orbit (LAMO, DWNCLCFC2_2) science phases.

  7. The rational emotions of FC København

    DEFF Research Database (Denmark)

    Storm, Rasmus K.

    2009-01-01

    Professional team sports clubs in Scandinavia and Europe operate in a complex combination of rational economic logic and emotional irrational behaviour. With a few exceptions most clubs favour winning over profit, thus producing a range of severe financial problems as a direct consequence...... performers in the sports business, I explain why only a few clubs are capable of combining economic gain with sporting success. The Danish soccer club FC K benhavn is chosen to be the case and turning point in this study, as it serves as a counter example illustrating how profit and championships can...... actually be combined in certain logic of 'rational emotionality'. The 'extremity' of the case in this respect serves as a way to expose the general rules of commercial sports....

  8. CT-FC: more Comprehensive Traversal Focused Crawler

    Directory of Open Access Journals (Sweden)

    NFN Kuspriyanto

    2012-03-01

    Full Text Available In todays world, people depend more on the WWW information, including professionals who have to analyze the data according their domain to maintain and improve their business. A data analysis would require information that is comprehensive and relevant to their domain. Focused crawler as a topical based Web indexer agent is used to meet this applications information need. In order to increase the precision, focused crawler face the problem of low recall. The study on WWW hyperlink structure characteristics indicates that many Web documents are not strong connected but through co-citation & co-reference. Conventional focused crawler that uses forward crawling strategy could not visit the documents in these characteristics. This study proposes a more comprehensive traversal framework. As a proof, CT-FC (a focused crawler with the new traversal framework ran on DMOZ data that is representative to WWW characteristics. The results show that this strategy can increase the recall significantly.

  9. Fc-fragment removal allows the EPO-Fc fusion protein to be detected in blood samples by IEF-PAGE.

    Science.gov (United States)

    Postnikov, Pavel; Krotov, Grigory; Mesonzhnik, Natalia; Efimova, Yulia; Rodchenkov, Grigory

    2015-01-01

    EPO-Fc proteins have been under investigation as a potential drug for treating anaemia and have shown larger half-life values than other erythropoiesis-stimulating agents (ESAs). Sodium dodecyl sulfate/sodium N-lauroylsarcosinate polyacrylamide gel electrophoresis (SDS/SAR-PAGE) methods and subsequent immunoblotting are used for routine anti-doping analysis. This paper reports that EPO-Fc fusion proteins can be detected in serum samples by isoelectric focusing-polyacrylamide gel electrophoresis (IEF-PAGE) in carrier ampholyte-based gels with a pH 2-6 gradient after removing the Fc part via site-specific IdeS protease cleavage. The IdeS-digested EPO-Fc protein yields three fragments: two Fc fragments and one dimeric EPO-hinge fragment. After IEF-PAGE was followed by double Western blotting with chemiluminescent detection, the dimeric EPO-hinge fragment showed a unique isoelectric pattern, which differed from those of any other currently known analogue of EPO. We observed that the removal of the Fc fragment from EPO-Fc reduced the apparent molecular weight of entire fusion protein and increased its electrophoretic mobility. As a result, the band for the EPO-hinge fragment was located in a region between the rEPO and NESP standards, at which lower amounts of serum proteins are present. Simple and selective protocols for determining the EPO-Fc protein in human serum were developed to extend the methodological anti-doping arsenal. This protocol has been characterized. The limit of detection (LOD) of the IEF-PAGE method was 20 pg, and that of SDS/SAR-PAGE was 15 pg.

  10. Critical Role of the Neonatal Fc Receptor (FcRn) in the Pathogenic Action of Antimitochondrial Autoantibodies Synergizing with Anti-desmoglein Autoantibodies in Pemphigus Vulgaris.

    Science.gov (United States)

    Chen, Yumay; Chernyavsky, Alex; Webber, Robert J; Grando, Sergei A; Wang, Ping H

    2015-09-25

    Pemphigus vulgaris (PV) is a life-long, potentially fatal IgG autoantibody-mediated blistering disease targeting mucocutaneous keratinocytes (KCs). PV patients develop pathogenic anti-desmoglein (Dsg) 3 ± 1 and antimitochondrial antibodies (AMA), but it remained unknown whether and how AMA enter KCs and why other cell types are not affected in PV. Therefore, we sought to elucidate mechanisms of cell entry, trafficking, and pathogenic action of AMA in PV. We found that PVIgGs associated with neonatal Fc receptor (FcRn) on the cell membrane, and the PVIgG-FcRn complexes entered KCs and reached mitochondria where they dissociated. The liberated AMA altered mitochondrial membrane potential, respiration, and ATP production and induced cytochrome c release, although the lack or inactivation of FcRn abolished the ability of PVIgG to reach and damage mitochondria and to cause detachment of KCs. The assays of mitochondrial functions and keratinocyte adhesion demonstrated that although the pathobiological effects of AMA on KCs are reversible, they become irreversible, leading to epidermal blistering (acantholysis), when AMA synergize with anti-Dsg antibodies. Thus, it appears that AMA enter a keratinocyte in a complex with FcRn, become liberated from the endosome in the cytosol, and are trafficked to the mitochondria, wherein they trigger pro-apoptotic events leading to shrinkage of basal KCs uniquely expressing FcRn in epidermis. During recovery, KCs extend their cytoplasmic aprons toward neighboring cells, but anti-Dsg antibodies prevent assembly of nascent desmosomes due to steric hindrance, thus rendering acantholysis irreversible. In conclusion, FcRn is a common acceptor protein for internalization of AMA and, perhaps, for PV autoantibodies to other intracellular antigens, and PV is a novel disease paradigm for investigating and elucidating the role of FcRn in this autoimmune disease and possibly other autoimmune diseases.

  11. Genetic variation in human Fc gamma receptors: Functional consequences of polymorphisms and copy number variation

    NARCIS (Netherlands)

    van der Heijden, J.

    2014-01-01

    Fc gamma receptors (FcγRs) are receptors for immunoglobulin G (IgG), the most abundant of five classes of antibodies. They are expressed on almost all immune cells and mediate a range of cellular functions, such as phagocytosis, antibody-dependent cellular cytotoxicity, activation of the NADPH-oxida

  12. Science Signaling Podcast for 20 December 2016: Trans-inhibition by Fc receptors.

    Science.gov (United States)

    Daëron, Marc; VanHook, Annalisa M

    2016-12-20

    This Podcast features an interview with Marc Daëron, author of a Research Article that appears in the 20 December 2016 issue of Science Signaling, about a mechanism by which an Fc receptor can inhibit signaling by other receptors without aggregating with those other receptors. Engagement of Fc receptors on basophils and mast cells can either activate these cells, which promotes autoimmune and allergic inflammation, or prevent these cells from being activated. Whether these cells are activated depends upon which Fc receptors are present in clusters, because some Fc receptors can inhibit signaling by other Fc receptors that are present in the same signalosome, a phenomenon known as cis-inhibition. Malbec et al. identified a mechanism whereby inhibitory Fc receptors limit signaling by activating Fc receptors without being present in the same signalosome. This mechanism of trans-inhibition also allowed inhibitory Fc receptors to limit signaling by growth factor receptors in mast cells and oncogene-induced proliferation in mastocytoma cells.Listen to Podcast. Copyright © 2016, American Association for the Advancement of Science.

  13. Fcγ receptor expression on splenic macrophages in adult immune thrombocytopenia

    NARCIS (Netherlands)

    Audia, S; Santegoets, K; Laarhoven, A G; Vidarsson, G; Facy, O; Ortega-Deballon, P; Samson, M; Janikashvili, N; Saas, P; Bonnotte, B; Radstake, T R

    2017-01-01

    Splenic macrophages play a key role in immune thrombocytopenia (ITP) pathogenesis by clearing opsonized platelets. Fcγ receptors (FcγR) participate in this phenomenon, but their expression on splenic macrophages and their modulation by treatment have scarcely been studied in human ITP. We aimed to

  14. Dicty_cDB: FC-IC0750 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AG--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-IC0750 (FC-IC...133 8e-31 own update 2004. 5.10 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value... 1 dna update 2002. 9. 7 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value

  15. Access to site-specific Fc-cRGD peptide conjugates through streamlined expressed protein ligation.

    Science.gov (United States)

    Frutos, S; Jordan, J B; Bio, M M; Muir, T W; Thiel, O R; Vila-Perelló, M

    2016-10-12

    An ideal drug should be highly effective, non-toxic and be delivered by a convenient and painless single dose. We are still far from such optimal treatment but peptides, with their high target selectivity and low toxicity profiles, provide a very attractive platform from which to strive towards it. One of the major limitations of peptide drugs is their high clearance rates, which limit dosage regimen options. Conjugation to antibody Fc domains is a viable strategy to improve peptide stability by increasing their hydrodynamic radius and hijacking the Fc recycling pathway. We report the use of a split-intein based semi-synthetic approach to site-specifically conjugate a synthetic integrin binding peptide to an Fc domain. The strategy described here allows conjugating synthetic peptides to Fc domains, which is not possible via genetic methods, fully maintaining the ability of both the Fc domain and the bioactive peptide to interact with their binding partners.

  16. Toll-like receptor 2 ligands regulate monocyte Fcγ receptor expression and function.

    Science.gov (United States)

    Shah, Prexy; Fatehchand, Kavin; Patel, Hemal; Fang, Huiqing; Justiniano, Steven E; Mo, Xiaokui; Jarjoura, David; Tridandapani, Susheela; Butchar, Jonathan P

    2013-04-26

    Fcγ receptor (FcγR) clustering on monocytes/macrophages results in phagocytosis and inflammatory cytokine production, which serve to eliminate antibody-opsonized targets and activate neighboring immune cells. Toll-like receptor 2 (TLR2), which recognizes a range of both bacterial and fungal components, elicits strong proinflammatory responses in these cells when stimulated by ligands, either natural or synthetic. Thus, we explored the possibility that TLR2 agonists could strengthen FcγR activity within the context of antibody therapy. Human peripheral blood monocytes treated with the TLR2 agonist Pam2CSK4 showed significantly enhanced FcγR-mediated cytokine production as well as phagocytic ability. An examination of the molecular mechanism behind this enhancement revealed increased expression of both FcγRIIa and the common γ subunit following Pam2CSK4 treatment. Interestingly however, expression of the inhibitory receptor FcγRIIb was also modestly increased. Further investigation revealed that Pam2CSK4 also dramatically decreased the expression of SHIP, the major mediator of FcγRIIb inhibitory activity. Using a murine Her2/neu solid tumor model of antibody therapy, we found that Pam2CSK4 significantly enhanced the ability of anti-Her2 antibody to reduce the rate of tumor growth. To verify that the FcγR enhancement was not unique to the diacylated Pam2CSK4, we also tested Pam3CSK4, a related triacylated TLR2 agonist. Results showed significant enhancement in FcγR function and expression. Taken together, these findings indicate that TLR2 activation can positively modulate FcγR and suggest that TLR2 agonists should be considered for testing as adjuvants for antitumor antibody therapy.

  17. Toll-like Receptor 2 Ligands Regulate Monocyte Fcγ Receptor Expression and Function*

    Science.gov (United States)

    Shah, Prexy; Fatehchand, Kavin; Patel, Hemal; Fang, Huiqing; Justiniano, Steven E.; Mo, Xiaokui; Jarjoura, David; Tridandapani, Susheela; Butchar, Jonathan P.

    2013-01-01

    Fcγ receptor (FcγR) clustering on monocytes/macrophages results in phagocytosis and inflammatory cytokine production, which serve to eliminate antibody-opsonized targets and activate neighboring immune cells. Toll-like receptor 2 (TLR2), which recognizes a range of both bacterial and fungal components, elicits strong proinflammatory responses in these cells when stimulated by ligands, either natural or synthetic. Thus, we explored the possibility that TLR2 agonists could strengthen FcγR activity within the context of antibody therapy. Human peripheral blood monocytes treated with the TLR2 agonist Pam2CSK4 showed significantly enhanced FcγR-mediated cytokine production as well as phagocytic ability. An examination of the molecular mechanism behind this enhancement revealed increased expression of both FcγRIIa and the common γ subunit following Pam2CSK4 treatment. Interestingly however, expression of the inhibitory receptor FcγRIIb was also modestly increased. Further investigation revealed that Pam2CSK4 also dramatically decreased the expression of SHIP, the major mediator of FcγRIIb inhibitory activity. Using a murine Her2/neu solid tumor model of antibody therapy, we found that Pam2CSK4 significantly enhanced the ability of anti-Her2 antibody to reduce the rate of tumor growth. To verify that the FcγR enhancement was not unique to the diacylated Pam2CSK4, we also tested Pam3CSK4, a related triacylated TLR2 agonist. Results showed significant enhancement in FcγR function and expression. Taken together, these findings indicate that TLR2 activation can positively modulate FcγR and suggest that TLR2 agonists should be considered for testing as adjuvants for antitumor antibody therapy. PMID:23504312

  18. Innovation and learning facilitated by play

    DEFF Research Database (Denmark)

    Hansen, Poul H. Kyvsgård; O´Connor, Rory

    2008-01-01

    "This paper describes an approach to facilitate interaction between students and industrial companies in a problem based learning environment. The approach is adapted from a methodology developed at the LEGO Company and relies on an improved ability to communicate complex problems when using...

  19. Learning facilitating leadership

    DEFF Research Database (Denmark)

    Rasmussen, Lauge Baungaard; Hansen, Mette Sanne

    2016-01-01

    This paper explains how engineering students at a Danish university acquired the necessary skills to become emergent facilitators of organisational development. The implications of this approach are discussed and related to relevant viewpoints and findings in the literature. The methodology deplo....... By connecting the literature, the authors’ and engineering students’ reflections on facilitator skills, this paper adds value to existing academic and practical discussions on learning facilitating leadership....

  20. Visual explorer facilitator's guide

    CERN Document Server

    Palus, Charles J

    2010-01-01

    Grounded in research and practice, the Visual Explorer™ Facilitator's Guide provides a method for supporting collaborative, creative conversations about complex issues through the power of images. The guide is available as a component in the Visual Explorer Facilitator's Letter-sized Set, Visual Explorer Facilitator's Post card-sized Set, Visual Explorer Playing Card-sized Set, and is also available as a stand-alone title for purchase to assist multiple tool users in an organization.

  1. Electronic Communication and Decision Making.

    Science.gov (United States)

    Feldman, M. S.; Sarbaugh-Thompson, M.

    1996-01-01

    Electronic communication can either facilitate or sabotage decision-making contexts. This article formulates recommendations about when and how to use electronic communication to enhance decision making and describes various decision contexts. Solutions to communication problems such as groupthink, social deadlock, bureaucratic isolation from…

  2. Aluminum excytotoxicity and neuroautotoimmunity: the role of the brain expression of CD32+ (FcγRIIa), ICAM-1+ and CD3ξ in aging.

    Science.gov (United States)

    Jovanova-Nesic, Katica; Shoenfeld, Yehuda; Spector, Novera Herbert

    2012-12-01

    In the central nervous system (CNS) microglia are crucial for the defense of the brain against invading microorganisms, formation of tumors, and damage following trauma. However, uncontrolled activation of these cells may have deleterious outcomes through activation of Fcγ and the complement 3 receptors and the induction of an adaptive immune reaction. Proteins contributing to this reaction are the intercellular adhesion molecule-1 (ICAM-1) and CD3 molecules, among others. Both can be expressed on the glia cells before cytokine release and may facilitate an autoimmune inflammatory reaction in the brain. Round microglial cells among the pyramidal cells of the hippocampus with increased expression of CD32+ (FcγIIa) and near the site of injection of aluminum were detected immunohistochemically and indicate microglial activation at the site of aluminum injury. ICAM-1+ immunoreactivity significantly increased in the hippocampus and in the choroids plexus, indicating increased inflammation in the brain as well as increased CD3ξ+ expression in the hippocampus and non-MHC-restricted T cytotoxicity after aluminum injection. The pattern of expression of CD32+ (FcγIIa receptor) near the site of aluminum injection indicates that microglia may play a phagocytic role at the site of aluminum-induced excitotoxicity in the brain. Significant expression of ICAM-1+ and CD3ξ+ immunoreactive cells with the clusters of ICAM-1+ in the choroid plexus suggests a consequently neurotoxic autoimmune reaction induced by microglial hyperactivation in the injured brain.

  3. Ligand binding and antigenic properties of a human neonatal Fc receptor with mutation of two unpaired cysteine residues

    DEFF Research Database (Denmark)

    Andersen, Jan T; Justesen, Sune; Fleckenstein, Burkhard

    2008-01-01

    The neonatal Fc receptor (FcRn) is a major histocompatibility complex class I-related molecule that regulates the half-life of IgG and albumin. In addition, FcRn directs the transport of IgG across both mucosal epithelium and placenta and also enhances phagocytosis in neutrophils. This new knowle...

  4. The Fc and not CD4 Receptor Mediates Antibody Enhancement of HIV Infection in Human Cells

    Science.gov (United States)

    Homsy, Jacques; Meyer, Mia; Tateno, Masatoshi; Clarkson, Sarah; Levy, Jay A.

    1989-06-01

    Antibodies that enhance human immunodeficiency virus (HIV) infectivity have been found in the blood of infected individuals and in infected or immunized animals. These findings raise serious concern for the development of a safe vaccine against acquired immunodeficiency syndrome. To address the in vivo relevance and mechanism of this phenomenon, antibody-dependent enhancement of HIV infectivity in peripheral blood macrophages, lymphocytes, and human fibroblastoid cells was studied. Neither Leu3a, a monoclonal antibody directed against the CD4 receptor, nor soluble recombinant CD4 even at high concentrations prevented this enhancement. The addition of monoclonal antibody to the Fc receptor III (anti-FcRIII), but not of antibodies that react with FcRI or FcRII, inhibited HIV type 1 and HIV type 2 enhancement in peripheral blood macrophages. Although enhancement of HIV infection in CD4+ lymphocytes could not be blocked by anti-FcRIII, it was inhibited by the addition of human immunoglobulin G aggregates. The results indicate that the FcRIII receptor on human macrophages and possibly another Fc receptor on human CD4+ lymphocytes mediate antibody-dependent enhancement of HIV infectivity and that this phenomenon proceeds through a mechanism independent of the CD4 protein.

  5. IgG Fc Fragment as a Scaffold for Development of Targeted Therapeutics.

    Science.gov (United States)

    Wozniak-Knopp, Gordana; Stadlmayr, Gerhard; Rueker, Florian

    2016-11-14

    Monoclonal antibodies and Fc fusion proteins have been successful therapeutics in the field of cancer and immune disease. As their pharmacological activity is dependent on the Fc fragment governing their effector functions and long in vivo half-life, the extensive engineering of the Fc for altered binding of its natural ligands that enable these properties has delivered molecules optimized for their therapeutic effect. Recently, the IgG1 Fc region itself and its subunits monomeric Fc fragment, CH2 and monomeric CH3 domain, have been engineered into scaffolds with favorable biophysical properties and a high potential for de novo antigen recognition. A dimeric Fc fragment with an antigen binding site has proven suitable for evaluation in animal models and will soon be entering human trials. Such modified constant domains can easily be incorporated into an antibody or fused with antibody domains of a second specificity. The small size of the Fc and its subunits that enhances their tissue penetration, as well as the unique topology of their binding sites that allows novel modes of contact with the antigen, are attractive features that prompt their development into promising candidate therapeutics.

  6. Atomic resolution model of the antibody Fc interaction with the complement C1q component.

    Science.gov (United States)

    Schneider, Sebastian; Zacharias, Martin

    2012-05-01

    The globular C1q heterotrimer is a subunit of the C1 complement factor. Binding of the C1q subunit to the constant (Fc) part of antibody molecules is a first step and key event of complement activation. Although three-dimensional structures of C1q and antibody Fc subunits have been determined experimentally no atomic resolution structure of the C1q-Fc complex is known so far. Based on systematic protein-protein docking searches and Molecular Dynamics simulations a structural model of the C1q-IgG1-Fc-binding geometry has been obtained. The structural model is compatible with available experimental data on the interaction between the two partner proteins. It predicts a binding geometry that involves mainly the B-subunit of the C1q-trimer and both subunits of the IgG1-Fc-dimer with small conformational adjustments with respect to the unbound partners to achieve high surface complementarity. In addition to several charge-charge and polar contacts in the rim region of the interface it also involves nonpolar contacts between the two proteins and is compatible with the carbohydrate moiety of the Fc subunit. The model for the complex structure provides a working model for rationalizing available biochemical data on this important interaction and can form the basis for the design of Fc variants with a greater capacity to activate the complement system for example on binding to cancer cells or other target structures.

  7. (Some cellular mechanisms influencing the transcription of human endogenous retrovirus, HERV-Fc1.

    Directory of Open Access Journals (Sweden)

    Magdalena Janina Laska

    Full Text Available DNA methylation and histone acetylation are epigenetic modifications that act as regulators of gene expression. DNA methylation is considered an important mechanism for silencing of retroelements in the mammalian genome. However, the methylation of human endogenous retroviruses (HERVs is not well investigated. The aim of this study was to investigate the transcriptional potential of HERV-Fc1 proviral 5'LTR in more detail, and examined the specific influence of CpG methylation on this LTR in number of cell lines. Specifically, the role of demethylating chemicals e.g. 5-aza-2' deoxycytidine and Trichostatin-A, in inducing or reactivating expression of HERV-Fc1 specific sequences and the mechanisms were investigated. In our present study, 5-aza-dC is shown to be a powerful inducer of HERV-Fc1, and at the same time it strongly inhibits methylation of DNA. Treatment with this demethylating agent 5-aza-dC, results in significantly increased levels of HERV-Fc1 expression in cells previously not expressing HERV-Fc1, or with a very low expression level. The extent of expression of HERV-Fc1 RNAs precisely correlates with the apparent extent of demethylation of the related DNA sequences. In conclusion, the results suggest that inhibition of DNA methylation/histone deacetylase can interfere with gene silencing mechanisms affecting HERV-Fc1 expression in human cells.

  8. Modulating immunogenicity of factor IX by fusion to an immunoglobulin Fc domain: a study using a hemophilia B mouse model.

    Science.gov (United States)

    Levin, D; Lagassé, H A D; Burch, E; Strome, S; Tan, S; Jiang, H; Sauna, Z E; Golding, B

    2017-04-01

    Essentials Fc-fusion increases a therapeutic's half-life, but FcγR interactions may impact immunogenicity. Species-specific Fc-FcγR interactions allow for mechanistic in vivo studies using mouse models. Fc fusion modulates the immune response to factor IX in hemophilia B mice by eliciting Th1 bias. This model could inform future studies of IgE-associated anaphylaxis in hemophilia B patients. Background Fc fusion is a platform technology used to increase the circulating half-life of protein and peptide therapeutics. However, there are potential immunological consequences with this approach, such as changes in the molecule's immunogenicity as well as possible interactions with a repertoire of Fc receptors (FcR) that can modulate immune responses. Objectives/Methods Using a mouse hemophilia B (HB) model, we compared the immune responses to infusions of recombinant human factor IX (hFIX) and hFIX fused to mouse IgG2a-Fc (hFIX-mFc). The mFc was employed to allow species-specific Fc-FcγR interactions. Results Although treatment with hFIX-mFc altered the early development of anti-FIX IgG, no significant differences in anti-FIX antibody titers were observed at the end of the treatment regimen (5 weeks) or upon anamnestic response (5 months). However, treatment with hFIX-mFc elicited higher FIX-neutralizing antibody levels and resulted in reduced IgE titers compared with the hFIX-treated group. Additionally, differences in plasma cytokine levels and in vitro CD4(+) T-cell responses suggest that whereas hFIX treatment triggered a Th2-biased immune response, hFIX-mFc treatment induced Th1-biased CD4(+) T cells. We also show that hFIX-mFc bound to soluble FcγRs and engaged with FcγRs on different cell types, which may impact antigen presentation. Conclusions These studies provide a model system to study how Fc-fusion proteins may affect immune mechanisms. We used this model to demonstrate a plausible mechanism by which Fc fusion may modulate the IgE response to hFIX. This

  9. Neutron Reflection Study of Surface Adsorption of Fc, Fab, and the Whole mAb.

    Science.gov (United States)

    Li, Zongyi; Li, Ruiheng; Smith, Charles; Pan, Fang; Campana, Mario; Webster, John R P; van der Walle, Christopher F; Uddin, Shahid; Bishop, Steve M; Narwal, Rojaramani; Warwicker, Jim; Lu, Jian Ren

    2017-07-12

    Characterizing the influence of fragment crystallization (Fc) and antigen-binding fragment (Fab) on monoclonal antibody (mAb) adsorption at the air/water interface is an important step to understanding liquid mAb drug product stability during manufacture, shipping, and storage. Here, neutron reflection is used to study the air/water adsorption of a mAb and its Fc and Fab fragments. By varying the isotopic contrast, the adsorbed amount, thickness, orientation, and immersion of the adsorbed layers could be determined unambiguously. While Fc adsorption reached saturation within the hour, its surface adsorbed amount showed little variation with bulk concentration. In contrast, Fab adsorption was slower and the adsorbed amount was concentration dependent. The much higher Fc adsorption, as compared to Fab, was linked to its lower surface charge. Time and concentration dependence of mAb adsorption was dominated by Fab behavior, although both Fab and Fc behaviors contributed to the amount of mAb adsorbed. Changing the pH from 5.5 to 8.8 did not much perturb the adsorbed amount of Fc, Fab, or mAb. However, a small decrease in adsorption was observed for the Fc over pH 8-8.8 and vice versa for the Fab and mAb, consistent with a dominant Fab behavior. As bulk concentration increased from 5 to 50 ppm, the thicknesses of the Fc layers were almost constant at 40 Å, while Fab and mAb layers increased from 45 to 50 Å. These results imply that the adsorbed mAb, Fc, and Fab all retained their globular structures and were oriented with their short axial lengths perpendicular to the interface.

  10. Improvement of the method of obtaining human IgA Fc-fragments

    Directory of Open Access Journals (Sweden)

    O. Y. Galkin

    2015-02-01

    Full Text Available To address a number of fundamental and applied problems in immunology, molecular and cellular biology and biotechnology it is necessary to obtain Fc-fragments of immunoglobulins. Fc-fragments may be used for studying of the effector functions of antibodies which are mediated by these areas. They are often used as an immunogen to produce anti-specie (based on so-called secondary antibody conjugate in the development of serological tests for diagnostics (predominantly such conjugate based on monoclonal antibodies. The work is aimed to develop improved methods of obtaining and allocation of Fc-fragments of human IgA. To achieve this objective, optimization of hydrolysis of IgA with subsequent purification of Fс-fragments have been carried out. Improved method of obtaining Fc-fragments of IgA provides: papain hydrolysis of immunoglobulin in the environment of nitrogen for 4 h, allowing to achieve maximum output of Fc-fragments without their further degradation: isolation and purification of Fc-fragments of human IgA by one-stage gel filtration on sephadex G-100; control of purity of the target product by electrophoresis in polyacrylamide gel with sodium dodecyl sulfate and Ouchterlony immunodiffusion. Enzymatic hydrolysis was carried out at the optimal temperature of papain (37 °C. As the oxygen in the air may have inhibitory effect on enzymatic hydrolysis reaction, the reaction mixture was incubated in the nitrogen atmosphere to prevent inactivation of papain. To reduce the incident degradation of immunoglobulin molecules, papain hydrolysis was carried out without using an enzyme activator (cysteine. Usage of the proposed scheme allows obtaining Fc-fragments of human IgA of high purity. Outcome of Fc-fragments after all stages of purification was about 18% of the initial amount of IgA in the preparation. Molecular weight from Fc-fragments of human IgA was equal to approximately 70 kDa.

  11. Structural recognition and functional activation of Fc[gamma]R by innate pentraxins

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Jinghua; Marnell, Lorraine L.; Marjon, Kristopher D.; Mold, Carolyn; Du Clos, Terry W.; Sun, Peter D. (UNM); (NIH)

    2009-10-05

    Pentraxins are a family of ancient innate immune mediators conserved throughout evolution. The classical pentraxins include serum amyloid P component (SAP) and C-reactive protein, which are two of the acute-phase proteins synthesized in response to infection. Both recognize microbial pathogens and activate the classical complement pathway through C1q. More recently, members of the pentraxin family were found to interact with cell-surface Fc{gamma} receptors (Fc{gamma}R) and activate leukocyte-mediated phagocytosis. Here we describe the structural mechanism for pentraxin's binding to Fc{gamma}R and its functional activation of Fc{gamma}R-mediated phagocytosis and cytokine secretion. The complex structure between human SAP and Fc{gamma}RIIa reveals a diagonally bound receptor on each SAP pentamer with both D1 and D2 domains of the receptor contacting the ridge helices from two SAP subunits. The 1:1 stoichiometry between SAP and Fc{gamma}RIIa infers the requirement for multivalent pathogen binding for receptor aggregation. Mutational and binding studies show that pentraxins are diverse in their binding specificity for Fc{gamma}R isoforms but conserved in their recognition structure. The shared binding site for SAP and IgG results in competition for Fc{gamma}R binding and the inhibition of immune-complex-mediated phagocytosis by soluble pentraxins. These results establish antibody-like functions for pentraxins in the Fc{gamma}R pathway, suggest an evolutionary overlap between the innate and adaptive immune systems, and have new therapeutic implications for autoimmune diseases.

  12. The challenges of facilitation

    DEFF Research Database (Denmark)

    Agger, Annika

    and at the same time make closures in order to secure progress in the process? The analysis draws upon theoretical perspectives on deliberative democracy and facilitation. Whereas, the scholarly literature on deliberative democracy is rich in describing potential outcomes and criteria for deliberative processes...... hours transcriptions of three table deliberations; questionnaires of 91 participants, 2 focus group interviews with participants and facilitators....

  13. Garcinielliptone FC: antiparasitic activity without cytotoxicity to mammalian cells.

    Science.gov (United States)

    Silva, Ana P; Silva, Marcos P; Oliveira, Cristiano G; Monteiro, Daniela C; Pinto, Pedro L; Mendonça, Ronaldo Z; Costa Júnior, Joaquim S; Freitas, Rivelilson M; de Moraes, Josué

    2015-06-01

    Garcinielliptone FC (GFC) is a natural prenylated benzophenone found in the seeds of Platonia insignis Mart. (Clusiaceae), a native Brazilian plant. It has been chemically characterized and it is known that GFC has several biological activities such as antioxidant and vasorelaxant properties. In this study, we report the in vitro effect of GFC against the blood fluke Schistosoma mansoni, the parasite responsible for schistosomiasis mansoni. The anti-S. mansoni activity and cytotoxicity toward mammalian cells were determined for the compound. GFC⩾6.25 μM showed antischistosomal activity and confocal laser scanning microscopy analysis demonstrated several morphological alterations on the tegument of worms, and a correlation between viability and tegumental damage was observed. In addition, at sub-lethal concentrations of GFC (⩽3.125 μM), the number of S. mansoni eggs was reduced. More importantly, GFC exhibited no activity toward mammalian cells and, therefore, there is an appreciable selectivity of this compound against the helminths. In conclusion, these findings indicate the potential of GFC as an antiparasitic agent. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Patient advocacy: barriers and facilitators

    Directory of Open Access Journals (Sweden)

    Nikravesh Mansoure

    2006-03-01

    Full Text Available Abstract Background During the two recent decades, advocacy has been a topic of much debate in the nursing profession. Although advocacy has embraced a crucial role for nurses, its extent is often limited in practice. While a variety of studies have been generated all over the world, barriers and facilitators in the patient advocacy have not been completely identified. This article presents the findings of a study exploring the barriers and facilitators influencing the role of advocacy among Iranian nurses. Method This study was conducted by grounded theory method. Participants were 24 Iranian registered nurses working in a large university hospital in Tehran, Iran. Semi-structured interviews were used for data collection. All interviews were transcribed verbatim and simultaneously Constant comparative analysis was used according to the Strauss and Corbin method. Results Through data analysis, several main themes emerged to describe the factors that hindered or facilitated patient advocacy. Nurses in this study identified powerlessness, lack of support, law, code of ethics and motivation, limited communication, physicians leading, risk of advocacy, royalty to peers, and insufficient time to interact with patients and families as barriers to advocacy. As for factors that facilitated nurses to act as a patient advocate, it was found that the nature of nurse-patient relationship, recognizing patients' needs, nurses' responsibility, physician as a colleague, and nurses' knowledge and skills could be influential in adopting the advocacy role. Conclusion Participants believed that in this context taking an advocacy role is difficult for nurses due to the barriers mentioned. Therefore, they make decisions and act as a patient's advocate in any situation concerning patient needs and status of barriers and facilitators. In most cases, they can not act at an optimal level; instead they accept only what they can do, which we called 'limited advocacy' in

  15. Structural Basis for Fc[gamma]RIIa Recognition of Human IgG and Formation of Inflammatory Signaling Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Ramsland, Paul A.; Farrugia, William; Bradford, Tessa M.; Sardjono, Caroline Tan; Esparon, Sandra; Trist, Halina M.; Powell, Maree S.; Tan, Peck Szee; Cendron, Angela C.; Wines, Bruce D.; Scott, Andrew M.; Hogarth, P. Mark (Burnet); (Monash); (LICR); (Melbourne)

    2011-09-20

    The interaction of Abs with their specific FcRs is of primary importance in host immune effector systems involved in infection and inflammation, and are the target for immune evasion by pathogens. Fc{gamma}RIIa is a unique and the most widespread activating FcR in humans that through avid binding of immune complexes potently triggers inflammation. Polymorphisms of Fc{gamma}RIIa (high responder/low responder [HR/LR]) are linked to susceptibility to infections, autoimmune diseases, and the efficacy of therapeutic Abs. In this article, we define the three-dimensional structure of the complex between the HR (arginine, R134) allele of Fc{gamma}RIIa (Fc{gamma}RIIa-HR) and the Fc region of a humanized IgG1 Ab, hu3S193. The structure suggests how the HR/LR polymorphism may influence Fc{gamma}RIIa interactions with different IgG subclasses and glycoforms. In addition, mutagenesis defined the basis of the epitopes detected by FcR blocking mAbs specific for Fc{gamma}RIIa (IV.3), Fc{gamma}RIIb (X63-21), and a pan Fc{gamma}RII Ab (8.7). The epitopes detected by these Abs are distinct, but all overlap with residues defined by crystallography to contact IgG. Finally, crystal structures of LR (histidine, H134) allele of Fc{gamma}RIIa and Fc{gamma}RIIa-HR reveal two distinct receptor dimers that may represent quaternary states on the cell surface. A model is presented whereby a dimer of Fc{gamma}RIIa-HR binds Ag-Ab complexes in an arrangement that possibly occurs on the cell membrane as part of a larger signaling assembly.

  16. Social Media to Facilitate Public Participation in IA

    NARCIS (Netherlands)

    Naber, A.C.; Enserink, B.

    2012-01-01

    Social media are web-based and mobile technologies that facilitate interaction between organizations, communities and individuals. Important characteristics are that the technologies are ubiquitous, communication instantaneous and that they enable the creation and exchange of user-generated content.

  17. Social Media to Facilitate Public Participation in IA

    NARCIS (Netherlands)

    Naber, A.C.; Enserink, B.

    2012-01-01

    Social media are web-based and mobile technologies that facilitate interaction between organizations, communities and individuals. Important characteristics are that the technologies are ubiquitous, communication instantaneous and that they enable the creation and exchange of user-generated content.

  18. 基于蒙特卡罗法的FC-AE-ASM网络可靠性研究%Study on reliability of FC-AE-ASM network based on Monte Carlo method

    Institute of Scientific and Technical Information of China (English)

    易川; 翟正军; 羊昌燕

    2014-01-01

    To solve the reliability problem of FC-AE-ASM(Fibre Channel-Avionics Environment-Anonymous Subscriber Messaging)network, based on basic FC-AE-ASM network model, several redundancy structure of the FC-AE-ASM network is introduced. An analysis method of network reliability is proposed. A calculation method of all terminal network reliability and error analysis is developed. Combined with the complexity of the FC-AE-ASM network model that is con-sisted of multiple FC switches, the effect of link redundancy structure, link reliability and node reliability to network reli-ability are analyzed.%对于FC-AE-ASM网络的可靠性问题,从FC-AE-ASM网络的基本模型出发,介绍了两种FC-AE-ASM网络冗余结构;提出了基于蒙特卡罗仿真法的网络可靠性分析方法,给出了FC-AE-ASM网络全端可靠度计算方法,给出了仿真结果的误差分析公式;结合由多个FC交换机组成的复杂FC-AE-ASM网络模型实例,分析链路冗余结构、链路可靠概率和节点可靠概率对FC-AE-ASM网络可靠性的影响。

  19. Facilitated thyrotropin release after retrochiasmatic hypothalamic knife cuts.

    Science.gov (United States)

    Phelps, C P; Colombo, J A

    1981-03-01

    Diencephalic structures that influence plasma thyrotropin (TSH) in male rats under pentobarbital anesthesia (35 mg/kg, IP) were studied by combining medial preoptic area-suprachiasmatic nucleus (MPOA-Sch) bilateral electrical stimulation (monophasic pulses, 200 microA at 50 Hz, 30 min) with progressive midline lesions produced by a retractable Halász knife. Plasma TSH was measured by radioimmunoassay just before (0 time) and at 30, 60 and 90 min after the beginning of stimulation. Rats that had received only sham surgical procedures 90 days prior to stimulation were characterized by a more than 2-3 fold elevation in basal (0 time) plasma TSH levels when compared to those found in intact control rats and expected elevations in plasma TSH at 30 min after stimulation were eliminated. After a small frontal cut (1.3 FC), 0 time plasma TSH levels increased more tha 4-fold above those of controls in association with a facilitation of stimulated release of TSH. When the knife blade radius was 1.5 mm (1.5 FC) the facilitation of TSH release after stimulation occurred again; however, 0 time plasma TSH concentrations in 1.5 FC rats were not different from control levels. These effects of midline cortical, thalamic and hypothalamic damage on TSH release required the passage of more than 12 days after brain surgery. Collectively, these findings suggest potential neural elements that are inhibitory for 'basal' and 'phasic' TSH release which are in close proximity to a separate excitatory neural system and which can be activated by MPOA-Sch stimulation.

  20. Cloning, characterization, and expression analysis of the DEAD-box family genes, Fc-vasa and Fc-PL10a, in Chinese shrimp ( Fenneropenaeus chinensis)

    Science.gov (United States)

    Zhou, Qianru; Shao, Mingyu; Qin, Zhenkui; Kyoung, Ho Kang; Zhang, Zhifeng

    2010-01-01

    RNA helicases of the DEAD-box and related families are involved in various cellular processes including DNA replication, DNA repair, and RNA processing. However, the function of DEAD-box proteins in aquaculture species is poorly understood at molecular level. We obtained the full-length cDNA sequences of two genes encoding helicase-related proteins, Fc-vasa and Fc-PL10a, from the testes of Chinese shrimp, Fenneropenaeus chinensis. The two predicted amino acid sequences contain all the conserved motifs characterized by the DEAD-box family and several RGG repeats in the N-terminal regions. Homology and phylogenetic analyses indicate that they belong to the vasa and PL10 subfamilies. The three-dimensional structures of the two proteins were predicted with a homology modeling approach. Both core proteins consist of two tandem RecA-like domains similar to those of the DEAD-box RNA helicase. Using reverse transcription-polymerase chain reaction (RT-PCR) and real-time PCR we found that Fc-vasa was expressed specifically in the adult gonads. Transcription decreased in the ovary but increased in the testis during gonadal development. Fc-PL10a expression was widely distributed in the tissues we examined. Using in situ hybridization, we demonstrated that the Fc-vasa transcript is localized to the cytoplasm of the spermatogonia and oocytes. Thus, our results suggest that Fc-vasa plays an important role in germ-line development, and has utility as a germ cell lineage marker which will help to generate new insight into the origin and differentiation of germ cells as well as the regulation of reproduction in F. chinensis.

  1. Transgenic rabbits that overexpress the neonatal Fc receptor (FcRn generate higher quantities and improved qualities of anti-thymocyte globulin (ATG.

    Directory of Open Access Journals (Sweden)

    Mária Baranyi

    Full Text Available Immune suppression with rabbit anti-thymocyte globulin (rATG is a well-established therapeutic concept for preventing host rejection of transplanted organs and graft versus host disease. Increasing the efficiency of rATG production by reducing the number of animals would be highly beneficial to lower cost and to improve quality standards. We have developed transgenic (Tg mice and rabbits that overexpress the neonatal Fc receptor (FcRn and have shown an augmented humoral immune response in these animals. To test whether our FcRn Tg rabbits produced rATG more efficiently, we immunized them and their New Zealand White controls with live Jurkat cells. By day 21 after immunization, Tg animals produced significantly, 1.5 times higher amount of total IgG compared to their wt littermates. Also, the binding efficiency of Tg sera to Jurkat cells and their complement-mediated cytotoxicity was significantly higher. The purified Tg IgG preparation contained 2.6 the amount of Jurkat specific IgG as the wt preparation analyzed by complement-mediated lysis, suggesting greater antigen-specific B cell activation in the Tg rabbits. To test this hypothesis, immunization with ovalbumin and human α1-antitrypsin was performed, resulting in significantly greater numbers of antigen-specific B-cells in the FcRn Tg rabbits as compared with wt controls. The shift towards significantly larger populations of antigen-specific B cells relative to the non-specific B cell pool is further corroborated by our previous findings in FcRn Tg mice. Consequently, our FcRn Tg rabbits have the potential to offer substantial qualitative and quantitative improvements for the production of rATG and other polyclonal or monoclonal antibodies.

  2. NFκB induces overexpression of bovine FcRn: a novel mechanism that further contributes to the enhanced immune response in genetically modified animals carrying extra copies of FcRn.

    Science.gov (United States)

    Cervenak, Judit; Doleschall, Márton; Bender, Balázs; Mayer, Balázs; Schneider, Zita; Doleschall, Zoltán; Zhao, Yaofeng; Bősze, Zsuzsanna; Hammarström, Lennart; Oster, Wolfgang; Kacskovics, Imre

    2013-01-01

    Among the many functions of the neonatal Fc receptor (FcRn) for IgG, it binds to IgG-opsonized antigen complexes and propagates their traffic into lysosomes where antigen processing occurs. We previously reported that transgenic (Tg) mice and rabbits that carry multiple copies and overexpress FcRn have augmented humoral immune responses. Nuclear factor-kappa B (NFκB) is a critical molecule in the signaling cascade in the immune response. NFκB induces human FcRn expression and our previous in silico analysis suggested NFκB binding sites in the promoter region of the bovine (b) FcRn α-chain gene (FCGRT). Here, we report the identification of three NFκB transcription binding sites in the promoter region of this gene using luciferase reporter gene technology, electromobility shift assay and supershift analysis. Stimulation of primary bovine endothelial cells with the Toll-like receptor-4 ligand lipopolysaccharide (LPS), which mediates its effect via NFκB, resulted in rapid upregulation of the bFcRn expression and a control gene, bovine E-selectin. This rapid bFcRn gene induction was also observed in the spleen of bFcRn Tg mice treated with intraperitoneally injected LPS, analyzed by northern blot analysis. Finally, NFκB-mediated bFcRn upregulation was confirmed at the protein level in macrophages isolated from the bFcRn Tg mice using flow cytometry with a newly developed FcRn specific monoclonal antibody that does not cross-react with the mouse FcRn. We conclude that NFκB regulates bFcRn expression and thus optimizes its functions, e.g., in the professional antigen presenting cells, and contributes to the much augmented humoral immune response in the bFcRn Tg mice.

  3. Cloning,characterization,and expression analysis of the DEAD-box family genes,Fc-vasa and Fc-PL10a,in Chinese shrimp (Fenneropenaeus chinensis)

    Institute of Scientific and Technical Information of China (English)

    周倩如; 邵明瑜; 秦贞奎; 康庆浩; 张志峰

    2010-01-01

    RNA helicases of the DEAD-box and related families are involved in various cellular processes including DNA replication,DNA repair,and RNA processing.However,the function of DEAD-box proteins in aquaculture species is poorly understood at molecular level.We obtained the full-length cDNA sequences of two genes encoding helicase-related proteins,Fc-vasa and Fc-PL10a,from the testes of Chinese shrimp,Fenneropenaeus chinensis.The two predicted amino acid sequences contain all the conserved motifs characterized ...

  4. A soluble form of the high affinity IgE receptor, Fc-epsilon-RI, circulates in human serum.

    Directory of Open Access Journals (Sweden)

    Eleonora Dehlink

    Full Text Available Soluble IgE receptors are potential in vivo modulators of IgE-mediated immune responses and are thus important for our basic understanding of allergic responses. We here characterize a novel soluble version of the IgE-binding alpha-chain of Fc-epsilon-RI (sFcεRI, the high affinity receptor for IgE. sFcεRI immunoprecipitates as a protein of ∼40 kDa and contains an intact IgE-binding site. In human serum, sFcεRI is found as a soluble free IgE receptor as well as a complex with IgE. Using a newly established ELISA, we show that serum sFcεRI levels correlate with serum IgE in patients with elevated IgE. We also show that serum of individuals with normal IgE levels can be found to contain high levels of sFcεRI. After IgE-antigen-mediated crosslinking of surface FcεRI, we detect sFcεRI in the exosome-depleted, soluble fraction of cell culture supernatants. We further show that sFcεRI can block binding of IgE to FcεRI expressed at the cell surface. In summary, we here describe the alpha-chain of FcεRI as a circulating soluble IgE receptor isoform in human serum.

  5. Fluorocarbons and cardiac arrhythmia: does difluorodichloromethane (FC 12) inhibit cardiac metabolism

    Energy Technology Data Exchange (ETDEWEB)

    Lessard, Y.; Begue, J.M.; Paulet, G.

    1986-01-01

    Certain fluorocarbons, such as difluorodichloromethane (FC 12), depress the cardiovascular system by diminution of all the transmembrane ionic conductances in cardiac tissues. Does FC 12 also inhibit active transport and thus enzymatic activity and cellular energy. We measured phosphocreatine (PC), adenosine triphosphate (ATP) and cyclic adenosine monophosphate (AMPc) in rat hearts. Rats were randomly divided into 4 groups; 2 control groups: one breathing a mixture of oxygen (21%) and nitrogen (79%) (group C) and the other breathing the same mixture but simultaneously perfused with 1 microgram/kg/min. epinephrine (groupe E-C); 2 trial groups T and E-T where nitrogen was replaced by FC 12. The maximal FC 12 concentration of 720 micrograms/ml in arterial blood produced no significant difference in the concentrations of these three metabolites compared with controls.

  6. The role of bullfighting and FC Barcelona in the emancipation of Catalonia from Spain

    OpenAIRE

    TKac, John A.

    2014-01-01

    This paper looks at the role that bullfighting and FC Barcelona have played in the growing independence movement in Catalonia. This article will discuss nations, the importance of bullfighting and soccer to Iberian cultures, Catalan political parties and

  7. Fc gamma receptor polymorphisms in systemic lupus erythematosus and their correlation with the clinical severity of the disease

    Directory of Open Access Journals (Sweden)

    Pradhan Vandana

    2008-01-01

    Full Text Available Receptors for the Fc domains of IgG (Fc γ R play a critical role in linking humoral and cellular immune responses. The various Fc γ R genes may contribute to differences in infectious and immune related diseases in various ethnic populations. Polymorphisms of Fc γ R mainly Fc γ R IIA, IIB, IIIA, IIIB have been identified as genetic factors influencing susceptibility to disease or disease course of a prototype autoimmune disease like Systemic Lupus Erythematosus (SLE. Activated and inhibitory Fc γ Rs seem to play an important role in the pathogenesis of SLE, in initiation of autoimmunity, the subsequent development of inflammatory lesions and finally immune clearance mechanisms. This review focuses on the role of Fc γ R polymorphism and their association with clinical manifestations and initiation of autoantibody production, inflammatory handling of immune complexes and disease development in SLE patients.

  8. Facilitating Understandings of Geometry.

    Science.gov (United States)

    Pappas, Christine C.; Bush, Sara

    1989-01-01

    Illustrates some learning encounters for facilitating first graders' understanding of geometry. Describes some of children's approaches using Cuisenaire rods and teacher's intervening. Presents six problems involving various combinations of Cuisenaire rods and cubes. (YP)

  9. Facilitating Knowledge Sharing

    DEFF Research Database (Denmark)

    Holdt Christensen, Peter

    Abstract This paper argues that knowledge sharing can be conceptualized as different situations of exchange in which individuals relate to each other in different ways, involving different rules, norms and traditions of reciprocity regulating the exchange. The main challenge for facilitating...... and the intermediaries regulating the exchange, and facilitating knowledge sharing should therefore be viewed as a continuum of practices under the influence of opportunistic behaviour, obedience or organizational citizenship behaviour. Keywords: Knowledge sharing, motivation, organizational settings, situations...

  10. Fc functional antibodies in humans with severe H7N9 and seasonal influenza

    Science.gov (United States)

    Vanderven, Hillary A.; Liu, Lu; Ana-Sosa-Batiz, Fernanda; Nguyen, Thi H.O.; Wan, Yanmin; Hogarth, P. Mark; Tilmanis, Danielle; Parsons, Matthew S.; Hurt, Aeron C.; Davenport, Miles P.; Kotsimbos, Tom; Cheng, Allen C.; Kedzierska, Katherine; Zhang, Xiaoyan; Xu, Jianqing; Kent, Stephen J.

    2017-01-01

    BACKGROUND. Both seasonal and novel avian influenza viruses can result in severe infections requiring hospitalization. Anti-influenza antibodies (Abs) with Fc-mediated effector functions, such as Ab-dependent cellular cytotoxicity (ADCC), are of growing interest in control of influenza but have not previously been studied during severe human infections. As such, the objective of this study was to examine Fc-mediated Ab functions in humans hospitalized with influenza infection. METHODS. Serum Ab response was studied in subjects hospitalized with either pandemic H7N9 avian influenza virus in China (n = 18) or circulating seasonal influenza viruses in Melbourne, Australia (n = 16). Recombinant soluble Fc receptor dimer ELISAs, natural killer (NK) cell activation assays, and Ab-dependent killing assays with influenza-infected target cells were used to assess the Fc functionality of anti-influenza hemagglutinin (HA) Abs during severe human influenza infection. RESULTS. We found that the peak generation of Fc functional HA Abs preceded that of neutralizing Abs for both severe H7N9 and seasonal influenza infections. Subjects who succumbed to complications of H7N9 infection demonstrated reduced HA-specific Fc receptor–binding Abs (in magnitude and breadth) immediately prior to death compared with those who survived. Subjects who recovered from H7N9 and severe seasonal influenza infections demonstrated increased Fc receptor–binding Abs not only against the homologous infecting strain but against HAs from different influenza A subtypes. CONCLUSION. Collectively, survivors of severe influenza infection rapidly generate a functional Ab response capable of mediating ADCC against divergent influenza viruses. Broadly binding HA Abs with Fc-mediated functions may be a useful component of protective immunity to severe influenza infection. FUNDING. The National Health and Medical Research Council ([NHMRC] grants 1023294, 1041832, and 1071916), the Australian Department of Health

  11. Protection of Mice from Lethal Endotoxemia by Chimeric Human BPI-Fcγ1 Gene Delivery

    Institute of Scientific and Technical Information of China (English)

    Chen Li; Jing Li; Zhe Lv; Xinghua Guo; Qinghua Chen; Qingli Kong; Yunqing An

    2006-01-01

    To evaluate the potentiality of applying gene therapy to endotoxemia in high-risk patients, we investigated the effects of transferring an adeno-associated virus serotype 2 (AAV2)-mediated BPI-Fcγ1 gene on protecting mice from challenge of lethal endotoxin. The chimeric BPI-Fcγ1 gene consists of two parts, one encods functional N-terminus (1 to 199 amino acidic residues) of human BPI, which is a bactericidal/permeability-increasing protein,and the other encodes Fc segment of human immunoglobulin G1 (Fcγ1). Our results indicated that the target protein could be expressed and secreted into the serum of the gene-transferred mice. After lethal endotoxin challenge, the levels of endotoxin and TNF-α in the gene-transferred mice were decreased. The survival rate of the BPI-Fcγ1 gene-transferred mice was markedly increased. Our data suggest that AAV2-mediated chimeric BPI-Fcγ1 gene delivery can potentially be used clinically for the protection and treatment of endotoxemia and endotoxic shock in high-risk individuals.

  12. Method for creating gas standards form liquid HFE-7100 and FC-72.

    Energy Technology Data Exchange (ETDEWEB)

    White, Michael K.; Brown, Jason R.; Thornberg, Steven Michael; Hochrein, James Michael; Irwin, Adriane Nadine

    2007-07-01

    HFE-7100 and FC-72 fluorinert are two fluids used during weapon component manufacturing. HFE-7100 is a solvent used in the cleaning of parts, and FC-72 is the blowing agent of a polymeric removable foam. The presence of either FC-72 or HFE-7100 gas in weapon components can provide valuable information as to the stability of the materials. Therefore, gas standards are needed so HFE-7100 and FC-72 gas concentrations can be accurately measured. There is no current established procedure for generating gas standards of either HFE-7100 or FC-72. This report outlines the development of a method to generate gas standards ranging in concentration from 0.1 ppm to 10% by volume. These standards were then run on a Jeol GC-Mate II mass spectrometer and analyzed to produce calibration curves. We present a manifold design that accurately generates gas standards of HFE-7100 and FC-72 and a procedure that allows the amount of each to be determined.

  13. Method for creating gas standards form liquid HFE-7100 and FC-72.

    Energy Technology Data Exchange (ETDEWEB)

    White, Michael K.; Brown, Jason R.; Thornberg, Steven Michael; Hochrein, James Michael; Irwin, Adriane Nadine

    2007-07-01

    HFE-7100 and FC-72 fluorinert are two fluids used during weapon component manufacturing. HFE-7100 is a solvent used in the cleaning of parts, and FC-72 is the blowing agent of a polymeric removable foam. The presence of either FC-72 or HFE-7100 gas in weapon components can provide valuable information as to the stability of the materials. Therefore, gas standards are needed so HFE-7100 and FC-72 gas concentrations can be accurately measured. There is no current established procedure for generating gas standards of either HFE-7100 or FC-72. This report outlines the development of a method to generate gas standards ranging in concentration from 0.1 ppm to 10% by volume. These standards were then run on a Jeol GC-Mate II mass spectrometer and analyzed to produce calibration curves. We present a manifold design that accurately generates gas standards of HFE-7100 and FC-72 and a procedure that allows the amount of each to be determined.

  14. Inhibition of tumor growth and metastasis by ATF-Fc, an engineered antibody targeting urokinase receptor.

    Science.gov (United States)

    Hu, Xian-Wen; Duan, Hai-Feng; Gao, Li-Hua; Pan, Shu-Yuan; Li, Yong-Mei; Xi, Yongyi; Zhao, Su-Rong; Yin, Liang; Li, Jin-Feng; Chen, Hui-Peng; Wu, Chu-Tse

    2008-05-01

    Urokinase (uPA) and its receptor (uPAR) play an important role in tumor growth and metastasis, and overexpression of these molecules is strongly correlated with poor prognosis in a variety of malignant tumors. In this study, ATF-Fc, an antibody-like molecule comprising the amino-terminal fragment of human uPA (ATF) linked to the Fc fragment of human IgG1 via a flexible linker was developed. Its antitumor activities were evaluated in vitro and in vivo. The results showed that ATF-Fc had obvious cytotoxic effect on several types of tumor cells, which is dependent on cellular expression of uPAR and its Fc fragment. Treatment with ATF-Fc caused a significant suppression on tumor growth and metastasis of xenograft human tumors (MCF-7 breast cancer and BGC-823 gastric cancer) in athymic nude mice. Furthermore, we demonstrated that ATF-Fc had an anti-angiogenesis activity both in vitro and in vivo. In conclusion, we provided a novel therapeutic antibody-like molecule in the management of a variety of solid tumors by disrupting the uPA/uPAR interaction.

  15. Neonatal Fc receptor expression in dendritic cells mediates protective immunity against colorectal cancer.

    Science.gov (United States)

    Baker, Kristi; Rath, Timo; Flak, Magdalena B; Arthur, Janelle C; Chen, Zhangguo; Glickman, Jonathan N; Zlobec, Inti; Karamitopoulou, Eva; Stachler, Matthew D; Odze, Robert D; Lencer, Wayne I; Jobin, Christian; Blumberg, Richard S

    2013-12-12

    Cancers arising in mucosal tissues account for a disproportionately large fraction of malignancies. Immunoglobulin G (IgG) and the neonatal Fc receptor for IgG (FcRn) have an important function in the mucosal immune system that we have now shown extends to the induction of CD8(+) T cell-mediated antitumor immunity. We demonstrate that FcRn within dendritic cells (DCs) was critical for homeostatic activation of mucosal CD8(+) T cells that drove protection against the development of colorectal cancers and lung metastases. FcRn-mediated tumor protection was driven by DCs activation of endogenous tumor-reactive CD8(+) T cells via the cross-presentation of IgG complexed antigens (IgG IC), as well as the induction of cytotoxicity-promoting cytokine secretion, particularly interleukin-12, both of which were independently triggered by the FcRn-IgG IC interaction in murine and human DCs. FcRn thus has a primary role within mucosal tissues in activating local immune responses that are critical for priming efficient anti-tumor immunosurveillance.

  16. The Transcription Factor Ehf Is Involved in TGF-β-Induced Suppression of FcεRI and c-Kit Expression and FcεRI-Mediated Activation in Mast Cells.

    Science.gov (United States)

    Yamazaki, Susumu; Nakano, Nobuhiro; Honjo, Asuka; Hara, Mutsuko; Maeda, Keiko; Nishiyama, Chiharu; Kitaura, Jiro; Ohtsuka, Yoshikazu; Okumura, Ko; Ogawa, Hideoki; Shimizu, Toshiaki

    2015-10-01

    FcεRI, which is composed of α, β, and γ subunits, plays an important role in IgE-mediated allergic responses. TGF-β1 has been reported to suppress FcεRI and stem cell factor receptor c-Kit expression on mast cell surfaces and to suppress mast cell activation induced by cross-linking of FcεRI. However, the molecular mechanism by which these expressions and activation are suppressed by TGF-β1 remains unclear. In this study, we found that the expression of Ets homologous factor (Ehf), a member of the Ets family transcriptional factors, is upregulated by TGF-β/Smad signaling in mouse bone marrow-derived mast cells (BMMCs). Forced expression of Ehf in BMMCs repressed the transcription of genes encoding FcεRIα, FcεRIβ, and c-Kit, resulting in a reduction in cell surface FcεRI and c-Kit expression. Additionally, forced expression of Ehf suppressed FcεRI-mediated degranulation and cytokine production. Ehf inhibited the promoter activity of genes encoding FcεRIα, FcεRIβ, and c-Kit by binding to these gene promoters. Furthermore, the mRNA levels of Gata1, Gata2, and Stat5b were lower in BMMCs stably expressing Ehf compared with control cells. Because GATA-1 and GATA-2 are positive regulators of FcεRI and c-Kit expression, decreased expression of GATAs may be also involved in the reduction of FcεRI and c-Kit expression. Decreased expression of Stat5 may contribute to the suppression of cytokine production by BMMCs. In part, mast cell response to TGF-β1 was mimicked by forced expression of Ehf, suggesting that TGF-β1 suppresses FcεRI and c-Kit expression and suppresses FcεRI-mediated activation through upregulation of Ehf.

  17. Chemical Communications

    Science.gov (United States)

    2012-10-26

    Army Research Office P.O. Box 12211 Research Triangle Park , NC 27709-2211 15. SUBJECT TERMS biomaterials processing, silk interfaces...David Kaplan. New Opportunities for an Ancient Material, Science (09 2011) 09/14/2011 9.00 RH Kim, DH Kim, J Xiao, B Hoon Kim, S Park , Bruce Panilaitis...Omenetto Tufts University 4 Colby Street Medford MA 02155 5a: 5f-1a: 5f-c: Eleanor Pritchard Tufts University 4 Colby Street Medford MA 02155 5a: 5f-1a: 5f-c

  18. Consistent wind Facilitates Vection

    Directory of Open Access Journals (Sweden)

    Masaki Ogawa

    2011-10-01

    Full Text Available We examined whether a consistent haptic cue suggesting forward self-motion facilitated vection. We used a fan with no blades (Dyson, AM01 providing a wind of constant strength and direction (wind speed was 6.37 m/s to the subjects' faces with the visual stimuli visible through the fan. We used an optic flow of expansion or contraction created by positioning 16,000 dots at random inside a simulated cube (length 20 m, and moving the observer's viewpoint to simulate forward or backward self-motion of 16 m/s. we tested three conditions for fan operation, which were normal operation, normal operation with the fan reversed (ie, no wind, and no operation (no wind and no sound. Vection was facilitated by the wind (shorter latency, longer duration and larger magnitude values with the expansion stimuli. The fan noise did not facilitate vection. The wind neither facilitated nor inhibited vection with the contraction stimuli, perhaps because a headwind is not consistent with backward self-motion. We speculate that the consistency between multi modalities is a key factor in facilitating vection.

  19. Rapid polyclonal desensitization with antibodies to IgE and FcεRIα.

    Science.gov (United States)

    Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Lewkowich, Ian; Morris, Suzanne C; Finkelman, Fred D

    2013-06-01

    Rapid desensitization, a procedure in which persons allergic to an antigen are treated at short intervals with increasing doses of that antigen until they tolerate a large dose, is an effective, but risky, way to induce temporary tolerance. We wanted to determine whether this approach can be adapted to suppress all IgE-mediated allergies in mice by injecting serially increasing doses of monoclonal antibodies (mAbs) to IgE or FcεRIα. Active and passive models of antigen- and anti-IgE mAb-induced IgE-mediated anaphylaxis were used. Mice were desensitized with serially increasing doses of anti-IgE mAb, anti-FcεRIα mAb, or antigen. Development of shock (hypothermia), histamine and mast cell protease release, cytokine secretion, calcium flux, and changes in cell number and FcεRI and IgE expression were evaluated. Rapid desensitization with anti-IgE mAb suppressed IgE-mediated immediate hypersensitivity; however, some mice developed mild anaphylaxis during desensitization. Rapid desensitization with anti-FcεRIα mAb that only binds FcεRI that is not occupied by IgE suppressed both active and passive IgE-mediated anaphylaxis without inducing disease. It quickly, but temporarily, suppressed IgE-mediated anaphylaxis by decreasing mast cell signaling through FcεRI, then slowly induced longer lasting mast cell unresponsiveness by removing membrane FcεRI. Rapid desensitization with anti-FcεRIα mAb was safer and longer lasting than rapid desensitization with antigen. A rapid desensitization approach with anti-FcεRIα mAb safely desensitizes mice to IgE-mediated anaphylaxis by inducing mast cell anergy and later removing all mast cell IgE. Rapid desensitization with an anti-human FcεRIα mAb may be able to prevent human IgE-mediated anaphylaxis. Copyright © 2013 American Academy of Allergy, Asthma & Immunology. Published by Mosby, Inc. All rights reserved.

  20. Distinct Fcγ receptors mediate the effect of serum amyloid p on neutrophil adhesion and fibrocyte differentiation.

    Science.gov (United States)

    Cox, Nehemiah; Pilling, Darrell; Gomer, Richard H

    2014-08-15

    The plasma protein serum amyloid P (SAP) reduces neutrophil adhesion, inhibits the differentiation of monocytes into fibroblast-like cells called fibrocytes, and promotes phagocytosis of cell debris by macrophages. Together, these effects of SAP reduce key aspects of inflammation and fibrosis, and SAP injections improve lung function in pulmonary fibrosis patients. SAP functions are mediated, in part, by FcγRs, but the contribution of each FcγR is not fully understood. We found that aa Q55 and E126 in human SAP affect human fibrocyte differentiation and SAP binding to FcγRI. E126, K130, and Q128 affect neutrophil adhesion and SAP affinity for FcγRIIa. Q128 also affects phagocytosis by macrophages and SAP affinity for FcγRI. All the identified functionally significant amino acids in SAP form a binding site that is distinct from the previously described SAP-FcγRIIa binding site. Blocking FcγRI with an IgG-blocking Ab reduces the SAP effect on fibrocyte differentiation, and ligating FcγRIIa with Abs reduces neutrophil adhesion. Together, these results suggest that SAP binds to FcγRI on monocytes to inhibit fibrocyte differentiation, and binds to FcγRIIa on neutrophils to reduce neutrophil adhesion.

  1. Neuronal Fc gamma receptor I as a novel mediator for IgG immune complex-induced peripheral sensitization

    Institute of Scientific and Technical Information of China (English)

    Lintao Qu

    2012-01-01

    Chronic pain often accompanies immune-related diseases with an elevated level of IgG immune complex (IgG-IC) in the serum and/or the affected tissues though the underlying mechanisms are largely unknown. Fc gamma receptors (FcγRs), known as the receptors for the Fc domain of immunoglobulin G (IgG), are typically expressed on immune cells. A general consensus is that the activation of FcγRs by IgG-IC in such immune cells induces the release of proinflammatory cytokines from the immune cells, which may contribute to the IgG-IC-mediated peripheral sensitization. In addition to the immune cells, recent studies have revealed that FcγRI, but not FcγRII and FcγRIII, is also expressed in a subpopulation of primary sensory neurons. Moreover, IgG-IC directly excites the primary sensory neurons through neuronal FcγRI. These findings indicate that neuronal FcγRI provides a novel direct linkage between immunoglobulin and primary sensory neurons, which may be a novel target for the treatment of pain in the immune-related disorders. In this review, we summarize the expression pattern, functions, and the associated cellular signaling of FcγRs in the primary sensory neurons.

  2. "How Can I Help You Get What You Want?": A Communication Strategy for Students with Severe Disabilities.

    Science.gov (United States)

    Ostrosky, Michaelene M.; Drasgow, Erik; Halle, James W.

    1999-01-01

    Examines ways to facilitate communication by nonverbal students with severe disabilities. Discusses selecting functional communication targets and teachable contexts, facilitating widespread use (generalization), ensuring maintenance of the new communication behavior, and implications for practice. (DB)

  3. Pharmacokinetics, Pharmacodynamics, and Efficacy of a Novel Long-Acting Human Growth Hormone: Fc Fusion Protein.

    Science.gov (United States)

    Kim, Su Jin; Kwak, Hyun-Hee; Cho, Sung Yoon; Sohn, Young Bae; Park, Sung Won; Huh, Rimm; Kim, Jinsup; Ko, Ah-Ra; Jin, Dong-Kyu

    2015-10-05

    The current recombinant human growth hormone (rhGH) therapy requires daily subcutaneous (sc) injections, which results in poor patient compliance, especially in young children. To reduce the dosing frequency, we generated a chimeric protein of rhGH and the Fc-domain of immunoglobulin G (IgG) (rhGH-Fc). The pharmacokinetics and pharmacodynamics of sc-injected rhGH-Fc were assessed in male Sprague-Dawley rats and hypophysectomized rats, respectively. A single sc injection of rhGH-Fc at a dose of 0.2 mg/kg slowly reached a Cmax of 16.80 ng/mL and remained for 7 days with a half-life of 51.1 h. Conversely, a single sc injection of rhGH 0.2 mg/kg rapidly reached a Cmax of 46.88 ng/mL and declined with a half-life of 0.55 h to baseline values in 4 h. In the efficacy study, the sc-injected rhGH-Fc induced rapid weight gain and tibial width growth at a dose of 240 μg/animal. The effect of two injections of rhGH-Fc separated by 1 week was comparable to that of the same dose of 14 daily injections of rhGH. The rhGH-Fc is a novel candidate for long-acting rhGH therapy with more convenient weekly administration, as it reduces glomerular filtration and receptor-mediated clearance while allowing for the rapid reversal of potential adverse events.

  4. Advances in the Fc receptor of teleosts%鱼类Fc受体研究

    Institute of Scientific and Technical Information of China (English)

    邵茜; 安利国; 杨桂文

    2009-01-01

    Fc受体是免疫细胞表面一种重要受体分子,通过与免疫球蛋白Fc段结合触发多种生物学功能,是联系体液免疫和细胞免疫的桥梁.部分硬骨鱼中已经发现了Fc受体,在斑马鱼、斑点叉尾鲴和鲤鱼中都克隆到了Fc受体的γ亚基,在鲨鱼和大西洋鲑中证明有能够与免疫球蛋白结合的Fc受体存在,并在斑点叉尾鲴、河豚和虹鳟中存在着类似α亚基的Fc受体.对鱼类Fc受体的发现和研究必将为了解鱼类的免疫机制及免疫进化提供重要的资料.%Fc receptors(FcRs) of immunoglobulins on immune cell play an important role in immune system by providing a link between antibody-antigen complexes and the effect cell. FcRs supply an essential link between humoral and cellular immunity. FcRs have been cloned in teleost fish, the γ subunit of Fc receptor has been cloned from zebrafish, catfish and common carp, while the subunits binding to immunoglobulins have been identified from shark, atlantic salmon, catfish, fugu and rainbow trout. Identification of subunits of the Fc receptors could lead to a farther investigation of the immune mechanism in teleosts and the phylogeny of Fc receptors.

  5. Facilitation skills for trainers

    Directory of Open Access Journals (Sweden)

    F. Cilliers

    2000-06-01

    Full Text Available This research aims to develop the facilitation skills of trainers. Facilitation is defined form the Person-Centered approach, as providing an opportunity for the trainee to experience personal growth and learning. A facilitation skills workshop was presented to 40 trainers, focussing on enhancing selfactualisation, its intra and inter personal characteristics, and attending and responding behaviour. Measurement with the Personal Orientation Inventory and Carkhuff scales, indicate enhanced cognitive, affective and conative sensitivity and interpersonal skills. A post-interview indicates the trainers experienced empowerment in dealing with the providing of opportunities for growth amongst trainees, in all kinds of training situations. Recommendations are made to enhance facilitation development amongst trainers. Opsomming Hierdie navorsing poog om die fasiliteringsvaardighede van opieiers te ontwikkel. Fasilitering word gedefinieer vanuit die Persoonsgesentreerde benadering as die beskikbaarstelling van 'n geleentheid om persoonlike groei en leer te ervaar. 'n Fasiliteringsvaardighede werkswinkel is aangebied vir 40 opieiers, met die fokus op die stimulering van selfaktualisering, die intra en interpersoonlike kenmerke daarvan, en aandagskenk- en responderings- gedrag. Meting met die Persoonlike Orientasievraelys en die Carkhuff skale, dui op n toename in kognitiewe, affektiewe en konatiewe sensitiwiteit en interpersoonlike vaardighede. n Post-onderhoud dui op die opleier se ervaarde bemagtiging in die beskikbaarstelling van groeigeleenthede vir opleidelinge, in all tipe opleidingsituasies. Aanbevelings word gemaak om die ontwikkeling van fasiliteringsvaardighede by opleiers te verhoog.

  6. From Teaching to Facilitation

    DEFF Research Database (Denmark)

    de Graaff, Erik

    2013-01-01

    A shift from teaching to learning is characteristic of the introduction of Problem Based Learning (PBL) in an existing school. As a consequence the teaching staff has to be trained in skills like facilitating group work and writing cases. Most importantly a change in thinking about teaching...

  7. Facilitation of Adult Development

    Science.gov (United States)

    Boydell, Tom

    2016-01-01

    Taking an autobiographical approach, I tell the story of my experiences facilitating adult development, in a polytechnic and as a management consultant. I relate these to a developmental framework of Modes of Being and Learning that I created and elaborated with colleagues. I connect this picture with a number of related models, theories,…

  8. Facilitation skills for nurses

    Directory of Open Access Journals (Sweden)

    F Cilliers

    2000-09-01

    Full Text Available Using the pcrson-centered approach, facilitation in this study was conceptualised as providing opportunities for personal growth in the patient, and operationalised in a skills workshop for 40 nurses from different hospitals in Gauteng. The first objective was to evaluate the workshop and the second to ascertain its effect on the participant’s experienced performance. A combined quantitative and qualitative research design was used. The quantitative measurement (Personal Orientation Inventory, Carkhuff scales indicated that the workshop stimulated self-actualisation in terms of intrapersonal awareness, and the interpersonal skills of respect, realness, concreteness, empathy, as well as in terms of attending and responding behaviour. The qualitative measurement (a semi-structured interview indicated that the participants were able to empower patients to find their own answers to difficult personal questions. The alternative hypothesis was accepted, namely that this workshop in facilitations skills significantly enhanced the intra- and interpersonal characteristics associated with self-actualisation and the facilitation of growth in patients. The findings highlighted the difference between the two roles of instructor and facilitator, and recommendations to this effect were formulated.

  9. Computer Mediated Communication

    Science.gov (United States)

    Fano, Robert M.

    1984-08-01

    The use of computers in organizations is discussed in terms of its present and potential role in facilitating and mediating communication between people. This approach clarifies the impact that computers may have on the operation of organizations and on the individuals comprising them. Communication, which is essential to collaborative activities, must be properly controlled to protect individual and group privacy, which is equally essential. Our understanding of the human and organizational aspects of controlling communication and access to information presently lags behind our technical ability to implement the controls that may be needed.

  10. [Bacteria and viruses modulate FcεRI-dependent mast cell activity].

    Science.gov (United States)

    Słodka, Aleksandra; Brzezińska-Błaszczyk, Ewa

    2013-03-08

    Undoubtedly, mast cells play a central role in allergic processes. Specific allergen cross-linking of IgE bound to the high affinity receptors (FcεRI) on the mast cell surface leads to the release of preformed mediators and newly synthesized mediators, i.e. metabolites of arachidonic acid and cytokines. More and more data indicate that bacteria and viruses can influence FcεRI-dependent mast cell activation. Some bacterial and viral components can reduce the surface expression of FcεRI. There are also findings that ligation of Toll-like receptors (TLRs) by bacterial or viral antigens can affect IgE-dependent mast cell degranulation and preformed mediator release as well as eicosanoid production. The synergistic interaction of TLR ligands and allergen can also modify cytokine synthesis by mast cells stimulated via FcεRI. Moreover, data suggest that specific IgE for bacterial or viral antigens can influence mast cell activity. What is more, some bacterial and viral components or some endogenous proteins produced during viral infection can act as superantigens by interacting with the VH3 domain of IgE. All these observations indicate that bacterial and viral infections modify the course of allergic diseases by affecting FcεRI-dependent mast cell activation. 

  11. Synthetically Control of a Hybrid PV/FC/SC Power System for Stand-Alone Applications

    Directory of Open Access Journals (Sweden)

    Dakang Zhu

    2013-02-01

    Full Text Available In this study, a simple and practical control scheme for power assignment and load-following of a Hybrid Power System (HPS is proposed. The system consists of Photovoltaic (PV, Fuel Cell (FC, Super-Capacitor (SC, dc load, ac load and different kinds of converters. PV is chosen as a prior source, which normally operates in Maximum Power Point Tracking (MPPT mode. In order to achieve 24 h power supply under various natural conditions, FC is used as a backup source to provide the power deficit between solar generation and load demand. Taking the slow FC system dynamics into account, FC power slope has been limited to protect FC from fuel starvation, whereas SC is chosen to satisfy the requirement of the sudden load and solar radiation changes. Besides, a V/f controller is designed to meet ac load demand, while keeping the voltage and frequency within an acceptable range. All the details of this study, including system structure, control diagrams and MATLAB simulation results, are presented.

  12. Comparison of Fc N-Glycosylation of Pharmaceutical Products of Intravenous Immunoglobulin G.

    Directory of Open Access Journals (Sweden)

    Willem Jan R Fokkink

    Full Text Available Intravenous immunoglobulin (IVIg products from different pharmaceutical companies vary in composition, in part because of the selected blood donors and production process. N-glycosylation of the Fc-portion of IgG varies between blood donors and may influence both the side-effects and therapeutic effectiveness of IVIg. At present, the variation in Fc N-glycosylation between IVIg products has not been defined. Utilizing mass spectrometry, we performed relative quantitation of the Fc N-glycosylation of IgG, assessing a total of 154 unique lot numbers of IVIg. Seven products showed comparable Fc N-glycosylation, with only one product differing from the others in all glycosylation features (galactosylation, sialylation, fucosylation and bisecting N-acetylglucosamine. However, the mean difference did not exceed 3%. Within product variation was present to a minor degree, but largely indistinguishable from analytical variation. In conclusion, we expect that the minor variation in Fc N-glycosylation between IVIg products has a small effect, if any, on the biological activity.

  13. Comparison of Fc N-Glycosylation of Pharmaceutical Products of Intravenous Immunoglobulin G

    Science.gov (United States)

    Santbergen, Tom C. M.; Huizinga, Ruth; Wuhrer, Manfred; Jacobs, Bart C.

    2015-01-01

    Intravenous immunoglobulin (IVIg) products from different pharmaceutical companies vary in composition, in part because of the selected blood donors and production process. N-glycosylation of the Fc-portion of IgG varies between blood donors and may influence both the side-effects and therapeutic effectiveness of IVIg. At present, the variation in Fc N-glycosylation between IVIg products has not been defined. Utilizing mass spectrometry, we performed relative quantitation of the Fc N-glycosylation of IgG, assessing a total of 154 unique lot numbers of IVIg. Seven products showed comparable Fc N-glycosylation, with only one product differing from the others in all glycosylation features (galactosylation, sialylation, fucosylation and bisecting N-acetylglucosamine). However, the mean difference did not exceed 3%. Within product variation was present to a minor degree, but largely indistinguishable from analytical variation. In conclusion, we expect that the minor variation in Fc N-glycosylation between IVIg products has a small effect, if any, on the biological activity. PMID:26457892

  14. Systemic inflammation modulates Fc receptor expression on microglia during chronic neurodegeneration.

    Science.gov (United States)

    Lunnon, Katie; Teeling, Jessica L; Tutt, Alison L; Cragg, Mark S; Glennie, Martin J; Perry, V Hugh

    2011-06-15

    Chronic neurodegeneration is a major worldwide health problem, and it has been suggested that systemic inflammation can accelerate the onset and progression of clinical symptoms. A possible explanation is that systemic inflammation "switches" the phenotype of microglia from a relatively benign to a highly aggressive and tissue-damaging phenotype. The current study investigated the molecular mechanism underlying this microglia phenotype "switching." We show in mice with chronic neurodegeneration (ME7 prion model) that there is increased expression of receptors that have a key role in macrophage activation and associated signaling pathways, including TREM-2, Siglec-F, CD200R, and FcγRs. Systemic inflammation induced by LPS further increased protein levels of the activating FcγRIII and FcγRIV, but not of other microglial receptors, including the inhibitory FcγRII. In addition to these changes in receptor expression, IgG levels in the brain parenchyma were increased during chronic neurodegeneration, and these IgG levels further increased after systemic inflammation. γ-Chain-deficient mice show modified proinflammatory cytokine expression in the brain after systemic inflammation. We conclude that systemic inflammation during chronic neurodegeneration increases the expression levels of activating FcγR on microglia and thereby lowers the signaling threshold for Ab-mediated cell activation. At the same time, IgG influx into the brain could provide a cross-linking ligand resulting in excessive microglia activation that is detrimental to neurons already under threat by misfolded protein.

  15. Bacteria and viruses modulate FcεRI-dependent mast cell activity 

    Directory of Open Access Journals (Sweden)

    Aleksandra Słodka

    2013-03-01

    Full Text Available Undoubtedly, mast cells play a central role in allergic processes. Specific allergen cross-linking of IgE bound to the high affinity receptors (FcεRI on the mast cell surface leads to the release of preformed mediators and newly synthesized mediators, i.e. metabolites of arachidonic acid and cytokines. More and more data indicate that bacteria and viruses can influence FcεRI-dependent mast cell activation. Some bacterial and viral components can reduce the surface expression of FcεRI. There are also findings that ligation of Toll-like receptors (TLRs by bacterial or viral antigens can affect IgE-dependent mast cell degranulation and preformed mediator release as well as eicosanoid production. The synergistic interaction of TLR ligands and allergen can also modify cytokine synthesis by mast cells stimulated via FcεRI. Moreover, data suggest that specific IgE for bacterial or viral antigens can influence mast cell activity. What is more, some bacterial and viral components or some endogenous proteins produced during viral infection can act as superantigens by interacting with the VH3 domain of IgE. All these observations indicate that bacterial and viral infections modify the course of allergic diseases by affecting FcεRI-dependent mast cell activation. 

  16. Fc-Binding Ligands of Immunoglobulin G: An Overview of High Affinity Proteins and Peptides

    Directory of Open Access Journals (Sweden)

    Weonu Choe

    2016-12-01

    Full Text Available The rapidly increasing application of antibodies has inspired the development of several novel methods to isolate and target antibodies using smart biomaterials that mimic the binding of Fc-receptors to antibodies. The Fc-binding domain of antibodies is the primary binding site for e.g., effector proteins and secondary antibodies, whereas antigens bind to the Fab region. Protein A, G, and L, surface proteins expressed by pathogenic bacteria, are well known to bind immunoglobulin and have been widely exploited in antibody purification strategies. Several difficulties are encountered when bacterial proteins are used in antibody research and application. One of the major obstacles hampering the use of bacterial proteins is sample contamination with trace amounts of these proteins, which can invoke an immune response in the host. Many research groups actively develop synthetic ligands that are able to selectively and strongly bind to antibodies. Among the reported ligands, peptides that bind to the Fc-domain of antibodies are attractive tools in antibody research. Besides their use as high affinity ligands in antibody purification chromatography, Fc-binding peptides are applied e.g., to localize antibodies on nanomaterials and to increase the half-life of proteins in serum. In this review, recent developments of Fc-binding peptides are presented and their binding characteristics and diverse applications are discussed.

  17. [In vivo effect of recombined IL-15/Fc fusion protein on EAU].

    Science.gov (United States)

    Xia, Zong-jing; Kong, Xiang-li; Zhang, Ping

    2008-11-01

    To test the effect of recombined IL-15/Fc on experimental autoimmune uveitis (EAU) in mice. EAU were induced in C57 mice by transferring activated T cells specific to the interphotoreceptor-binding protein (IRBP) 1-20 peptide. The mice were then treated with recombine IL-15/Fc fusion protein or IgG as controls. The severity of EAU were graded on a scale of 0 to 4 with half-point increment based on the type, number, and size of the lesions detected by funduscopic and HE staining. The IRBP1-20 sensitive CD8+T cells were isolated from the IRBP1-20 immune mice with auto-MACS. The in vitro effect of IL-15/Fc fusion protein on the proliferation, differentiation, expansion and production of inflammatory cytokines of the purified IRBP1-20 sensitive CD8+T cells were analyzed with 3HTdR, FACS and ELISA. IL-15/Fc fusion protein inhibited the activation, proliferation, expansion and production of inflammatory cytokines of the IRBP1-20 specific CD8+T cells, down regulated CD44(high)CD62L(low) effect and CD8+ CD62L(low) activated T cell subsets, and consequently decreased the severity of EAU. IL-15/Fc fusion proteins decrease the severity of EAU through inhibiting the proliferation, expansion, differentiation and production of inflammatory cytokines of CD8+ T cells.

  18. Intravenous immunoglobulin ameliorates ITP via activating Fc gamma receptors on dendritic cells.

    Science.gov (United States)

    Siragam, Vinayakumar; Crow, Andrew R; Brinc, Davor; Song, Seng; Freedman, John; Lazarus, Alan H

    2006-06-01

    Despite a more than 20-year experience of therapeutic benefit, the relevant molecular and cellular targets of intravenous immunoglobulin (IVIg) in autoimmune disease remain unclear. Contrary to the prevailing theories of IVIg action in autoimmunity, we show that IVIg drives signaling through activating Fc gamma receptors (Fc gammaR) in the amelioration of mouse immune thrombocytopenic purpura (ITP). The actual administration of IVIg was unnecessary because as few as 10(5) IVIg-treated cells could, upon adoptive transfer, ameliorate ITP. IVIg did not interact with the inhibitory Fc gammaRIIB on the initiator cell, although Fc gammaRIIB does have a role in the late phase of IVIg action. Notably, only IVIg-treated CD11c+ dendritic cells could mediate these effects. We hypothesize that IVIg forms soluble immune complexes in vivo that prime dendritic-cell regulatory activity. In conclusion, the clinical effects of IVIg in ameliorating ITP seem to involve the acute interaction of IVIg with activating Fc gammaR on dendritic cells.

  19. CONSTRUCTION, EXPRESSION AND BIOLOGICAL ASSESSMENT OF BPI23-Fcγ 1 RECOMBINANT PROTEIN PROKARYOTIC EXPRESSION VECTOR

    Institute of Scientific and Technical Information of China (English)

    安云庆; 管远志; 柯岩; 杨贵贞

    2002-01-01

    Objective. To construct pBV-BPI600-Fcγ 1700 recombinant expression vector, to transform it into Escherichia coli DH5α , and to induce the expression of BPI23-Fcγ 1 anti-bacterial recombinant protein. Methods. Genes coding for BPI23 and Fcγ 1 were amplified by RT-PCR from mRNA extracted from HL-60 cell and normal human leukocytes; recombinant cloning vector and recombinant expression vector were then constructed. pBV-BPI600-Fcγ 1700 recombinant expression vector was transformed into the competent Escherichia coli DH5α and BPI23-Fcγ 1 recombinant protein was expressed by a temperature-induced method. Results. (1) Expected amplified products BPI600bp and Fcγ 1700bp were obtained by RT-PCR method. (2) pUC18-BPI180, pUC18-BPI420 and pUC18-Fcγ 1700 recombinant cloning vectors were successfully constructed, and sequences were identical with the reported ones. (3) pBV-BPI600-Fcγ 1700 recombinant expression vector was successfully constructed, and the enzyme digestion analysis showed an expected result. (4) The expression level of BPI23-Fcγ 1 recombinant protein accounted for 20% of total bacterial proteins. (5) The renatured BPI23-Fcγ 1 recombinant protein showed bacteriocidal activity and biological function of complement fixation, and opsonization. Conclusion. pBV-BPI600-Fcγ 1700 recombinant expression vector was successfully constructed, and BPI23-Fcγ 1 recombinant protein with double biological activity of BPI and IgGFc was expressed in Escherichia coli.

  20. CONSTRUCTION,EXPRESSION AND BIOLOGICAL ASSESSMENT OF BPI23—Fcγ1 RECOMBINANT PROTEIN PROKARYOTIC EXPRESSION VECTOR

    Institute of Scientific and Technical Information of China (English)

    安云庆; 管远志; 等

    2002-01-01

    Objective:To construct pBV-BPI600-Fcγ1700 recombinant expression vector,to transform it into Escherichia coli DH5α,and to induce the expression of BPI23-Fcγ1 anti-bacterial recombinant protein.Methods:Genes coding for BPI23 and Fcγ1 were amplified by RT-PCR from mRNA extracted from Hl-60 cell and normal human leukocytes;recombinant cloning vector and recombinant expression vector were then constructed.pBV-BPI600-Fcγ1700 recombinant expression vector was transformed into the competent Escherichia coli DH5α and BPI23-Fcγ1 recombinant protein was expressed by a temperature-induced method.Results:(1)Expected amplified products BPI600bp and Fcγ1700bp were obtained by RT-PCR method.(2)pUC18-BPI180,pUC18-BPI420 and pUC18-Fcγ1700 recombinant cloning vectors were successfully constructed, and sequences were identical with the reported ones.(3)pBV-BPI600-Fcγ1700 recombinant expression vector was successfully constructed,and the enzyme digestion analysis showed an expected result.(4)The expression level of BPI23-Fcγ1 recombinant protein accounted for 20% of total bacterial proteins.(5)The renatured BPI23-Fcγ1 recombinant protein showed bacteriocidal activity and biological function of complement fixation,and opsonization.Conclusion:pBV-BPI600-Fcγ1700 recombinant expression vector was successfully constructed,and BPI23-Fcγ1 recombinant protein with double biological activity of BPI and IgGFc was expressed in Escherichia coli.

  1. Fractionation of rat IgG subclasses and screening for IgG Fc-binding to bacteria.

    Science.gov (United States)

    Nilsson, R; Myhre, E; Kronvall, G; Sjögren, H O

    1982-01-01

    The four IgG subclasses of the rat, IgGl, IgG2a, IgG2b and IgG2c, were purified from normal serum by a combination of protein A-affinity chromatography and DEAE-cellulose chromatography. Purified, radiolabelled preparations of IgG were tested for binding to Gram-positive bacteria representing five different Fc-receptor (FcR) types. Distinct rat subclass-specific Fc-binding was noted to bacterial species belonging to different Fc-receptor types. Staphylococcus aureus (FcR I) strains bind IgGl and IgG2c as shown by others. Group C and G Streptococci (FcR III) bind all four subclasses of rat IgG. Streptococcus zooepidemicus strains (FcR V) also bind all four subclases but only to a lower degree. Human group A Streptococci (FcR II) and bovine group G Streptococci (FcR IV) do not bind any of the rat IgG subclasses. Elution studies on two strains. Staphylococcus aureus, Cowan I, and human group G Streptococcus, G 148, showed that both thiocyanate and pH-elution might be useful for the fractionation of IgG subclasses bound to bacterial cells. The present work indicates the possible use of bacterial cells as solid-phase absorbents in immunological studies of rat IgG.

  2. Maximal elements and generalized games involving condensing mappings in locally FC-uniform spaces and applications (Ⅰ)

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    First, the notions of the measure of noncompactness and condensing setvalued mappings are introduced in locally FC-uniform spaces without convexity structure. A new existence theorem of maximal elements of a family of set-valued mappings involving condensing mappings is proved in locally FC-uniform spaces. As applications,some new equilibrium existence theorems of generalized game involving condensing mappings are established in locally FC-uniform spaces. These results improve and generalize some known results in literature to locally FC-uniform spaces. Some further applications of our results to the systems of generalized vector quasi-equilibrium problems will be given in a follow-up paper.

  3. Structural basis for pH-insensitive inhibition of immunoglobulin G recycling by an anti-neonatal Fc receptor antibody.

    Science.gov (United States)

    Kenniston, Jon A; Taylor, Brandy M; Conley, Gregory P; Cosic, Janja; Kopacz, Kris J; Lindberg, Allison P; Comeau, Stephen R; Atkins, Kateri; Bullen, Jameson; TenHoor, Christopher; Adelman, Burt A; Sexton, Daniel J; Edwards, Thomas E; Nixon, Andrew E

    2017-09-06

    The neonatal Fc receptor FcRn plays a critical role in the trafficking of immunoglobulins (IgGs) across tissue barriers and in retaining high circulating concentrations of both IgG and albumin. Although generally beneficial in maintaining IgG populations from an immunological perspective, FcRn can contribute to the pathogenesis of autoimmune disorders when an abnormal immune response targets normal biological components. We previously described a monoclonal antibody (DX-2507) that binds to FcRn with high affinity at neutral and acidic pH, prevents the simultaneous binding of IgG, and reduces circulating IgG levels in preclinical animal models. Here, we show the a 2.5 Å x-ray crystal structure of an FcRn:DX-2507 Fab complex, revealing a near complete overlap of the IgG Fc-binding site in FcRn by DX-2507 Fab CDR regions. This overlap explains how DX-2507 blocks IgG binding to FcRn and consequently shortens IgG half-life by preventing them from recycling back into circulation. Additionally, the complex structure explains how the DX-2507 interaction is pH-insensitive unlike normal Fc-interactions and how serum albumin levels are unaffected by DX-2507 binding. These studies support a novel therapeutic approach for limiting the effects of antibody-mediated autoimmune disease. Copyright © 2017, The American Society for Biochemistry and Molecular Biology.

  4. Maximal elements and generalized games involving condensing mappings in locally FC-uniform spaces and applications (Ⅱ)

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    This paper is a continuum of the preceding paper of author. Some new systems of generalized vector quasi-equilibrium problems involving condensing mappings are introduced and studied in locally FC-uniform spaces. By applying the existence theorem of maximal elements of condensing set-valued mappings in locally FC-uniform spaces obtained by author in the preceding paper, some new existence theorems of solutions for the systems of generalized vector quasi-equilibrium problems are proved in locally FC-uniform spaces. These results improve and generalize some known results in literature to locally FC-uniform spaces.

  5. Investigating the Interaction between the Neonatal Fc Receptor and Monoclonal Antibody Variants by Hydrogen/Deuterium Exchange Mass Spectrometry

    DEFF Research Database (Denmark)

    Jensen, Pernille Foged; Larraillet, Vincent; Schlothauer, Tilman

    2015-01-01

    that several regions in the IgG Fab region also showed reduced deuterium uptake. Our findings indicate the presence of hitherto unknown FcRn interaction sites in the Fab region or a possible conformational link between the IgG Fc and Fab regions upon FcRn binding. Further, we investigated the role of Ig......-type glycosylated IgG. Our results provide new molecular insight into the IgG-FcRn interaction and illustrate the capability of hydrogen/deuterium exchange mass spectrometry to advance structural proteomics by providing detailed information on the conformation and dynamics of large protein complexes in solution....

  6. Galactosylation of IgG1 modulates FcγRIIB-mediated inhibition of murine autoimmune hemolytic anemia.

    Science.gov (United States)

    Yamada, Kazunori; Ito, Kiyoaki; Furukawa, Jun-Ichi; Nakata, Junichiro; Alvarez, Montserrat; Verbeek, J Sjef; Shinohara, Yasuro; Izui, Shozo

    2013-12-01

    Murine immune effector cells express three different stimulatory FcγRs (FcγRI, FcγRIII and FcγRIV) and one inhibitory receptor, FcγRIIB. Competitive engagement of stimulatory and inhibitory FcγRs has been shown to be critical for the development of immune complex-mediated inflammatory disorders. Because of the previous demonstration that FcγRIIB was unable to inhibit FcγRIII-mediated autoimmune hemolytic anemia induced by 105-2H IgG1 anti-RBC mAb, we reevaluated the regulatory role of FcγRIIB on the development of anemia using two additional IgG1 anti-RBC mAbs (34-3C and 3H5G1) and different 34-3C IgG subclass-switch variants. We were able to induce a more severe anemia in FcγRIIB-deficient mice than in FcγRIIB-sufficient mice after injection of 34-3C and 3H5G1 IgG1, but not 105-2H IgG1. Structural analysis of N-linked oligosaccharides attached to the CH2 domain revealed that 105-2H was poorly galactosylated as compared with the other mAbs, while the extent of sialylation was comparable between all mAbs. In addition, we observed that a more galactosylated 105-2H variant provoked more severe anemia in FcγRIIB-deficient mice than FcγRIIB-sufficient mice. In contrast, the development of anemia induced by three non-IgG1 subclass variants of the 34-3C mAb was not down-regulated by FcγRIIB, although they were more galactosylated than its IgG1 variant. These data indicate that FcγRIIB-mediated inhibition of autoimmune hemolytic anemia is restricted to the IgG1 subclass and that galactosylation, but not sialylation, of IgG1 (but not other IgG subclasses) is critical for the interaction with FcγR, thereby determining the pathogenic potential of IgG1 autoantibodies.

  7. TGEV infection up-regulates FcRn expression via activation of NF-κB signaling.

    Science.gov (United States)

    Guo, Jinyue; Li, Fei; Qian, Shaoju; Bi, Dingren; He, Qigai; Jin, Hui; Luo, Rui; Li, Shaowen; Meng, Xianrong; Li, Zili

    2016-08-24

    It has been well characterized that the neonatal Fc receptor (FcRn) transports maternal IgG to a fetus or newborn and protects IgG from degradation. We previously reported that FcRn is expressed in a model of normal porcine intestinal epithelial cells (IPEC-J2). Transmissible gastroenteritis is an acute enteric disease of swine that is caused by transmissible gastroenteritis virus (TGEV). How porcine FcRn (pFcRn) expression is regulated by pathogenic infection remains unknown. Our research shows that IPEC-J2 cells infected with TGEV had up-regulated pFcRn expression. In addition, the NF-κB signaling pathway was activated in IPEC-J2 cells by TGEV infection. Furthermore, treatment of TGEV-infected IPEC-J2 cells with the NF-κB-specific inhibitor BAY 11-7082 resulted in down-regulation of pFcRn expression. Transient transfection of pFcRn promoter luciferase report plasmids with overexpression of NF-κB p65 transcription factor enhanced the activation of the luciferase report plasmids. We identified four NF-κB transcription factor binding sites in the promoter region of this gene using luciferase reporter system, chromatin immunoprecipitation, electromobility shift assay, and supershift analysis. Together, the data provide the first evidence that TGEV infection up-regulates pFcRn expression via activation of NF-κB signaling.

  8. pH-dependent binding engineering reveals an FcRn affinity threshold that governs IgG recycling.

    Science.gov (United States)

    Borrok, M Jack; Wu, Yanli; Beyaz, Nurten; Yu, Xiang-Qing; Oganesyan, Vaheh; Dall'Acqua, William F; Tsui, Ping

    2015-02-13

    The Fc domain of IgG has been the target of multiple mutational studies aimed at altering the pH-dependent IgG/FcRn interaction to modulate IgG pharmacokinetics. These studies have yielded antibody variants with disparate pharmacokinetic characteristics, ranging from extended in vivo half-life to those exhibiting extremely rapid clearance. To better understand pH-dependent binding parameters that govern these outcomes and limit FcRn-mediated half-life extension, we generated a panel of novel Fc variants with high affinity binding at acidic pH that vary in pH 7.4 affinities and assessed pharmacokinetic outcomes. Pharmacokinetic studies in human FcRn transgenic mice and cynomolgus monkeys showed that multiple variants with increased FcRn affinities at acidic pH exhibited extended serum half-lives relative to the parental IgG. Importantly, the results reveal an underappreciated affinity threshold of neutral pH binding that determines IgG recycling efficiency. Variants with pH 7.4 FcRn affinities below this threshold recycle efficiently and can exhibit increased serum persistence. Increasing neutral pH FcRn affinity beyond this threshold reduced serum persistence by offsetting the benefits of increased pH 6.0 binding. Ultra-high affinity binding to FcRn at both acidic and neutral pH leads to rapid serum clearance.

  9. Mindfulness for group facilitation

    DEFF Research Database (Denmark)

    Adriansen, Hanne Kirstine; Krohn, Simon

    2014-01-01

    In this paper, we argue that mindfulness techniques can be used for enhancing the outcome of group performance. The word mindfulness has different connotations in the academic literature. Broadly speaking there is ‘mindfulness without meditation’ or ‘Western’ mindfulness which involves active...... thinking and ‘Eastern’ mindfulness which refers to an open, accepting state of mind, as intended with Buddhist-inspired techniques such as meditation. In this paper, we are interested in the latter type of mindfulness and demonstrate how Eastern mindfulness techniques can be used as a tool for facilitation....... A brief introduction to the physiology and philosophy of Eastern mindfulness constitutes the basis for the arguments of the effect of mindfulness techniques. The use of mindfulness techniques for group facilitation is novel as it changes the focus from individuals’ mindfulness practice...

  10. Facilitating Knowledge Sharing

    OpenAIRE

    Holdt Christensen, Peter

    2005-01-01

    Abstract This paper argues that knowledge sharing can be conceptualized as different situations of exchange in which individuals relate to each other in different ways, involving different rules, norms and traditions of reciprocity regulating the exchange. The main challenge for facilitating knowledge sharing is to ensure that the exchange is seen as equitable for the parties involved, and by viewing the problems of knowledge sharing as motivational problems situated in different organization...

  11. (Some) cellular mechanisms influencing the transcription of human endogenous retrovirus, HERV-Fc1

    DEFF Research Database (Denmark)

    Laska, Magdalena Janina; Nissen, Kari Konstantin; Nexø, Bjørn Andersen

    2013-01-01

    DNA methylation and histone acetylation are epigenetic modifications that act as regulators of gene expression. DNA methylation is considered an important mechanism for silencing of retroelements in the mammalian genome. However, the methylation of human endogenous retroviruses (HERVs) is not well...... investigated. The aim of this study was to investigate the transcriptional potential of HERV-Fc1 proviral 5'LTR in more detail, and examined the specific influence of CpG methylation on this LTR in number of cell lines. Specifically, the role of demethylating chemicals e.g. 5-aza-2' deoxycytidine...... and Trichostatin-A, in inducing or reactivating expression of HERV-Fc1 specific sequences and the mechanisms were investigated. In our present study, 5-aza-dC is shown to be a powerful inducer of HERV-Fc1, and at the same time it strongly inhibits methylation of DNA. Treatment with this demethylating agent 5-aza...

  12. Retargeting T cells for HER2-positive tumor killing by a bispecific Fv-Fc antibody.

    Directory of Open Access Journals (Sweden)

    Lei Wang

    Full Text Available To exploit the biological and pharmacological properties of immunoglobulin constant domain Fc fragment and increase the killing efficacy of T cells, a single chain variable fragment specific to CD3 was fused with Fcab (Fc antigen binding, a mutant Fc fragment with specificity against Human epidermal growth factor receptor 2 (HER2 developed by F-star. The bispecific fusion named as FcabCD3 was expressed by transient transfection in HEK-293T cells and purified by affinity chromatography. Specific cytolytic activity of retargeted T cells to kill HER2 positive SKBR3 cell line was evaluated in vitro. FcabCD3 was able to retarget T cells to kill both Herceptin insensitive Colo205-luc cell line and HER2 low expression MDA-MB-231-luc cell line. Furthermore, FcabCD3 was effective in eliminating the Colo205 tumor established on BALB/c nu/nu mice.

  13. Human Endogenous Retrovirus HERV-Fc1 Association with Multiple Sclerosis Susceptibility: A Meta-Analysis

    Science.gov (United States)

    García-Montojo, Marta; Alcina, Antonio; Fedetz, María; Alloza, Iraide; Astobiza, Ianire; Leyva, Laura; Fernández, Oscar; Izquierdo, Guillermo; Antigüedad, Alfredo; Arroyo, Rafael; Álvarez-Lafuente, Roberto; Vandenbroeck, Koen; Matesanz, Fuencisla; Urcelay, Elena

    2014-01-01

    Background Human endogenous retroviruses (HERVs) are repetitive sequences derived from ancestral germ-line infections by exogenous retroviruses and different HERV families have been integrated in the genome. HERV-Fc1 in chromosome X has been previously associated with multiple sclerosis (MS) in Northern European populations. Additionally, HERV-Fc1 RNA levels of expression have been found increased in plasma of MS patients with active disease. Considering the North-South latitude gradient in MS prevalence, we aimed to evaluate the role of HERV-Fc1on MS risk in three independent Spanish cohorts. Methods A single nucleotide polymorphism near HERV-Fc1, rs391745, was genotyped by Taqman chemistry in a total of 2473 MS patients and 3031 ethnically matched controls, consecutively recruited from: Northern (569 patients and 980 controls), Central (883 patients and 692 controls) and Southern (1021 patients and 1359 controls) Spain. Our results were pooled in a meta-analysis with previously published data. Results Significant associations of the HERV-Fc1 polymorphism with MS were observed in two Spanish cohorts and the combined meta-analysis with previous data yielded a significant association [rs391745 C-allele carriers: pM-H = 0.0005; ORM-H (95% CI) = 1.27 (1.11–1.45)]. Concordantly to previous findings, when the analysis was restricted to relapsing remitting and secondary progressive MS samples, a slight enhancement in the strength of the association was observed [pM-H = 0.0003, ORM-H (95% CI) = 1.32 (1.14–1.53)]. Conclusion Association of the HERV-Fc1 polymorphism rs391745 with bout-onset MS susceptibility was confirmed in Southern European cohorts. PMID:24594754

  14. Imaging of injured and atherosclerotic arteries in mice using fluorescence-labeled glycoprotein VI-Fc

    Energy Technology Data Exchange (ETDEWEB)

    Bigalke, Boris, E-mail: boris.bigalke@med.uni-tuebingen.de [Medizinische Klinik III, Kardiologie und Kreislauferkrankungen, Eberhard-Karls-Universitaet Tuebingen (Germany); Division of Imaging Sciences, St Thomas' Hospital, King' s College London (United Kingdom); Pohlmeyer, Ilka; Schoenberger, Tanja [Medizinische Klinik III, Kardiologie und Kreislauferkrankungen, Eberhard-Karls-Universitaet Tuebingen (Germany); Griessinger, Christoph M. [Labor fuer Praeklinische Bildgebung und Bildgebungstechnologie der Werner-Siemens-Stiftung, Radiologische Klinik, Eberhard-Karls-Universitaet Tuebingen (Germany); Ungerer, Martin [Corimmun GmbH, Martinsried (Germany); Botnar, Rene M. [Division of Imaging Sciences, St Thomas' Hospital, King' s College London (United Kingdom); Pichler, Bernd J. [Labor fuer Praeklinische Bildgebung und Bildgebungstechnologie der Werner-Siemens-Stiftung, Radiologische Klinik, Eberhard-Karls-Universitaet Tuebingen (Germany); Gawaz, Meinrad [Medizinische Klinik III, Kardiologie und Kreislauferkrankungen, Eberhard-Karls-Universitaet Tuebingen (Germany)

    2011-08-15

    Purpose: To assess endothelial injury and repair using fluorescence-labeled glycoprotein VI (GPVI)-Fc in a murine model. Materials and methods: Three 4-week-old male ApoE-deficient (ApoE{sup -/-})-mice were fed with a 1.25% cholesterol diet over 16 weeks and compared to three wild type (WT) C57BL/6J-mice in a wire-induced vascular injury model. Another group of WT mice (n = 10) were mechanically injured by carotid ligation. Fluorescence-labeled GPVI-Fc (150 {mu}g/mouse) was administered and assessed by optical imaging 24 h after injury and compared to another group (n = 3) which was injected two days after injury and sacrificed another day later. Results: After denudation, all injured carotids of WT mice showed a higher mean fluorescence signal than the corresponding intact carotids of the same animals (48.4 {+-} 18.9 vs. 10.4 {+-} 1.0; P = 0.028). Injection of unlabeled GPVI-Fc 20 h and 3 h before injecting GPVI-Fc-FITC significantly reduced the fluorescence signal in injured carotids to 14.6 {+-} 4.6, while intact carotids showed a signal of 9.2 {+-} 1.1; P = 0.046. Ligation injury resulted with an increased GPVI-Fc-binding to injured carotids compared to intact carotids (31.53 {+-} 6.18 vs. 16.48 {+-} 5.15; P = 0.039). Three days after injury and 24 h after GPVI-Fc-FITC injection, differences between intact and injured carotids have vanished (12.51 {+-} 2.76 vs. 14.76 {+-} 1.59; P = 0.519). Conclusions: A GPVI-based plaque imaging system could help to identify vascular lesions and to take a precautionary measure as necessary.

  15. Human endogenous retrovirus HERV-Fc1 association with multiple sclerosis susceptibility: a meta-analysis.

    Directory of Open Access Journals (Sweden)

    Belén de la Hera

    Full Text Available BACKGROUND: Human endogenous retroviruses (HERVs are repetitive sequences derived from ancestral germ-line infections by exogenous retroviruses and different HERV families have been integrated in the genome. HERV-Fc1 in chromosome X has been previously associated with multiple sclerosis (MS in Northern European populations. Additionally, HERV-Fc1 RNA levels of expression have been found increased in plasma of MS patients with active disease. Considering the North-South latitude gradient in MS prevalence, we aimed to evaluate the role of HERV-Fc1on MS risk in three independent Spanish cohorts. METHODS: A single nucleotide polymorphism near HERV-Fc1, rs391745, was genotyped by Taqman chemistry in a total of 2473 MS patients and 3031 ethnically matched controls, consecutively recruited from: Northern (569 patients and 980 controls, Central (883 patients and 692 controls and Southern (1021 patients and 1359 controls Spain. Our results were pooled in a meta-analysis with previously published data. RESULTS: Significant associations of the HERV-Fc1 polymorphism with MS were observed in two Spanish cohorts and the combined meta-analysis with previous data yielded a significant association [rs391745 C-allele carriers: pM-H = 0.0005; ORM-H (95% CI = 1.27 (1.11-1.45]. Concordantly to previous findings, when the analysis was restricted to relapsing remitting and secondary progressive MS samples, a slight enhancement in the strength of the association was observed [pM-H = 0.0003, ORM-H (95% CI = 1.32 (1.14-1.53]. CONCLUSION: Association of the HERV-Fc1 polymorphism rs391745 with bout-onset MS susceptibility was confirmed in Southern European cohorts.

  16. Fc gamma receptor CD64 modulates the inhibitory activity of infliximab.

    Directory of Open Access Journals (Sweden)

    Kacper A Wojtal

    Full Text Available BACKGROUND: Tumor necrosis factor (TNF is an important cytokine in the pathogenesis of inflammatory bowel disease (IBD. Anti-TNF antibodies have been successfully implemented in IBD therapy, however their efficacies differ among IBD patients. Here we investigate the influence of CD64 Fc receptor on the inhibitory activity of anti-TNFs in cells of intestinal wall. METHODS: Intestinal cell lines, monocytes/macrophages and peripheral blood mononuclear cells (PBMCs were used as models. The efficacies of adalimumab, infliximab and certolizumab-pegol were assessed by RT-PCR for target genes. Protein levels and localizations were examined by Western blotting and immunofluorescence. Antibody fragments were obtained by proteolytic digestion, immunoprecipitation and protein chip analysis. Knock-down of specific gene expression was performed using siRNAs. RESULTS: Infliximab had limited efficacy towards soluble TNF in cell types expressing Fc gamma receptor CD64. Both adalimumab and infliximab had lower efficacies in PBMCs of IBD patients, which express elevated levels of CD64. Infliximab-TNF complexes were more potent in activating CD64 in THP-1 cells than adalimumab, which was accompanied by distinct phospho-tyrosine signals. Blocking Fc parts and isolation of Fab fragments of infliximab improved its efficacy. IFN-γ-induced expression of CD64 correlated with a loss of efficacy of infliximab, whereas reduction of CD64 expression by either siRNA or PMA treatment improved inhibitory activity of this drug. Colonic mRNA expression levels of CD64 and other Fc gamma receptors were significantly increased in the inflamed tissues of infliximab non-responders. CONCLUSIONS: CD64 modulates the efficacy of infliximab both in vitro and ex vivo, whereas the presence of this receptor has no impact on the inhibitory activity of certolizumab-pegol, which lacks Fc fragment. These data could be helpful in both predicting and evaluating the outcome of anti-TNF therapy in

  17. KKM type theorem in FC-space and its applications%FC-空间内的KKM型定理及应用

    Institute of Scientific and Technical Information of China (English)

    江慎铭; 邹群

    2007-01-01

    在不具有任何凸性结构和线性结构的有限连续空间(简称FC-空间)巾给出了KKM型定理.并应用此定理,在很弱的条件下证明了鞍点定理和Walras型定理,推广了近期文献中的一些相关的结果.

  18. Second Language Exposure, Functional Communication, and Executive Function in Children with and without Autism Spectrum Disorder (ADS)

    Science.gov (United States)

    Iarocci, Grace; Hutchison, Sarah M.; O'Toole, Gillian

    2017-01-01

    Parents and professionals are concerned that second language exposure may delay communication in children with ASD. In this study 174 youth (6-16 years) with and without ASD, exposed to a second language, were compared on executive function (EF) and functional communication (FC) with their peers without exposure. There were no significant…

  19. Multiple Plasmodium falciparum Erythrocyte Membrane Protein 1 Variants per Genome Can Bind IgM via Its Fc Fragment Fcμ

    DEFF Research Database (Denmark)

    Jeppesen, Anine; Ditlev, Sisse Bolm; Soroka, Vladyslav;

    2015-01-01

    The Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) adhesive proteins expressed on the surfaces of infected erythrocytes (IEs) are of key importance in the pathogenesis of P. falciparum malaria. Several structurally and functionally defined PfEMP1 types have been associated...... with severe clinical manifestations, such as cerebral malaria in children and placental malaria in pregnant women. PfEMP1 that can bind the Fc part of IgM (Fcμ) characterizes one such type, although the functional significance of this IgM binding to PfEMP1 remains unclear. In this study, we report...... the identification and functional analysis of five IgM-binding PfEMP1 proteins encoded by P. falciparum NF54. In addition to the VAR2CSA-type PFL0030c protein, already known to bind Fcμ and to mediate chondroitin sulfate A (CSA)-specific adhesion of IEs in the placenta, we found four PfEMP1 proteins not previously...

  20. Multiple Plasmodium falciparum erythrocyte membrane protein 1 variants per genome can bind IgM via its Fc fragment Fcμ

    DEFF Research Database (Denmark)

    Jeppesen, Anine; Ditlev, Sisse Bolm; Soroka, Vladyslav;

    2015-01-01

    The Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) adhesive proteins expressed on the surfaces of infected erythrocytes (IEs) are of key importance in the pathogenesis of P. falciparum malaria. Several structurally and functionally defined PfEMP1 types have been associated...... with severe clinical manifestations, such as cerebral malaria in children and placental malaria in pregnant women. PfEMP1 that can bind the Fc part of IgM (Fcμ) characterizes one such type, although the functional significance of this IgM binding to PfEMP1 remains unclear. In this study, we report...... the identification and functional analysis of five IgM-binding PfEMP1 proteins encoded by P. falciparum NF54. In addition to the VAR2CSA-type PFL0030c protein, already known to bind Fcμ and to mediate chondroitin sulfate A (CSA)-specific adhesion of IEs in the placenta, we found four PfEMP1 proteins not previously...

  1. Novel human IgG1 and IgG4 Fc-engineered antibodies with completely abolished immune effector functions.

    Science.gov (United States)

    Schlothauer, Tilman; Herter, Sylvia; Koller, Claudia Ferrara; Grau-Richards, Sandra; Steinhart, Virginie; Spick, Christian; Kubbies, Manfred; Klein, Christian; Umaña, Pablo; Mössner, Ekkehard

    2016-10-01

    Recombinant human IgG antibodies (hIgGs) completely devoid of binding to Fcγ receptors (FcγRs) and complement protein C1q, and thus with abolished immune effector functions, are of use for various therapeutic applications in order to reduce FcγR activation and Fc-mediated toxicity. Fc engineering approaches described to date only partially achieve this goal or employ a large number of mutations, which may increase the risk of anti-drug antibody generation. We describe here two new, engineered hIgG Fc domains, hIgG1-P329G LALA and hIgG4-P329G SPLE, with completely abolished FcγR and C1q interactions, containing a limited number of mutations and with unaffected FcRn interactions and Fc stability. Both 'effector-silent' Fc variants are based on a novel Fc mutation, P329G that disrupts the formation of a proline sandwich motif with the FcγRs. As this motif is present in the interface of all IgG Fc/FcγR complexes, its disruption can be applied to all human and most of the other mammalian IgG subclasses in order to create effector silent IgG molecules.

  2. Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.

    Science.gov (United States)

    Konduru, Krishnamurthy; Shurtleff, Amy C; Bradfute, Steven B; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo

    2016-01-01

    Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support

  3. Human epidermal Langerhans cells express the high affinity receptor for immunoglobulin E (Fc epsilon RI)

    OpenAIRE

    1992-01-01

    It has been suggested that epidermal Langerhans cells (LC) bearing immunoglobulin E (IgE) may be involved in the genesis of atopic disease. The identity of the IgE receptor(s) on LC remained unclear, although it represents a crucial point in understanding cellular events linked to the binding of allergens to LC via IgE. In this report, we demonstrate that epidermal LC express the high affinity receptor for the Fc fragment of IgE (Fc epsilon RI) which has, so far, only been described on mast c...

  4. Fc receptors do not mediate African swine fever virus replication in macrophages

    Energy Technology Data Exchange (ETDEWEB)

    Alcami, A.; Vinuela, E. (Centro de Biologia Molecular, Universidad Autonoma, Madrid (Spain))

    1991-04-01

    Titration experiments in swine macrophages have shown that African swine fever virus infectivity was not enhanced in the presence of antiviral antibodies. The early viral protein synthesis and the viral DNA replication in swine macrophages infected with virus-antibody complexes were inhibited in the presence of high doses of uv-inactivated virus, which saturated specific virus receptors, but not when Fc receptors were saturated with antibodies. These results indicate that African swine fever virus does not infect swine macrophages through Fc receptors and that the normal entry pathway through virus receptors is not bypassed by the virus-antibody complexes.

  5. Activatory and inhibitory Fcγ receptors augment rituximab-mediated internalization of CD20 independent of signaling via the cytoplasmic domain.

    Science.gov (United States)

    Vaughan, Andrew T; Chan, Claude H T; Klein, Christian; Glennie, Martin J; Beers, Stephen A; Cragg, Mark S

    2015-02-27

    Type I anti-CD20 mAb such as rituximab and ofatumumab engage with the inhibitory FcγR, FcγRIIb on the surface of B cells, resulting in immunoreceptor tyrosine-based inhibitory motif (ITIM) phosphorylation. Internalization of the CD20·mAb·FcγRIIb complex follows, the rate of which correlates with FcγRIIb expression. In contrast, although type II anti-CD20 mAb such as tositumomab and obinutuzumab also interact with and activate FcγRIIb, this interaction fails to augment the rate of CD20·mAb internalization, raising the question of whether ITIM phosphorylation plays any role in this process. We have assessed the molecular requirements for the internalization process and demonstrate that in contrast to internalization of IgG immune complexes, FcγRIIb-augmented internalization of rituximab-ligated CD20 occurs independently of the FcγRIIb ITIM, indicating that signaling downstream of FcγRIIb is not required. In transfected cells, activatory FcγRI, FcγRIIa, and FcγRIIIa augmented internalization of rituximab-ligated CD20 in a similar manner. However, FcγRIIa mediated a slower rate of internalization than cells expressing equivalent levels of the highly homologous FcγRIIb. The difference was maintained in cells expressing FcγRIIa and FcγRIIb lacking cytoplasmic domains and in which the transmembrane domains had been exchanged. This difference may be due to increased degradation of FcγRIIa, which traffics to lysosomes independently of rituximab. We conclude that the cytoplasmic domain of FcγR is not required for promoting internalization of rituximab-ligated CD20. Instead, we propose that FcγR provides a structural role in augmenting endocytosis that differs from that employed during the endocytosis of immune complexes.

  6. Detection of EPO-Fc fusion protein in human blood: screening and confirmation protocols for sports drug testing.

    Science.gov (United States)

    Reichel, Christian; Thevis, Mario

    2012-11-01

    The neonatal Fc receptor (FcRn) has been under investigation for several years as a pharmaceutical drug target. Clinical studies have shown that fusion proteins consisting of human recombinant erythropoietin (rhEPO) and the Fc-part of IgG can be transported after pulmonary administration via FcRn across the airway epithelium to the blood stream. So far, no clinically approved pharmaceutical formulation of EPO-Fc is available. Since various forms of recombinant erythropoietins have been frequently misused by athletes as performance-enhancing agents, EPO-Fc might play a similar role in sports in the future. In order to investigate the detectability of EPO-Fc in human blood, different strategies were tested and developed. Only two of them fulfilled the necessary requirements regarding sensitivity and specificity. A rapid protocol useful for screening purposes first enriches EPO-Fc from human serum via high capacity protein A beads and subsequently detects EPO-Fc in the eluate with a commercial EPO ELISA kit. The limit of detection (LOD) of the method is about 5 pg (45 amol) EPO-Fc and is independent of the serum volume used. For screening and/or confirmation purposes a second protocol was evaluated, which consists of a fast EPO immunopurification step followed by sodium dodecyl sulfate or sarcosyl polyacrylamide gel electrophoresis (SDS-PAGE, SAR-PAGE) and Western double-blotting with chemiluminescence detection - a method already established in routine EPO anti-doping control. The latter strategy allows the detection of EPO-Fc in serum together with all other recombinant erythropoietins and with an identical LOD (5 pg/45 amol) as for the rapid screening protocol.

  7. Facilitative root interactions in intercrops

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Jensen, E.S.

    2005-01-01

    Facilitation takes place when plants ameliorate the environment of their neighbours, and increase their growth and survival. Facilitation occurs in natural ecosystems as well as in agroecosystems. We discuss examples of facilitative root interactions in intercropped agroecosystems; including...... intensified cropping systems using chemical and mechanical inputs also show that facilitative interactions definitely can be of significance. It is concluded that a better understanding of the mechanisms behind facilitative interactions may allow us to benefit more from these phenomena in agriculture...

  8. Facilitation as a teaching strategy : experiences of facilitators

    Directory of Open Access Journals (Sweden)

    E Lekalakala-Mokgele

    2006-09-01

    Full Text Available Changes in nursing education involve the move from traditional teaching approaches that are teacher-centred to facilitation, a student centred approach. The studentcentred approach is based on a philosophy of teaching and learning that puts the learner on centre-stage. The aim of this study was to identify the challenges of facilitators of learning using facilitation as a teaching method and recommend strategies for their (facilitators development and support. A qualitative, explorative and contextual design was used. Four (4 universities in South Africa which utilize facilitation as a teaching/ learning process were identified and the facilitators were selected to be the sample of the study. The main question posed during in-depth group interviews was: How do you experience facilitation as a teaching/learning method?. Facilitators indicated different experiences and emotions when they first had to facilitate learning. All of them indicated that it was difficult to facilitate at the beginning as they were trained to lecture and that no format for facilitation was available. They experienced frustrations and anxieties as a result. The lack of knowledge of facilitation instilled fear in them. However they indicated that facilitation had many benefits for them and for the students. Amongst the ones mentioned were personal and professional growth. Challenges mentioned were the fear that they waste time and that they do not cover the content. It is therefore important that facilitation be included in the training of nurse educators.

  9. Essence: Facilitating Software Innovation

    DEFF Research Database (Denmark)

    Aaen, Ivan

    2008-01-01

      This paper suggests ways to facilitate creativity and innovation in software development. The paper applies four perspectives – Product, Project, Process, and People –to identify an outlook for software innovation. The paper then describes a new facility–Software Innovation Research Lab (SIRL......) – and a new method concept for software innovation – Essence – based on views, modes, and team roles. Finally, the paper reports from an early experiment using SIRL and Essence and identifies further research....

  10. Satellite Communication.

    Science.gov (United States)

    Technology Teacher, 1985

    1985-01-01

    Presents a discussion of communication satellites: explains the principles of satellite communication, describes examples of how governments and industries are currently applying communication satellites, analyzes issues confronting satellite communication, links mathematics and science to the study of satellite communication, and applies…

  11. Integrating Computer-Mediated Communication Strategy Instruction

    Science.gov (United States)

    McNeil, Levi

    2016-01-01

    Communication strategies (CSs) play important roles in resolving problematic second language interaction and facilitating language learning. While studies in face-to-face contexts demonstrate the benefits of communication strategy instruction (CSI), there have been few attempts to integrate computer-mediated communication and CSI. The study…

  12. Inhibition of murine fibrocyte differentiation by cross-linked IgG is dependent on FcγRI.

    Science.gov (United States)

    Pilling, Darrell; Crawford, Jeffrey R; Verbeek, J Sjef; Gomer, Richard H

    2014-08-01

    Monocyte-derived, fibroblast-like cells, called fibrocytes, participate in wound-healing and the formation of fibrotic lesions. Aggregated or cross-linked IgG are key effectors in infections, autoimmune diseases, anaphylaxis, and immunotherapy. Cells, including monocytes and fibrocytes, bind IgG using FcγRs, and aggregated or cross-linked IgG inhibits fibrocyte differentiation. Mice have four different FcγRs, and which of these, if any, mediate the cross-linked IgG effect on fibrocyte differentiation is unknown. We find that in mice, deletion of FcγRI or the common signaling protein FcRγ significantly reduces the ability of cross-linked IgG or IgG2a to inhibit fibrocyte differentiation. Cells from FcγRIIb/III/IV KO mice are still sensitive to cross-linked IgG, whereas cells from FcγRI/IIb/III/IV KO mice are insensitive to cross-linked IgG. These observations suggest that IgG-mediated inhibition of fibrocyte differentiation is mediated by FcγRs, with FcγRI mediating most of the signaling.

  13. A cautionary note on the use of split-YFP/BiFC in plant protein-protein interaction studies.

    Science.gov (United States)

    Horstman, Anneke; Tonaco, Isabella Antonia Nougalli; Boutilier, Kim; Immink, Richard G H

    2014-05-30

    Since its introduction in plants 10 years ago, the bimolecular fluorescence complementation (BiFC) method, or split-YFP (yellow fluorescent protein), has gained popularity within the plant biology field as a method to study protein-protein interactions. BiFC is based on the restoration of fluorescence after the two non-fluorescent halves of a fluorescent protein are brought together by a protein-protein interaction event. The major drawback of BiFC is that the fluorescent protein halves are prone to self-assembly independent of a protein-protein interaction event. To circumvent this problem, several modifications of the technique have been suggested, but these modifications have not lead to improvements in plant BiFC protocols. Therefore, it remains crucial to include appropriate internal controls. Our literature survey of recent BiFC studies in plants shows that most studies use inappropriate controls, and a qualitative rather than quantitative read-out of fluorescence. Therefore, we provide a cautionary note and beginner's guideline for the setup of BiFC experiments, discussing each step of the protocol, including vector choice, plant expression systems, negative controls, and signal detection. In addition, we present our experience with BiFC with respect to self-assembly, peptide linkers, and incubation temperature. With this note, we aim to provide a guideline that will improve the quality of plant BiFC experiments.

  14. Evaluation of FcεRl-binding serum IgE in patients with ocular allergic diseases

    Directory of Open Access Journals (Sweden)

    Satoru Matsumoto

    1999-01-01

    Full Text Available We evaluated high-affinity receptor for IgE (FcεRI- binding serum IgE in patients with atopic keratoconjunctivitis (AKC; n=31 and with seasonal allergic conjunctivitis (SAC; n=13 by enzyme-linked immunosorbent assay (ELISA using a recombinant soluble form of the human FcεRIα ectodomain (soluble α. The quantities of FcεRI-binding IgE are compared with those of total IgE measured by a conventional sandwich ELISA. Both of the quantities of FcεRI-binding and total IgE in AKC were significantly larger than those in SAC (P<0.001. In contrast, the proportion of FcεRI- binding IgE (FcεRI-binding IgE/total IgE; % in SAC was significantly larger than that in AKC (P <0.001, although significant reverse correlation was observed between the proportion of FcεRI-binding IgE and total IgE in both AKC and SAC. Significantly, a higher proportion of FcεRI-binding IgE in SAC than that in AKC may reflect the differences in pathologic states of AKC and SAC that are caused by a disparity in immune responses in these diseases.

  15. The unfolding/denaturation of immunogammaglobulin of isotype 2b and its F-ab and F-c fragments

    NARCIS (Netherlands)

    Vermeer, AWP; Norde, W; van Amerongen, A

    2000-01-01

    The unfolding and further denaturation of IgG and its F-ab and F-c fragments were studied both on a macroscopic and molecular level, using differential scanning calorimetry and circular dichroism spectroscopy, respectively. It was shown that the structural integrity of the F-ab and F-c units was ret

  16. A Cautionary Note on the Use of Split-YFP/BiFC in Plant Protein-Protein Interaction Studies

    Directory of Open Access Journals (Sweden)

    Anneke Horstman

    2014-05-01

    Full Text Available Since its introduction in plants 10 years ago, the bimolecular fluorescence complementation (BiFC method, or split-YFP (yellow fluorescent protein, has gained popularity within the plant biology field as a method to study protein-protein interactions. BiFC is based on the restoration of fluorescence after the two non-fluorescent halves of a fluorescent protein are brought together by a protein-protein interaction event. The major drawback of BiFC is that the fluorescent protein halves are prone to self-assembly independent of a protein-protein interaction event. To circumvent this problem, several modifications of the technique have been suggested, but these modifications have not lead to improvements in plant BiFC protocols. Therefore, it remains crucial to include appropriate internal controls. Our literature survey of recent BiFC studies in plants shows that most studies use inappropriate controls, and a qualitative rather than quantitative read-out of fluorescence. Therefore, we provide a cautionary note and beginner’s guideline for the setup of BiFC experiments, discussing each step of the protocol, including vector choice, plant expression systems, negative controls, and signal detection. In addition, we present our experience with BiFC with respect to self-assembly, peptide linkers, and incubation temperature. With this note, we aim to provide a guideline that will improve the quality of plant BiFC experiments.

  17. Analysis of PV-FC Hybrid System Operation Considering Sale Electricity

    Directory of Open Access Journals (Sweden)

    Amirali Shahkoomahalli

    2013-06-01

    Full Text Available This paper presents a hybrid power generation system modeling and simulation with the objective of electricity sale to distribution network (DN which consists of photovoltaic (PV module, proton exchange membrane (PEM fuel cell (FC, hydrogen storage tank (HST and electrolyzer (EL.Since last researches in optimal FC and PV application aimed in power electronic approach, In this paper the application between FC and PV is considered with the aim of maximizing profit gained due to electricity sale revenue to DN. The revenue from electricity sale to DN considering electricity price in low load, shoulder load and peak load hours is considered as the system profit. Also in a sensitivity analysis the impact of technical parameters of hybrid system components is investigated on system profit. The results showed that the system saves the electricity by hydrogen storage in HST in low load hours and sale it with more prices in shoulder load hours to DN. Also the obtained results show that several technical parameters of PV and PEM FC have considerable impact on system operation and profit.

  18. Optimisation of FC-PEDRI for in vivo free radical imaging

    CERN Document Server

    Youngdee, W

    2001-01-01

    of 4. Finally, inversion recovery spin preparation has been added to the hybrid fast technique to yield different anatomical information while reducing power deposition in the sample. It was found that an IR hybrid FISP FC-PEDRI pulse sequence could be used to generate T sub 1 contrast in images which show similar detail and intensity of the free radical distribution as those obtained using hybrid FISP FC-PEDRI. A model for studying magnetisation during FC-PEDRI experiments has been developed and verified experimentally. The optimum EPR irradiation frequency, which maximises the Overhauser enhancement while minimising the RF power deposition in sample, was investigated using the FC-DNP technique. Experiments to verify the model were carried out in the EPR frequency range between 20 and 180 MHz and with different applied EPR RF power for free radicals with different EPR linewidths. The optimum EPR irradiation frequency was found to be dependent on the applied power level and on the EPR linewidths. Methods to o...

  19. Fc gamma receptor polymorphisms and periodontal status : a prospective follow-up study

    NARCIS (Netherlands)

    Wolf, D. L.; Neiderud, A. M.; Hinckley, K.; Dahlen, G.; van de Winkel, J. G. J.; Papapanou, P. N.

    2006-01-01

    Aims: The aims of this study were to assess: (i) the distribution of Fc gamma receptor polymorphisms among patients with chronic periodontitis ("cases") and control subjects with no/minimal loss of periodontal tissue support in a Caucasian population; (ii) whether these polymorphisms can serve as se

  20. Relationship between Febrile Convulsion (FC and Serum Level of Magnesium (Mg In Children

    Directory of Open Access Journals (Sweden)

    morteza Saddinejad

    2006-02-01

    Conclusion: There is a relationship between serum level of magnesium and the presence of febrile convulsion in children. It can be said that the deficiency of magnesium may be one of causes of FC in children. So, it is suggested to use supplements of magnesium in diet of affected children.