WorldWideScience

Sample records for evaluering av norsk

  1. Evaluering av norsk historiefaglig forskning

    DEFF Research Database (Denmark)

    Simonsen, Dorthe Gert; Lindkvist, Thomas; Stråth, Bo

    considered quality and relevance, organisation, training and cooperation patterns, capacity and financing, future developments and requirements. As a gauge for the comparison the evaluation committee, consisting of five historians from Denmark, Finland and Sweden covering various chronological and thematic...... debate. History is an important point of reference in the debate, in particular local history. An indication of the high repute is the size of the externally financed research commissioned by local, regional and central government offices and authorities and by business companies and trade associations......-exploited potential in Norwegian professional historical research. More distinct strategic reflection and priority choices require, in turn, more transparent information about the financing....

  2. Forskere i norske avisers dekning av skole

    Directory of Open Access Journals (Sweden)

    Emilia Andersson-Bakken

    2015-10-01

    Full Text Available Skolen er stadig i medienes søkelys, og i denne artikkelen ser vi nærmere på hvordan forskere bidrar med sine fagkunnskaper i skoledebatten i mediene. Den problemstillingen vi ønsker å besvare, er: Hvilken rolle har forskere i norske avisers dekning av skole? For å svare på dette har vi gjort en analyse av samtlige artikler om skole i VG, Bergens Tidende og Aftenposten i 2013. Resultatene viser at det forekommer en navngitt forsker i ca. 12 % av avisenes artikler om skole (209 av 1712 artikler. Det er imidlertid forskjell mellom avisene, og i VG opptrer det forskere i ca. 24 % av artiklene om skole, mens andelen både i Aftenposten og BT er ca. 11 %. Undersøkelsen viser videre at det er mange forskere som får mulighet til å uttale seg om skole i disse tre avisene, men det store flertallet av disse uttaler seg kun én gang. Vi fant også at forskere ofte uttaler seg om rammene for skolens undervisningsvirksomhet, og sjelden om det som foregår i klasserommene. Resultatene av vår empiriske undersøkelse stemmer i stor grad overens med hovedtendensene i tidligere studier av forskere i media, noe som indikerer at forskernes rolle i norske avisers skoledekning ikke skiller seg markant ut fra den rollen forskere har i media generelt. Våre resultater peker imidlertid på én viktig forskjell: Forskere ser ut til å være uvanlig godt synlige i norske avisers dekning av skole.Nøkkelord: skoleforskning, media, forskningsformidlingAbstractSchool is a frequently debated topic in the media, and this article investigates how researchers contribute with their knowledge in this media debate. The research question is: What characterizes researcher participation in Norwegian newspaper coverage of school? To answer this question we have analyzed all articles about school in the Norwegian newspapers VG, Bergens Tidende and Aftenposten during 2013. The results show that there is a named researcher in about 12 % of the newspaper articles about school

  3. Overvåking av norsk kosthold - metoder og resultater

    Directory of Open Access Journals (Sweden)

    Lars Johansson

    2009-11-01

    Full Text Available  SAMMENDRAGKunnskap om endringer i matvarenes sammensetning og befolkningens kosthold er grunnleggende for utformingog oppfølging av en helsefremmende mat- og ernæringspolitikk. Dagens system for overvåking avkostholdet bygger først og fremst på en matvaredatabase og opplysninger om forbruket av matvarer fra tretyper datasett; matforsyningsstatistikk, forbruksundersøkelser og kostholdsundersøkelser. Det avgis årlig envurdering av utviklingen i norsk kosthold i forhold til mat- og ernæringspolitiske målsettinger. Det norskesystemet for overvåking av kostholdet er blitt betydelig styrket i løpet av 1990-årene ved innføringen avregelmessige kostholdsundersøkelser blant landsrepresentative utvalg av befolkningen i ulike aldersgrupperog økte ressurser til analyse av næringsinnholdet i matvarer. Det er imidlertid beskjedent sammenlignet meddatainnsamlingen i land som USA og Storbritannia. Det norske overvåkingssystemet er forsatt i enutviklingsfase, og det må justeres og kompletteres etter hvert. Dessuten vil det arbeides med å kvalitetssikredatainnsamlingen.Johansson L. Surveillance of the diet in Norway – methods and results.Nor J Epidemiol ENGLISH SUMMARYKnowledge about changes in composition and intake of foods, as well as changes in the prevalence of dietrelatedhealth problems is fundamental for an effective food and nutrition policy. The National Council onNutrition and Physical Activity is responsible for evaluating changes in the diet. Annually the Council publishesreports about trends in the Norwegian diet, and suggests measures to improve the diet. The Council, incooperation with the National Food Authority and the Institute for Nutrition Research, University of Oslo,has established a national food and dietary surveillance system. This system is mainly based on a fooddatabase and food consumption data. The food consumption data include three principally different datasets: food supplies, household consumption surveys

  4. Fra kirkegård til museum : en kulturhistorisk analyse av Norsk Folkemuseums gravminneutstilling

    OpenAIRE

    Seim, Runhild

    2002-01-01

    Norsk Folkemuseum har helt fra starten i 1894 hatt en gruppe gravminner i sin samling av etterreformatoriske kirkesaker. Denne oppgaven tar særlig for seg gravminnene, og følger dem gjennom det kontekstskifte det er å forflyttes fra kirkelig til museal grunn. Hans Aall, initiativtaker til Norsk Folkemuseum, og Harry Fett, senere riksantikvar, var begge ildsjeler i museumsinnsamlingen. Begge hadde en forkjærlighet for det vakre, om enn ikke med de samme preferanser som datidens kunstmuseer...

  5. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  6. Samhandling på tvers av lokasjoner ved hjelp av videokonferanse : Casestudie av virtuelle møter innenfor driftsorganisasjonen i Det norske oljeselskap

    OpenAIRE

    Volden, Helene

    2016-01-01

    Globaliseringen de siste årene har bidratt til endringer av samfunnet og organisasjonslivet. Arbeid skjer til alle døgnets tider og man befinner seg på ulike steder. Teknologien tillater å kunne gjennomføre møter på tvers av lokasjoner, og antall virtuelle møter er spådd en økning fremover. Olje- og gassindustrien er de mest erfarne brukerne av videokonferanse i norsk næringsliv. Denne studien skal belyse hvordan virtuelle møter kan bli mer effektive i arbeidet på tvers av loka...

  7. Bør man tillate at norske statsborgere benytter seg av surrogati i India?

    Directory of Open Access Journals (Sweden)

    Annelin Haukeland

    2013-11-01

    Full Text Available I Norge er ikke surrogati tillatt, og myndighetene fraråder norske statsborgere å benytte seg av surrogati i utlandet. I denne artikkelen fokuserer vi på kommersiell gestational surrogati og stiller spørsmålet: Bør man tillate at norske statsborgere benytter seg av surrogati i India? De etiske problemstillingene rundt surrogati er mange og sammensatte og blir spesielt utfordrende når tjenesten tilbys i et land med store kulturelle og økonomiske forskjeller både internt og i forhold til Norge. Vi baserer analysen og drøftingen av dette etisk utfordrende spørsmålet på Beauchamps og Childress sin veletablerte metodiske tilnærming innen biomedisinsk etikk. Vi anvender de fire allmennmoralske prinsipper: respekt for autonomi, velgjørenhet, ikke-skade og rettferdighet på sakskomplekset for å synliggjøre spenningene involvert i dette etiske dilemmaet. Med full bevissthet om at det ikke finnes noen lettvinte og omkostningsfrie løsninger på dilemmaer generelt og dette spesielt, konkluderer vi med at interessene til de berørte parter, og spesielt surrogatmødrenes, kan bli bedre ivaretatt om surrogati tillates under omfattende reguleringer. Dersom man velger å gjøre praksisen illegal, vil man også miste mulighetene til å påvirke prosessen og sikre rettighetene til de involverte partene.Nøkkelord: surrogati, Norge–India, utnyttelse, autonomi, regulering av prosessenEnglish summary: Should Norwegian citizens be permitted to use surrogacy in India?Surrogacy is not permitted in Norway, and the government strongly advises against Norwegian citizens travelling abroad to have children through the use of the surrogacy industry. In this article, we focus on commercial gestational surrogacy and debate the question: Should Norwegian citizens be permitted to use surrogacy in India? The ethical concerns regarding surrogacy are complex and are especially challenging when the service is offered in a country with big cultural and economic

  8. Måleegenskaper ved den norske versjonen av The Pediatric Quality of Life Inventory TM, 4.0 (PedsQL)

    OpenAIRE

    Reinfjell, Trude; Jozefiak, Thomas

    2012-01-01

    Livskvalitetsmålet PedsQLTM ble utviklet av James W. Varni, og første gang publisert på engelsk i 1999. Trude Reinfjell og Trond H. Diseth står bak den norske oversettelsen med publisering i 2006. Oversettelsen ble gjennomført etter internasjonale retningslinjer og godkjent av originalforfatteren. Målgruppen er barn i førskole- og skolealder, samt ungdom og unge voksne. PedsQLTM foreligger i fem versjoner tilpasset alder og informant (barneversjonen for 5-7 år, tenåringsversjonen for 8-12 år,...

  9. Levende norsk

    DEFF Research Database (Denmark)

    Bostrup, Lise; Egebakken, Inger

    "Levende norsk" er en indføringsbog i norsk (bokmål) for udenlandske studenter og andre, som ønsker at lære at tale norsk. Hovedfokus er norsk som kommunikationsmiddel, et levende, moderne norsk, som det tales i dag....

  10. Hockeykjelke - Setebunn og knestøtte: Utvikling av ny kjelke til det norske kjelkehockeylandslaget

    OpenAIRE

    Seim, Anders

    2013-01-01

    Kjelkehockey er basert på de samme prinsippene som ishockey, men er rettet mot utøvere med funksjonsnedsettelser i nedre del av kroppen. Utøverne sitter i en tilpasset kjelke med skøytestål på undersiden av bakre del av kjelken. De har en tilpasset hockeykølle i hver hånd, som har to funksjoner, i den ene enden er det pigger til å stake seg frem med på isen, og den andre enden ligner en vanlig hockeykølle og brukes til å håndtere pucken. Hyppige retningsforandringer gjør svingresponsen til en...

  11. Mellom risiko og kontroll - en studie av eksplisitte modelleringsformer i norsk grunnskolelærerutdanning

    Directory of Open Access Journals (Sweden)

    Fride Lindstøl

    2017-12-01

    Full Text Available Å være lærerutdanner skiller seg fra andre stillinger innenfor høyere utdanning: Lærerutdanneren underviser både i fagstoff og i hvordan studentene kan lære bort og adaptere fagstoffet i klasserommet. Det at lærerutdanneren underviser i det å undervise, har implikasjoner for hvordan undervisningen planlegges, gjennomføres og analyseres i lærerutdanningen – undervisningens form blir en del av budskapet. Lærerutdannerens arbeid handler derfor om å utforme, velge og sette i spill aktiviteter og oppgaver som kan adaptere fag, forskning, didaktikk og teori til klasserom og profesjonen. Utforming og montasje av de ulike delene eller episodene i et undervisningsforløp kan betegnes som undervisningsforløpets dramaturgi. I denne artikkelen har jeg gjort en dramaturgisk analyse av tre lærerutdanneres undervisning for å identifisere og beskrive hvordan de bruker eksplisitte modelleringsformer, og hva som skjer når de bruker dem. I etterkant av den dramaturgiske analysen har jeg gjort en konvensjonell innholdsanalyse av intervjudata for å undersøke hvordan lærerutdannerne selv forklarer formålet og erfaringer med å bruke eksplisitt modellering i undervisningen. Analyse av tre lærerutdanneres undervisningspraksis sammenfattes i en modelleringsstige som visualiserer hvordan enkelte former for eksplisitte modelleringsformer tilbyr en egen sirkulær dramaturgi. Studien antyder og drøfter også på hvilken måte modelleringsstigen kan fungere som en dramaturgisk modell, som kan brukes som utgangspunkt for lærerutdanneres planlegging, gjennomføring og analyse av egen undervisning. Studien er et bidrag til å utvikle og forske på hvordan eksplisitte modelleringsformer kan brukes for å skape sammenheng mellom praktisk lærerarbeid og teoretisk metarefleksjon i lærerutdannerens undervisning. Innsamling av data er gjort i profesjonsverksted, som kan forklares som en læringsarena hvor lærerutdannere fra ulike fag samarbeider om

  12. Levd skuespillerliv og rolletildeling. En studie av kvinner i norsk institusjonsteater

    Directory of Open Access Journals (Sweden)

    Rikke Gürgens Gjærum

    2015-12-01

    Full Text Available The article presents findings from the qualitative study Women in Norwegian theatre, Kvinner i norsk teater (KIT. The researchers have examined the experiences of actresses on the distribution of dramatical roles/parts in Norwegian institutional theatres, in a lifespan perspective. The study is based on 20 qualitative research interviews of a strategic selection of actresses from smaller and larger institutional theatres. We discuss the data with a feministic view and six issues are highlighted in the article: 1. Repertoir, 2. Focus on looks and appearances, 3. Ageism, 4. Role characteristics, 5. Role ambitions/wishes of the actresses, 6. Nobility, 7. Prosesses of change. In the KIT study we find both active and creative innovating actresses and actresses who appear creative but yet more passive. A central discovery is that the success criterion for achieving an enriching professional life as an actress in Norwegian institutional theatres, is to dare “to take the wheel" in order to avoid marginalisation and ageism from the institution.

  13. Survey of potentials for exploitation of waste heat from norwegian industry; Potensialstudie for utnyttelse av spillvarme fra norsk industri

    Energy Technology Data Exchange (ETDEWEB)

    Sollesnes, Geir; Helgerud, Hans Even

    2009-07-01

    Norsk Energi and NEPAS has mapped sources and elucidated possibilities for exploitation of waste heat from Norwegian industry. These industries are examined: food industry, wood processing industry, cement- and Leca, chemical, aluminium and ferro-alloy in addition to some other heavy energy user companies and the biggest waste incineration plants. A simplified 'guide' which can be used for a first evaluation whether exploitation of waste heat might be technical/ practical possible and profitable or not. Relevant technologies are described. The report point out four areas which should be prioritized for technology development. Barriers for exploitation of waste heat from industry are set up and incentives for increased usage are pointed out. (AG). 6 refs., 34 figs., 3 tabs

  14. Hva vet vi (ikke om elevers opplevelser med friluftsliv i norsk skole – en gjennomgang av empiriske studier 1974–2014

    Directory of Open Access Journals (Sweden)

    Kristian Abelsen

    2017-09-01

    Full Text Available Artikkelen presenterer en kunnskapsoversikt basert på en systematisk gjennomgang av empiriske studier om friluftsliv i norsk skole der elevers opplevelser eller stemmer kommer til uttrykk. En slik oversikt er ikke tidligere sammenfattet, selv om det er over 40 år siden ordet friluftsliv kom inn i fagplanformuleringene med Mønsterplanen av 1974. 1974 ble derfor valgt som utgangspunkt for studiens søkeperiode, selv om det kan hevdes at opplæring og undervisning som omfatter aktivitet, læring og opphold i natur allerede fra tidlig 1900-tall har vært en del av norsk skoles oppdrag og virke. For søkeperioden fram til 2014 avdekkes 24 studier som møter inklusjonskriteriene, hvorav 18 er master- og hovedfagsoppgaver. Resultatet forteller at foreliggende empirisk basert kunnskap om elevers opplevelser med friluftsliv i skolen er begrenset og ikke tillater å trekke syntetiserte slutninger. Med den reservasjonen som hovedkonklusjon drøfter artikkelen hvilken kunnskap de inkluderte studier kan gi om friluftsliv i skolen ut fra elevers perspektiv.

  15. Musikkfaget i norsk grunnskole: Læreres kompetanse og valg av undervisningsinnhold i musikk

    Directory of Open Access Journals (Sweden)

    Jon Helge Sætre

    2016-08-01

    Full Text Available Denne artikkelen presenterer resultater fra en spørreundersøkelse om grunnskolelæreres kompetanse i musikk og deres valg av undervisningsinnhold i musikkfaget i grunnskolen. Dermed bidrar undersøkelsen til å beskrive hva lærere i musikk kan og hva de vektlegger i sin undervisning, og slik også sammenhengen mellom kompetanse og valg av undervisningsinnhold. Utvalget er 135 lærere som underviser musikk på tredje, sjette og niende trinn i fem kommuner på Østlandet. Datamaterialet analyseres gjennom deskriptiv statistikk og variansanalyser (ANOVA. Resultatene viser at de fleste lærere i musikk er allmennlærere med lite formell kompetanse i musikk fra høyere utdanning. Lærere på lave trinn har vesentlig mindre formell kompetanse enn lærere på høyere trinn, og de deltar også i mindre grad i uformell musikalsk læring gjennom musikkpraksis utenfor skolen. Det er også forskjeller i valg av undervisningsinnhold, og disse forskjellene kan ikke forklares av læreplanens beskrivelse av de ulike trinnene alene. Det ser ut til å være klare sammenhenger mellom hva lærere kan og hva de velger å vektlegge i sin undervisning. Likevel er studiens kanskje viktigste bidrag at den antyder at forskjeller i læreres musikkundervisningspraksis påvirkes av flere forhold, og kompetanse (formell og uformell, læreplanforståelse, profesjonell identitet og kjønn ser ut til å være sentrale faktorer.  Nøkkelord: musikk, lærere, kompetanse, undervisningsinnhold, kjønnAbstractThis article presents results from a survey investigating the competence of music teachers in Norwegian primary and lower secondary schools, and their choice of educational content in music lessons. Thus, the survey presents a description of what teachers know, and what they emphasize in their music teaching, and the correspondence between these factors. The sample comprises 135 teachers teaching music in grades three, six and nine in five municipalities. Data is analyzed

  16. Bitcoin: En analyse av Bitcoins implikasjoner og hvordan norske skattemyndigheter utfordres

    OpenAIRE

    Standal, Lene; Hageløkken, Julie H.

    2017-01-01

    Bitcoin er en virtuell og desentralisert valuta som for første gang muliggjør betalinger direkte fra person til person, uten at betalingen må verifiseres av noen sentral, finansiell institusjon. Siden Bitcoin ble introdusert i 2008 har valutaen opplevd en betydelig økning i handelsvolum og vekslingskurs. Ingen tradisjonelle valutaer hadde en sterkere prisstigning enn Bitcoin i 2016, og antall kjøpte og solgte Bitcoin økte fra 40 milliarder euro i 2015 til 370 milliarder euro i 2016. I denne u...

  17. Utvikling av et bærekraftsbarometer for norsk lakseoppdrett - Forprosjekt

    OpenAIRE

    Andreassen, Otto; Karlsen, Kine Mari; Robertsen, Roy; Solås, Ann-Magnhild

    2016-01-01

    - Det har vært lansert ønsker fra havbruksnæringen om å utvikle et årlig barometer eller en tilstandsrapportering, som gir en bredere og mer helhetlig forståelse av havbruksnæringens nasjonale bærekraftsutvikling og effekt på miljø og samfunn. I den forbindelse er det gjennomført et forprosjekt, der målet har vært å klargjøre rammer for et førstegenerasjons bærekraftsbarometer. Dette barometeret skal inkluderer miljømessig, økonomisk og sosial bærekraft. The objective of this project wa...

  18. Utfordringer i norsk produksjon av plommer (Prunus domestica L.) og søtkirsebær (Prunus avium L.)

    OpenAIRE

    Kind, Heidi; Olsen, Anne Cecilie

    2016-01-01

    Hensikten med denne studien var å kartlegge mulige årsaker til hvorfor steinfruktavlingene i Norge ikke har økt som følge av omfattende satsing på steinfruktproduksjon. De siste16 år har det vært stort fokus på produksjon av plomme og søtkirsebær. Arealet av steinfrukt har i denne perioden økt betraktelig, uten at fruktmengden har økt tilsvarende. Det er også store årlige variasjoner i avlingsmengde, noe som ofte begrunnes med klima. Interessen for kvalitetsfrukt av søtkirsebær og plommer er ...

  19. Pastorer i trosbevegelsen : en studie av to norske pastorer sin autoritetsforståelse og rolleforståelse

    OpenAIRE

    Bryne, Jarle

    2007-01-01

    Jeg har valgt bevisst et omfattende sammendrag. Sammendraget er utformet med tanke på at det skal være mulig for leseren å få et inntrykk av mine resultater i prosjektet uten at leseren trenger å lese hele prosjektet. Jeg har laget et sammendrag fra hvert kapittel. Kapittel 1: Prosjektet mitt handler om undersøkelser av to sentrale ledere i trosbevegelen. Henholdsvis Åge Åleskjær som er leder av Oslo Kristne Senter på Kjeller og Enevald Flåten som inntil 2006 var leder av Levende Ord Bibel...

  20. Pastorer i trosbevegelsen : en studie av to norske pastorer sin autoritetsforståelse og rolleforståelse

    OpenAIRE

    Bryne, Jarle

    2007-01-01

    Masteroppgave i kristendomskunnskap - Universitetet i Agder 2007 Jeg har valgt bevisst et omfattende sammendrag. Sammendraget er utformet med tanke på at det skal være mulig for leseren å få et inntrykk av mine resultater i prosjektet uten at leseren trenger å lese hele prosjektet. Jeg har laget et sammendrag fra hvert kapittel. Kapittel 1: Prosjektet mitt handler om undersøkelser av to sentrale ledere i trosbevegelen. Henholdsvis Åge Åleskjær som er leder av Oslo Kristne Senter på Kjel...

  1. Norsk fiskeriforvaltning og bærekraft; en studie av forvaltningen av atlantisk laks (Salmo salar) og nordøstarktisk torsk (Gadus morhua)

    OpenAIRE

    Meaas, Anne Christine

    2012-01-01

    Laksefisket og torskefisket er forvaltet av to forskjellige sektorer, og laksefisket er i tillegg sektorovergripende på grunn av laksens anadrome livshistorie. Denne oppgaven har tatt for seg disse to forvaltningene, og sett på disse i lys av bærekraftbegrepet. Resultatene ble funnet gjennom litteraturstudier og personlig kommunikasjon med personer i forvaltningen. Lakseforvaltningen har høy sosial bærekraft, og laksefisket har et stort potensial som mål for turister og fritidsfiskere. Lak...

  2. En kartlegging av forekomsten av forskjellige rusmidler blant norske motorvognførere pågrepet av politiet, med mistanke om påvirket kjøring

    Directory of Open Access Journals (Sweden)

    Kari-Mette Beylich m. fl Beylich m. fl

    2009-10-01

    Full Text Available  SAMMENDRAGSjåfører som mistenkes for påvirket kjøring blir i første omgang vurdert av politiet med henblikk på om det kunskal rekvireres alkoholanalyse eller om det også skal tas prøve med hensyn på andre rusmidler (narkotika,medikamenter med ruspotensial ved Statens rettstoksikologiske institutt (SRI. Rutinemessig vil SRI undersøkedet politiet rekvirerer, men prøvene lagres inntil to år etter at de er analysert. Ved supplerende analyse i ettertidkan man således få et mer fullstendig bilde av hva mistenkte, påvirkede bilførere hadde i kroppen da de avgaprøve. I den foreliggende undersøkelsen ble 1197 prøver fra februar og september 1993 analysert på et bredtspekter av andre rusmidler foruten alkohol, uavhengig av hva politiets mistanke hadde vært. Vi fant da at alkoholalene var til stede i 55 % av prøvene, andre rusmidler alene i 16%, både alkohol og andre rusmidler i 14%, mensverken alkohol eller andre rusmidler ble påvist i 15% av prøvene. Politiets mistanke med hensyn til alkoholpåvirkningble bekreftet av analyseresultatene i 71% av tilfellene, og mistanke om forekomst av andre rusmidler i58% av tilfellene. Tidligere studier og denne undersøkelsen viste at bilførere som mistenkes for påvirket kjøringsynes å representere en gruppe med storbruk av alkohol og misbruk av andre stoff.Beylich K-M, Christophersen AS, Skurtveit S, Bjørneboe A, Mørland J. Frequency of different drugs in  ENGLISH SUMMARYDrivers apprehended under the suspicion of drunken or drugged driving are primarily evaluated by the police withregard to whether alcohol or drugs should be looked for in the blood samples taken shortly after apprehension.Until March 1996 all blood samples were sent to the National Institute of Forensic Toxicology (NIFT, for analysis.NIFT routinely perform only those analyses requested, but the samples are stored for up to two years afteranalysis. By later additional analyses of this material one could obtain a more

  3. Kommuneplanens samfunnsdel som forankringsredskap i lokalt folkehelsearbeid : case-studie av en planprosess i en norsk kommune

    OpenAIRE

    Bagge, Cecilie Merethe

    2016-01-01

    Folkehelseloven fra 2012 styrker kommunenes ansvar for folkehelsearbeidet, og har et mål om at folkehelsearbeidet skal foregå i alle etater, ikke bare i helsesektoren. Plan- og bygningsloven fra 2008 styrker kommuneplanleggingen, med kommuneplanens samfunnsdel som retningsgivende for kommuneorganisasjon og -samfunn. Det systematiske folkehelsearbeidet skal styrke koblingen mellom planlegging og folkehelse, og innebærer at oversikt over helsetilstand skal ligge til grunn for fastsetting av fol...

  4. På leit etter grunnlag for norske barnehagers matematikkdidaktiske arbeid med romforståelse. - Et systematisk søk på forskning om barns utvikling av romforståelse gjort i barnehagekonteksten 1995-2010

    Directory of Open Access Journals (Sweden)

    Line Rønning Føsker

    2015-07-01

    hvilken betydning disse arbeidene kan ha for arbeidet med romforståelse i norske barnehager. Det kan se ut som at videre forskning bør vektlegge barnehagelærerens bruk av materiell, hvordan man planlegger arbeid med visualisering og orientering, og hvordan et økt fokus på romforståelse kan støtte barnehagelærerens arbeid med å iverksette den norske rammeplanens intensjoner på området.

  5. Nåværende norske rutiner for innsamling av data innen kariesepidemiologi blant barn/unge – holder rutinene fortsatt mål?

    Directory of Open Access Journals (Sweden)

    Marit S. Skeie

    2012-05-01

    Full Text Available KOSTRA (Kommune-Stat-Rapportering utgjør et nasjonalt informasjonssystem som gir opplysninger om kommunal og fylkeskommunal virksomhet, også når det gjelder tannhelsetjenestens virksomhet. Hovedmålet med denne artikkelen er å evaluere nytteverdien av KOSTRA-data som de per i dag innrapporteres, det vil si om de harmonerer med moderne behandlingsfilosofi av sykdommen karies og lavere kariesprevalens, samt bidrar som redskap i det tannhelsefremmende arbeid. Som delmål vil vi kritisk vurdere hvordan kariesdata blir innrapportert til KOSTRA og der blir presentert, samt diskutere videreutvikling av denne innrapporteringen. Vi fant at nåværende KOSTRA-rutiner bør endres og arbeidsmetoder oppdateres i samsvar med moderne syn på kariesforebyggelse og terapi. Det å inkludere emaljelesjoner i KOSTRArapportene og overvåke kariesutviklingen fra tidlig alder, er essensielt hvis planlegging av tannhelsetjenesten for barn og ungdom skal kunne gjennomføres på en optimal måte. Videre bør man gå over fra aggregerte data til rapportering på individnivå, eventuelt fra statistisk tilfeldige utvalg og endring av klasseinndelingen i frekvensfordelinger. Dette for å kunne estimere SIC og tilpasse fordelingene til endret karieserfaring i nøkkelårskullene. Bruk av kalibrerte undersøkere vil være en stor gevinst med tanke på å heve kvaliteten på de data som blir innrapportert, både når det gjelder reliabilitet og validitet.Skeie MS, Klock KS, Haugejorden O. Current Norwegian routines for collection of data on caries epidemiology among children and adolescents – are the routines still adequate? Nor J Epidemiol 2012; 22 (1: 59-68.ENGLISH SUMMARYKOSTRA (Community-State-Report is a national information system providing data about activity at community and country level, as well as in the Public Dental Service (PDS. The main aim of this study is to assess the usefulness of the present KOSTRA data reporting system, i.e. if it is in accordance with

  6. Institusjonelle felt og forståelser av evaluering

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Furubo, Jan-Eric

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av refo...

  7. Evaluering av inflammatoriske mediatorer i diagnostikk av alvorlige neonatale infeksjoner

    Directory of Open Access Journals (Sweden)

    Henrik Døllner

    2009-10-01

    Full Text Available  Formål: SAMMENDRAGStudie design: Resultater: IL-6 predikerte uavhengig infeksjon (bidrag til infeksjonsdiagnosen. En kombinert parameter bestående av CRP≥ 10 mg/l og/eller IL-6 > 50 pg/mlga en sensitivitet på 96% (95% CI: 88–100%, en spesifisitet på 74% (95% CI: 65–83%, en negativ prediktivverdi på 99% (95% CI: 96–100% og en positiv prediktiv verdi på 49% (95% CI: 35–63%.Konklusjon: diagnosis of severe neonatal infections  ObjectiveENGLISH SUMMARY Study design Results: of IL-6 yielded independent contributions to the diagnosis of infection ( mediator made any further contribution to the diagnosis. A combined parameter of CRP≥ 10 mg/l and/or IL-6 >50 pg/ml yielded a sensitivity of 96% (95% CI: 88–100%, a specificity of 74% (95% CI: 65–83%, a negativepredictive value of 99% (95% CI: 96–100% and a positive predictive value of 49% (95% CI: 35–63%.Conclusion: severe neonatal infections.IL-6 in combination with CRP may constitute a valuable parameter in the early diagnosis ofp p p = 0.03. No other Twentyfour neonates with sepsis, clinical sepsis and pneumonia had significantly raised serumlevels of all six mediators compared to noninfected neonates (all : Blood samples were collected at admittance from 165 neonates who were suspected to have asevere bacterial infection and serum concentrations of the six inflammatory mediators were determined. Weanalysed the mediators, either isolated or in combination, as diagnostic parameters by multiple logisticregression, receiver-operator characteristic plots and predictive value theory (sensitivity and specificity.: To study C-reactive protein (CRP, interleukin-6 (IL-6, soluble tumor necrosis factor receptors(TNFR p55 and p75 and the adhesion molecules ICAM-1 and E-selectin in the early diagnosis of neonatalsepsis.The value of inflammatory mediators in the . Nor J Epidemiol 1997; 7 (1: 73-78.IL-6 i kombinasjon med CRP synes å være en verdifull parameter ved utredning

  8. Strategi for opptrapping av kraftfôr etter kjeing for å sikre god produksjon og helse hos norske mjølkegeiter

    OpenAIRE

    Asheim, Karianne Garthus

    2016-01-01

    I Norge har mjølkeavdråtten hos geit økt mye i seinere tid. Etter kjeing er geiter ofte i negativ energibalanse (NEB), og fôring av kraftfôr må balanseres mellom tilførsel av nok energi, og samtidig unngå for mye mobilisering av kroppsreserver og sikre godt vommiljø og grovfôropptak videre i laktasjonen. Formålet med denne oppgaven var å undersøke effekten av forskjellige opptrappingshastigheter for kraftfôr etter kjeing. Et feltforsøk ble utført i 8 besetninger med geitemjølksproduksjon ...

  9. «Det er fedt»: Evaluering av det frivillige 10. skoleår i Danmark

    OpenAIRE

    Nordahl, Thomas; Sunnevåg, Anne-Karin; Løken, Gro

    2011-01-01

    Norsk: Manglende kunnskaper fra grunnskolen framstår som den viktigste faktoren for ikke å gjennomføre videregående opplæring med studie- eller yrkeskompetanse. Elever som ikke lykkes faglig i grunnskolen og dermed får faglige problemer i videregående, har også gjerne sosiale og personlige erfaringer som bidrar til at videre skolegang kan bli vanskelig. En av tre lykkes ikke i norsk videregående opplæring. Sannsynligheten for frafall fnner en særlig i overgangsfasene mellom de...

  10. Educational expeditions - et norsk perspektiv

    Directory of Open Access Journals (Sweden)

    Andre Horgen

    2015-06-01

    friluftsliv”pedagogy?    Key words: Educational expeditions, Adventure programming, Outdoor educa-tion and Personal growthSammendragArtikkelen handler om friluftsliv brukt pedagogisk med tanke på personlig utvikling. Bakgrunnen er en undring rundt hvorfor temaet personlig utvikling, som står så sentralt i britisk og angloamerikansk pedagogisk friluftslivs-tradisjon, ikke er viet større plass i norsk friluftslivspedagogisk tradisjon. Problemstillingen har vært: Opplever norske bachelorstudenter i friluftsliv at de lærer noe om seg selv og sine egenskaper som ledere under lange ferder i vinterfjellet? Datainnsamlingen har foregått over tre år, i etterkant av tre lange vinterferder med tjuefem 3. års studenter ved Høgskolen i Telemark. Studentene har svart skriftlig på spørsmål knyttet til personlig utvikling. Flere av dem gir uttrykk for en opplevelse av å ha gjort seg erfaringer knyttet til selvbilde/identitet som kan koples til personlige utvikling. Informantene reflekterer bl.a. over opplevelser knyttet til det å mestre og prestere, det å akseptere egne styrker og svakheter, samt det å utvikle troen på seg selv, også i lederrollen. I tillegg reflekteres det over opplevelser av læring knyttet til mellommenneskelig ferdigheter, selvkontroll og kommunikasjon, samt mellommenneskelig forhold knyttet til utøvelsen av lederskap og over omsorgsoppgaver lederskapet innebærer. Opplevelser av læring knyttet til det å ha overblikk, lese situasjoner, gjøre vurderinger og treffe nødvendig tiltak, er også gjenstand for refleksjon. I forlengelsen av dette reflekteres det over viktigheten av å ha fornemme den enkelte, det å oppmuntre, være positiv og gi omsorg. Studien har vist at lange vinterferder, i en norsk tradisjon, har et potensiale til å utløse refleksjoner knyttet til personlig utvikling og ledelse. Kanskje kan denne studien øke bevisstheten rundt de pedagogiske mulighetene som ligger i menneskers møter med andre mennesker i natur?Nøkkelord: Friluftsliv  

  11. Ny versjon av standarden ISO 15489

    OpenAIRE

    Herbjørn Andresen

    2016-01-01

    Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. ...

  12. Fortid nr. 3/2008. Ringvirkninger av Israels opprettelse

    OpenAIRE

    2008-01-01

    Leder (s. 5) Korttekster: Mindre nasjon. Mer teori. Av Geirr Olav Gram (s. 7-8) Historiefaget i all sin bredde. Av Maria Halle (s. 8-9) Tema: Ringvirkninger av Israels opprettelse Al-Nakba 1948 - 60 år siden katastrofen. Av Jørgen Jensehaugen (s. 9-10) "Et folk som alle andre": Norsk-jødiske perspektiver på opprettelsen av Israel. Av Vibeke Kieding Banik (s. 12-19) Remembering Al-Nakba 60 years later. Av Ahmad H. Sa'di (s. 20-26) Israel and the exodus of the Jews of ...

  13. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2016-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  14. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2015-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  15. Barndom på nett - En kvalitativ analyse av mammabloggeres fremstilling av egne barn på Internett

    OpenAIRE

    Sinding-Larsen, Helene

    2015-01-01

    Master i sosialt arbeid Denne studien tar for seg et relativt nytt og lite utforsket tema, nemlig fremstillinger av barn i mammablogger. Mammablogger kan forstås og utforskes som en slags personlig dagbok på Internett, hvor bloggeren deler fortellinger fra seg og sine barns hverdagsliv. Jeg har, gjennom et sosialkonstruksjonistisk perspektiv og inspirert av diskursteori, rettet fokus mot hvordan et utvalg av norske mammabloggere fremstiller sine barn. De ulike fremstillingene jeg har funne...

  16. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    OpenAIRE

    John Olav Bjørnestad; Anne Valen-Senstad Skisland; Olle Söderhamn

    2010-01-01

    Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatning...

  17. "Klubben er vår livsforsikring!" Evaluering av arbeidet i Familieklubbene i Norge

    OpenAIRE

    Fyrand, Live

    2007-01-01

    Bakgrunn for rapporten er ønske om utvikling av evalueringsverktøy og evaluering av Familieklubbene i Norge. Familieklubbene i Norge startet opp i 1999. De første klubbene ble etablert i 2000 og stiftet som egen organisasjon mars 2005. Diakonhjemmets Høgskole ved 1. amanuensis, dr. philos Live Fyrand har gjennomført evalueringen på oppdrag fra Familieklubbene i Norge. Rapporten bygger på dokumentstudier og en bruker undersøkelse gjennomført ved utvikling og bruk av spørreskjema til a...

  18. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  19. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  20. «Det går an å lage ganske mye morsomt ut av læring»

    OpenAIRE

    Zachrisen, Berit

    2003-01-01

    Rapporten presenterer en evaluering av Puggandplay, gjennomført på oppdrag fra Høgskolen i Hedmark, avdeling for lærerutdanning våren 2003. Puggandplay er tenkt som et lærings- og leksehjelpprogram i fagene matematikk, naturfag, samfunnsfag og norsk i 5. til og med 7. klasse. Hovedmålet med evalueringen var å få erfaring med Puggandplay som et redskap i faglige læringsprosesser på mellomtrinnet og pedagogiske muligheter som ligger i konseptet. Informanter var elever og lærer...

  1. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  2. En empirisk studie av ansattes samarbeidsinnstilling hos to norske konsern.

    OpenAIRE

    Faanes, Arne

    2015-01-01

    Studien hadde som formål å se om det var sammenheng mellom kvaliteten i det profesjonelle forholdet mellom leder – ansatt og samarbeidsinnstilling. I tillegg til dette skulle studien se om samarbeidsinnstilling hadde sammenheng med opplevd tillit til samarbeidspartnere og rettferdighet i forbindelse med samarbeid. Studien er forankret i teori om Leader Member Exchange (LMX), samt tillit og rettferdighet i forbindelse med samarbeid. Hypotesene tar utgangspunkt i at det er en sammenheng mell...

  3. En empirisk studie av ansattes samarbeidsinnstilling hos to norske konsern.

    OpenAIRE

    Faanes, Arne

    2015-01-01

    Master's thesis in Service management Studien hadde som formål å se om det var sammenheng mellom kvaliteten i det profesjonelle forholdet mellom leder – ansatt og samarbeidsinnstilling. I tillegg til dette skulle studien se om samarbeidsinnstilling hadde sammenheng med opplevd tillit til samarbeidspartnere og rettferdighet i forbindelse med samarbeid. Studien er forankret i teori om Leader Member Exchange (LMX), samt tillit og rettferdighet i forbindelse med samarbeid. Hypotesene tar ut...

  4. Evaluation of iodine tablets as the relevant countermeasure in Norwegian nuclear and radiological emergency response.; Vurdering av jodtabletter som aktuelt tiltak i norsk atomberedskap.

    Energy Technology Data Exchange (ETDEWEB)

    Jaworska, Alicja; Jerstad, Ane Naess; Holo, Eldri N.

    2012-07-01

    The report contains definitions of volume and dose parameters for external radiotherapy. In addition the report contains recommendations for use, documentation and minimum reporting for radiotherapy of the individual patient.(Author)

  5. Er mobiltelefonen nordmenns nye lommebok? : en kvalitativ studie om tidlige adoptører i det norske mobilbetalingsmarkedet

    OpenAIRE

    Hansen, Rune Alexander

    2015-01-01

    Smarttelefonrevolusjonen har ført til nye tekniske løsninger. Flere av disse teknologiene har blitt dagligdagse for forbrukere i det globale markedet. En av teknologiene som enda ikke har slått fullverdig an, er mobilbetaling. Mobilbetaling har bare sett suksess i enkelte land og regioner, men har på ingen måte etablert seg som en fullverdig konkurrent til eksisterende betalingsløsninger. I det norske markedet antas det at mobilbetaling endelig får sitt gjennombrudd i 2015, og med dette som b...

  6. Evaluation of demand integrated substations; Utvaerdering av funktionsintegrerad fjaerrvaermecentral

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Sofie; Werner, Sven [FVB Sverige AB, Boraas (Sweden)

    2005-07-01

    Demand integrated substations contain an intelligent control unit, which recently has been developed by NordIQ Goeteborg AB. The purpose with this project has been to evaluate the benefits of this intelligent control unit. This evaluation project has been based on field measurement of hourly heat supply, circulated water, forward- and return temperatures in six substations with a 12 month reference period with the existing substation and another 12 month evaluation period with a demand integrated substation. The results from the evaluation show that: - The annual heat delivery was reduced by 10-11 % in average, when a new demand integrated substation replaced an existing conventional substation in the same building. - The annual cooling of the district heat fluid increased by 10-11 deg C, giving lower return temperatures in the district heating systems. The annual volume of circulated water was reduced with 33,200 m{sup 3} from the initial 112,800 m{sup 3} during the reference year. - The daily variation of the customer heat demand became less bumpy from lower morning peaks and heat demands moved to evenings and nights. The financial benefit from the intelligent control unit estimated as net present value is higher than the cost for new conventional substations. Applied to the whole Swedish district heat sector, this benefit has an annual value of about 1,6-2,0 billion SEK (180- 220 million Euro), corresponding to 7-9 % of the current price level for district heat in Sweden.

  7. Spis ikke, med mindre helsa eller miljøet blir bedre! Om utviklingen i norske forbrukeres holdninger til genmodifisert mat

    Directory of Open Access Journals (Sweden)

    Trine Magnus

    2009-05-01

    Full Text Available I denne artikkelen drøfter vi hvordan norske forbrukeres holdninger til genmodifisert mat har endret seg gjennom årene. Allerede da genteknologi ble etablert som et eget forskningsfelt og utviklingsområde på 1980-tallet, viste den norske opinionen stor skepsis. Den norske lovgivningen tidlig på 1990-tallet utmerket seg også som den mest restriktive i Europa. Dette bildet endret seg ikke mye i løpet av 1990-tallet, mens opinionen i mange europeiske land i disse årene kom mer på linje med den norske. I hele denne perioden var både forbrukeropinionen og lovgivningen i USA langt mer aksepterende enn i Europa, noe som ga seg utslag i en handelskonflikt som toppet seg med EU sitt moratorium for utsetting av genmodifiserte planter i 1999. I denne artikkelen stiller vi spørsmålet om norske forbrukeres holdninger til genmodifisert mat har endret seg de siste årene. Artikkelen viser at mellom 2002 og 2007 er det en voksende gruppe av forbrukere som ser ut til å akseptere genmodifiserte matvarer hvis det fører til en helse- eller miljøgevinst (mindre sprøytemidler. Men til tross for dette så er nordmenn fremdeles skeptiske til genmodifisert mat. Det kan tolkes slik at genmodifisert mat ikke har ført til den nytten som ansees nødvendig for å ta den risikoen det innebærer å gjøre et betydelig skifte i matseddel. Matpatriotisme og en kulturell konservatisme når det gjelder skifte i matvaner bidrar også til å forklare den dominerende vente-og-se-holdningen.http://dx.doi.org/10.5324/eip.v3i1.1715

  8. Lærer- og elevmangfold i det livstolkingsplurale norske klasserommet – utfordringer og muligheter for lærerutdanningen

    Directory of Open Access Journals (Sweden)

    Sidsel Lied

    2009-05-01

    Full Text Available Med denne artikkelen ønsker jeg å gi et bidrag til diskusjonen om hvordan lærerutdanningen kan møte utfordringene fra et økt kulturelt mangfold i samfunnet. Siden mitt forsknings- og interessefelt er knyttet til mangfoldet på feltet livstolking, er artikkelens forskningsspørsmål og overordnede problemstilling: Hvordan kan lærerutdanningen møte de utfordringer og muligheter som det livstolkingsplurale norske klasserommet representerer? Delspørsmål jeg utforsker for å svare på dette, er: Hvordan kommer en livstolkingsplural virkelighet til uttrykk i grunnskolens og lærerutdanningens religions- og livssynsfag? Og: Hvordan kan lærerstudenters medvirkning i forskning bidra til å øke deres forståelse for de kravene det livstolkingsplurale norske klasserommet stiller til sine lærere? De empiriske prosjektene som inngår i arbeidet med å besvare forskningsspørsmålene, er utført i norsk offentlig grunnskole og allmenlærerutdanning. Det er naturlig å holde disse prosjektene sammen fordi all norsk lærerutdanning kvalifiserer sine studenter til å arbeide i grunnskolen. Ved å se på hvordan en livstolkingsplural virkelighet kommer til uttrykk i grunnskolens religions- og livssynsfag, vil en følgelig kunne si noe om hvordan deler av den skolehverdagen som norsk lærerutdanning kvalifiserer sine studenter for, ser ut. Dessuten vil en, ved å utforske hvordan en livstolkingsplural virkelighet kommer til uttrykk i lærerutdanningen, kunne si noe om hvordan utdanningen forventes å forberede sine studenter for denne yrkesutfordringen.

  9. Hvem vet best? Om styringen av grunnopplæringen under Kunnskapsløftet

    Directory of Open Access Journals (Sweden)

    Petter Aasen

    2010-12-01

    Full Text Available Emnet for artikkelen er iverksettingen av Kunnskapsløftet som styringsreform. Kunnskapsløftet ble av nasjonale utdanningsmyndigheter introdusert som en reform der forutsetningen for å lykkes innebar et systemskifte i styringen av norsk grunnopplæring. Klare nasjonale mål, kunnskap om resultater, tydelig ansvarsplassering, lokal handlefrihet og et godt støtte- og veiledningsapparat skulle være bestanddelene. Artikkelens problemstilling er denne: Hva var statlige myndigheters uttalte intensjoner med systemskiftet, og hvordan oppfatter og vurderer skoleeiernivået den nye styringsmodellen for grunnopplæringen? Artikkelen bygger på prosjektet Evaluering av Kunnskapsløftet - Forvaltningsnivåenes og institusjonenes rolle. Prosjektets datamateriale inkluderer alle forvaltningsnivå (sentralstat, regionalstat, skoleeiere, skoler, lærebedrifter og rommer både kvalitative og kvantitative data. I denne artikkelen bygger fremstillingen av intensjonene bak systemskiftet på dokumenter i reformforarbeidene. Kommuner og fylkeskommuners forventninger til og vurderinger av det signaliserte systemskiftet avdekkes via kvalitative intervju blant utvalgte skoleeiere, som dermed gir innblikk i oppfatninger av systemskiftet generelt og rolle- og ansvarsfordelingen spesielt. Spørreskjemadata fra skoleeiernivået synliggjør allmenne vurderinger av styringsreformen og sier noe om de kvalitative funnenes utbredelse. Funnene våre tyder på at Kunnskapsløftets signaliserte systemskifte ikke virker etter hensikten. Blant skoleeierne er det generelt uklart hva systemskiftet innebærer. Det er heller ingen utbredt oppfatning av at det faktisk skjer endringer i styringer av grunnopplæringen i den retningen reformen la opp til. I vår analyse av forholdet mellom forvaltningsnivåene har vi lagt særlig vekt på spørsmålene om tydelig ansvarsplassering og lokal handlefrihet. Skoleeierne erfarer ikke stor lokal handlefrihet. Fristillingen følges og begrenses

  10. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  11. Lungekreft blant norske nikkelverksarbeidere: Nytt lys på en klassisk studie

    Directory of Open Access Journals (Sweden)

    Tom Kristian Grimsrud

    2009-11-01

    Full Text Available  SAMMENDRAGI 1973 ble det påvist økt risiko for lunge- og nese-/bihulekreft blant norske nikkelverksarbeidere i en epidemiologiskundersøkelse fra Kreftregisteret. Analysene var basert på 48 lungekrefttilfeller, og man fant atrisikoen var høyest i den gruppen som hadde lengst ansettelse i roste-, smelte- og elektrolyseavdelingene.Tilsvarende funn var tidligere gjort blant nikkelarbeidere i andre land, og undersøkelsen vakte oppsikt fordiforhøyet risiko også ble funnet blant ansatte i elektrolysen. Senere analyser med spesifikke eksponeringsdatahar vist at kreftfaren er nært knyttet til eksponering for vannløselige nikkelformer. Nye data er nå blitt samletinn i forbindelse med en pasient-kontroll-undersøkelse basert på 213 tilfeller av lungekreft og 525 kontrollpersoner.På bakgrunn av opplysningene er relativ risiko regnet ut ved hjelp av regresjonsmodeller derfølgende faktorer var inkludert: total varighet av ansettelse ved bedriften, eller varighet av ansettelse i ulikeavdelinger, tidspunkt for førsteansettelse og røykevaner. Resultatene fra pasient-kontroll-analysen bekreftetfunnene fra 1973 når disse ble regnet om til relativ risiko, og tydet på at konklusjonene fra den gang varvalide selv om analysene var basert på færre arbeidstakere, kortere observasjonstid, en forenklet inndelingav arbeidstakerene i henhold til deres avdelingshistorikk, og manglende opplysninger om røykevanene.Grimsrud TK. Lung cancer among Norwegian nickel-refinery workers: Reappraisial ofa classical study. Nor J Epidemiol 2001; 11 (2: 171-176.  ENGLISH SUMMARYIn 1973, increased risk of cancer of the lung and nasal cavities was demonstrated among Norwegian nickelworkers in a study from The Cancer Registry of Norway (Kreftregisteret. The analyses were based on 48cases of lung cancer and the highest risk was found in workers with the longest employment in the electrolysis,roasting, and smelting departments. The study gave supportive evidence to

  12. Bruken av nasjonale prøver

    DEFF Research Database (Denmark)

    Skov, Poul

    2010-01-01

    Artiklen beskriver resultater fra en omfattende evaluering af brugen af de nationale prøver i norsk grundskole. De nationale prøver er blevet modtaget positivt af mange kommuner og skoleledere og i mindre grad af lærerne. Resultaterne viser også, at prøverne er styrende for undervisningen, at bru...

  13. "Snaprevyen" : en studie av NRKs nyhetsformidling på Snapchat under det amerikanske presidentvalget i 2016

    OpenAIRE

    Restad, Julie Stenset

    2017-01-01

    Nyheter er ikke lenger bare forbeholdt massemediene. Norske nyhetsaktører har den siste tiden for alvor begynt å ta i bruk sosiale medier for å formidle nyheter, også Snapchat. I motsetning til tidligere studier som ser på bruksmåter av Snapchat, vil denne studien se på hvilke grep avsender tar i bruk for å formidle nyheter i applikasjonen. Denne masteroppgaven tar for seg hvordan den norske allmennkringkasteren NRK har tatt i bruk den sosiale medie-plattformen Snapchat til å formidle nyheter...

  14. Etisk kompetanseheving i norske kommuner – hva er gjort, og hva har vært levedyktig over tid?

    Directory of Open Access Journals (Sweden)

    Elisabeth Gjerberg

    2014-11-01

    Full Text Available De senere år har pleie- og omsorgstjenesten i mange norske kommuner startet med ulike former for etikkarbeid, oftest initiert av KS’ prosjekt “Samarbeid om etisk kompetanseheving”. Hensikten med vår studie var å evaluere innsatsen i de kommunene som deltok i prosjektet fra starten av, med vekt på hvilke tiltak som var iverksatt, hvilke virksomheter dette omfattet, og om tiltakene har fortsatt utover prosjektperioden. Studien har et kvalitativt design. Materialet er hovedsakelig basert på telefonintervjuer med kontaktpersoner for etikksatsingen i 34 kommuner. Det transkriberte materialet er analysert ved kvalitativ innholdsanalyse. Med unntak av fem kommuner som aldri kom i gang med etikkarbeidet, hadde de fleste startet etikkrefleksjon innenfor flere tjenester, oftest i sykehjem og hjemmetjenester. Noen kommuner hadde imidlertid ikke klart å videreføre etikkarbeidet utover en prosjektperiode. Det var stor variasjon både i etikkarbeidets forankring i kommunen, omfang, hyppighet og metoder. Et gjennomgående funn er vektlegging av behovet for etikkkompetanse og oppfølging av dem som skal lede etikkarbeidet. Flertallet av kommunene som fortsatt gjennomfører etikkrefleksjon, tar utgangspunkt i egen praksis, men et mindretall anvender strukturerte metoder. Dersom etikkarbeidet i kommunen skal være levedyktig over tid, bør arbeidet forankres på flere nivåer i organisasjonen, og de som skal lede dette arbeidet, bør få styrket sin kompetanse i etikk og etikkrefleksjon.Nøkkelord: etikk, evaluering, kommunehelsetjenestenEnglish summary: Building ethical competence in Norwegian municipalities: What has been done and what has been sustainable?“Cooperation for building ethics competence” is a national project aimed to stimulate moral reflection and build competence in ethics in community health services in Norway. This article is based on an evaluation of the activities implemented by the first 34 participating municipalities

  15. Eldre i sykehjem. Hvordan utøve sykepleie som ivaretar beboerens opplevelse av personlig integritet i hverdagen?

    OpenAIRE

    Knutsen, Mari; Røsåsen, Line

    2011-01-01

    NORSK: Hovedfokuset i denne studien er ivaretakelsen av personlig integritet hos eldre beboere i sykehjem. Personlig integritet beskrives som anerkjennelse og respekt for den enkelte beboer, dens unike identitet, selvforståelse og selvbestemmelse. Faktorer som kan krenke den personlige integriteten i hverdagen i sykehjem blir også omtalt. Sykepleien beskrives med fokus på betydningen av at beboere i sykehjem opplever at deres personlige integritet blir ivaretatt. Vi støtter oss til Joyce T...

  16. Veileder for kravspesifikasjon for leie av kontorarealer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne

    Investorer og leietakere blir stadig mer interessert i helse- og miljøkvaliteter. Men kunnskapen er lav hos de fleste om hva de skal etterspørre og hvordan slike kvaliteter kan dokumenteres. Meglere har en viktig rolle som formidler av kvaliteter. Grønn Byggallianse har i samarbeid med blant annet...... Norsk Eiendom, Enova og NGBC utarbeidet en mal for standard kravspesifikasjon for leie av kontorlokaler. Målet med malen er å bidra til at leietager får det produktet han trenger til riktig pris og at man unngår unødig miljøbelastning. Målet er videre at å bidra og stimulere til, at innleie....../utleie prosesser startes med en dialogbasert prosess. Standarden er tenkt som et hjelpemiddel til en systematisk gjennomgang av, og diskusjon av hvilke kvaliteter som har prioritet, høy, middel eller lav prioritet for leietaker. Resultatet av dialog og diskusjon fastlegger endelige krav til kvalitet og...

  17. Evaluation of strategies for end storage of high-level reactor fuel; Vurdering av strategier for sluttlagring av hoeyaktivt reaktorbrensel

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    This report evaluates a national strategy for end-storage of used high-level reactor fuel from the research reactors at Kjeller and in Halden. This strategy presupposes that all the important phases in handling the high-level material, including temporary storage and deposition, are covered. The quantity of spent fuel from Norwegian reactors is quite small. In addition to the technological issues, ethical, environmental, safety and economical requirements are emphasized.

  18. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  19. Etikk i anvendt idrettspsykologi: en kvalitativ studie av idrettspsykologiske rådgiveres etiske utfordringer i anvendt idrettspsykologi, og håndtering av disse

    OpenAIRE

    Ulltang, Espen

    2015-01-01

    Masteroppgave - Norges idrettshøgskole, 2015 Idrettspsykologi er et fag som arbeider for å utvikle mentale ferdigheter hos utøvere og trenere. De som arbeider med anvendt idrettspsykologi møter en rekke etiske utfordringer i sin praksis, men kunnskap om dette synes mangelfullt i Norge. Internasjonalt er det publisert en rekke essays, artikler, og bøker om etiske utfordringer i anvendelsen av faget, men ingen studier viser hvordan norske idrettspsykologiske rådgivere opplever sl...

  20. Mat som egner seg til kos : en kvalitativ studie av hva barneskoleelever i Oslo mener om kosemat

    OpenAIRE

    Bremer, Torgeir

    2013-01-01

    Sammendrag Bakgrunn: Barns kosthold er viktig i et folkehelseperspektiv, ettersom et dårlig kosthold identifiseres som en av de viktigste årsakene til overvekt. I tillegg er barndommen en tid i livet hvor grunnlaget for helse og kostholdsvaner legges. Overvekt hos barn er et betydelig problem i Norge, og norske barn har et kosthold som blant annet inneholder for mye fett og sukker. Å kose seg med mat er et velkjent fenomen i det norske kostholdet, og handler tilsynelatende om å spise usunn...

  1. Multinational evaluation of the interpretability of the iterative method of optimisation of AV delay for CRT.

    Science.gov (United States)

    Raphael, Claire E; Kyriacou, Andreas; Jones, Siana; Pabari, Punam; Cole, Graham; Baruah, Resham; Hughes, Alun D; Francis, Darrel P

    2013-09-20

    AV delay optimisation of biventricular pacing devices (cardiac resynchronisation therapy, CRT) is performed in trials and recommended by current guidelines. The Doppler echocardiographic iterative method is the most commonly recommended. Yet whether it can be executed reliably has never been tested formally. 36 multinational specialists, familiar with using the echocardiographic iterative method of CRT optimisation, were shown 20-40 sets of transmitral Doppler traces at 6-8 AV settings and asked to select the optimal AV delay. Unknown to the specialists, some Doppler datasets appeared in duplicate, allowing assessment of both inter and intra-specialist interpretation. On the Kappa scale of agreement (1 = perfect agreement, 0 = chance alone), the agreement regarding optimal AV delay between specialists was poor (kappa=0.12 ± 0.08). More importantly, agreement of specialists with themselves (i.e. viewing identical sets of traces, twice) was also poor, with Kappa=0.23 ± 0.07 and mean absolute difference in optimum AV delay of 83 ms between first and second viewing of the same traces. Iterative AV optimisation is not executed reliably by experts, even in an artificially simplified context where biological variability and variation in image acquisition are eliminated by use of identical traces. This cannot be blamed on insufficient skills of some experts or discordant methods of selecting the optimum, because operators also showed poor agreement with themselves when assessing the same trace. Instead, guidelines should retract any recommendation for this algorithm. Guideline-development processes might usefully begin with a rudimentary check on proposed algorithms, to establish at least minimal credibility. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  2. Vurdering av andrespråksinnlærere - en utfordring i skolen

    Directory of Open Access Journals (Sweden)

    Kirsten Palm

    2014-06-01

    Full Text Available Vurdering av andrespråkselevers språkkompetanse og språkutvikling er en sentral del av læreres arbeid, og forskning har vist at dette er en utfordring for skolene. Det er stor variasjon i vurderingsformer, og skolene mangler ofte vurderingskompetanse. På bakgrunn av dette utarbeidet Utdanningsdirektoratet i 2007 vurderingsverktøyet Kartleggingsmateriell. Språkkompetanse i grunnleggende norsk for språklige minoriteter. Materiellet er utarbeidet blant annet med referanse til Common European Framework of Reference for Languages (CEFR. I artikkelen redegjør vi for en undersøkelse der målet var å finne ut hvorvidt dette kartleggingsmateriellet er hensiktsmessig for å vurdere andrespråkselevers språkkompetanse. Hoveddataene er innhentet gjennom kasusstudier ved tre grunnskoler, der vi intervjuet skoleledelse og lærere samt observerte kartleggingssituasjoner og klasseromsundervisning. Kasusstudiene ble senere fulgt opp av to spørreundersøkelser, én til de samme skolene, og én til et større antall skoler for å få bredere innsikt i kartleggingspraksis og skolers oppfatninger av denne formen for vurdering. Undersøkelsen viser at flere av informantene mener verktøyet kan bidra til mer tilpasset og systematisk andrespråkopplæring og bedre vurdering av andrespråkselevenes språkkompetanse. Samtidig er det utfordringer knyttet til å bruke vurderingsverktøyet, dette skyldes blant annet mangelfull kompetanse i skolen når det gjelder andrespråkstilegnelse og vurdering av elevenes språkkompetanse. Det er ikke tidligere forsket på bruk av et slikt konkret kartleggingsverktøy i norsk grunnskole. Undersøkelsen kan gi et bidrag til økt kunnskap om vurdering av andrespråkskompetanse og tilpasset undervisning for andrespråksinnlærere.

  3. ”I sangen møtes vi på felles grunn.” Om sang og sangbøker i norsk skole.

    Directory of Open Access Journals (Sweden)

    Ragnhild Elisabeth Lund

    2010-12-01

    Full Text Available Sangfaget har en lang og sterk tradisjon i den norske skolestua og sangboka har vært et sentralt læremiddel i mer enn 150 år. Formålet med denne artikkelen er å belyse de mange og ulike begrunnelser som er blitt knyttet til faget opp gjennom tidene og å vise hvilket innhold sangbøkene har søkt å formidle. Presentasjonen av sangfagets begrunnelser er basert på en undersøkelse av skolehistoriske tekster og læreplaner fra tidlig på 1800-tallet fram til vår tid. Jeg har også sett på forordene og forfatternes vektlegging av sangrepertoar og annet sang- og musikkfaglig innhold i de mest toneangivende sangbøkene fra samme periode. For å finne ut hvilke sanger elevene er blitt tilbudt og hvilke verdier sangene formidler, har jeg kartlagt repertoarvalget i tolv sangbokverk fra 1850 (Behrens’ Skolesangbog til 2008 (Amsrud & Bjørnstads Sang i Norge. Artikkelen viser at begrunnelsene for sangfaget favner vidt og at både de og innholdet i sangbøkene har endret seg i takt med utviklingen i utdanningssystemet og i samfunnet forøvrig. Videreformidling av sentrale sanger i norsk kulturarv har selvsagt stått sentralt. Men sangfaget har også befattet seg med opplæring i musikkteori, notelære og stemmepleie, og det har hatt som oppgave å utvikle kvalitetsbevissthet, samhold og fellesskap i tillegg til å bidra til læring og trivsel i andre fag. Når det gjelder repertoarvalg, har utviklingen gått fra en hovedvekt på sanger med et religiøst og oppdragende innhold via nasjonale sanger til en stadig økende andel ”blott-til-lyst-sanger” og sanger fra populærmusikkens område. Til tross for at repertoarvalget har endret seg, er det mange sanger som går igjen gjennom hele perioden. Med referanse til en definisjon av kanon som ”stabile forekomster” identifiserer artikkelen 34 sanger som kan sies å utgjøre en del av ”den norske sangskatten”.

  4. Evaluation of subsidy for electricity savings in households; Evaluering av tilskuddsordning for elektrisitetssparing i husholdninger

    Energy Technology Data Exchange (ETDEWEB)

    2010-04-15

    Ramboll Management Consulting (Ramboll) has on behalf of Enova SF (Enova) conducted an evaluation of the 'Grant Scheme for electricity savings in households'. The evaluation is conducted in the period January to March 2009, Ramboll is solely responsible for all the analysis, conclusions and recommendations in the report. The evaluation conducted on the basis of a review of the grant assessed on the basis of six evaluation themes. The evaluation will form the basis for further work on the grant by Enova and in their reporting to the Ministry of Petroleum and Energy (OED). (AG)

  5. Forever Young - den norske tv-serie Skam

    DEFF Research Database (Denmark)

    Jerslev, Anne

    2016-01-01

    Hvorfor er det lige, at den norske netbaserede ungdomsserie "Skam" er på alles læber for tiden? Svaret er simpelt: Den er nyskabende og supergod, og den taler til en langt bredere målgruppe end den gruppe af teenagepiger, den er rettet mod....

  6. Evaluation of an accelerated mineralization process for ashes - feasibility study; Evaluering av jordmaansbildande askbehandlingsprocess (EJA) - foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Ecke, Holger; Bjurstroem, Henrik

    2005-03-01

    In Japan, expenses for landfilling yield about 400 USD per ton of ash, which gives an incentive to reduce the amount of landfilled ash. At NIES (National Institute for Environmental Studies) in Tsukuba, Japan, the AMT process (Accelerated Mineralization Technology) was developed aiming at the treatment of ashes and production of soil-like material for reuse. The objective of the project EJA was to evaluate the AMT process on the basis of available information and the possibilities the process could offer with respect to the conditions present in Sweden. With support of researchers at NIES, available literature including unpublished manuscripts on the AMT process was compiled, translated and evaluated. During treatment, the ashes are washed, aged and mixed with up to 5 % by weight of biodegradable organic matter. The material is stabilized at landfill. During up to several decades, metals are demobilized through a combination of three mechanisms, viz. carbonation, clay formation, and humification. Also persistent organic pollutants (POP) are demobilized due to humification products or they are degraded anaerobically. When the treatment is completed, the reuse of the material is envisaged. Due to the long treatment period, the AMT method might not be favored by ash producers in Sweden. In the future, landfill companies could be interested in the technology, since they are experienced to handle waste at long sight. This, however, requires that the legislation does not pose any hindrance for the implementation of the method, e.g. regarding the requirement to add organic matter to the ash. Above all, it remains several years of research on the AMT process to fully understand and evaluate the underlying biological and chemical processes as well as their interaction.

  7. Evaluation of programme for energy management in buildings; Evaluering av program for energiledelse i bygg

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    Enova SF needed to evaluate the programmes for energy management for greater and smaller building owners. The question was: What has been the impact of the Buildings Network and the energy management programmes for greater and smaller building owners on energy conservation and economic life , and are the programmes operated efficiently? The buildings which participated in the Buildings Network in 1996 - 2002 had an average reduction of the energy consumption of about 7 per cent, which is somewhat less than the supposed potential of 10 per cent. There is some uncertainty in this calculation and the true figure is probably 1 or 2 per cent higher. Whether this energy conservation tendency has continued after Enova took over the responsibility for the programme in 2002 is too early to measure. It is very probable that the public support to the projects has triggered off the saving, that is, there has been few free riders. After 2002, Enova has made the programme more efficient and the cost per building has been halved in the period 2001 - 2003. But some of the original infrastructure of the programme has been discontinued.

  8. Exploring factors influencing training transfer in Norsk Hydro

    OpenAIRE

    Calkins, Elizabeth Rachael

    2016-01-01

    Organizations in North America and Europe invest heavily in training programs for their employees in hopes that such programs will lead to business impact. Yet, the extent to which these programs give sufficient returns are unclear. This study explored how the factors training reputation, perceived benefits, supervisor support, and pretraining motivation influence training transfer. This study sampled 72 participants across three training programs in Norsk Hydro, a multinational organization....

  9. 75 FR 43531 - Medicare and Medicaid Programs; Application by Det Norske Veritas Healthcare for Deeming...

    Science.gov (United States)

    2010-07-26

    ... notice with comment period acknowledges the receipt of an application from Det Norske Veritas Healthcare... HUMAN SERVICES Centers for Medicare & Medicaid Services Medicare and Medicaid Programs; Application by Det Norske Veritas Healthcare for Deeming Authority for Critical Access Hospitals (CAHs) AGENCY...

  10. Biobanken i Den norske mor og barn undersøkelsen

    Directory of Open Access Journals (Sweden)

    Kjersti S. Rønningen

    2009-10-01

    Full Text Available  Biobanker for langtidslagring av biologisk materiale blir en viktigere og viktigere del av epidemiologiske studier. I planleggingen av en biobank er det en rekke avgjørelser som må tas for å sikre best mulig oppslutning både med hensyn til å få inn så mange prøver som mulig og å oppnå best mulig prøvekvalitet både på kort og lang sikt. Den norske mor og barn undersøkelsen (MoBa skal inkludere 100 000 svangerskap og følge mor, far og barn i lang tid fremover. Innsamlingen av data startet i ett fylke i 1999, og omfatter i dag hele landet. Siden det tas blodprøver to ganger fra hver kvinne, blodprøve fra far og navlesnorsblod frabarna, betydde dette at Biobanken for MoBa måtte planlegges for å kunne motta og langtidslagre over 380 000 prøvesett. Ved Biobanken ved Nasjonalt folkehelseinstitutt lagres fullblod, plasma, urin, DNA og spesialrør til senere RNA isolering. Rekruttering til MoBa foregår ved 52 av landets sykehus. Prøvene sendes per post til Biobanken ved Folkehelseinstituttet for prosessering. Per januar 2006 er over 200 000 prøvesett lagret ved Biobanken. Denne artikkelen gir en kortfattet oversikt over oppbyggingen av Biobanken og logistikken knyttet til innsamlingen av biologisk materiale, fra blodet tappes til det er sikkert lagret og klart til å tas ut på et senere tidspunkt, kanskje mange år inn i fremtiden.The biobank in The Norwegian Mother and Child Cohort Study.Long term storage of biological material is becoming a critical component of many epidemiological studies. In designing specimen repositories, efforts need to be made to balance future needs for samples with logistical constraints necessary to process and store samples in a timely fashion. The Norwegian Mother and Child Cohort Study was started in 1999 and aims at including 100,000 pregnancies, and will follow mother, father and child for many years to come. The Biobank was faced with the challenge to receive and store over 380,000 biological

  11. Evaluation of the energy component in the main grid tariff and the use of marginal loss rates; Evaluering av energileddet i sentralnettstariffen og bruk av marginaltapssatser

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Endre; Bjoerndal, Mette

    2010-11-15

    In this report, we make an evaluation of the energy component of the central grid tariff and the use of marginal loss rates. We will first review the theory of optimum transmission tariffs and describes how the marginal loss rates are calculated and how these are used in combination with the system price in the current transmission costs. We describe the trend in the Swedish marginal loss schedule, and we refer the very short development in the PJM area (U.S. east coast). As the Swedish and the Norwegian system is apparently based on the same principles, we problematize the lack of harmonization, since the systems actually are now very different. There is little doubt that Statnett has refined and improved methods for calculating the marginal loss rates, while ensuring that bottlenecks are still handled fairly easy by a few large price areas on Nord Pool Spot. We discuss the relationship between loss-tariff and congestion management, and we recommend that Statnett considering using the area price as the settlement price. This will make it much easier for operators to take account of losses. (Author)

  12. Kommunikasjonskultur i sosiale medier i Japan og Norge. Sammenlikning av smarttelefon-apper mellom LINE og Facebook Messenger

    OpenAIRE

    Abumi, Asaki

    2015-01-01

    Denne oppgaven analyser hvordan norske og japanske brukere kommuniserer på sosiale medier på smarttelefoner. Analysen er basert på en spørreundersøkelse med 20 deltagere fra Japan som bruker appen LINE, og 20 deltagere fra Norge som bruker Facebook Messenger. Informantene består av unge universitetsstudenter fra 18 til 25 år. Resultatene viser blant annet at japanere foretrekker LINE fordi den har et stort utvalg av søte sticker, som gjør kommunikasjon lettere for japanere som bor i et stort ...

  13. Elever med atferdsproblemer i skolen – Hvordan ser de på seg selv og hvordan ser læreren på dem? En sammenligning av sosiale og faglige faktorer.

    OpenAIRE

    Tørrissen, Ann-Kristin

    2017-01-01

    Mastergradsoppgave i tilpasset opplæring, Avdeling for lærerutdanning og naturvitenskap, Høgskolen i Innlandet, 2017. Norsk: Denne masteroppgaven er skrevet ved Høgskolen i Innlandet under studiet Master i tilpasset opplæring, og ble ferdigstilt våren 2017. Et relevant begrep her, er det den norske skolen skal være bygd på: Fellesskolen – en skole for alle! Dette er utgangspunktet for vårt læreplanverk K06, der alle uavhengig av egne forutsetninger skal få en likeverdig og tilpasset opp...

  14. Potential and barrier study. Energy efficiency of Norwegian homes; Potensial- og barrierestudie. Energieffektivisering av norske boliger

    Energy Technology Data Exchange (ETDEWEB)

    Mjoenes, Christian; Pettersen, Folke Vogn Haug; Kristoffersen, Bjoerge Sandberg; Birkeland, Bjoern Mangor; Essen, Jan von; Haarberg; Karl Johan

    2012-01-15

    On behalf of Enova SF, Prognosesenteret AS and Entelligens AS carried out a potential and barrier study of energy efficiency of the Norwegian housing stock. The study made use of newer and known studies of the Norwegian housing stock, known and documented barriers to energy efficiency, and new and extensive studies of several topics which have only been partially or never explored before. Through unique analysis and a case-based approach, it revealed a real energy efficiency potential in Norwegian homes with known technology and revealed representativeness, relevance, strength and extent of the barriers that prevent that one can realize most of the technical energy efficiency potential in the Norwegian housing stock. (eb)

  15. Hva kan norsk skole lære av PISA-vinneren Finland?

    Directory of Open Access Journals (Sweden)

    Svein Østerud

    2016-05-01

    Full Text Available During the last two decades, we have seen an increasing globalization of the education sector, in particular expressed through the implementation of international tests organized by OECD. The use of international tests as a policy tool has been legitimized within international educational development for the purpose of measuring education quality. The normative power of high-stakes standardized testing can be understood as a global testing culture, particularly associated with the three-yearly Student Assessment (PISA in reading, mathematics and science. The testing culture permeates all aspects of school life, creating an atmosphere of competition not only between schools, but also between countries. At the top of the ranking lists of the participating countries we find Finland; their students do slightly better than the students in Singapore and Canada. Paradoxically enough, the Finnish people busy themselves less with the PISA Assessments than people in many other countries, and have kept OECD's New Public Management-oriented reform proposals at a distance. The Finns have always stuck to their locally based school: the authorities have given the highly educated teachers confidence and professional autonomy. There is no doubt that we can learn from the Finnish school system, but not by imitating it. The success of the Finnish school is due to a complex interaction of several factors. Only to the extent that we acknowledge this, can we draw inspiration and guidance from Finnish education for our own school development.

  16. Polske foreldre i norsk skole: en kvalitativ studie av hjem-skolesamarbeid

    OpenAIRE

    Roland, Lidia

    2013-01-01

    Revised version: Spelling errors corrected As a result of the EU expansion in 2004, a number of Polish labour-immigrants have migrated to Norway. Poles currently make up the largest group of immigrants in the country. In this thesis I have focused on collaboration between Polish parents and Norwegian schools. Based on the research question: how does the collaboration between Polish parents and Norwegian school work, viewed from both perspectives , I have carried out qualitative interviews ...

  17. Mangfoldsstrategier i arbeidslivet: En case-studie av 5 norske virksomheter

    OpenAIRE

    Øiaas, Susanne Hellan

    2013-01-01

    The focus on diversity is relatively new in the Norwegian labor market but its expansion is comparable to other European countries. Due to the changing contours of the population outlook in Norway and the large demand of labor, there is a challenge faced by different actors in the processes of formulating and implementing social policies. These confrontations include factors such as qualification, training, facilitation, racism and other forms of discrimination. Along with political and legal...

  18. Norwegian gas export policy - management of external change; Norsk gasseksportpolitikk - haandtering av ytre endring

    Energy Technology Data Exchange (ETDEWEB)

    Claes, Dag Harald

    1997-12-31

    This report is the first study in the research project `` Norwegian gas policy - external change and national adaptation``. The project is financed through Norges forskningsraad`s research program ``Petropol``. The main aim of the project is to understand the market, political and institutional changes in the European gas market as well as what implications they may have for the political and institutional design of the Norwegian gas sector. In this report an approach model is developed for studying the connection between changes in the European gas market and the Norwegian petroleum policy which will be central in several of the later works in the project. The report gives a historic account of Norwegian gas export policy as well, a field where altered frame conditions have given the authorities political and institutional challenges. The main focus in the report is however, connected to the empirical explanation of the connection between changed external environments and alterations in the Norwegian gas export policy. The question the study tries to answer is: To what extent and how the Norwegian gas export policy is affected by alterations in the European gas market and the EU policy towards this market. In the centre of the study of the gas export policy is the element of governmental control. The governmental control assumes ability to formulate national aims as well as the ability to produce laws and regulations which reflects the goals and counts on that the aims are reached in addition to that the authorities either implement the policies themselves or if this is left to other parties, have ability to survey and sanction these parties should they break the guidelines or oppose the national political aims. The report shows how these aspects are affected by changes in the environments surrounding the Norwegian gas export. 6 figs., 1 tab., 45 refs

  19. Grønne Transportvalg - En sosiologisk analyse av norske elbilister

    OpenAIRE

    Skjelde, Christian

    2017-01-01

    Over the past few years there has been an increase in the amount of consumers that choose to drive an electric car in their everyday lives. Economic and psychological models dominate large segments of research associated with this topic and these models are based on whether or not the choice of driving an electric car is individual. Thus, these models do not take into account social and contextual factors. In this thesis I wish to investigate how the social aspect can affect whether or not a ...

  20. Analysis of Norwegian bio energy statistics. Quality improvement proposals; Analyse av norsk bioenergistatistikk. Forslag til kvalitetsheving

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    This report is an assessment of the current model and presentation form of bio energy statistics. It appears proposed revision and enhancement of both collection and data representation. In the context of market development both in general for energy and particularly for bio energy and government targets, a good bio energy statistics form the basis to follow up the objectives and means.(eb)

  1. Potential and barrier study. Energy efficiency of Norwegian homes; Potensial- og barrierestudie. Energieffektivisering av norske boliger

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-01

    Enova has identified potentials and barriers for energy efficiency in Norwegian buildings. This report summarizes the results of this work. Efficient energy in buildings is important to ensure that future economic activity and growth can occur in a way that reduces the possibilities for an environmentally and economically sound development. (eb)

  2. Simulations of the development in the Nordic power market; Simuleringer av utviklingen i det norske kraftmarkedet

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    This report examines the development of prices, production, trade and CO{sub 2} emission in the power markets in Scandinavia and Germany up to 2012. Simulations of a reference course indicate relatively strong growth of the power consumption. In combination with a modest development of the capacity in the short run, the growing consumption causes the prices to rise. Little by little it becomes profitable to build new gas power in Norway and Germany and a common quota market for CO{sub 2} emissions makes it possible. Sweden and Finland will have an increasing power deficiency. The results vary in step with the variation in water supply but the adaptation is largely taken in the Nordic countries: in dry years, consumption is considerably reduced while the import from Germany increases modestly. Increasing the CO{sub 2} tax with 150 per cent increases the prices and lowers the CO{sub 2} emission, but not enough to comply with the Kyoto agreement. The impact of a new nuclear power plant in Finland will be less gas power and reduced emission of CO{sub 2} in Norway. Finally, the calculations show that a scenario for which the climate goals are to be fulfilled nationally requires strong measures in the form of retrenchment on the consumer side, and the development of new capacity based on renewable energy sources in addition to scrapping and converting coal power plants.

  3. Kartlegging av kreftrisiko og årsakspesifikk dødelighet blant ansatte i norsk offshorevirksomhet

    Directory of Open Access Journals (Sweden)

    Leif Åge Strand

    2009-11-01

    Full Text Available  ENGLISH SUMMARYStrand LÅ. Cancer risk and cause-specific mortality among workers in the Norwegian offshoreoil industry. Nor J Epidemiol 2001; 11 (2: 137-142.The Cancer Registry of Norway has, in collaboration with the Norwegian oil industry association, started aproject investigating cancer risk and cause-specific mortality among workers in the Norwegian offshore oilindustry. The project started in 1996 by identifying the 61,300 present and former workers on the platformson the Norwegian continental shelf. The main contributors to the crew lists were oil companies, contractingcompanies, labour unions, safety training schools, and the national archives of Norway. In 1998 a selfadministeredquestionnaire was distributed by mail to the 57,000 workers alive and living in Norway. Thequestionnaire included questions on offshore job history, other occupations, leisure activities, and life-stylefactors such as smoking, alcohol consumption and nutrition.The study design of the project is a prospective cohort study, where cancer incidence and mortalityamong the exposed (the offshore workers will be compared with the non-exposed (the general population.Factors known to cause cancer and other diseases in other industries are probably present in the offshorework environment. The offshore workers may also be exposed to harmful agents more or less specific forthe work on the platforms, such as crude oil, gas, and drilling mud. Intense work periods and long leaveperiods, a diet rich in fat and calories, cheap tobacco, a ban on alcohol consumption on the platform, andworry about helicopter flights and platform safety are also factors that may influence the workers' health.The overall response rate was 62%. The collected material will constitute a basis for research in thecoming decades. With regular intervals the cohort will be linked to the cancer database in the CancerRegistry and the Cause of Death Registry at Statistics Norway.Because they are a highly selected group, the offshore workers as a whole will probably be as healthy asthe general population, yet excesses in cancer incidence and certain causes of death among the most exposedworkers (i.e., maintenance workers, drilling personnel, welders, painters and cleaners are expected. 

  4. Use of radiographic diagnostics among Norwegian dentists; Bruk av roentgendiagnostikk blant norske tannleger

    Energy Technology Data Exchange (ETDEWEB)

    2009-07-01

    Norwegian Radiation Protection Authority has conducted a survey of X-ray use among Norwegian dentists as well as inspection and measurement technical control of x-ray equipment. Radiation protection regulations were not well known among dentists, only 53% had made periodic service agreement with the supplier and it was revealed deviations at entire 43% of the investigated X-ray machines. (AG)

  5. Endovascular image-guided treatment of in-vivo model aneurysms with asymmetric vascular stents (AVS): evaluation with time-density curve angiographic analysis and histology

    Science.gov (United States)

    Dohatcu, A.; Ionita, C. N.; Paciorek, A.; Bednarek, D. R.; Hoffmann, K. R.; Rudin, S.

    2008-03-01

    In this study, we compare the results obtained from Time-Density Curve (TDC) analysis of angiographic imaging sequences with histological evaluation for a rabbit aneurysm model treated with standard stents and new asymmetric vascular stents (AVS) placed by image-guided endovascular deployment. AVSs are stents having a low-porosity patch region designed to cover the aneurysm neck and occlude blood flow inside. To evaluate the AVSs, rabbits with elastase-induced aneurysm models (n=20) were divided into three groups: the first (n=10) was treated with an AVS, the second (n=5) with a non-patch standard coronary stent, and third was untreated as a control (n=5). We used TDC analysis to measure how much contrast media entered the aneurysm before and after treatment. TDCs track contrast-media-density changes as a function of time over the region of interest in x-ray DSA cine-sequences. After 28 days, the animals were sacrificed and the explanted specimens were histologically evaluated. The first group showed an average reduction of contrast flow into the aneurysm of 95% after treatment with an AVS with fully developed thrombus at 28 days follow-up. The rabbits treated with standard stents showed an increase in TDC residency time after treatment and partial-thrombogenesis. The untreated control aneurysms displayed no reduction in flow and were still patent at follow-up. The quantitative TDC analysis findings were confirmed by histological evaluation suggesting that the new AVS has great potential as a definitive treatment for cerebro-vascular aneurysms and that angiographic TDC analysis can provide in-vivo verification.

  6. Universell utforming og den vanskelige avgrensingen av «alle»

    Directory of Open Access Journals (Sweden)

    Lars Christian Risan

    2013-12-01

    Full Text Available Universell utforming er et prinsipp hvor målsetningen er at «utforming av produkter og omgivelser [skal skje] på en slik måte at de kan brukes av alle mennesker, i så stor utstrekning som mulig, uten behov for tilpassing og en spesiell utforming.» (Aslaksen mfl, 1997, den første norske definisjonen I løpet av de siste 15 årene har dette prinsippet blitt fremmet i Norge som et utvetydig fremskritt. Det kan imidlertid være farlig å tro at en ren teknisk løsning kan bygge bro over politiske kontroverser (Imrie 2012, og i denne artikkelen vil vi vise hvordan viktige ideologiske premisser er skjult under paraplyen om universalitet. Vårt empiriske felt er norsk boligpolitikk fra etterkrigstiden og fram til i dag. Innenfor dette feltet ser vi at det har vært argumentert for ulike versjoner av «universell utforming» de siste 40 årene, selv om navnet «universell utforming» er av nyere dato. Vi vil vise hvordan prinsippet har endret seg fra å ha et sosialdemokratisk innhold – før det ble omdøpt til «universell utforming» – for å bli inkorporert i et nyliberalt boligpolitisk paradigme de siste 15 årene. De sosialdemokratiske forgjengerne til «universell utforming» ble til dels formulert som videreutviklinger av en boligpolitikk for sosial rettferdighet og økonomisk likhet. Med innføringen av begrepet «universell utforming» har denne brede sosiale rammen forsvunnet, men under dekke av universalitet og entydig framskrittsoptimisme har denne politiske endringen blitt underkommunisert.[i] [i] Prosjektet er finansiert av Husbanken. Prosjektmedarbeiderne har bestått av NIBR-forskerne Erik Henningsen, Siri Nørve og Lars Risan. Underveis har disse forskerne intervjuet og snakket med en rekke personer innenfor feltene funksjonshemming- og boligpolitikk. Vi takker også Jon Guttu, Olav Rand Bringa, Tore Lange for mange konstruktive innspill. 

  7. Regionale forskningsmidler i Helse Sør-Øst RHF: Evaluering av ressursbruk og habilitet i tildelingsprosessen

    OpenAIRE

    Langfeldt, Liv; Moen, Svein Erik

    2013-01-01

    I denne rapporten gjennomgås søknads- og vurderingsprosessen som benyttes ved tildeling av forskningsmidler i Helse Sør-Øst RHF. Evalueringen er utført på oppdrag fra Helse Sør-Øst RHF og har vekt på habilitetshåndtering og ressursbruk i tildeling av forskningsmidler. Hovedkonklusjonen er at Helse Sør-Østs tildelingsprosess fungerer bra og foregår på en forsvarlig og habil måte: Det er gode og klare rutiner for habilitetshåndtering, tildelinger er klart fundert i faglige vurderinger, og det s...

  8. Marginal electricity and environmental evaluation of electricity; Marginalel och miljoevaerdering av el

    Energy Technology Data Exchange (ETDEWEB)

    Skoeldberg, Haakan; Unger, Thomas; Olofsson, Mattias

    2006-08-15

    In many environmental-impact analyses and assessments it is inevitable to estimate the environmental consequences of electricity use and electricity generation. In most cases, this is done in order to confront different alternatives with one another and compare their environmental effects. Hence, it is the effects of a change that one wants to illustrate. There are a number of approaches that can form the basis for such environmental evaluations. This project has been carried out in order to find a structure in the conceptions of environmental evaluations of electricity and to present different approaches for such evaluations. In particular, the concept of marginal electricity has been of central interest in this project. By marginal electricity we refer to the last used unit of electricity at any given point of time, which, generally, is supplied with the most costly means of generation in the generation merit order. An important part of the project has been a seminar where nine different speakers presented their views on the subject. In a concluding panel debate, the speakers participated in a discussion with the audience. The principles for environmental evaluation often appear to be chosen to fit the alternative that one is favouring. Those who want to achieve reduced electricity use preferably use marginal data for electricity, while those who are in favour of increased electricity use preferably choose average data. The choice of environmental evaluation principle has a decisive impact on the results. The most important reason for this is the dramatic difference between average and marginal data in the Swedish and Nordic electricity generation systems. It is obvious that there is a lack of consensus regarding which principle for environmental evaluation of electricity that should be used. In the initial phase of this project eight different principles were identified. Most people, but far from all, have the opinion that some type of marginal approach should

  9. Evaluation of methods for characterizations of deposits; Utvaerdering av metoder foer avlagringsmaetningar

    Energy Technology Data Exchange (ETDEWEB)

    Hoegberg, J.; Bjoerkman, P. [Vattenfall Utveckling AB, Aelvkarleby (Sweden)

    2001-11-01

    In boilers there are problems with deposits on parts exposed to the flue gas, in particular on heat exchanging parts and to an increasing extent with the changeover to the use of biofuels and wood waste fuels. In order to solve the problems deposits are examined by using a deposit probe and taking deposit samples from the interior of the boiler. In this report an evaluation of methods of analysis is performed based on experiences in both literature and laboratory work. The evaluation forms the basis of an instruction for deposit measurements in 'Vaermeforsks Maethandbok'. The procedure for use of deposit probes is treated as well as the importance of careful and well planned sample preparation before analysis. In the literature a large number of methods used for analysis of deposits from flue ashes and similar applications are found. The methods include chemical analyses of solids and liquids, analysis of crystal structures, thermal properties and the solid mechanics of the materials. Several methods, for example SEM-EDX, XRF, ICP, IC and methods for determining the mechanical and thermal properties are suited for a survey examination of a deposit, while more specialised methods with higher resolution can add information but require a clear framing of a question and in practice are suited for only separate samples. Examples from the latter category are AES, ESCA and TOF-SIMS.

  10. Evaluation of creep damage development by the replica method; Utvaerdering av krypskadeutveckling med replikmetoden

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan [Det Norske Veritas AB, Stockholm (Sweden); Roennholm, Markku [Fortum (Sweden)

    2002-04-01

    Creep damage development in high temperature components can be monitored by the replica method. Damage is classified and an experience based time period for safe operation is recommended where a re-inspection should be conducted. Original recommendations are still commonly used but there are also developed ones are mostly less conservative. A data base of more than 6000 replicas, collected from welded components in Swedish and Finnish power plants, has been evaluated with respect to damage development in the present project. The results are in general in good agreement to the existing developed recommendations for re-inspections. Important factors that should be considered for use of the recommendations are highlighted: Service history, Material, welding and heat treatment, Measure of pressure and temperature, System stresses, Geometrical stress concentrations, stress distributions, Design of components and welds, Creep crack growth, Starts and stops, Extent and performance of the replica method. These factors have been analysed with respect to the evaluated data resulting in comments to the existing recommendations. In addition, recommendations and conditions for a high reliability of the replica method are described. The comments and recommendations can be read in separate sections in the end of the report.

  11. Small scale combustion of reed canary grass - inventory and evaluation of available technology; Smaaskalig foerbraenning av roerflen - inventering och vaerdering av tillgaenglig teknik

    Energy Technology Data Exchange (ETDEWEB)

    Gustavsson, Lennart; Paulrud, Susanne

    2011-07-01

    The feasibility of commercially available boilers in the interval 50 kW to 1 MW for use with reed canary grass (RCG) as fuel has been preliminary evaluated. The capacity to handle the large ash volumes generated by RCG both in terms of ash withdrawal and combustion quality was used as the main criteria. Nine boilers and two burners were identified and classified in a three-step scale from verified functioning on RCG to possible functioning with some design changes

  12. Investigation of industrial gateways - evaluation of energy losses and the function of air curtains; Utvaerdering av industriportar - bedoemning av energifoerluster och luftridaaers funktion

    Energy Technology Data Exchange (ETDEWEB)

    Toernstroem, Tobias; Quicklund, Henrik; Axell, Monica

    2005-07-01

    The need for reducing the energy usage and in particular the electricity-usage is increasing. Every year lot of energy is wasted when using industrial gates. It is therefore important to examine this energy loss and to evaluate solutions for preventing or reducing this occurrence. In order to design good solutions that provide the desired climate in the premise and at the same time save energy we need knowledge on how a certain parameter affects the leakage of the surrounding air into the building. The purpose of this project was to examine the energy losses that arise when using industrial gates and to evaluate solutions to reduce these losses. Numerical calculations have been applied to evaluate the following parameters effect on the air exchange through the opening; temperature difference between the building and the surrounding, the size of the gate and the size of the building. For examine the function of the air curtain the inlet velocity, the width and the inlet turbulence intensity were evaluated. The CFD calculations have been complemented with the energy simulation program Simulink and also compared with measurements from previous studies. The results show a good agreement between the CFD and the Simulink calculation after the adjustment of a coefficient in Simulink. The size of the building did not affect the energy exchange through the gate. For each gate size there is an optimal inlet velocity and width of the air curtain that results in lowest energy exchange through the gate. When dimensioning the air curtains the impulse force of the air curtain should be used since it combines the velocity and width. It was also concluded that of two air curtains with the same impulse force the wider curtain is the most efficient. With a correct installed and dimensioned air curtain it is possible to achieve an energy saving of approximately 60-85 percent.

  13. Evaluering av førskolelærerutdanning i Norge 2010

    DEFF Research Database (Denmark)

    Broström, Stig; Andersen, Peter Østergaard; Guldbrandsen, Lars

    developments in the preschool field. The providing institutions' self-evaluations occupy a central position as a source of information. In addition, a survey was conducted among all students who were registered on preschool teacher education programmes in the spring of 2009 and another survey went out to all...... candidates who received their preschool teacher diplomas in 2007 or 2008. Supplementing this information compiled by NOKUT, two external sources have been utilised: an investigation among managers and practice teachers in nursery schools and another among third-year students in preschool teacher education...... students in 2003 could choose among 33 relatively similar programmes, their choice in 2010 had been widened to 51 programmes that either offer a general preschool teacher competence, or they have a special orientation towards e.g. aesthetic or natural science subjects. There is also a choice between full...

  14. Corrosive wear. Evaluation of wear and corrosive resistant materials; Noetningskorrosion. Utvaerdering av noetnings- och korrosionsbestaendiga material

    Energy Technology Data Exchange (ETDEWEB)

    Persson, H.; Hjertsen, D.; Waara, P.; Prakash, B.; Hardell, J.

    2007-12-15

    With a new purchase of a waste conveyer screw at hand, for the 'A-warehouse' at the combined power and heating plant at E.ON Norrkoeping, the request for improved construction materials was raised. The previous screw required maintenance with very short intervals due to the difficult operation conditions. With the new screw the expectation is to manage 6 months of operation without interruption. The environment for the screw has two main components that sets the demand on the materials, on one hand the corrosive products that comes along and which forms at digestion of the waste and on the other hand the abrasive content in the waste. The term of the mechanism is wear-corrosion and can give considerably higher material loss than the two mechanisms wear and corrosion separately. Combination of a strong corrosive environment together with extensive wear is something that we today have limited knowledge about. The overall objective of the project has been to establish better wear and corrosive resistant construction materials for a waste conveyer screw that will lead to reduced operational disturbance costs. The evaluation has been performed in both controlled laboratory environments and in field tests, which has given us a better understanding of what materials are more suitable in this tough environment and has given us a tool for future predictions of the wear rate of the different material. The new conveyer screw, installed in February 2007 and with which the field test have been performed, has considerably reduced the wear of the construction and the target of 6 month maintenance-free operation is met with this screw for all the evaluated materials. The wear along the screw varies very much and with a clear trend for all the materials to increase towards the feeding direction of the screw. As an example, the wear plate SS2377 (stainless duplex steel) has a useful life at the most affected areas that is calculated to be 1077 days of operation with the

  15. Evaluation of an agricultural biogas plant at Hagavik; Utvaerdering av gaardsbaserad biogasanlaeggning paa Hagavik

    Energy Technology Data Exchange (ETDEWEB)

    Edstroem, Mats; Nordberg, Aake; Ringmar, Anders

    2005-07-01

    Hagavik is an organic farm (municipality of Malmoe in Sweden) and the grown crops at the farm are sugar-beet, wheat, tritricale and ley crop (for green manure). The farmer has erected a new farm scale biogas plant with a digester volume of 500 m{sup 3}. The motives for building the plant were to produce biogas for cogeneration and digestate for supplying the farm with nutrients. Biogas substrates, harvested at the farm, are ley crop and sugar-beet tops and external substrates are solid manure from horses and organic waste from industrial bakery. Digestion of fibre-rich substrates as ley crop and straw-rich solid manure at farm scale plants is fairly untested in Sweden. The fibre has a rather big impact on the rheological properties of the substrate mixture and digester slurry and can cause problems with pumping and ineffective stirring. To achieve satisfactory function on the pumps and stirrers the fibre-rich substrates the rheological properties has to be improved. This can be done by 1) mixing the fibre-rich substrates with rather large quantities of liquids which can result in low dry mater content both in substrates an digester slurry 2) reduce the fibre size by mechanical disintegration. The Swedish Inst. of Agricultural and Environmental Engineering (JTI) has been in charge of the evaluation of the biogas plant. Evaluation of the start-up phase of the plant, regarding the technical and biological function, was accomplished in July-November 2003. During year 2004 focus has been on practical experience running the plant. The plant electricity demand has been measured. Based on those measurements the calculated electricity demand running the plant with a biogas production at 600 m{sup 3}/d (3,54 MWh/d) corresponds to ca 2-3% of the energy content of the biogas. The calculated heat demand corresponds to 15 % of the biogas. At cogeneration (with assumed electrical efficiency of 34% and thermal efficiency of 55%) the net-energy production is 919 MWh/year where 44

  16. Norsk og matematikk i et literacy-perspektiv: metabevissthet også for de svake elevene [Visions 2011: Teaching

    Directory of Open Access Journals (Sweden)

    Bodil Kleve

    2012-06-01

    Full Text Available Artikkelen er diskuterende med fokus på teoretiske perspektiver som i didaktisk sammenheng kan brukes til å synliggjøre likheter og ulikheter mellom skolefag. Vi fokuserer spesielt på svake elever som trenger aktive og språkbevisste lærere. Vi tar utgangspunkt i et bevisstgjørende didaktisk metaperspektiv (literacy-perspektiv og et fenomenologisk meningsperspektiv og argumenterer på tre ulike nivå som alle fremmer metaspråklig perspektiv og innsikt. Det første er diskursnivået. Det neste er sjangernivået. Diskursnivået og sjangernivået er nødvendige metaperspektiv i all skolefaglig læring. Til slutt en erkjennelse av læreprosessens grunnleggende perspektiv: De ulike tenkemåter, "modes of thought", som er nødvendig for læring i de to fagene. Bevissthet om de to tenkemåtene, "modes of thought" tydeliggjør likheter og forskjeller mellom norsk og matematikk.

  17. Evaluation of the program 'Environmentally correct utilization of ashes'; Utvaerdering av programmet 'Miljoeriktig anvaendning av askor'

    Energy Technology Data Exchange (ETDEWEB)

    Herbert, Roger B. (Uppsala Univ., Inst. of Earth Sciences, Uppsala (Sweden))

    2008-04-15

    Vaermeforsk's program Environmentally-correct utilization of ashes ('Ash program') has financed research and development projects since 2002. The overall goal of the program is that knowledge and data for decision-making shall exist so that 90 percent of Swedish ash from energy production is utilized in an environmentally-correct application by the end of 2008. In this report, an evaluation of the Ash program is presented, with an overall goal of determining if the program is proceeding along the correct path to goal fulfillment. The following components of the program have been evaluated: Funded projects during the program period 2002-2008, with focus on project selection, goal fulfillment, and the need for addition studies; Selected projects that have particular significance for goal fulfillment; Communication and dissemination of results; Significance of the Ash program's network. Funded projects within each research area have been reviewed with respect to project prioritization and the relevance of projects for goal fulfillment. The projects have been compared with previously identified research and development needs. The primary emphasis in the areas of Engineering and Landfills lies in projects that, taken together, can lead to an increased confidence in our understanding of the geotechnical and environmental properties of ash. In the area Forest and soil, Vaermeforsk has funded new ash recycling and fertilization experiments and also continuation projects. Such a prioritization is warranted, since long-term experiments are necessary in order to indicate if the addition of ash has an effect. Large ventures within the areas of Engineering, Landfills and Forests arouse the greatest attention; these are the projects that will presumably make the greatest breakthroughs for ash utilization. It is my assessment that the Ash program is proceeding along the correct path toward goal fulfillment, and that the program has contributed to knowledge and

  18. System analysis of energy utilization from waste - evaluation of energy, environment and economy. Summary report; Systemanalys av energiutnyttjande fraan avfall - utvaerdering av energi, miljoe och ekonomi. Oeversiktsrapport

    Energy Technology Data Exchange (ETDEWEB)

    Sundqvist, Jan-Olov; Granath, Jessica [IVL Swedish Environmental Research Inst. Ltd., Stockholm (Sweden); Frostell, Bjoern; Bjoerklund, Anna; Eriksson, Ola [Royal Inst. of Tech., Stockholm (Sweden). Dept. of Chemical Engineering and Technology; Thyselius, Lennart; Baky, Andras [Swedish Inst. of Agricultural and Environmental Engineering, Uppsala (Sweden); Carlsson, Marcus [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Economics

    1999-12-01

    Energy, environmental, and economic consequences of different management systems for municipal solid waste have been studied in a systems analysis. In the systems analysis, different combinations of incineration, materials recycling of separated plastic and cardboard containers, and biological treatment (anaerobic digestion and composting) of easily degradable organic waste, were studied and also compared to landfilling. In the study a computer model (ORWARE) based on LCA methodology was used. Case studies were performed for three different municipalities: Uppsala, Stockholm, and Aelvdalen. The following parameters were used for evaluating the different waste management options: consumption of energy resources, global warming potential, acidification, eutrophication, photo oxidant formation, heavy metal flows, financial economy and welfare economy, where welfare economy is the sum of financial economy and environmental economy. The study shows that reduced landfilling to the benefit of an increased use of energy and material from waste is positive from an environmental and energy as well as economic aspect. This is mainly due to the fact that the choice of waste management method affects processes outside the waste management system, such as production of district heating, electricity, vehicle fuel, plastic, cardboard, and fertiliser. This means that landfilling of energy-rich waste should be avoided as far as possible, both because of the the environmental impact, and because of the low recovery of resources. Incineration should constitute a basis in the waste management systems of the three municipalities studied, even if the waste has to be transported to a regional facility. Once the waste is collected, longer regional transports are of little significance, as long as the transports are carried out in an efficient manner. Comparing materials recycling and incineration, and biological treatment and incineration, no unambiguous conclusions can be drawn. There are

  19. Evaluation of electrochemical techniques for measurement of fireside corrosion in thermal power plants; Utvaerdering av elektrokemiska tekniker foer maetning av roekgassidig hoegtemperaturkorrosion i pannor

    Energy Technology Data Exchange (ETDEWEB)

    Hjorrnhede, Anders

    2007-12-15

    The possibility to measure the corrosion rate on-line, in situ, is getting more and more interesting due to increased corrosion. The worsening may be a result of lower fuel quality or increased steam data due to raised efficiency demands. Also the use of inhibitors can be improved and the lifetime of important components can be increased. Today, virtually all corrosion measurements of materials used for waterwalls, superheaters, economisers and other heat-transferring surfaces are based on in-situ probe tests of coupons or rings. The aim of the project is to evaluate the practicability of commercial or semicommercial on-line in-situ corrosion probes for use in waste fired boilers. The target groups are owners of boilers, operators, service personnel but also boiler manufacturer and material producers. Since the use of on-line, in situ, corrosion probes is substantial, some of the most promising corrosion probes have been tested in a waste fired boiler in Hamburg, Germany. Tests in waste fired boiler have never before been performed. The MECO CB, a Linear Polarisation Resistance (LPR) corrosion probe from Coresto Oy, Finland was tested and from Lehrstuhl fuer Umweltverfahrenstechnik und Anlagentechnik (LUAT) der Universitaet Duisburg-Essen, Germany an Electrochemical Noise (EN) - probe was tested. From Pepperl + Fuchs both EN- and LPR-CorrTran corrosion sensors were tested. The test periods were lasting from 1050h to 3750h. The test materials were the low alloyed steel 15Mo3, the Ni-based super alloys Sanicro 63 and Haynes Hastelloy C-2000. The fluegas temperatures were 635 deg C or 520 deg C. The material temperatures were 440 deg C, 420 deg, 350 deg C and was swept from 400 deg C to 300 deg C. All probes are measuring a signal which has a correlation to the corrosion process, but the quantification procedure is not working well. The results achieved from the corrosion probes must be calibrated against corrosion rates measured by means of conventional corrosion

  20. Evaluation and optimization of a method for pretreatment of sorted household wastes for biogas production; Utvaerdering och optimering av metod foer foerbehandling av kaellsorterat hushaallsavfall till biogasproduktion

    Energy Technology Data Exchange (ETDEWEB)

    Bohn, Irene (NSR AB, Helsingborg (Sweden)); Carlsson, My (AnoxKaldnes AB, Lund (Sweden)); Eriksson, Ylva; Holmstroem, David (Lund Univ., Lund (Sweden))

    2010-04-15

    At NSR in Helsingborg, Sweden, organic household waste is digested and converted into biogas and bio-fertiliser. The incoming waste contains a small fraction of non-sorted waste such as plastics, metal and paper. These materials, especially plastics, can cause operational problems in the digester and pollution of the bio-fertiliser. In order to separate these particles from the digestion substrate, the waste requires pre-treatment. For two years, a screw press has been applied for pre-treating the waste at NSR. In the pre-treatment process, food waste is grounded and mixed with water to form a slurry. The slurry is separated into a dry fraction (reject) and a liquid fraction in the press. The liquid fraction is the digestion substrate and is sent to the digester while the reject is sent to combustion. Though, the separation in the screw press is not complete and thus organic, easily degradable matter ends up in the reject. In order to evaluate the efficiency in the screw press and to estimate the loss of easily degradable matter (and thus loss of methane), an assessment of the mass- and energy balances was carried out. The composition of the in- and outgoing fractions was analysed with the purpose of determining the distribution of organic material in the two outgoing fractions. The methane potential in the liquid fraction was compared with the methane potential in the slurry so as to estimate the loss of methane. The results of the mass balances showed that 63 % of the organic material that enters the screw press ends up in the liquid fraction and 37 % ends up in the reject. One ton of waste that enters the pre-treatment facility will eventually result in 1.5 tons of liquid and 0.2 tons of reject. Analysis of the composition was carried out in the slurry, the liquid fraction and the reject. These analyses showed that the liquid fraction contains a higher concentration of easily degradable matter such as fat and protein than the reject. In the incoming material, as

  1. «Del det du har og bruk det du får» En kvalitativ undersøkelse om bruk av nettbrett i vurdering for læring

    OpenAIRE

    Overland, Jan-Arve

    2016-01-01

    Master i IKT-støttet læring Formålet med denne undersøkelsen har vært å få fram kunnskap om hvordan nettbrett blir brukt i vurdering for læring på ungdomstrinnet. Fokuset i oppgaven har vært å se på hvordan nettbrett blir brukt i vurdering for læring for å støtte opp om samhandlingen mellom elev og lærer og mellom elevene. Bakgrunnen for studien er det økte fokuset på bruk av nettbrett og vurdering for læring i norsk skole. Bruk av nettbrett i norsk skole har kommet på den politiske dag...

  2. Verdivurdering av Prosafe

    OpenAIRE

    Sanne, Tom

    2006-01-01

    Prosafe ASA er et offshore selskap som eier og driver verdens største flåte av halvtnedsenkbare bolig- og service rigger. I tillegg er de en ledende eier og operatør av flytende produksjons- og lagringsfartøyer. Selskapet har uttrykt følgende visjon: ”Prosafe har som visjon å være en ledende og innovativ leverandør av produkter og tjenester til utvalgte nisjer i den globale olje- og gassindustrien.”(Prosafe.no) Prosafe har mesteparten av sine inntekter, kostnader og gjeldsfo...

  3. Summativ vurdering i formativ drakt – elevperspektiv på tilbakemelding fra heldagsprøver i norsk

    Directory of Open Access Journals (Sweden)

    Agnete Bueie

    2015-03-01

    Full Text Available Denne artikkelen handler om hvordan elever på ungdomstrinnet forstår og bruker skriftlige lærerkommentarer på heldagsprøvebesvarelser i norsk. Slike kommentarer gis ofte på sluttprodukter. I vurderingsforskning antas tilbakemelding på sluttprodukter å ha begrenset verdi som læring, og med denne studien ønsker jeg å se om en slik generell antakelse gjelder også i en norskfaglig kontekst. Det empiriske materiale består av elevtekster med lærerkommentarer, verbale protokoller og individuelle elevintervju for 18 elever. Verbale protokoller brukes for å studere elevenes forståelse av lærerkommentarene, og intervju brukes for å få dypere innsikt i hvordan elevene bruker kommentarene. Studien viser at elevene har liten bevissthet rundt vurderingskriterier. Men de leser vurderingene og viser i hovedsak adekvat forståelse av kommentarene de får. Når det gjelder oppfølging av kommentarene, gjør elevene det som blir forventet av dem. Noen av elevene må «rette» tekstene sine, mens andre er ikke forventet å gjøre noe med kommentarene. Dette gjør at elevene i liten grad bruker kommentarene videre i skrivearbeidet. Mens enkelte internasjonale studier rapporterer om at studenter i høyere utdanning ikke leser tilbakemeldingene (Hounsell, 1987 eller ikke forstår dem (Lea & Street, 1998, viser mitt materiale at elevene leser og forstår kommentarene, og de gjør det som forventes av dem i oppfølgingen. Ved å legge til rette for at elevene skal bruke kommentarene mer aktivt kan kommentarene få en sterkere formativ funksjon. 'Abstract This article presents a study conducted in Norwegian lower secondary school (grades 8-10. The aim of the study is to investigate how pupils understand and use the written feedback they get from their teacher on single draft texts. This feedback is often received after the writing task is completed. Some feedback researchers have pointed that feedback given after the task is completed has limited value

  4. Methodology - evaluation of strategies -and the system for taking care of spent nuclear fuel; Metodval - utvaerdering av strategier och system foer att ta hand om anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    2010-10-15

    This report deals with the question of how the Swedish spent nuclear fuel is to be disposed of. What are the requirements? What are the alternatives? In the main chapter of the report, an evaluation is made of the KBS-3 method compared with other strategies and systems for final disposal of spent nuclear fuel. An appendix to the report presents in general terms how the KBS-3 method has developed from the end of the 1970s up to today. The report is one of a number of supporting documents for SKB's applications for construction and operation of the final repository for spent nuclear fuel. In parallel with and as a basis for the present report, SKB has prepared the reports 'Principer, strategier och system foer slutligt omhaendertagande av anvaent kaernbraensle' ('Principles, strategies and systems for final disposal of spent nuclear fuel') /Grundfelt 2010a/, 'Jaemfoerelse mellan KBS-3-metoden och deponering i djupa borrhaal foer slutlig foervaring av anvaent kaernbraensle' ('Comparison between the KBS-3 method and deposition in deep boreholes for final disposal of spent nuclear fuel') /Grundfelt 2010b/ and 'Utvecklingen av KBS-3-metoden. Genomgaang av forskningsprogram, saekerhetsanalyser, myndighetsgranskningar samt SKB:s internationella forskningssamarbete' ('Development of the KBS-3 method. Review of research programmes, safety assessments, regulatory reviews and SKB's international research cooperation') /SKB 2010a/. The reports are in Swedish, but contain summaries in English. The first report is an update of the comprehensive account of alternative methods presented by SKB in 2000. The second report presents a comparison between the KBS-3 method and the Deep Boreholes concept, plus a status report on research and development in the area of Deep Boreholes. The last report describes how the KBS-3 method has been developed from the end of the 1970s up to today. It further describes how the

  5. Evaluation of Norwegian-Russian environmental collaboration 1995-2006; Evaluering av miljoevernsamarbeidet mellom Norge og Russland

    Energy Technology Data Exchange (ETDEWEB)

    Rowe, Lars; Hoenneland, Geir; Moe, Arild

    2007-09-15

    This report presents the findings of FNI's evaluation of the Norwegian-Russian collaboration on environmental issues from 1995 to 2006. The central body of this collaboration is the Norwegian-Russian Environmental Commission, established in 1988 (then as the Norwegian-Soviet Environmental Commission) and renewed in 1992. The Commission has developed a number of working areas, of which three have been studied specifically: (i) the cleaner production programme; (ii) the transboundary environmental collaboration; and (iii) the collaboration on cultural heritage. In addition, this evaluation concentrates on two project areas directly under the auspices of the Norwegian Ministry of Foreign Affairs: (i) the energy saving programme in Northwest-Russia; and (ii) the bio energy programme in Russia. The main empirical source has been a number of in-depth interviews with participants on both sides. Additional information has been drawn from written material such as minutes, project reports, propositions to the Norwegian parliament, etc. After an examination of the overarching level of the collaboration and the individual project areas mentioned above, the report briefly discusses potential future developments in the Norwegian-Russian environmental collaboration. (author). 23 refs., 3 figs

  6. Randomized, double-blind, active-controlled study evaluating the safety and immunogenicity of three vaccination schedules and two dose levels of AV7909 vaccine for anthrax post-exposure prophylaxis in healthy adults.

    Science.gov (United States)

    Hopkins, Robert J; Kalsi, Gurdyal; Montalvo-Lugo, Victor M; Sharma, Mona; Wu, Yukun; Muse, Derek D; Sheldon, Eric A; Hampel, Frank C; Lemiale, Laurence

    2016-04-19

    AV7909 vaccine being developed for post-exposure prophylaxis of anthrax disease may require fewer vaccinations and reduced amount of antigen to achieve an accelerated immune response over BioThrax(®) (Anthrax Vaccine Adsorbed). A phase 2, randomized, double-blind, BioThrax vacccine-controlled study was conducted to evaluate the safety and immunogenicity of three intramuscular vaccination schedules and two dose levels of AV7909 in 168 healthy adults. Subjects were randomized at a 4:3:2:4:2 ratio to 5 groups: (1) AV7909 on Days 0/14; (2) AV7909 on Days 0/28; (3) AV7909 on Days 0/14/28; (4) half dose AV7909 on Days 0/14/28; and (5) BioThrax vaccine on Days 0/14/28. Vaccinations in all groups were well tolerated. The incidences of adverse events (AEs) were 79% for AV7909 subjects and 65% for BioThrax subjects; 92% of AV7909 subjects and 87% of BioThrax subjects having AEs reported Grade 1-2 AEs. No serious AEs were assessed as potentially vaccine-related, and no AEs of potential autoimmune etiology were reported. There was no discernible pattern indicative of a safety concern across groups in the incidence or severity of reactogenicity events. Groups 2-4 achieved success for the primary endpoint, demonstrated by a lower 95% confidence limit of the percentage of subjects with protective toxin neutralizing antibody NF50 values (≥0.56) to be ≥40% at Day 63. Group 1 marginally missed the criterion (lower bound 95% confidence limit of 39.5%). Immune responses were above this threshold for Groups 1, 3 and 4 at Day 28 and all groups at Day 42. Further study of an AV7909 two-dose schedule given 2 weeks apart is warranted in light of the favorable tolerability profile and immunogenicity response relative to three doses of BioThrax vaccine, as well as preliminary data from nonclinical studies indicating similar immune responses correlate with higher survival for AV7909 than BioThrax vaccine. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. Robust AVS Audio Watermarking

    Science.gov (United States)

    Wang, Yong; Huang, Jiwu

    Part III of AVS(China Audio and Video Coding Standard) is the first standard for Hi-Fi audio proposed in China and is becoming more popular in some IT industries. For MP3 audio, some efforts have been made to solve the problems such as copyright pirating and malicious modifications by the way of watermarking. But till now little efforts have been made to solve the same problems for AVS audio. In this paper, we present a novel robust watermarking algorithm which can protect the AVS audio from the above problems. The watermark is embedded into the AVS compressed bit stream. At the extracting end, the watermark bits can be extracted from the compressed bit stream directly without any computation. This algorithm achieves robustness to decoding/recoding attacks, and low complexity of both embedding and extracting while preserves the quality of the audio signals.

  8. Acute evaluation of programmer-guided AV/PV and VV delay optimization comparing an IEGM method and echocardiogram for cardiac resynchronization therapy in heart failure patients and dual-chamber ICD implants.

    Science.gov (United States)

    Baker, James H; McKenzie, John; Beau, Scott; Greer, G Stephen; Porterfield, James; Fedor, Matthew; Greenberg, Steven; Daoud, Emile G; Corbisiero, Raffaele; Bailey, J Russell; Porterfield, Linda

    2007-02-01

    Intracardiac delay optimization of biventricular and dual-chamber pacing devices currently relies on time-consuming echocardiographic measurements. A novel intracardiac electrogram (IEGM) method for atrioventricular (AV/PV) and interventricular (VV) delay optimization was developed, which can be performed during routine device follow-up. In this prospective, nonrandomized, multi-center trial, patients previously implanted with St. Jude Medical cardiac resynchronization therapy defibrillator (CRT-D) devices or dual-chamber implantable cardioverter defibrillators (ICDs) underwent standard AV/PV and/or VV delay optimization guided by Doppler echocardiogram measurements of the maximum aortic velocity time integral (aortic VTI). Aortic VTI measurements applying the IEGM method recommended delays were then obtained in all patients. Fifty-eight patients (age: 68 +/- 11 years; 81% male; 74% ischemic) and 57 patients (age: 71 +/- 10 years; 74% male; 71% ischemic) were enrolled for AV/PV and VV delay evaluation, respectively. An independent core lab determined the maximum aortic VTIs. Data analysis of the AV, PV, and VV delays demonstrated the concordance correlation coefficient (CCC) between the standard method aortic VTI values and the IEGM method aortic VTI values was 97.5%, 96.1%, and 96.6%, respectively. All analyses demonstrated that the CCC > 90% (P method provides a reliable and simpler alternative to standard techniques for the optimization of AV/PV and VV delay settings in patients with CRT-D devices and dual-chamber ICDs.

  9. Kampklubb : en kommentert oversettelse av Fight club av Chuck Palahniuk

    OpenAIRE

    Gottschalk, Morten Peter

    2006-01-01

    Oppgaven er en kommentert oversettelse av romanen Fight Club av Chuck Palahniuk. Den inneholder en oversettelse av de sju første kapitlene i romanen. Kommentardelen tar for seg oversetterproblemer, og diskuterer disse i detalj. Det dreier seg om stil, syntaks, oversettelse av navn med betydning og problemer der kulturelle forskjeller mellom USA og Norge skaper oversetterproblemer. Som bakgrunnsmateriale brukes Gideon Tourys begreper om adekvate og akseptable oversettelser, og hvordan kildekul...

  10. Restaurangernas val av livsmedel

    OpenAIRE

    Korpihalkola, Janica

    2009-01-01

    Syftet med detta lärdomsprov är att ta reda på vilka livsmedel restaurangerna i Vasa har valt att använda samt varifrån de skaffar sina råvaror och livsmedel. Avsikten var även att undersöka om valet av livsmedel skiljer sig vid lunch och a la carté -mat och om det finns skillnader mellan privata och kedjerestauranger med tanke på val av livsmedel. I teoridelen beskriver jag om hur restaurangerna och deras användning av råvaror har utvecklats på 1900-talet och om olika valmöjligheter som ...

  11. Nykonstruktion av trippelsaxlyftbord

    OpenAIRE

    Gisselman, Niklas

    2010-01-01

    SammanfattningDenna rapport behandlar konstruktion av ett trippelsaxlyftbord. Lyftbord är ett bord som harmöjlighet att lyfta eller sänka en bordsskiva till en höjd som underlättar arbete. Dessa lyftbordutgår från en av SIS standardiserat arbetsgång för att uppfylla CE-märkning. En förändring idenna standard har öppnat en marknad för lyftbord som lågfartshissar upp till 3 våningsplansom Edmolift avser att täcka. Av denna anledning vill Edmolift konstruera etttrippelsaxlyftbord med en kapacite...

  12. Hvorfor kommer de ikke? Minoritetsspråklige foreldres erfaringer med hjem-skole-samarbeid i lys av teorier om makt og anerkjennelse

    OpenAIRE

    Evensen, Tone

    2013-01-01

    Mastergradsoppgave i tilpasset opplæring, Avdeling for lærerutdanning og naturvitenskap, Høgskolen i Hedmark, 2009. Norsk sammendrag Dette er en masteroppgave i tilpasset opplæring ved Høgskolen i Hedmark. Oppgaven er en empirisk undersøkelse av minoritetsspråklige foreldres erfaringer med hjem–skole-samarbeid. Bakgrunnene for undersøkelsen er forskning som viser at samarbeidet mellom hjem og skole er viktig for elevenes resultater i skolen, samtidig viser det seg at minoritetsspråklige...

  13. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  14. Evaluating the Effects of Metals on Microorganisms in Flooded Paddy Soils Using the SEM/AVS-Based Approach and Measurements of Exchangeable Metal Concentrations.

    Science.gov (United States)

    Kunito, Takashi; Toya, Hitomi; Sumi, Hirotaka; Ishikawa, Yuichi; Toda, Hideshige; Nagaoka, Kazunari; Saeki, Kazutoshi; Aikawa, Yoshio; Matsumoto, Satoshi

    2017-04-01

    We examined possible adverse effects of heavy metals on microbial activity, biomass, and community composition using the simultaneously extracted metals (SEM)/acid-volatile sulfide (AVS)-based approach and measurements of exchangeable metal concentrations in three paddy soils (wastewater-contaminated soil, mine-contaminated soil, and noncontaminated soil) incubated for 60 days under flooded conditions. Incubation under flooding increased pH and decreased Eh in all samples. AVS increased when Eh decreased to approximately -200 mV for the mine-contaminated and noncontaminated soils, while the wastewater-contaminated soil originally had a high concentration of AVS despite its air-dried condition. Addition of rice straw or alkaline material containing calcium carbonate and gypsum increased AVS levels under flooded conditions. We observed no apparent relationship between soil enzyme activity (β-D-glucosidase and acid phosphatase) and concentrations of SEM, [∑SEM - AVS], and exchangeable metals. Bacterial and fungal community composition, assessed using polymerase chain reaction-denaturing gradient gel electrophoresis (DGGE) analysis targeting rRNA genes, was largely influenced by site of collection and incubation time, but metal contamination did not influence community composition. We observed significant negative correlations between biomass C and [∑SEM - AVS] and between biomass C and ∑SEM, suggesting that [∑SEM - AVS] and ∑SEM might reflect the bioavailability of organic matter to microorganisms in these soils.

  15. ”Hvis du redder et menneske, så har du reddet hele verden”. Den gode moralen og den dialogiske samtalen i et norsk klasserom

    Directory of Open Access Journals (Sweden)

    Sylvi Penne

    2009-03-01

    Full Text Available Artikkelen tar utgangspunkt i observasjoner fra et klasserom på ungdomstrinnet der elevene arbeider tverrfaglig i norsk, KRL og samfunnsfag. Temaet er blant annet jødenes situasjon før og under krigen. Læreren er faglig dyktig, erfaren og sterkt engasjert i å formidle overgrepene som ble begått mot jødene, og elevene er velvillige. Likevel er elevenes konklusjon at de i en krigssituasjon med en etisk fordring, ikke ville ha våget å gjøre noe for å hjelpe jødene.      Med utgangspunkt i diskursteori, sosiokulturell teori og nyere kognitiv teori diskuteres disse svarene som ”naturlige” svar i den konteksten som skapes i klasserommet, og gjennom det språket som elevene utfordres i, deres ”mediational means”. Et konkret didaktisk problem er at den historiske fortellingen er borte og erstattet av empatisk innlevelse. Artikkelen avslutter med å hevde at uten en narrativ ramme forsvinner muligheten for etisk erkjennelse gjennom konteksten som skapes, og gjennom materialet som foreligger. Her ligger imidlertid nye didaktiske muligheter for engasjerte lærere, ikke minst gjennom litteraturundervisning.

  16. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    2017-01-01

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  17. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  18. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  19. Store Norske Leksikon: Defining a New Role for an Edited Encyclopaedia

    Directory of Open Access Journals (Sweden)

    Georg Kjøll

    2014-06-01

    Full Text Available Store norske leksikon (SNL [Great Norwegian Encyclopaedia] is an edited, online encyclopaedia that strives towards radical transparency. Our aim is for as many parts of text production as possible to be visible to everyone, much like in the model that Wikipedia has pioneered. Unlike Wikipedia, however, contributors to SNL are required to use their full name, and encouraged to supply biographies that explain their background and qualifications within a field or topic.

  20. The Founding, Fantastic Growth, and Fast Decline of Norsk Data AS

    OpenAIRE

    Steine, Tor,

    2010-01-01

    Part 6: The Making of a Nordic Computing Industry; International audience; Norsk Data was a remarkable company that in just twenty years went from a glimmer in the eyes of some computer enthusiasts to become number two in share value at the Oslo Stock Exchange. Within a few years thereafter, it collapsed, for no obvious reason. How was this tremendous success possible and why did the company collapse?

  1. Ledelse og sikkerhetsklima. Har konsensus mellom kapteiner og mannskap i vurderinger av utøvd lederstil betydning for opplevelse av sikkerhet i norsk sjøfart?

    OpenAIRE

    Førde, Marte Ytrehus; Låstad, Erlend

    2014-01-01

    The aim of this study was to investigate whether self-other agreement between crew and captains on two types of leadership dimensions; transformational and authentic leadership, would relate to safety climate on ships operating offshore. Data were collected from a survey conducted in two large Norwegian shipping companies. The response rate was at 73%, and a total of 594 participants from 40 ships took part in the study. Safety climate was measured with the Norw...

  2. "Heja Sverige! Heia Norge!" : En kritisk diskursanalys av nationalism inom svensk och norsk sportjournalistik med fokus på bevakningen av Skid-VM i Falun 2015

    OpenAIRE

    Westling, Oscar

    2015-01-01

    The purpose of this essay, entitled ”Heja Sverige! Heia Norge”, was to study the difference in nationalistic tendencies between Swedish and Norwegian news coverage of the 2015 FIS Nordic World Ski Championships in Falun, Sweden, which took place between 18 February and 1 March 2015. It was the fourth time the event took place in Falun, previous games having been held in 1954, 1974 and 1993. I performed a critical discourse analysis of a total of twelve articles split over two race days – one ...

  3. Projektering av robotcell

    OpenAIRE

    Carnbo, Linda; Suonperä, Nadja

    2012-01-01

    Syftet med examensarbetet var att projektera en fysisk robotcell till Haldex i Landskrona, tillverkare av bromshävarmar, då det finns ett behov hos dem att effektivisera sin produktion för att kunna bibehålla konkurrenskraften och tillverkningen i Sverige. Bromshävarmen är en mogen produkt vilket medför att det inte skulle bli lönsamt att omforma den utan istället fokusera på tillverkningen. Därför vore lösningen att automatisera den del av monteringslinan som inte tillför något värde till sl...

  4. Life cycle adaption of biofuel ashes. Evaluation of new techniques for pelletizing of biofuel ashes, especially regarding operational properties and environmental effects in the forest after ash recycling. Stage 1; Kretsloppsanpassning av bioaskor. Utvaerdering av ny teknik foer pelletering av bioaska med avseende paa dels driftsegenskaper, dels miljoeeffekter i skogen av askaaterfoering

    Energy Technology Data Exchange (ETDEWEB)

    Loevgren, Linnea [Stora Enso Environment, Falun (Sweden); Lundmark, Jan-Erik; Jansson, Charlotta [AssiDomaen AB, Stockholm (Sweden)

    2000-11-01

    The aim of the project 'Adaptation of Wood Ashes to Recycling' is to evaluate a new technique - roll pelleting - for making wood ash suitable for reuse as a fertiliser for woodland. The project is being carried out at the forest product companies AssiDomaen and Stora Enso. The main financier is the Swedish National Energy Administration. Other financiers are AssiDomaen, Stora Enso, The Thermal Engineering Research Institute and The Forestry Research Institute of Sweden. The project has involved the construction of a full-scale roll pelleter in a mobile container and its trial operation at two Swedish pulp and paper mills. The leaching properties of the ash products were studied with a laboratory method. In addition, the effects of ash fertilisation with these products are being studied in a four-year field trial. Effects on soil pH, nutrient supply, soil water chemistry and ground vegetation are being evaluated by The Forestry Research Institute of Sweden and will be reported separately in the year 2003. In a laboratory prestudy, the leaching properties of pellets from twelve different ash products made in a laboratory prototype machine were evaluated. The ash products were made from residues from the AssiDomaen Froevi mill and the Stora Enso Fors mill. Fly ash from Froevi was used alone and mixed with green liquor sludge and lime sludge respectively. Fly ash from Fors was also used alone and mixed with coating colour. The laboratory method used for the evaluation of leaching properties is the method developed by IVL The Swedish Environmental Research Institute Ltd. The results show that the progress of the leaching of roll pelleted ash is significantly slower than for the corresponding crushed product and a reference lime product. The speed of leaching, measured as acid neutralisation capacity, ANC, was significantly lower for the roll pelleted ash compared to self-hardened and crushed ash products. Because of the high content of calcium, lime has on the

  5. Scientific evaluation on the NKS programme 1998-2001; Facklig utvaerdering av NKS-programmet 1998-2001

    Energy Technology Data Exchange (ETDEWEB)

    Loewenhielm, G. [Swedish Radiation Protection Authority, SSI (Sweden); Mustonen, R. [Radiation and Nuclear Safety Authority, STUK (Finland)

    2002-11-01

    The Board of the Nordic Nuclear Safety Research (NKS) decided in the autumn 2000 to contract out two separate evaluations on the NKS Programme 1998-2001. Martin Oeiby from the NorwegiOe Radiation Protection Authority was requested to perform an evaluation on overall administration of the NKS Programme. Two experts conducted the scientific evaluation. Gustaf Lowenhielm from the Swedish Nuclear Power Inspectorate was requested to assess projects on nuclear safety issues and waste management, and Raimo Mustonen from the Finnish Radiation and Nuclear Safety Authority to evaluate projects on radiation protection and nuclear emergency preparedness. This report deals with the scientific evaluation. The report contains brief review on the history of the Nordic nuclear and radiation safety co-operation and on the development of Programme for 1998-2001. Brief summaries of activities in all the projects are given, together with the main results of the projects. The evaluators give their subjective assessments on the success and effectiveness of the projects based on the evaluation criteria agreed With the NKS Board in the beginning of work. Also some general recommendations for the future co-operation are given. (au)

  6. Konkurranseutsetting av pleie- og omsorgstjenester : en studie av Oslo kommune

    OpenAIRE

    Seim, Karianne

    2006-01-01

    Sammendrag Siden konkurranseutsetting av pleie- og omsorgstjenester har vært, og er, et omstridt tema, synes jeg at det er spennende å studere hvorfor noen kommuner likevel bestemmer seg for å ta i bruk denne formen for produksjon av sine tjenester, og hvordan de går frem for å gjennomføre dette. For å kunne dekke alle sider ved konkurranseutsetting, valgte jeg derfor å konsentrere meg om å se på innføringen av konkurranseutsetting av pleie- og omsorgstjenester i Oslo kommune. Jeg har...

  7. Utveckling av ett snabblyftblock

    OpenAIRE

    Svensk, Johanna; Schönning, Lisa

    2014-01-01

    Detta examensarbete har genomförts i samarbete med Svero Lifting. Företaget säljer och utvecklar lyftanordningar. Svero Lifting arbetar idag med att reducera vikten på företagets komponenter genom ett materialbyte och har påbörjat utveckling av en ny lyftanordning, en blockvagn och ett snabblyftblock. Svero Lifting vill fortsätta utveckla företagets lyftanordning så att komponenterna i lyftanordningen passar varandra och utmärker sig på marknaden. Idag har Svero Lifting inga CAD-modeller elle...

  8. Arctic Visiting Speakers Series (AVS)

    Science.gov (United States)

    Fox, S. E.; Griswold, J.

    2011-12-01

    The Arctic Visiting Speakers (AVS) Series funds researchers and other arctic experts to travel and share their knowledge in communities where they might not otherwise connect. Speakers cover a wide range of arctic research topics and can address a variety of audiences including K-12 students, graduate and undergraduate students, and the general public. Host applications are accepted on an on-going basis, depending on funding availability. Applications need to be submitted at least 1 month prior to the expected tour dates. Interested hosts can choose speakers from an online Speakers Bureau or invite a speaker of their choice. Preference is given to individuals and organizations to host speakers that reach a broad audience and the general public. AVS tours are encouraged to span several days, allowing ample time for interactions with faculty, students, local media, and community members. Applications for both domestic and international visits will be considered. Applications for international visits should involve participation of more than one host organization and must include either a US-based speaker or a US-based organization. This is a small but important program that educates the public about Arctic issues. There have been 27 tours since 2007 that have impacted communities across the globe including: Gatineau, Quebec Canada; St. Petersburg, Russia; Piscataway, New Jersey; Cordova, Alaska; Nuuk, Greenland; Elizabethtown, Pennsylvania; Oslo, Norway; Inari, Finland; Borgarnes, Iceland; San Francisco, California and Wolcott, Vermont to name a few. Tours have included lectures to K-12 schools, college and university students, tribal organizations, Boy Scout troops, science center and museum patrons, and the general public. There are approximately 300 attendees enjoying each AVS tour, roughly 4100 people have been reached since 2007. The expectations for each tour are extremely manageable. Hosts must submit a schedule of events and a tour summary to be posted online

  9. Quality assurance of automated emission measurement systems - long time evaluation; Kvalitetssaekring av automatiska emissionsmaetsystem - analys och laangtidsutvaerdering

    Energy Technology Data Exchange (ETDEWEB)

    Harnevie, Henrik; Andersson, Magnus [Swedpower, Stockholm (Sweden); Gustavsson, Lennart [Swedish National Testing and Research Inst., Boraas (Sweden)

    2004-11-01

    As a consequence of the waste incineration directive and the EG-directive of large combustion plant, standards to meet the requirements in those directives had been worked out within CEN. Among those standards a standard concerning 'quality assurance of automated measurement system' is of major importance (SS-EN 14181). All automated emission monitoring systems (AMS) used to verify the requirements in the EC combustion directives should follow the procedures in SS-EN 14181. The standard both handle different types of controls (as function controls and parallel measurements) and documentation of data and journals. To make it easier for their members to implement the standard this Vaermeforsk study had been realized. SEPA (Swedish Environmental Protection Agency) and Vattenfall have also financed the work. SEPAs interest of the standard is to receive information of which parts in the standard that are in conflict with their present legislation. The main objectives of this project had been to document and explain the separate parts in the standard (QAL2, QAL3 and AST). Especially how the standard affects the situation and the routines on the plants. Other objectives have been to identify differences between other Swedish legislation and explain the consequences of such differences. In this project the standard also has been used to evaluate an existing AMS for measurement of NO{sub x}, SO{sub 2} and dust. In most cases the analyzers succeed to fulfill the criteria mentioned in the standard. During QAL2 only the dust analyzer failed the controls. The results of the AST gave better results for the dust analyzer but the SO{sub 2}-analyzer failed the requirements. Differences and consequences of such differences between the standard and the current Swedish legislation are also described. Finally, the report gives recommendations to the plant owners how to handle the standard. The standard is already valid. However, the use of it will be regulated by the

  10. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  11. Fruktbarhet hos simler: effekter av ernæring og vekst

    Directory of Open Access Journals (Sweden)

    N.J.C. Tyler

    1988-06-01

    Full Text Available Tyler's article is published in English in Rangifer 7 (2, 1987: Fertility in female reindeer: the effect of nutrition and growth.Sammendrag: Drektighetsprosenten i ungrein varierer sterkt fra individ til individ og fra flokk til flokk. En høy fruktbarhet i reinflokken er selve grunnlaget for en vellykket reindrift. Overraskende er det derfor at man vet lite om hvilke faktorer som bestemmer om rein skal bli drektig eller ikke. I denne artikkelen blir effekten av ernæring på reinsimlenes fruktbarhet diskutert. Undersøkelser indikerer at rein er som andre pattedyr, der fruktbarheten er relatert til kroppsvekten. Forholdet mellom reinens kroppsvekt og fruktbarhet varierer likevel sterkt. Mye tyder på at drektighetsprosenten i ungrein er avhengig av reintettheten. Dette indikerer at ernæringen er en viktig faktor når det gjelder fruktbarhet i ungrein. Vektspesifikk fruktbarhet kan derfor være en brukbar indikator for reinflokkens fortilgang. I prinsippet vil slike fruktbarhetsundersøkelser gi et tidlig varsel om reintallet er for høyt i forhold til beitegrunnlaget før en markert nedgang i slaktevekten observeres. Etter foredraget til Nic. Tyler hadde Terje Skogland et forberedt innlegg som er gjengitt på norsk. Deretter fulgte en lengre diskusjon som også er gjengitt.

  12. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  13. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  14. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  15. NILU - Annual Report 1995; Norsk institutt for luftforskning - aarsrapport 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-10-01

    This is the annual report for 1995 from NILU. NILU does research work, develops methods and performs evaluations of all kinds of air pollution. The field of operations ranges from local air conditions (indoors, in streets, and in the local environment) to global problems relating to changes in the ozone layer and climate changes. The institute, which participates in many international research projects, obtained 13 new contracts in 1995. NILU is the coordinator of three EU projects. Unlike the universities, which receive up to 100% financial support from EU, NILU receives only 50% and must provide the rest itself. The report surveys briefly the projects in which NILU is currently involved. These include projects in Poland, Russia, Czech Republic, Hungary, Spain, Botswana, Egypt, Mauritius, China, India, Chile Venezuela. A modern monitoring system for air quality, AirQUIS, was installed in Oslo. NILU is participating in the EUREKA project MEMbrain, which is an emergency system for use in disasters and catastrophes such as for instance nuclear accidents. A new model called FOTOPLUME has been developed, which is a Gaussian dispersion model. It has been used to calculate the effect of the emissions from offshore oil installations on the ozone concentration and the deposition of Nitrogen compounds in areas close to the coast. There is a full list of papers, reports etc. published by NILU in 1995. A notable event in 1995 was the visit to NILU by the Polish president Lech Walesa accompanied by Norway`s king Harald. 31 figs., 1 table

  16. Opplevelsen av god helse på tross av KOLS

    OpenAIRE

    Blakseth, Margrethe

    2017-01-01

    Master i folkehelsevitenskap med vekt på endringer av livsstilsvaner, 2017 Bakgrunn: Verdens helseorganisasjon (WHO) kom i 1978 med utsagnet og et ambisiøst mål kalt «Helse for alle i år 2000». I 2013 i Almaty ble det på nytt diskutert de globale utfordringene. Her ble det fokusert på to hovedtemaer, ulikheter i helse og den økte byrden av kroniske sykdommer. Hovedvekten ble lagt på samarbeid mellom helsevesenet og brukerne for å imøtekomme disse problemene. I Stortingsmelding 26 snakkes d...

  17. Evaluation of hearings. Results from reviews of the nuclear waste issue in the Swedish site candidate municipalities; Utvaerdering av utfraagningar. Resultat fraan genomlysningar av kaernavfallsfraagan i de svenska foerstudiekommunerna

    Energy Technology Data Exchange (ETDEWEB)

    Drottz-Sjoeberg, B.M. [NTNU, Trondheim (Norway). Dept. of Psychology

    2001-10-01

    The purpose of this report was to present an evaluation of the public hearings that took place in February of 2001 in the Swedish municipalities of Oesthammar, Tierp, and Aelvkarleby in Norduppland, Hultsfred and Oskarshamn in Smaaland, and Nykoeping in Soedermanland. These municipalities had participated in feasibility studies conducted by the Swedish Nuclear Fuel and Waste Management Co (SKB). A company report on the results of these studies had been published shortly before the hearings (FUD-K). The regulatory authorities, i.e. the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI), organized the hearings for additional information and aid in their ongoing evaluation of the SKB report. Representatives of the municipalities participated in the planning of the events, and a large meeting in Tierp in January 2001, that also involved the authorities, consultants and interested parties, agreed on the aims and practical arrangements. The authorities furthermore ordered a report for a summary and evaluation of the events, and the results are presented here. The aim of, and the preparations for, the hearings were based on a theoretical model developed within the RISCOM project, i.e. the RISCOM-model of transparency, which postulates three basic elements, i.e. technical/scientific issues, normative issues and authenticity. These elements combine to achieve an optimal clarification on the interaction between scientific and value-laden components in decision-making. An assumption is that the quality of decisions would improve given that transparency can be increased. The hearings were designed to 'stretch' the implementer by means of asking essential questions and to clarify what was achieved and known so far in the process, as well as to clarify what matters required further attention. The content covered technical, legal and social aspects on issues of nuclear waste management and the choices involved in the process

  18. District heating for increased biogas production. Technical and economical evaluation of district heating as heating source in biogas processes; Fjaerrvaerme foer utoekad biogasproduktion. Teknisk och ekonomisk utvaerdering av fjaerrvaerme foer uppvaermning av biogasprocesser

    Energy Technology Data Exchange (ETDEWEB)

    Lundqvist, Per (AaF-Consult AB, Stockholm (Sweden))

    2009-11-15

    This report presents a technical evaluation, the potential and an economical evaluation of the increased net biogas production by using district heating as energy supply for different types of biogas production units. The study presents generalized results for different plant sizes. The district heating is considered as replacement of the heat produced by burning biogas in a hot-water boiler. Hence more biogas could be available for upgrading to fuel-gas quality to be used in vehicles as a renewable fuel. The study is aimed at biogas producers, district heating and combined heat and power (CHP) companies. Biogas has a composition of mostly methane (about 65 %) and carbon dioxide (about 35 %) and small amounts of other gases e.g. sulphur dioxide (H{sub 2}S). Biogas up-grading is a process where the methane content is increased to about 97 % by removing most of the other gases in e.g. an absorption unit. The Swedish biogas is mainly produced in several sewage treatment plants and some co-digestion units but is also collected from dumps. Biogas is produced by anaerobic microorganisms at temperatures of about 36 and 55 deg C which correspond to the thermal optimum for mesophile and thermophile bacteria respectively. Co-digestion of animal material which e.g. is contained in collected organic household waste has to be pasteurized at 70 deg C for 1h according to EU-regulations. Such regulations may also be introduced to the sludge from municipal sewage treatment plants. Due to the fact that the process temperature is higher than the temperature of the substrate (sludge or organic waste material) as well as the outdoor temperature, both heating of the incoming substrate and compensation of heat losses are required. Traditionally most of the biogas has been burnt to generate the necessary heat for the process and premises at the plant. The excess gas has been burnt in a torch. In recent years the biogas produced in Sweden has found increased use as a renewable vehicle fuel

  19. Evaluation of MELTGUARD{sup TM} - a measuring system for control of fireside corrosion in boilers; Utvaerdering av MELTGUARD{sup TM} - ett maetsystem foer kontroll av roekgassidig korrosion i pannor

    Energy Technology Data Exchange (ETDEWEB)

    Henderson, Pamela [Vattenfall Utveckling AB, Stockholm (Sweden)

    2001-10-01

    Studsvik AB has developed and now owns the patent for a product called MELTGUARD. According to information from Studsvik, Meltguard is a measuring probe that shows in real-time how much corrosion is occurring and that can reduce costs and increase the lifetime of power boilers burning biomass. The product consists of a tubular air-cooled probe which is exposed in the flue gas through an existing inspection port. The electrodes in the probe react with the flue gas and ash deposit and corrosion is registered as the short-circuited corrosion current (using the zero resistance method) between rings made of the investigated material. The aim of the project was to independently evaluate Meltguard, compare it with a conventional corrosion probe and to publish the results for the Swedish thermal power industry. Two steels have been compared on the probes (a Meltguard-probe can accommodate a maximum of two test pieces), with about the same temperature. Measurements have been carried out with the steels SS2218 (T22) and Esshete 1250 on a Meltguard probe in the biomass fired boiler at Naessjoe combined heat and power plant during the period November 2000 to March 2001. For a 48 hour period sulphur was added to the fuel supply to change the fuel chemistry and influence the corrosion rate. The corrosion current for SS2218 was unstable, fluctuating considerably throughout the measuring period, and was greatly affected by soot-blowing. Usually, soot-blowing resulted in a marked decrease in the corrosion current. No simple or clear relationship between the boiler load and the average corrosion current could be determined. The corrosion current for Esshete 1250 was mostly stable, about 20{mu}A. The current for SS2218 was a little higher than that for E1250, but the relationship between current and corrosion rate was unclear. It was obviously not a linear function as the corrosion measured in 2218, when the testing was completed, was approximately four times greater than that in E

  20. Evaluation of the support schemes of The District Heating Program during the period 2008 to 2011; Evaluering av stoetteprogrammene for fjernvarme i perioden 2008 til 2011

    Energy Technology Data Exchange (ETDEWEB)

    Lindland, Odd Ivar; Johansen, Staale; Holstad, Jon; Vennes, Wenche; Kallset, Eirik

    2012-11-01

    The District Heating Program as they are designed today, are evaluated after four years of operation, to see if the program works as intended and meet the goals that were set up at the start of 2008. It is also seen in the evaluation of the development of district heating market in the period, to see if there are trends and changes in the regulatory framework that makes it appropriate to make changes to the programs. Users 'perception of the program and the programs' direct and indirect influence on the development of district heating market is also considered. The PricewaterhouseCoopers AS (PwC) has carried out the evaluation, commissioned by Enova. PwC has conducted Internet-based surveys and interviewed actors in various roles within the district. PwC concluded that the goals that were set at the input of the program period is reached. Energy results were higher than expected, while there is a trend that Enova have to pay more and more for the projects. The number of applications and projects has remained fairly stable, while projects have been smaller in size and extent. (eb)

  1. Evaluation of NVE's snow station network; Subreport in R et D project 302H15 Good snow data; Evaluering av NVE sitt snoestasjonsnettverk

    Energy Technology Data Exchange (ETDEWEB)

    Ree, Bjoerg Lirhus; Landroe, Hilde; Trondsen, Elise; Moeen, Knut M.

    2011-03-15

    NVE has measured snow water equivalent of snow pillow in forty years. Our snow station network has risen since 1997 from 6 to 25 stations. It was therefore absolutely necessary to do a review and quality assurance of NVE's snow data. This report discusses the snow data measured continuously - snow water equivalent and snow depth. Each station and the parameters it measures are described and evaluated. It is concluded in relation to whether stations should be continued or not. Stations technical solutions are well described, both of NVE's standard stations and the two test stations, Filefjell and Svarttjoernbekken. It has been o importance to bring out what problems the instruments have or may have and provide suggestions for solutions to them. Problems related to measure the water equivalent under Norwegian conditions, with the challenges and winter rain and re-freezing provides, is also reviewed. Alternatives to water equivalent measurements with a snow pillow, which is the traditional way in this country, are presented. Some of the alternative methods NVE tests out, for the others only description and our opinion is given. (Author)

  2. Evaluation of the subsidy scheme for heat pumps, pellet-fuelled fireplaces and control systems; Evaluering av tilskuddsordningen til varmepumper, pelletskaminer og styringssystemer

    Energy Technology Data Exchange (ETDEWEB)

    Bjoernstad, Even; Grande, Jorunn; Sand, Roar; Wendelborg, Christian

    2005-07-01

    Enova's subsidy scheme for energy economising in households was carried out in 2003. Subsidies were given to investments in heat pumps, pellet-fuelled fireplaces and electric energy management systems. The primary objective for this evaluation is to build knowledge about the effect of such subsidy schemes, and determine if they contribute to the reduction of electricity consumption in households. Questions that are addressed include Enova's administration of the subsidy scheme, the effects on households, the effects on the energy market, prices and technology. It is concluded that the scheme had a varied effect for the three technologies entitled to subsidies, and heat pump applications got 92,5 percent of the total sum. The households that received subsidies are in general positive, and the households that did not are in general not so satisfied with the service. It is concluded Enova has administered the subsidy scheme well, especially considering the time-frame and the changed economical conditions given (ml)

  3. De yngste barna og tingene deres – en ANT-analyse av lek i småbarnsavdelinger

    Directory of Open Access Journals (Sweden)

    Dag Øystein Nome

    2017-03-01

    Full Text Available Artikkelen presenterer en mikro-etnografisk undersøkelse av barns forhold til tingene i to småbarnsavdelinger i norske barnehager. Hensikten er å forstå hvordan barns relasjoner til ting virker inn på deres mulighet til deltagelse og sosial posisjonering i gruppen. Undersøkelsen er basert på Aktør-Nettverk-Teori som vektlegger tingenes betydning som agens i sosiale nettverk og tingenes funksjon som forlengelse av barnas kropper. Undersøkelsen viser at tingene har betydning som legitim inngangsbillett til deltagelse i lekegrupper og at tingenes innbyrdes hierarkiske orden bidrar i å uttrykke den sosiale orden mellom barna som inngår i relasjon med dem. The article presents a micro-ethnographic study on toddlers’ relationship to the material artefacts in two Norwegian kindergarten groups. The purpose of the study is to understand how their relationship with objects influences their possibilities for participation in peer groups. The study is based on Actor-Network-Theory. A main point is that material artefacts have agency in social networks surrounding us and function as extensions of our bodies. The study indicates that material artefacts serve as entrance tickets for participation in group activities and that the hierarchic order between the objects in the room, influences the social order among the children using them.  

  4. En analyse av Yoga-kundalini-upanisad

    OpenAIRE

    Martinsen, Fred

    2006-01-01

    Avhandlingen En analyse av Yoga-kundalini-upanisad bygger på den indiske asketen Narayanaswamy Aiyers engelske oversettelse av Yoga-kundalini-upanisad, utgitt i Thirty Minor Upanisad-s, Including the Yoga Upanisad-s (Oklahoma, Santarasa Publications, 1980). Denne hinduistiske teksten er omtalt som en av de 21 yoga-upanishadene, den åttisjette av de 108 klassiske upanishadene, og utgjør en del av tekstkorpuset Krsna-Yajurveda. Teksten fungerer som en manual i øvelser fra disiplinene hathayoga,...

  5. Hvordan blir nasjonale faglige retningslinjer for antibiotikabruk fulgt i norsk primær- og spesialisthelsetjeneste?

    OpenAIRE

    Jovanovic, Mileva

    2016-01-01

    Bakgrunn: Bakterienes resistens mot antibiotika er et alvorlig og økende problem både i Norge og globalt. Økende resistens skyldes dels økt forbruk av antibiotika og dels økt spredning av resistente bakterier ved stor reiseaktivitet både til og fra Norge og globalt. For å begrense, redusere og holde antibiotikaforbruket innen fornuftige rammer, slik at det utvikles minst mulig resistens, er det viktig med kontinuerlig overvåking i helsevesenet. Hensikt: Hensikten med denne masteroppgaven var ...

  6. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease.

    Science.gov (United States)

    Paech, Christian; Dähnert, Ingo; Kostelka, Martin; Mende, Meinhardt; Gebauer, Roman

    2015-01-01

    Junctional ectopic tachycardia (JET) is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV) block and the occurrence of JET. Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001), whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56). temporary third degree AV block did not suffer from JET. A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  7. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease

    Directory of Open Access Journals (Sweden)

    Christian Paech

    2015-01-01

    Full Text Available Aim: Junctional ectopic tachycardia (JET is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV block and the occurrence of JET. Materials and Methods: Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. Results: The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001, whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56. temporary third degree AV block did not suffer from JET. Conclusions: A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  8. Effektivitetsundersokning av medeltida kastmaskiner

    OpenAIRE

    Lemne, Jennifer

    2013-01-01

    Through the ages mankind has developed and tested a cascade of varying weapons of war, large and small, and has has striven to push these creations to the limits of their time. A grand example of this are the medieval siege engines that have changed shape several times over the centuries. After all this time the eciency of these siege engines will have reached their peek. . . right? In this study the eciency of several siege engines will be evaluated and the possibility of improvement will be...

  9. Lærerstudenten som frafallen leser - Om litteraturens fremtid i norsk skole

    Directory of Open Access Journals (Sweden)

    Håvard Skaar

    2016-10-01

    Full Text Available Young people’s reading of literature is in decline in Norway, and research shows that teacher students read less than average. To be able to address this problem adequately we investigated why teacher students read as little as they do. In a qualitative investigation informed by phenomenological hermeneutics, we got permission to analyze the assignment “My reading history” which was handed in by 163 teacher students. The reasons the students gave for reading, or not reading, suggest that at present literature reading is under pressure both within and outside teacher education institutions. A majority conveyed a high valuation of literature together with a description of no or very little reading in their personal lives. We interpret this divergence in light of the participants’ role as teacher students and the situation in which the students wrote their reading histories. These circumstances are judged to neither explain nor weaken the strong tendency among the students to evade or not prioritize reading of literature in their daily life. In addition, their explanations for lack in reading engagement make it difficult to assume they will become more eager readers in the future. Thus, the study implies that the  mother tongue subject in teacher education have an incresingly difficult task if the ambition is to compensate for all the reasons given by these students for opting out of reading literature. It seems less likely than before that students will be able to draw on a personal interest in literature as future teachers.    Key words: phenomenological hermeneutics, engagement in reading, teacher students, literature readingSammendragPå nasjonalt nivå er unge menneskers lesning av skjønnlitteratur synkende, og lærerstudenter er blant dem som leser minst. Hvordan skal lærerutdanningene forholde seg til dette? Svaret på spørsmålet forutsetter mer kunnskap om hvorfor lærerstudenter leser så lite som de gjør. Derfor samlet

  10. Multivariat analyse av 18F-FDG PET av tre brystkreft-xenografter i mus

    OpenAIRE

    Skappel, Ingvild

    2015-01-01

    Denne masteroppgaven tar utgangspunkt i et studie hvor man har analysert bilder innhentet fra dynamisk PET (Positron Emission Tomography) av mus med implanterte menneskelige brystkreft-xenografter, utført ved Oslo Universitetssykehus i mars 2014. 2-deoksy-2-[18F]fluoro-D-glukose (FDG), en glukoseanalog merket med radioaktivt fluor (18F), er benyttet som tracer. Ved dynamisk FDG PET avbildes aktiviteten av 18F i kroppsvevet av interesse ved flere tidspunkt etter injeksjon av tracer. I denne op...

  11. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  12. Impacts on the receiving states of Norwegian petroleum investments with an emphasis on Angola; Effekter i mottakerlandene av norske petroleumsivesteringer med hovedvekt paa Angola

    Energy Technology Data Exchange (ETDEWEB)

    Nordaas, Hildegunn Kyvik; Tvedten, Inge; Wiig, Arne

    1999-07-01

    This report examines how Norwegian petroleum investments may contribute to develop industry and a more even distribution of income in the receiving states. It also examines to what extent such investments may help to improve social development, humane rights, health, the environment and safety. The study concentrates on Norwegian investments in Angola. Offshore petroleum activities are capital-intensive and technologically demanding industry which often becomes an enclave in countries with a weakly developed industrial basis and few skilled workers. The profit from this industry accounts for a very large part of the export earnings and of the earnings of the public sector while at the same time this sector creates relatively few jobs in the local community. Thus, the income from the petroleum industry is not widely distributed. The petroleum sector tends to increase the growth of income during its development period but then causes little further development. This can be remedied by an economic policy that deliberately smoothes differences and by taking macro-economic measures which prevent overheating of the economy and which creates space for development in the private sector in the mainland economy. This is difficult, and few oil-exporting developing countries have succeeded so far. In Angola it is hardly possible under the current circumstances with civil war and the absence of institutions that work. The report emphasises that oil companies can contribute with knowledge transfer to local employees and the local state oil company. They should also help to extract Angola's resources in the most efficient and environmentally friendly way. But the social and economical development is the responsibility of the local authorities. Norwegian authorities may provide technical and economical aid, if desired, but it is stressed that there should be a clear division of roles between the authorities and the oil companies.

  13. Den norske matvaretabellen og beregningsdatabasen ved Institutt for ernæringsforskning

    Directory of Open Access Journals (Sweden)

    Arnhild Haga Rimestad

    2009-11-01

    Full Text Available  SAMMENDRAGOpplysninger om matvarers innhold av energi og næringsstoffer er nødvendig i mange sammenhenger –for overvåking av kostholdet i ulike befolkningsgrupper, for studier av sammenhenger mellom kosthold,livsstil og helse, ved veiledning, undervisning og opplysning om et helsemessig godt kosthold. De flestevestlige land har en trykt matvaretabell som viser næringsinnholdet per 100 g matvare for etrepresentativt utvalg av de vanligste matvarene. Ved næringsberegning av kostholdsundersøkelser brukessom regel spesialtilpassete beregningsdatabaser, disse har ofte ikke-publiserte data i tillegg. Kvaliteten påden beregningsdatabasen som benyttes ved bearbeiding av kostholdsundersøkelser kan ha avgjørendebetydning for resultatene. Det er viktig at den databasen som benyttes blir omtalt i metodeavsnittet nårarbeidet publiseres. Matvaremarkedet endres stadig, fokus rettes mot nye næringsstoffer og analysemetodeneforbedres. Matvaretabellene og databasene må derfor revideres kontinuerlig. Næringsstoffinnholdet imatvarer varierer med sort, rase, fôring, dyrkingsbetingelser, lagring, transport, bearbeiding, oppskrifterog tilberedningsmetode. Siden mange av disse faktorene er forskjellig i forskjellige land, er det nødvendigå ha egne nasjonale matvaretabeller og databaser. For importerte matvarer kan det være forsvarlig å låneutenlandske verdier gitt at varen er av samme type, at håndteringen er lik og at næringsstoffdefinisjonerog analysemetoder er sammenlignbare. Det er viktig å fortsette det internasjonale samarbeidet med ågjøre tabellverk i ulike land sammenlignbare. Dette er en av forutsetningene for at resultatene frakostholdsundersøkelser i ulike land kan sammenlignes.Rimestad AH, Løken EB, Nordbotten A. The Norwegian food composition table and the database fornutrient calculations at the Institute for Nutrition Research. Nor J Epidemiol 2000; 10 (1: 7-16.ENGLISH SUMMARYFood composition data are needed for diet

  14. Vidareutveckling av PROFIBUS-modul

    OpenAIRE

    Forsberg, Andreas; Larsson, Christoffer

    2010-01-01

    Denna rapport beskriver ett examensarbete som gjordes på företaget Motion Control i Västerås AB. Rapporten följer projektets utvecklingssteg och beskriver hur arbetet med att ta fram elektronik och inbyggd programvara för en kommunikationsmodul har framskridit. Kommunikationsmodulen ska fungera som en länk mellan en styrenhet och en I/O-enhet.   De inledande delarna av rapporten tar upp undersökningar på kommunikationsprotokollen PROFIBUS och PROFINET som är vanliga kommunikationsmetoder inom...

  15. Bygningsinformasjonsmodellering - Evaluering av kompetanse: Måling av kapasitet og modenhet innen bruk av BIM

    OpenAIRE

    Mjåtvedt, Arne

    2012-01-01

    Oppgaven forsøker å identifisere hvilke aspekter rundt bygningsinformasjons-modellering/modeller man kan søke å bli bedre innen for å øke verdiskapningen innen bygg, anlegg og eiendomssektoren. Dette munner ut i et verktøy for å evaluere BIM-kapasitet og BIM-modenhet. Verktøyet er planlagt i 3 evalueringsnivåer, hvorav nivå 1 Egenevaluering presenteres her. Evalueringsverktøyet er utviklet med 7 evalueringskategorier; Modellen, Prosjektstyring, Program- og hardware, Kontrakter og regelverk,...

  16. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  17. Förpackning av keramiska substrat

    OpenAIRE

    Karlsson, Jan

    2008-01-01

    Detta examensarbete handlar om forpackning av keramiska substrat. Canning ar det universella namnet pa forpackning av keramiska substrat. Keramiska substrat kan vara katalysatorer eller partikelfilter som anvands som ett efterbehandlingssystem i bensin och Diesel applikationer. Examensarbetet genomfordes hos Scania CV AB. I installationsprocessen sveps en keramisk fibermatta runt det keramiska substratet. Substratet inkapslas sedan med ett metalholje. Rapporten inleds med att beskriva olika i...

  18. Efficient Software HEVC to AVS2 Transcoding

    Directory of Open Access Journals (Sweden)

    Yucong Chen

    2016-09-01

    Full Text Available The second generation of Audio and Video coding Standard (AVS is developed by the IEEE 1857 Working Group under project 1857.4 and was standardized in 2016 by the AVS Working Group of China as the new broadcasting standard AVS2. High Efficient Video Coding (HEVC is the newest global video coding standard announced in 2013. More and more codings are migrating from H.264/AVC to HEVC because of its higher compression performance. In this paper, we propose an efficient HEVC to AVS2 transcoding algorithm, which applies a multi-stage decoding information utilization framework to maximize the usage of the decoding information in the transcoding process. The proposed algorithm achieves 11×–17× speed gains over the AVS2 reference software RD 14.0 with a modest BD-rate loss of 9.6%–16.6%.

  19. Evaluation of research frame program on Energygases 2009 - 2012; Utvaerdering av Energimyndighetens kollektiv-forskningsprogram 'Energigastekniskt utvecklingsprogram 2009-2012'

    Energy Technology Data Exchange (ETDEWEB)

    Lilliestraale, Astrid; Johnsson, Filip

    2012-07-01

    This evaluation has been carried out with the purpose of evaluating the Energy Agency's collective research program 'Energigastekniskt utvecklingsprogram 2009 - 2012'. The evaluation concerning the current period (20090401 to 20130331) have focused on society, industry and universities benefit from the program. The assignment also includes assessing the working modalities of the program. The following points have been considered: 1. The program aims; a number of program-specific questions that focus on how the program helps to strengthen the relationship between industry and academia and the quality of R and D has been obtained from the Energy Authority. 2. Subareas - focus and priorities. 3. The benefits of the program, focusing on commercialization, information dissemination and international collaboration. 4. Administration of the program. The program evaluation has focused on the central and cross-cutting issues.

  20. Situasjonsbestemt ledelse av studentgrupper i friluftsliv

    Directory of Open Access Journals (Sweden)

    Odd Lennart Vikene

    2014-05-01

    Full Text Available Artikkelen gir et praktisk eksempel på hvordan ulike studentgrupper i forbindelse med bygging av nødbivuakk i vinterfjellet opplevde min situasjonsbestemte ledelse som veileder. Teorigrunnlaget viser til situasjonsbestemte ledelsesmodeller og hva som kjennetegner god veiledning i friluftsliv. Datainnsamlingen bygger på kvantitative data fra et spørreskjema og benyttes til å analysere studentenes opplevelse av veileders ledelse ut i fra rangeringsmetoden Visuell Analog Skala (VAS. Fra samme spørreskjema var det også et åpent spørsmål som benyttes til refleksjon over studentenes opplevelse av sikkerhet i undervisningssituasjonen. Resultatene viser at studentgruppene opplevde klare ledelsesforskjeller gjennom de ulike fasene som ledelsen ble delt opp i, men at ledelsesatferden varierte lite i forhold til gruppenes erfaringsgrunnlag. Resultatene tyder på at jeg som veileder i stor grad har blitt påvirket av mine tidligere erfaringer og den potensielle risikoen som ligger ved aktiviteten. Selv om den situasjonsbestemte ledelsen varierte lite mellom de tre gruppene, viser resultatenes store standardavvik at de ulike smågruppene opplevde at ledelsen varierte. Dette tyder på at jeg som veileder til en viss grad har evnet å benytte situasjonsbestemt ledelse i praksis. På grunn av studentgruppenes relativt like oppfatning av ledelsen i de ulike fasene, viser resultatene også noe av vanskelighetene veileder har i forhold til å gjøre en korrekt vurdering av gruppens evner og erfaring i relasjon til læringssituasjonene som oppstår. Sentralt for ledelsen er likevel at studentgruppene opplevde ledelsen som betryggende, noe som gir studentene et godt grunnlag for senere opplevelser i tilknytning til vinterfriluftsliv og bygging av nødbivuakk.

  1. Evaluation of the environmental quality objective 'A Safe Radiation Environment'; Utvaerdering av miljoekvalitetsmaalet 'Saeker straalmiljoe'

    Energy Technology Data Exchange (ETDEWEB)

    Asp, Helene; Brewitz, Erica; Halvarsson, Andreas; Ljungberg, Sophie; Mjoenes, Lars; Wallberg, Petra

    2007-11-15

    The evaluation of the environmental quality objective 'A Safe Radiation Environment' is a contribution to the Environmental Objective Council's assessment of progress towards the national environmental quality objectives. The report describes and evaluates the radiation environment in Sweden, the regulatory instruments, measures carried out and the monitoring programmes. Furthermore, the possibility of achieving the objective and its interim targets is evaluated. New measures and means of control are proposed. The proposals are directed to the government and Parliament, national authorities and other stakeholders in society. The Swedish Radiation Protection Authority (SSI) considers it possible to achieve the objective, but additional efforts are required to ensure success. Environmental monitoring, research on health effects of radiation and supervision are still important areas. Intensified efforts will be needed to change attitudes towards suntanning. Changes in the formulation of the objective and its interim targets are suggested. Today only protection against radiation in the external environment is covered by the objective. Radiation protection work has to consider all. SSI therefore suggests that the objective should extend to include workplaces and indoor environment. For the three interim targets included in 'A Safe Radiation Environment', changes are suggested for the interim targets for radioactive substances and electromagnetic fields. No change is suggested for the interim target for skin cancer

  2. Introduksjon til bruk av prosessimuleringsprogrammet Aspen Plus

    OpenAIRE

    Sjøvik, Torbjørn Eig

    2013-01-01

    Denne masteroppgaven er en introduksjon i bruk av prosessimuleringsprogrammet Aspen Plus, med tanke på framtidig bruk i prosessfagene ved institutt for matematiske realfag og teknologi ved Universitetet for Miljø og Biovitenskap. Målet var å finne ut om programmet er egnet å bruke i undervisning av prosessfag. For å løse problemstillingen ble simuleringer i Aspen Plus satt opp og løst, med økende grad av vanskelighet. Dette resulterte i en brukerveiledning, som kan hjelpe nye brukere i å k...

  3. Ataksi og spastisk paraparese uten genetisk diagnose i en norsk kohort

    OpenAIRE

    Richvoldsen, Ann-Helen

    2016-01-01

    Bakgrunn: Hereditær ataksi og spastisk paraparese er begge sjeldne, degenerative spinocerebellære lidelser, som kan nedarves via alle modaliteter for arv. De er kjennetegnet ved progressive gangvansker, og er klinisk og genetisk svært heterogene tilstander. Det foregår intensivt forskning på området, og det oppdages stadig nye gener som årsak til sykdommene, men det er fremdeles mange pasienter som står uten genetisk diagnose. Det har ved Ullevål Universitetssykehus vært samlet en kohort av d...

  4. Evaluation of Co-Digestion of Biosludge from Pulp and Paper Mills; Utvaerdering av samroetningspotential foer bioslam fraan massa-/pappersbruk

    Energy Technology Data Exchange (ETDEWEB)

    Berg, Andreas; Karlsson, Anna; Ejlertsson, Joergen; Nilsson, Fredrik

    2011-02-15

    The biogas potentials from 2 biosludges from the pulp- and paper industry and 10 possible co-digestion substrates have been evaluated. 6 combinations, each including two co-digestion substrates and one biosludge, were evaluated in lab scale biogas reactors. Stable biogas processes were obtained with all combinations and the rawgas potential was higher in the co-digestion processes then for the biosludges alone (0.31- 0.43 compared to 0.21- 0.22 NL/g VS) The investment costs for two production plants were calculated. For a plant using 7 ton biosludge TS/d (total solids per day), co-digested with evaporation condensate (3 m3/d) and fibre sludge (3 ton/d) and thereby producing 850 000 Nm3 CH{sub 4}/yr the investment cost was estimated to 43 MSEK excluding ground works. For a larger plant using 20 ton biosludge TS/d, co-digested with food waste (8 ton/d) and cereal residues (12 ton/d) and producing 2 500 000 Nm3 CH{sub 4}/yr, the investment cost was estimated to 51 MSEK excluding ground works

  5. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  6. Evaluation of consequences from emissions to air from the petroleum industry at Haltenbanken; Konsekvensvurdering av utslipp til luft fra petroleumsindustrien paa Haltenbanken/Norskehavet

    Energy Technology Data Exchange (ETDEWEB)

    Knudsen, S.; Skjelkvaale, B.L.; Aarrestad, P.A.

    1997-12-31

    This report discusses the consequences of emissions to air from the petroleum industry at Haltenbanken. The evaluation includes prognoses for photochemical activity, concentration distributions and deposition of nitrogen and sulphur for the years 2000, 2009 and a base alternative for 2000 but with different emissions. The greatest emission of nitrogen oxides comes from ships, especially from shuttle tankers. The gas turbines give the greatest NOx emission from stationary installations. Hydrocarbon emission is largely due to buoy loading. The emissions of NOx, CO, methane and NMVOC from Haltenbanken are considerable compared to the total emissions from the Norwegian shelf of the North Sea and also from continental Norway. The report discusses calculated impact of the emissions at some measurement stations in that part of Norway which will be affected by the emissions, for each of the three alternatives. 62 refs., 13 figs., 12 tabs.

  7. The use of roentgen diagnostics in chiropractor activities. Project based survey according to new regulations regarding radiation protection and use of radiation; Bruk av roentgendiagnostikk i norske kiropraktorvirksomheter. Prosjektrettet tilsyn etter ny forskrift om straalevern og bruk av straaling

    Energy Technology Data Exchange (ETDEWEB)

    Raaum, Aud; Widmark, Anders

    2005-12-15

    An audit has been performed in 17 chiropractic enterprises according to new radiation protection legislation. Before the audits a survey of the use of diagnostic imaging in Norwegian chiropractic enterprises was carried out. This report summarizes the results of the survey and the findings at the audits. (Author)

  8. Utilization of power customers in the end user market. Analysis of the competitive relationship between the Norwegian power contracts; Utnytting av kraftkundar i sluttbrukarmarknaden. Analyser av konkurransetilhoevet mellom norske kraftavtaler

    Energy Technology Data Exchange (ETDEWEB)

    Sunde, Bjarne Bjoerkavaag

    2011-07-01

    This study deals with the competitive relationship between the Norwegian power agreements in end user markets. As expected we find clear evidence of an exploitation of locked-in customers through expensive standard variable rate agreements. One also find evidence that the extent of this utilization have increased after power providers began to use price discrimination of customers more actively. Vendors say the exploitation of locked-in customers have held out for and utilization is often seen as the biggest problem for the market. In time to come, it is not however given that exploitation of locked-customers, through expensive standard variable rate agreements, will continue to be the biggest problem with the market. Today, 60% of households are connected to the spot price contract, and such a percentage would indicate less use of customers. Electricity suppliers uses hand spot agreements without notification to exploit uncertainty customers have about competitive premiums. Agreements without notification will not be registered in this summary power to the Competition Authority and the agreements are therefore difficult to compare for customers. Today, over half of the spot price agreements without notification, and power providers achieve much greater profit on these agreements than the spot price agreements with notification.(eb)

  9. Energy load in low energy residences. An analysis of the total energy use in 5 versions of a Norwegian residence; Energibelastninger ved lavenergiboliger. En analyse av totalenergiforbruket i 5 versjoner av en norsk bolig

    Energy Technology Data Exchange (ETDEWEB)

    Winther, Beate Nemeth

    1997-12-31

    The purpose of the study has been to investigate whether Norwegian low energy residences have a lower energy consumption throughout their existence than residences built according to the present practises. The building life span includes in this context production of the necessary building materials, construction and use of the house and demolition and handling of the demolition materials after the house lifetime is over. 5 versions of the building are analysed: 1) A residence built after the building practise according to the 1987 building regulations. 2) A residence built according to the expected practise using the 1997 regulations. 3) A low energy residence which satisfies the demands of U-Values in the 1997 technical regulations but with solar energy equipment and efficient heat recirculation of the exhaust air. 4) A well insulated, low energy residence aided by advanced solar and low energy systems that has a very low energy consumption when in operation. 5) A residence with alternative materials compared to what is normally used in Norwegian residences. The buildings are row houses built at Hamar. All the materials used are mapped. How a large part of the materials is used as well as what materials dominate the various building parts are investigated. The energy content values in most of the building materials have been determined. The yearly energy consumption for operating all the building versions is calculated and the energy for operating is 5 times higher in residences with the largest energy consumption than in residences with the lowest consumption. The energy reduction for all the technical installations used in the row house in the study is determined. The energy consumption for demolition after the life span and transporting the demolition waste is also considered. Finally an analysis is carried out for investigating how uncertainties in the various phases of the life span of the building versions may influence the obtained results. Both an advanced solar energy residence and a house with more traditional solar energy use have in total a lower energy consumption when both energy content and energy consumption for operation are considered than in a traditionally built house of the same type. Generally most of the buildings both use solar energy and energy conservation measures combined with materials with low energy content. 41 refs., 186 tabs., 42 figs., 5 ills.

  10. Use of diagnostic x-ray among Norwegian dentists. A survey and inspection based on new radiation protection regulations; Bruk av roentgendiagnostikk blant norske tannlegar. Prosjektretta tilsyn etter ny forskrift om straalevern og bruk av straaling

    Energy Technology Data Exchange (ETDEWEB)

    Hauge, I.H.R.; Widmark, A.; Bruzell, E.

    2009-02-15

    A survey among all dentists with e-mail addresses registered with The Norwegian Dental Association (NDA) has been conducted. In addition an audit has been conducted among 21 dentists. This report summarizes the results of the survey and the findings at the audits. (Author)

  11. Veiledning i praksis. Om praksisopplæring i norsk allmennlærerutdannelse

    Directory of Open Access Journals (Sweden)

    Kaare Skagen

    2009-05-01

    Full Text Available Artikkelen presenterer to nyere studier av veiledning i praksisopplæring i allmennlærerutdannelsen. Hovedfunnene drøftes i forhold til noen tidligere nordiske forskningsstudier. Studiene redegjør for intensjoner og realiteter i praksisopplæringen med fokus på mål, innhold og form i praksisveiledningen. Materialet er ramme- og fagplaner og intervjuer og observasjoner ved tre praksisskoler. Veiledningen drøftes i forhold til teori om veiledning. De to studiene som presenteres, konkluderer med at avstanden mellom teoridel og praksisdel i lærerutdannelsen fortsatt eksisterer. Det blir konstatert både fellestrekk og forskjeller mellom skolene når det gjelder graden av individuell veiledning og gruppeveiledning og individuell studentundervisning. Innholdsfokus i veiledningen varierte. Veilederrollen varierte mellom ettergivenhet og pågåenhet. Noen forskningsstudier hevder at øvingslærere praktiserer teknologisk veiledning. Artikkelen argumenterer for at innvielse i undervisningstradisjonen er nødvendig.

  12. Opplevelse av luksus : en konformativ og eksplorativ analyse av luksusbegrepet mot smarttelefoner og nettbrett.

    OpenAIRE

    Akimov, Sergej Aleksandrovitsch

    2011-01-01

    Formålet med denne studien var å undersøke luksusopplevelsen til smarttelefoner og nettbrett, med utgangspunkt i underliggende luksusmotiver. Den fastsatte problemstillingen var todelt. For det første skulle jeg identifisere graden av luksus på smarttelefoner av to ulike merker og hvilke motiver som var de mest fremtredende for disse produktene. Den andre delen av problemstillingen fokuserte på hvorvidt det eksisterer forskjeller i opplevd luksus på ett merke, på tvers av to produktkategorier...

  13. Konstruktion av hisslås

    OpenAIRE

    Lundin, Christian; Dalstam, Robert

    2010-01-01

    Examensarbetet ”Konstruktion av hisslås” som utförts på avdelningen för maskinteknik vid Blekinge Tekniska Högskola i samarbete med Nami lift AB i Tollarp. Dagens hisslås köper Nami av en leverantör som nu blivit uppköpta av Namis konkurrent. Därför vill de undersöka om det finns en möjlighet att tillverka egna lås till ett billigare pris. Önskemålet var att låset skulle vara en elektromekanisk konstruktion som drivs av en solenoid och låset måste uppfylla de säkerhetskrav som finns för hissa...

  14. Evaluation of future policy instruments - Sub-Project 2; Utvaerdering av framtida styrmedel - Delprojekt 2 inom projektet Perspektiv paa framtida avfallsbehandling

    Energy Technology Data Exchange (ETDEWEB)

    Bisaillon, Mattias; Dahlen, Lisa; Detterfelt, Lia; Edner, Stig; Toren, Johan

    2013-09-01

    There are several recently introduced and future possible policy instruments that are of great interest to study in order to understand the future for the Swedish waste treatment market. In the energy sector, the use of system analysis models has proven to be effective in order to understand the effects and consequences of policy instruments. In the waste sector, however, such analyses have only been conducted sporadically. This in spite of the introduction of highly influential policy instruments such as producer responsibility, landfill tax and landfill ban, which together have contributed to landfilling of Swedish household waste practically has ceased. The goal of this project was, by using system analysis models, to study and evaluate the newly introduced and future possible policy instruments which affect Swedish waste treatment. The assessment was made in terms of how policy instruments affect: - the distribution of treatment technologies, - waste amounts, - greenhouse gas emissions and - the economics of waste treatment. The project was performed during 2011 and 2012 as a part of the research project 'Perspectives on sustainable waste treatment (PFA)'. During the project, discussions have taken place within the working group and the reference group on which instruments are most interesting and relevant to study. Furthermore, opinions have been gathered from the association Swedish Waste Managements policy instrument group and from various players in the industry at conferences, presentations and workshops.

  15. Distributed Trust Management and Rogue AV Software

    Science.gov (United States)

    2010-06-10

    Software Secured Order 0 WIN PC® Defender 6 Months License SubsaiJtjon indudes ~ version updates, definition updates, standart rustomer support... standart customer support for 1 year. Only today limited ollerwith special discount~ $69.99. Q Lifetime UNUMITED LlceMt, Best Cholet ! WIN PC...2010 Basic Business Model • Rogue AV basic: $0 • Rogue AV full: $30-$100 • Multi-year licensing: ~$20 more • Bundling other applications: ~$20 more

  16. Konformasjonsanalyse og teoretiske beregninger av morfin

    OpenAIRE

    Syvertsen, Linda

    2013-01-01

    Master i biomedisin Morfin og morfinderivater er de beste smertestillende medisinene vi har i dag. Dessverre har disse medikamentene en mørk bakside i form av alvorlige bivirkninger som blant annet eufori, avhengighet og respirasjonsundertrykkelse. Til tross for omfattende forskning, har man hittil ikke klart å utvikle morfinderivater med like god smertestillende effekt, men med færre alvorlige bivirkninger. Mye forskningsarbeid har blitt utført i forbindelse med fremstilling av ulike deri...

  17. An evaluation of a farm scale biogas plant with a micro turbine for combined heat and power production; Utvaerdering av gaardsbiogasanlaeggning med mikroturbin foer kraftvaermeproduktion

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Nils; Edstroem, Mats; Hansson, Mikael (Swedish Inst. of Agricultural and Environmental Engineering, Uppsala (Sweden)); Algerbo, Per-Anders (HIR Malmoehus, Bjaerred (Sweden))

    2010-03-15

    The purpose of this study was to: To evaluate a farm scale biogas plant digesting energy and nutrient rich substrates at a high organic loading rate and biogas production using the biogas for combined heat and power production with a micro turbine. Put together technical, biological and economical documentation which can help farmers to investigate presumption to invest in a farm scale biogas plant for heat and power production. The farm scale biogas plant has an active digester volume of 450 m3 and the process temperature is ca 37 deg C. A micro turbine with 105 kW electrical and 160 kW thermal power is used for heat and power production. The produced electricity is sold to the grid and the heat is used on the farm for drying grain and heating two houses. The plant is digesting poultry manure and 2 substrates from the agriculture industry. All together the plant is digesting 3140 metric tons of substrates/yr and the substrates costs 160 k SEK/yr. Total investment for the plant is 4.7 M SEK. Produced head reduces the oil consumption at the farm with 15 m3 (value 100 k SEK/yr). There is a surplus of heat production of 600 MWh/yr. The production cost for the electricity is close to 0,66 SEK/kWh based on a value of the digestate of 100 SEK/ton together with an investment subsidy of 30 %. The production cost for the electricity is strongly depending on the value of the digestate. Hagavik is a crop production farm based on organic farming. If the valuation of the digestate is reduced to 50 SEK/ton, the production cost for the electricity increases to approx. 0.84 SEK/kWh (1 SEK is about 0.14 USD)

  18. How should the household waste be handled? Evaluation of different treatment methods; Hur skall hushaallsavfallet tas om hand? Utvaerdering av olika behandlingsmetoder

    Energy Technology Data Exchange (ETDEWEB)

    Sundqvist, J.O.; Carlsson Reich, M.; Granath, J. [The Swedish Environmental Research Inst., Goeteborg (Sweden); Baky, Andras [Swedish Inst. of Agriculatural and Environmental Engineering, Uppsala (Sweden); Eriksson, Ola [Royal Inst. of Tech., Stockholm (Sweden). Div. of Industrial Ecology

    2002-02-01

    Energy turnover, and environmental and economic consequences of different municipal solid waste management systems have been studied in a systems analysis. Different combinations of incineration, recycling of separated plastic and cardboard packages and biological treatment (anaerobic digestion and composting) of easy degradable organic waste, were studied and also compared to landfilling. A simulation model (ORWARE), based on LCA methodology, was used. The following parameters were used for evaluating the different waste management options: consumption of energy resources, emissions of greenhouse gases, emissions of acidifying substances, emissions of eutrophicating substances, emissions of photo oxidant formers, heavy metal flows, financial economy and welfare economy. The analysis was based on a model municipality. In a sensitivity analysis different technical, geographic and demographic parameters have been varied, making the result to cover several different types of municipalities and regions. The conclusions from the study are as follows. The most obvious conclusion is that landfilling should be avoided. Wastes that can be incinerated (combusted), material recycled, anaerobically digested or composted should not be landfilled. This is valid even if landfill gas is extracted and utilised, and the leachate is collected and treated. This is due to that the resources in the waste are inefficiently utilised when landfilled, making it necessary to produce materials, fuels and nutrients from virgin resources. It is impossible to draw unambiguous conclusions of which of the other treatment options that is is most preferable. There are advantages and disadvantages with all options. In a systems perspective there are small differences between incineration and aerobic digestion of easy degradable organic material, and between incineration and material recycling of e.g. plastics and cardboard. Material recycling, anaerobic digestion and incineration should not be seen

  19. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  20. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  1. Mönsteranalys av inomhusluft. Undersökning av luftkvaliteten i sjuka hus med flytspackelproblem

    OpenAIRE

    Bornehag, Carl-Gustaf

    1994-01-01

    Den hälsomässiga effekten som rapporteras i samband med sjuka-hus syndromet (SBS), vars orsak är okänd, kan betraktas som ett mönster av icke specifika symptom såsom irritationer i ögon, näsa och mun, upplevelser av torra sletnhinnor och hud, hudrodnad, mental trötthet och upplevelse av svag men ihållande lukt. Aven exponeringar i inomhusluften kan beskrivas som ett mönster av en mängd olika ämnen, exempelvis VOC, partiklar, sporer m. m. Detta innebär att en av svårigheterna med att undersöka...

  2. Läs med flyt! : - en studie av elevers tidiga utveckling av avkodning

    OpenAIRE

    Bryne, Camilla

    2013-01-01

    Syftet med detta arbete är att studera elevers tidiga utveckling av förmågan att avkoda text och attbeskriva huvudtyper av olika utvecklingsvägar. Frågor som besvaras är vilka steg som kanidentifieras i utvecklingen av förmågan av avkoda text i den tidiga läsutvecklingen i årskurs ettoch två samt vilka huvudtyper av utvecklingsvägar som kan identifieras. För att svara på dessafrågor har 46 elevers tidiga läsning analyserats vid tre tillfällen under ett år. Vid läsningenanalyseras fyra olika a...

  3. Utprøving av metodikker for modellering av overvann i et urbant område ved bruk av ArcGIS, MIKE21 og MIKE FLOOD

    OpenAIRE

    Johansen, Jarle Andre; Moldekleiv, Hans Jakob Saxe

    2016-01-01

    I de siste århundrene har det blitt registrert forandringer i klimasystemet. Det er sannsynlig at dette er en konsekvens av menneskers forbruk av fossilt brennstoff. Klimaendringene vises i en høynet middeltemperatur for store deler av jordkloden. I Norge blir klimaendringene synlige i form av at det har blitt mer nedbør og at nedbørshendelsene har blitt mer intense. Denne tendensen blir av de fleste forskere framskrevet til å vedvare. Samtidig med klimautviklingen har samfunnet blitt forandr...

  4. Fiskekonsum og kreftrisiko blant norske kvinner - The Norwegian Women and Cancer Study (NOWAC

    Directory of Open Access Journals (Sweden)

    Anette Hjartåker

    2009-11-01

    Full Text Available  SAMMENDRAGVed Institutt for samfunnsmedisin, Universitetet i Tromsø, er det over mange år bygget opp en landsdekkendeprospektiv undersøkelse kalt ’Kvinner, livsstil og helse’/’Kvinner og kreft’. Studien er primærtdesignet for å undersøke risikofaktorer for kreft, og i særdeleshet brystkreft. Siden 1991 har drøyt 100 000tilfeldig utvalgte kvinner, født 1927-1965, blitt inkludert i studien. Svarprosenten er omlag 60. Deltakernehar fylt ut et spørreskjema med noe varierende innhold, men med en del felles kjernespørsmål. Detaljgradennår det gjelder kostholdsinformasjon varierer. Av de vel 100 000 kvinnene som deltar har omlag halvpartenfylt ut et oppfølgingsskjema. Vi er særlig interessert i å studere en eventuell effekt av et høyt fiskekonsum påkreftrisiko. Spørsmålene om konsum av fisk og fiskeprodukter er validert mot fettsyresammensetningen iserum fosfolipider. Studien inngår i multi-senter prosjektet EPIC – the European Prospective Investigationinto Cancer and Nutrition. For å kunne sammenlikne kostdata fra de ti deltakerlandene er det utarbeidet enintern kalibreringsmetode basert på et strengt standardisert dataprogram for 24-timers kostholdsintervju. INorge vil det bli gjennomført omlag 1800 kostholdsintervju over telefon.Hjartåker A, Engeset D, Brustad M, Lund E. Fish consumption and cancer risk among Norwegianwomen – The Norwegian Women and Cancer Study (NOWAC. Nor J Epidemiol 2000; 10 (1: 63-70.ENGLISH SUMMARYThe Norwegian Women and Cancer study, NOWAC (in Norwegian: ’Kvinner, livsstil og helse’/’Kvinner ogkreft’ is a large population-based cohort study primarily designed to examine factors related to cancer, otherillnesses, and mortality in a prospective manner. In particular, it is designed for investigation of breastcancer. Since the establishment in 1991, more than 100 000 Norwegian women born 1927-1965 have beenincluded in the cohort. The participants are randomly sampled, and the

  5. IAS 41 - Värdering av skog

    OpenAIRE

    Hellsten, Fredric; Thorsson, Johan

    2006-01-01

    Införandet av standarden IAS/IFRS i Sverige är en effekt av den internationalisering som skett de senaste åren. En stor skillnad märks bland de företag som nu måste redovisa tillgångar till verkliga värden istället för som tidigare till historiska värden. Skogskoncernerna ställs inför ett sådant faktum. Effekten blir att en mer rättvisande bild av skogens värde uppkommer. De intervjuade företagen, Bergvik Skog AB, Holmen, SCA, Sveaskog och Öhrlings PricewaterhouseCoopers håller med om att dol...

  6. Dicty_cDB: FC-AV21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV21 (Link to dictyBase) - - - Contig-U15736-1 FC-AV21E (Li...nk to Original site) - - - - - - FC-AV21E 635 Show FC-AV21 Library FC (Link to library) Clone ID FC-AV21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV21Q.Seq.d/ Representative seq. ID FC-AV2...1E (Link to Original site) Representative DNA sequence >FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq....ignments: (bits) Value FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq.d/ 573 e-162 VHK407 (VHK407Q) /CSM/VH/V

  7. Dicty_cDB: FC-AV22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV22 (Link to dictyBase) - - - Contig-U16260-1 FC-AV22Z (Li...nk to Original site) - - FC-AV22Z 672 - - - - Show FC-AV22 Library FC (Link to library) Clone ID FC-AV22 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV22Q.Seq.d/ Representative seq. ID FC-AV2...2Z (Link to Original site) Representative DNA sequence >FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq....ignments: (bits) Value FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq.d/ 1281 0.0

  8. Bioseguridad en granjas avícolas

    OpenAIRE

    Sandra L. Ricaurte Galindo

    2005-01-01

    La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extr...

  9. Surgical analysis for 106 cases with A-V patterns strabismus

    Directory of Open Access Journals (Sweden)

    Xi-Lang Wang

    2013-08-01

    Full Text Available AIM: To analyze the causes and evaluate the surgical effect of A-V patterns strabismus.METHODS: Clinical data of 106 caseswith A-V patterns strabismus in our hospital from January 2011 to December 2012 were retrospectively analyzed. Seventy patients with oblique muscle overaction were performed weakening oblique muscle surgery to treat A-V pattern. Twenty-six patients with no abnormality of oblique muscle and superior and inferior rectus muscle, and with >20△ between gaze up 25° and down 25° in V pattern and with >15△ between gaze up 25° and down 25° in A pattern were performed horizontal rectus muscle transposition to half to one muscle tendon. While ten patients with no obvious abnormality of oblique muscle and vertical rectus muscle, and with ≤20△ between gaze up 25° and down 25° in V pattern and with ≤15△ between gaze up 25°and down 25° in A pattern were only performed horizontal rectus muscle surgery.RESULTS: No A-V patterns was defined asnormotopia and A-V patterns >10△ was defined as overcorrection or undercorrection after surgery. In 106 cases, V pattern was corrected in 75 cases, overcorrected in 5 cases, undercorrected in 4 cases. A pattern was corrected in 15 cases, overcorrected in 3 cases, undercorrected in 4 cases. Horizontal strabismus >±10△ was defined as overcorrection or undercorrection after surgery. Eighty-five cases were corrected, 11 cases were undercorrected, and 10 cases were overcorrected.CONCLUSION: A-V patterns strabismus was caused mainly by abnormal extraocular muscle. A-V patterns with abnormal oblique movement were treated by oblique surgery and A-V patterns with normal oblique and vertical rectus movement were treated by horizontal rectus muscle transposition, both which corrected A-V patterns. Patients had good distance and near stereopsis postoperation. Binocular weakening oblique muscle surgery can correct primary ocular position, so surgical design of horizontal deviation about A-V

  10. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  11. Utforming av innendeltaker-design grafer i Microsoft Excel 2007

    OpenAIRE

    Strømgren, Børge; Løkke, Gunn; Olsen, Fie; Løkke, Jon Arne

    2010-01-01

    I artikkelen gis det beskrivelser av hvordan grafer for framstilling av innendeltaker tilba-ketrekkingsingsdesign (reversering), multielementdesign og multippel basislinjedesign kan konstrueres i Microsoft Excel 2007 for Windows. Det gis tips om hvordan ferdige grafer kan overføres fra Excel til andre relevante programmer. Forutsetning for bruk av framstillingen er korrekt installert Microsoft Excel 2007 for Windows. Beskrivelsene er tenkt å gi utfyllende informasjon om konstruksjon av innend...

  12. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  13. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  14. Smertelindring av opioidavhengige pasienter. En oppgave om sykepleieres holdninger og kunnskaper om smertelindring av opioidavhengige pasienter

    OpenAIRE

    Selvig, Katrine Magelssen

    2013-01-01

    Hensikten med oppgaven var å belyse sykepleieres holdninger og kunnskap om smertelindring av opioidavhengige pasienter.Det viste seg at sykepleierne oppfattet å ikke ha tilstrekkelig kunnskap om smertelindring til opioidavhengige pasienter. Det å utvikle en tillitsfull relasjon var nødvendig for å yte god pleie. Holdninger ble identifisert som den viktigste faktoren som påvirket sykepleiernes intensjon om å yte pleie av høy kvalitet.

  15. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  16. Postmoderne overbelastning : en komparativ analyse av tre storbyromaner

    OpenAIRE

    Andersen, Øystein

    2006-01-01

    Denne oppgaven er en komparativ analyse av tre storbyromaner; Crash av J.G. Ballard, Requiem for a Dream av Hubert Selby Jr, og Fight Club av Chuck Palahniuk. I hver av disse romanene skildres en form for stagnert storbytilværelse, der hovedkarakterenes liv er repeterende og stillestående. I et postmoderne samfunn i evig forandring, er det viktig å kunne tilpasse seg disse endringene, skifte kurs og ta i bruk nye muligheter. Dette er den postmoderne livsstrategi, en nødvendig strategi for å l...

  17. Forsøk med planting av lakserogn i nedre Glomma 2011-2012

    OpenAIRE

    Rustadbakken, A.; Lund, E.

    2013-01-01

    Som avbøtende tiltak mot rekrutteringssvikt hos laks i Glomma, ble det vinteren 2011-2012 gjennomført et rognplantingsforsøk. Rogna ble plantet i Whitlock-Vibert-Bokser (WVB) for å kunne evaluere klekkesuksess på fire stasjoner. Det ble totalt satt ut 45 000 rognkorn, hvorav 10 000 stk ble satt ut i kontrollkasser for evaluering av klekkesuksess. I forbindelse med vannføringsøkning i april, mista vi to av de fire kontrollkassene. Rognoverlevelsen ved Papirfabrikken (1) og oppstrøms Grusørene ...

  18. Dimensionering av Södersjukhusets sterilcentral

    OpenAIRE

    Munguia Chang, Daniel; Dahlgren, Emma

    2016-01-01

    I dagsläget pågår en omfattande planering av utbyggnationen samt upprustningen av Södersjukhuset. Byggnationen beräknas preliminärt vara i bruk under mars 2018. I och med förändringen kommer sjukhuset få en helt ny sterilcentral.  Till en sterilcentral anländer kontaminerat medicinskt gods från tillhörande eller externa sjukhus. Efter att ha genomgått diskdesinficering och autoklavering på sterilcentralen kommer godset så småningom ut som sterilt för ytterligare användning.  Det finns idag en...

  19. Exponerade hatkommentarer : En studie av svensk hatkommentarsklassificering

    OpenAIRE

    Johansson, Kim

    2016-01-01

    I detta arbete presenteras hatfulla kommentarer på internet som ett sam- hällsproblem som vi bör göra något åt. Webbplatsen Exponerat.net presenteras som en källa till hatfulla kommentarer. Med hjälp av ett förenklande antagande om att de kommentarer som finns på Exponerat kan utgöra en god representation för hatfulla kommentarer på internet konstruerar vi en klassificerare. Klassificeraren utvärderas i två steg; det ena med hjälp av tiofaldig korsvalidering och det andra manu...

  20. Studenters opplevelse av egen og andres bruk av bærbar datamaskin i forelesninger

    Directory of Open Access Journals (Sweden)

    Halgeir Leiknes

    2014-02-01

    Full Text Available Denne studien har sett nærmere på studenters bruk av egen bærbar datamaskin (heretter kalt PC i en forelesningssituasjon. Vi har sett på studenters begrunnelse for bruk og faktiske anvendelse av PC. Studien ble gjennomført i to omganger med fire års mellomrom, der både PC-brukere og de som ikke brukte PC (ikke-brukere svarte.Studenters bruk av PC fremstår som et bevisst valg, og flertallet av studenter velger å ikke benytte PC. Andelen som bruker PC har økt noe, men økningen kan i stor grad forklares med økt tilgjengelighet av egen PC fra 2007 til 2011.Vi ser en klar tendens til at brukerne og ikke-brukerne har ulik oppfatning av andelen faglig og ikke-faglig bruk av PC. Forskjellen består i at ikke-brukerne rapporterer langt mer ikke-faglig aktivitet. Resultatene indikerer at ikke-brukerne forstyrres langt mer av underholdningsrelatert PC-bruk enn av faglig bruk og at de er svært sensitive for slik ikke-faglig bruk.SummaryThis study examined students’ use of their own laptop computer (hereafter called PC in a lecture setting. We have looked at students’ actual use of the PC, as well as their reasons for doing so. The study was conducted in two rounds, separated by four years, with both PC users and non-users (those who did not use a computer responses.Students’ use of PC appears to be a conscious choice, and the majority of students choose not to use a PC. The proportion using a PC increased slightly, but this increase can be largely explained by the increased availability and affordability of PCs from 2007 to 2011.We see a clear tendency for users and non-users to have different perceptions of the proportion of professional and non-professional use of the PC; non-users report far greater non-professional activities. The results indicate that non-users are disrupted far more by entertainment-related PC use than professional use and that they are very sensitive to such non-professional use.

  1. Uten lovlig opphold = uten rettigheter? Tilværelsen til migranter uten oppholdstillatelse i lys av normativ teori om rettferdighet

    Directory of Open Access Journals (Sweden)

    Katrine Fangen

    2012-11-01

    Full Text Available Migranter som fortsetter å oppholde seg i et land etter avslag på søknad om opphold, eller som unnlater å søke om oppholdstillatelse, utfordrer det juridiske rammeverket for nasjonalstater og statsborgerskap. I denne artikkelen diskuteres livssituasjonen til migranter uten lovlig opphold opp mot normativ kosmopolitisk teori om universelle rettigheter. Dette er belyst i internasjonal litteratur, men i mindre grad innenfor en norsk kontekst. Vi tar i denne artikkelen for oss tre empiriske eksempler: tilværelsen i såkalte ventemottak, tilværelsen utenfor ventemottakene og tilværelsen for barn uten lovlig opphold. Gjennom eksemplene diskuterer vi rettighetsspørsmål i migrantenes liv. Vi viser hvordan menneskerettighetene ikke er tilstrekkelige for å ivareta migrantenes velvære, og hvordan rettigheter migrantene faktisk har, ikke fremstår som reelle fordi det oppleves som risikabelt å benytte seg av dem. Artikkelen setter normativ kosmopolitisk teori i perspektiv ved å diskutere den konkrete situasjonen til migrantene, og spør til slutt hva som kan være konsekvensene av at rettigheter blir ulikt fordelt?Nøkkelord: rettferdighet, rettigheter, migrasjon, ulovlig opphold, kosmopolitismeEnglish summary: Without legal residency = no rights? A discussion of the situation of migrants who have settled without official authorisation, in light of the normative theory of justiceMigrants who continue to reside in a country after having received a negative answer to their residence application, or who stay without registering themselves in the first place, challenge the legal framework of national states and citizenship. In this article, we illustrate the situation of migrants without legal residence in light of normative cosmopolitan theory focusing on the universality of rights. We discuss three empirical contexts: life in the so-called waiting reception centers, life outside the waiting reception centers, and the situation of children

  2. Frequency-dependent electrophysiological remodeling of the AV node by hydroalcohol extract of Crocus sativus L. (saffron) during experimental atrial fibrillation: the role of endogenous nitric oxide.

    Science.gov (United States)

    Khori, Vahid; Alizadeh, Ali Mohammad; Yazdi, Hamidreza; Rakhshan, Elnaz; Mirabbasi, Abbas; Changizi, Shima; Mazandarani, Masumeh; Nayebpour, Mohsen

    2012-06-01

    The study assessed the hydroalcohol extract effects of Crocus sativus L. (saffron) on (i) the basic and rate-dependent electrophysiological properties of the AV node, (ii) remodeling of the AV node during experimental atrial fibrillation (AF) and (iii) the role of nitric oxide (NO) in the effects of saffron on the AV node. Stimulation protocols in isolated AV node were used to quantify AV nodal recovery, facilitation and fatigue in four groups of rabbits (n = 8-16 per group). In addition, the nodal response to AF was evaluated at multiple cycle lengths and during AF. Saffron had a depressant effect on AV nodal rate-dependent properties; further, it increased Wenckebach block cycle length, functional refractory period, facilitation and fatigue (p saffron on the AV node (p Saffron increased the zone of concealment in experimental AF (p saffron. Saffron increased the AV nodal refractoriness and zone of concealment. These depressant effects of saffron were mediated by endogenous NO. Copyright © 2011 John Wiley & Sons, Ltd.

  3. "Come as You Are" : En undersøkelse av fansens sakralisering av Kurt Cobain.

    OpenAIRE

    Winding-Sørensen, Anne

    2011-01-01

    I denne oppgaven tar jeg bruker jeg populærkulturen for å vise hvordan religiøse uttrykk kommer til synes gjennom fansens sakralisering av deres idol. For å vise hvordan ulike subkulturer i samfunnet bruker kjendiser for å skape en identitet og tilhørighet til andre mennesker har jeg brukt Kurt Coabin som eksempel på hvordan grungebevegelsen ikke bare var en musikkstil, men ble også en livsstil som skape rammer og strukturer for den gruppen av mennesker som følte et samhold til andre i denne...

  4. Fylogenetisk analyse av helgenom NGS-data av Bacillus cereus-gruppen

    OpenAIRE

    Simensen, Benedicte Been

    2015-01-01

    Sammenlikning av bakteriers genom er en effektiv måte å kartlegge hva som skiller arter og stammer fra hverandre. For å sammenlikne hele genomer fra bakterier er det vanlig å sekvensere. Utfordringen er dagens sekvenseringsteknologi, som ikke klarer å lese av hele lengden til genom-sekvensen, men kutter DNA-molekylene i kortere fragmenter før avlesning. Resultatet etter sekvensering er et stort antall korte fragmenter som etter sekvensering må pusles sammen til et fullstendig genom. Til dette...

  5. Kossan i sociala medier : Personifiering av kon inom marknadsföring av mejeriprodukter

    OpenAIRE

    Carlsson, Andrea

    2017-01-01

    Syftet med studien var att undersöka porträtterandet av kossan inom marknadsföring av mejeriprodukter i sociala medier. Undersökningens analys utfördes på mejeriföretaget Arlas Instagramkonto @arlasverige. Instagramkontots inlägg som publicerats mellan december månad 2015 till december månad 2016 innehållande en eller flera verkliga kossor analyserades. Metoderna som brukades var kvalitativ bild- och textanalys med kvantitativa inslag. Frågeställningarna undersökningen baserades på var: Hur p...

  6. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  7. FabAV antivenin use after copperhead snakebite: clinically indicated or knee-jerk reaction?

    Science.gov (United States)

    Gale, Stephen C; Peters, Jo Ann; Allen, LaDonna; Creath, Robert; Dombrovskiy, Viktor Y

    2016-01-01

    Crotalidae Polyvalent Immune Fab (Ovine) (FabAV) antivenin is commonly recommended after pit viper snakebites. Because copperhead envenomations are usually self-limited, some physicians are reluctant to use this costly treatment routinely, while others follow a more liberal approach. We hypothesized that, in practice, only patients with evidence of significant (moderate or severe) copperhead envenomation [those with snakebite severity score (SSS) > 3] receive FabAV and examined a large cohort to determine the relationship between clinical findings and FabAV administration. All data from patients evaluated for copperhead snakebite at a rural tertiary referral center from 5/2002 to 10/2013 were compiled. Demographics, transfer status, antivenin use, and clinical findings were collected; SSS was calculated. The relationships among FabAV use, clinical findings, and SSS were analyzed using t-test, chi-square, and Pearson's coefficient (p copperhead snakebite; 44 (13.8 %) received antivenin. Median dose was four vials (range: 1-10; IQR: 4,6). There were no deaths. Most patients receiving FabAV (63.6 %) were admitted. With regard to demographics and symptoms, only the degree of swelling (moderate vs. none/mild; p  3, indicating moderate or severe envenomation, was only very weakly correlated with antivenin use (r = 0.217; p  3 (65.8 %) did not receive antivenin while most patients who did receive antivenin (70.5 %) had SSS ≤ 3 (indicating mild envenomation). Considerable variation occurs in antivenin administration after copperhead snakebite. Use of FabAV appears poorly correlated with patients' symptoms. This practice may expose patients to the risks of antivenin and increasing costs of medical care without improving outcomes. Guidelines used for treating other pit viper strikes, such as rattlesnake or cottonmouth snakebite may be too liberal for copperhead envenomations. Our data suggests that most patients with mild or moderate envenomation

  8. Kritik av riskbegreppet - berättigad eller ej?

    DEFF Research Database (Denmark)

    Nexøe, Jørgen; Halvorsen, Peder; Kristiansen, Ivar Sønbø

    2009-01-01

    "Först och främst inte skada" (Primum non nocere) - så lyder ett av buden i den Hippokratiska eden. Men alla medicinska åtgärder kan medföra oönskade effekter. Undersökning och behandling av friska i förebyggande syfte är inget undantag. Ett problem är att negativa effekter och skador av förebygg...

  9. Om implementering av frekvenshopping i OpenBTS.

    OpenAIRE

    Bremseth, Morten

    2011-01-01

    Denne Rapporten gir en forklaring på hva programvaredefinert radio er generelt. Den omtaler en konkret realisering ved hjelp av programvaren GNU Radio og den universale radioenheten USRP (Universal Software Radio Peripheral). GSM forklares slik at leseren får den nødvendige oversikten som trengs for å forstå resten av rapporten. Frekvenshopping forklares generelt og hvordan det er gjort i GSM. Det fremstilles en mulig realisering av frekvenshopping med USRP. Programvaren som benyttes for å o...

  10. Bakteriell produksjon av sulfid for felling av metaller i avløpsvann fra gruver optimalisering og oppskalering av prosessen

    OpenAIRE

    Nygaard, K.; Christensen, B

    1995-01-01

    Det er gjennomført forsøk i laboratorieskala og i liten pilotskala for å vurdere om bakteriell sulfat-reduksjon kan utnyttes til å produsere hydrogensulfid for felling av tungmetaller i sur avrenning fra nedlagte kisgruver. Det ble tilført etanol som vekstsubstrat for bakteriene. I laboratorieforsøkene ble det påvist sulfatreduksjonsaktivitet allerede etter få dager, mens det i pilotforsøkene tok ca 7 uker å få i gang prosessen. Metaller ble fjernet fra vannfasen som metallsulfider. Effektivi...

  11. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  12. Betydning av fruktose for kostrelaterte helseproblemer

    OpenAIRE

    Kolderup, Astrid

    2013-01-01

    Synet på sukker som næringsmiddel har endret seg de siste ti-årene. Tidligere antakelser, som blant annet at sukker ikke virker fetende, er i dag erstattet med kunnskap om klare sammenhenger mellom sukkerinntak og sykdom. Fruktoses rolle i denne sammenhengen er fortsatt noe uklar. Målet med denne litteraturgjennomgangen er å beskrive kroppens håndtering av fruktose, samt diskutere fruktoses rolle i kostrelaterte helseproblemer, med fokus på blodglukosehomeostase, fedme og karsykdom. På gr...

  13. Diskursordning och hegemoni : Representationer av en skola

    OpenAIRE

    Öhman, Anna

    2012-01-01

    Den här artikeln utforskar, genom en mångperspektivistisk diskursanalys, tidningsartiklar, en vetenskaplig artikel, ett myndighetsbrev, bloggar och ett reportage skrivna om en specifik grundskola i Sverige, som har blivit känd för sitt lyckade utvecklingsarbete med elevernas studieresultat. Enligt denna artikel är bilden som förmedlas genom media mycket positiv tills en artikel följd av en blogg, förändrade diskursordningen på ett hegemoniskt sätt. Den här artikeln beskriver den diskursiva fö...

  14. Påvirkning av personlighetstrekk på klageprosesser, og effekten av kausal prosess på hindsight bias

    OpenAIRE

    Iqbal, Quddos

    2010-01-01

    Hindsight bias er et begrep som omhandler en persons evne til å føle på forhånd hva resultatet blir. Et begrep som ser på folks følelse av å vite at hendelses utfall ble som forventet. Grad av self monitoting forteller om en persons handlinger er refleksjoner av han og hans meninger, eller av andres forventninger. Avhandlingen tar for seg self monitoring i interaksjon med hva slags klagetype en er (påfører selvforskyldt skade på mobil telefon, eller produktfeil), og hva slags klagebehandling ...

  15. Analysis reports on the ecotoxicological evaluation of discharges of spent water at the cogeneration/central heating plants Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes and Aelmhult; Analysrapporter avseende ekotoxikologisk bedoemning av utslaepp av utgaaende vatten vid Alloeverket, Borgaas, Haendeloeverket, Moelnlycke, Saevenaes och Aelmhult

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Jonas; Axby, Fredrik; Persson, Maarten; Rossander, Annelie; Schultz, Emma; Svaerd, Sara [Carl Bro AB, Kristianstad (Sweden)

    2007-04-15

    The discharges to water at six biofuelled Swedish cogeneration/district heating plants are evaluated in light of the EU Water Framework Directive concerning ecotoxicological impacts. Ecotoxicological data for the 33 prioritized substances are also reviewed.

  16. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  17. En drøfting av forholdet mellom humanistisk og samfunnsvitenskapelig tilnærming til kultur. Eksempler på likheter og forskjeller fra nyere forskning

    Directory of Open Access Journals (Sweden)

    Else Marie Halvorsen

    2013-06-01

    Full Text Available Det å arbeide tverrvitenskapelig er ikke uvanlig når det gjelder forskning innenfor estetiske fagområder. I mitt tilfelle dreier det seg om kulturforskning som både har en humanistisk og en samfunnsvitenskapelig karakter. I den grad den tar opp spørsmål knyttet til kulturinnholdet i skolefagene norsk, musikk og kunst og håndverk, beveger vi oss inn på humanioras felt, der den dokumenterte kulturen, artefaktene eller har-kulturen er i fokus. Og det er bruk for tilnærmingsmåter som gjør det mulig å tolke et foreliggende materiale av tekster, gjenstander og melodier. Men når forskningens fokus også handler om kulturoverføring eller kulturformidling, beveger vi oss på samfunnsfagenes arena både av sosiologisk og pedagogisk art. Og det didaktiske og fagdidaktiske perspektivet aktiverer både innholds- og relasjonsspørsmål: Hva er det lærere velger ut til sin undervisning og hvorfor, hvilke arbeidsmåter brukes overfor ulike elevgrupper og hva er konstruktive evalueringsformer for å fremme læring? I denne sammenheng var det en utfordring å få en vitenskapsteoretisk oppgave som oppgitt emne til min prøveforelesning for den filosofiske doktorgraden. Representerer humanistisk og samfunnsvitenskapelig forskning uforenlige størrelser som gjør det umulig å bruke begge tilnærmingsmåter i ett prosjekt, eller er det mulig å finne også konvergerende trekk mellom disse vitenskapsgrener? I det følgende presenteres drøftingen av det oppgitte tema i noe bearbeidet form.Som overskriften viser, er temaet for denne artikkel omfattende, og vil innen den gitte ramme bare være mulig å behandle i grove trekk og ut fra enkelte utvalgte perspektiv. Drøftingen tolkes som et innspill i den vitenskapsfilosofiske debatt og vil i denne sammenheng omhandle det klassiske spørsmål om forholdet mellom egenart og fellestrekk i vitenskapen.Keywords: kulturbegrepet, kulturoverføring, kulturformidling, kulturforskning

  18. Evaluering av kostholdet blant saharawiske flyktninger i Algerie: Kartlegging av kostholdets kvalitet samt bruk av tobakk og alkohol

    OpenAIRE

    Kaasa, Ida Sophie

    2015-01-01

    Master i samfunnsernæring Background: The prevalence of overweight and obesity in the world is increasing, particularly among people living in developing countries. This trend has also been found among refugees living in refugee camps in Algeria. Overweight and obesity are risk factors associated with development of non-communicable diseases. Sedentary lifestyle, an unhealthy diet and consumption of alcohol and tobacco can contribute to this. Objective: The main objective for this the...

  19. AV Rising: Demand, Budgets, and Circulation Are All Up.

    Science.gov (United States)

    Oder, Norman

    1998-01-01

    A survey of 486 public libraries found that audiovisual (AV) budgets have increased 53% in the last five years. Provides data on average size of AV collections; budget break downs; circulation; audiobook, video, and music CD purchases; popular authors and titles in abridged and unabridged audiobooks; and problems with audiobook, video, and music…

  20. Bochdalek Hernia As A Cause Of Intermittent AV Block.

    Science.gov (United States)

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-09-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  1. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  2. EST Table: AV398806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398806 NV060303 11/12/09 GO hit GO:0005488(binding)|GO:0005515(protein binding)|G... aa gnl|Amel|GB16637-PA 10/09/10 74 %/237 aa gi|91092680|ref|XP_971368.1| PREDICTED: similar to AGAP009538-PA [Tribolium castaneum] AV398806 NV06 ...

  3. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  4. An evaluation of the project 'City cooperation at Soervestlandet - implementing Energy and environment'; Evaluering av prosjektet 'Storbysamarbeid paa Soervestlandet - iverksetting Energi og miljoe

    Energy Technology Data Exchange (ETDEWEB)

    Farsund, Arild Aurvaag; Holmen, Ann Karin Tennaas

    2012-11-01

    City Cooperation on the South West Coast, 'Implementing Energy and Environment' has been a short-term project that has spanned from June 2010 to December 2011, with a operational phase of the last six months. Objectives and activities were developed in a collaboration between Stavanger, Business Region Bergen and Kristiansand Municipality. The project intended to provide support for and knowledge of an overall renewable energy industry in southwestern Norway. This evaluation is based on a assessment of whether the objectives and activities outlined in the project description is followed up. This is supplemented with assessments of implementation and benefits for the sector. In general, the activities carried out as described in the project proposal.Through surveys and interviews, activities and positive initiative feedback, but also constructive suggestions that can be helpful for learning the regional funding programs. Study and delegation travel, which formed majority of the activity, is seen as a broad measure that can embrace many. The benefit, however, depends on site added to venues that are of interest to the industry. Journeys are important meeting places for establish or maintain contact with regional and international partners. InBesides networking helps such forums to increase knowledge of the sector, either for specific technological and product knowledge or general knowledge about the industry. This means that this type of travel is useful both for the industry, research communities, developers, funding agencies and policy makers to support the industry. Nevertheless, it is worth noting that some interviewees emphasized that the delegation traveling to those who were carried to Boston Amsterdam should be a main focus of the participants related industry.The major barriers to large cities and industry in their efforts to facilitate for developing a strong renewable sector in southwestern Norway emphasized to be The major barriers to large

  5. Avaliação de diferentes programas de restrição alimentar na recria de matrizes avícolas tipo corte Evaluation of different feeding programs for broiler breeder females during the rearing period

    Directory of Open Access Journals (Sweden)

    Neventon Santi Vieira

    1995-01-01

    Full Text Available Para matrizes avícolas tipo corte o manejo de alimentação é de extrema importância, principalmente durante a fase de recria, período no qual a ave está desenvolvendo sua estrutura corporal. A resposta em termos de produção destas aves, depende da maneira como foram recriadas. Com o objetivo de avaliar diferentes programas de arraçoamento na recria de matrizes avícolas tipo corte, sobre o peso corporal, uniformidade de peso corporal e viabilidade criatória, conduziu-se este experimento no Setor de Avicultura do Departamento de Zootecnia da UFSM. O delineamento experimental foi inteiramente casualizado, constituído de 3 tratamentos com 4 repetições, tendo cada unidade experimental 67 aves. Na 1ª e 2ª semana de idade as aves foram alimentadas à vontade, na 3ª e 4ª semanas o arraçoamento foi diário controlado. Durante a fase de recria (5ª a 20ª semana de idade, as aves foram submetidas aos tratamentos (programas de arraçoamento: T1: 5ª a 14ª semana = dia sim, dia não ("Skip-a-Day"; 15ª a 17ª = 2 dias sim/1 dia não e da 18ª a 20ª semana, arraçoamento diário controlado; T2: 5ª a 8ª semana = dia sim, dia não ("Skip-a-Day", 9ª a 16ª = método 48-57-63h e da 17ª a 20ª semana = 2 dias sim/1 dia não; T3: 5ª a 20ª semana de idade = 48-57-63h de intervalo entre arraçoamentos. Os resultados obtidos mostraram que, pode-se recriar matrizes com maior intervalo entre arraçoamentos (48-57-63 horas, sem haver comprometimento dos parâmetros avaliados neste trabalho, e ainda com a vantagem de não ser necessário o arraçoamento nos finais de semana, reduzindo os custos com mão de obra.Feeding management is estremely important for broiler breeders, mainly during the rearing period, when the birds develop their corporal structure. The production performance of the hens depends on the conditions they were grown. An experiment was done at the Poultry Section of the Animal Science Department of the Federal University of

  6. Förstudie till implementering av Electronic Flight Bag

    OpenAIRE

    Löfgren Bengtson, Erik

    2013-01-01

    Flygbranschen har på senare år blivit överrumplad av den snabba expansionen av Electronic Flight Bags (EFB) och introduktionen av bärbara läsplattor har öppnat upp för ett mer ekonomiskt alternativ till fast installerad utrustning. Med anledning av detta har NextJet beslutat sig för att genomföra en förstudie för att se om det går att implementera EFB i bolaget på ett säkert och kostnadseffektivt sätt. Den här studien visar att implementering av Electronic Flight Bag inte kunde påvisa några d...

  7. Review of the SKB SR-Can interim report: Evaluation by the Nuclear Inspectorate and the Radiation Protection Authority of SKB's updated methods for safety analysis; Granskning av SKB:s SR-Can interimsrapport: SKI:s och SSI:s bedoemning av SKB:s uppdaterade metoder foer saekerhetsanalys

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-03-01

    In this report the Nuclear Inspectorate and the Radiation Protection Authority comments on the present stage of the safety analysis for an encapsulation plant for spent nuclear fuels and a underground repository. According to the evaluation of the authorities, the SKB methods for safety analysis are well structured and logical and have good potentials as starting points for future safety analyses. However, important parts of the methods need further developments before they can be used for licensing applications. Important progress has been made in several areas compared to the latest safety analysis, SR97, for instance regarding the method for systematic identification and description of all the processes and conditions that need to be considered in the analysis. SKB has also produced improved methods for documentation of different types of expert evaluations and for selection of data for model calculations. Like the international group of experts we see shortcomings in the SKB method for identification and selection of scenarios. The authorities believe that SKB should show, in a systematic and traceable way, that all unfavourable processes, conditions et cetera that have been identified, and could be of importance for the scenario, have been thoroughly evaluated. The authorities see weaknesses in the quality assurance of the interimistic report, that complicates the evaluation of the methods for safety analysis. There are also ambiguities in how SKB plan to optimize/select the best technologies and the role of the safety analysis in this connection. Finally, the authorities give recommendation on how SKB should present the model and methods for analysis that are not yet developed.

  8. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  9. Cofactor requirement of HpyAV restriction endonuclease.

    Science.gov (United States)

    Chan, Siu-Hong; Opitz, Lars; Higgins, Lauren; O'loane, Diana; Xu, Shuang-Yong

    2010-02-05

    Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M) systems in microorganisms. We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++). The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  10. Når kontakter betyr alt : En studie av bruken av nettverksmediet LinkedIn

    OpenAIRE

    Blaalid, Maren Hyvang

    2012-01-01

    LinkedIn er et av de mest populære sosiale mediene i Norge og tiltrekker seg stadig flere medlemmer. I denne masteroppgaven studerer jeg bruken av LinkedIn for å undersøke hva som er det særegne ved dette nettverksmediet. Jeg har utført en spørreundersøkelse blant 280 brukere for å få innsikt i hvem de er, hvorfor de bruker LinkedIn og hvordan de gjør det. Funnene fra analysen viser at brukerne kjennetegnes ved at de er selvstendige og formålsrasjonelle, som bruker LinkedIn strategisk for å n...

  11. Identification and evaluation of surveillance data from the Norwegian Pollution Control Authority with respect to the deterioration of cultural monuments in air, soil and water; Identifisering og vurdering av Statens forurensningstilsyns overvaakingsdata sett i relasjon til nedbrytning av kulturminner i luft, jord og vann

    Energy Technology Data Exchange (ETDEWEB)

    Dahlin, Elin; Henriksen, Jan; Anda, Odd; Krigsvoll, Guri; Boerja, Isabella; Wright, RIchard

    1999-07-01

    The main aim of the project is to identify and evaluate to what extent ''National program for pollution monitoring'' contains data which are relevant for the evaluation of the risk of deterioration of cultural monuments in Norway when exposed to air or preserved in soil or water. Even if many measuring stations have collected data for over 20 years is this an immensely short period. Long distance transported pollutions are important primarily outside the urban areas. It would be particularly the archaeological artefacts that would be affected by water quality and acidity in the soil and the degradation rate is greater. The amount of monuments in the cities are larger. In the bases there are sufficient data for estimating the degradation rates for several materials and they contain data which may give information regarding the average load in the areas and that cannot be used for evaluating the degradation rate in the air in the micro environments of the monuments. With the present dose response equations it would mainly be the ozone measurements for the urban air that may contribute to improved predictions. As the equations use long term average values the costs for including this for such areas through using passive test sampling would be reasonable. There is a substantial national measuring network for forest soils which will be useful for predicting what areas have increased risk of deterioration. There are however, few time studies of the soil changes. There are few known dose response equations for soil and water. The location of the cultural monuments in soil and water is an additional problem which will complicate the transfer of general knowledge to artefacts which may be buried at various depths. For soil and water the polluted areas may be defined. Several models for air pollution exist. When the pollution maps are connected with the meteorological maps the CorrCost model may be applied for direct calculations of where the corrosion

  12. Hvordan opplever elevene den formative evaluering i praksis?

    Directory of Open Access Journals (Sweden)

    Marie Gran Aspunvik

    2016-03-01

    norske ungdomsskoleelever opplever de formative evalueringene. Artikkelen stiller spørsmål ved den formative evalueringens betydning for elevens læring, selvutvikling og samspillet mellom eleven og omverdenen. Resultatene viser at elevene opplever formative evalueringer forskjellig og at ikke alle opplever at denne form for evaluering fremmer læring. Videre gir artikkelen innspill til hvordan evalueringspraksis kan forbedres.

  13. Framtagning av en Maintenance Organisation Expositon

    OpenAIRE

    Vukasinovic, Zoran; Mehmeti, Adnan

    2012-01-01

    För att få bedriva underhållsverksamhet på flygplan över 5700kg så måste underhållsorganisationen i fråga vara godkänd av Transportstyrelsen samt följa EU:s flygsäkerhetsmyndighet EASAs Part 145 regelverk. För att berörda myndigheter ska få sig en insikt i hur underhållsorganisationera ser ut och fungerar så måste dessa skriva en verkstadshandbok som beskriver verksamheten och processer. Detta är ett krav som finns beskrivet i Part 145 regelverket. Uppgiften blev att skriva ett förslag på kap...

  14. A case of pancreatic AV malformation in an elderly man.

    Science.gov (United States)

    Gupta, Vipin; Kedia, Saurabh; Sonika, Ujjwal; Madhusudhan, Kumble Seetharama; Pal, Sujoy; Garg, Pramod

    2018-02-05

    A 60-year-old man presented with recurrent abdominal pain and weight loss for 6 months. Abdominal imaging showed a large vascular lesion in the head and neck of pancreas suggestive of arteriovenous malformation (AV malformation). Endoscopic ultrasound was done which showed features of AV malformation with no evidence of pancreatic malignancy. Surgery was planned for definitive treatment of malformation. Digital subtraction angiography with angioembolization was done prior to surgery to reduce vascularity of the lesion. He recovered after a pylorus preserving pancreaticoduodenectomy. Histopathology of the resected specimen confirmed the pancreatic AV malformation. There has been no recurrence at 2 years of follow-up.

  15. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger. Oslo vann og avløpsverk (OVA)

  16. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger.

  17. Nansen i norsk polartradisjon

    Directory of Open Access Journals (Sweden)

    Harald Dag Jølle

    2014-08-01

    Full Text Available Fridtjof Nansen’s expeditions introduced polar exploration in Norway. And his stories from the North formed our image of the Arctic. For later generations of Norwegian explorers Nansen surely has been a great inspiration. Also within polar science Nansen serves as a hero. The article asks to what extent Nansen shared the general political view on Norwegian polar imperialism in the interwar period. That reminds us simultaneously that not all of today's political polar ambitions necessarily are in accordance with Nansen's vision for Arctic research.

  18. Compositional mapping of Vesta quadrangle Av-10

    Science.gov (United States)

    Tosi, F.; Palmer, E.; De Sanctis, M. C.; Nathues, A.; Pieters, C.; Ammannito, E.; Capaccioni, F.; Frigeri, A.; Palomba, E.; Zambon, F.; Jaumann, R.; Le Corre, L.; Preusker, F.; Stephan, K.; Raymond, C. A.; Reddy, V.; Russell, C. T.

    2012-04-01

    The Dawn spacecraft entered orbit around asteroid 4 Vesta in mid-July 2011. Since then, the Visible and InfraRed Imaging Spectrometer (VIR) acquired hyperspectral images of Vesta's surface in the overall wavelength range from 0.25 to 5.1 μm. During the Approach and Survey mission phases (23 July through 29 August 2011), VIR obtained resolved images of Vesta with spatial resolution between 1.31 km and 0.68 km/pix. More than 65% of the surface, from the South Pole up to ˜40°N, was observed under different illumination conditions and local solar elevations. Further data were acquired in the subsequent HAMO and LAMO phases. Based on this datasets, the Dawn Team is conducting mineralogical mapping of Vesta's surface in the form of 15 quadrangle maps. In this work we present the results of the spectroscopic analysis carried out for the quadrangle Av-10 ("Oppia"), spanning Vesta's latitude 22S° - 22N° and longitude 288° - 360°. Vesta is known to have a basaltic surface from visible/near-infrared reflectance spectroscopy. Although pyroxenes' spectral signatures at about 0.9 and 1.9 µm are ubiquitous on Vesta and largely dominate its surface composition, significant variability in slope, strength and wavelength position of the center of these features can be measured, which indicate multiple physical surface processes. Absorption band depth is sensitive to abundance, texture and multiple scattering effects. On the other hand, the position of the band centers is sensitive to Calcium and Magnesium abundance in pyroxenes, which is crucial to establish a link with Howardite, Eucrite and Diogenite meteorites' clan (HEDs). On the basis of several spectral indices, the surface of Vesta can be divided into different terrain types, which are mostly related to specific geological units or morphological surface features. By combining VIR channels and ratios into colour images, the presence and abundance of these materials can be revealed. Among the terrain types identified on

  19. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  20. Knihovna Sociologického ústavu AV ČR

    Czech Academy of Sciences Publication Activity Database

    Hesová, Nela

    2017-01-01

    Roč. 7, č. 3 (2017) E-ISSN 1805-2800 Institutional support: RVO:68378025 Keywords : library Subject RIV: AF - Documentation, Librarianship, Information Studies https://www.lib.cas.cz/casopis-informace/knihovna-sociologickeho-ustavu-av-cr/

  1. Navy AV-8B Crash Survivable Flight Incident Recorder (CSFIR)

    National Research Council Canada - National Science Library

    1998-01-01

    ...) met at the Naval Air Weapons Development Center, Building P302, China Lake, CA for a Program Review I Technical Interchange Meeting in support of the AV-8B Crash Survivable Flight Incident Recorder System (CSFIR...

  2. Porträtt - bilder av människan

    OpenAIRE

    Fagerholm, Tanja

    2016-01-01

    Mitt examensarbete är nödvändigtvis inte ett slutresultat av mina visuella arbeten under studietiden utan snarare resultatet av en ständigt pågående process i att hitta min plats inom konsten. En frågeställning jag brottats med under studiernas gång är begreppet konstnär. Vad är en konstnär? Vad är konst? För att närma mig förväntningarna på hur en riktig konstnär bör vara har jag gått tillbaka till en klassisk form av måleri, nämligen avbildning av människor. Istället för att använda mi...

  3. Evaluering av Leap Motion kontrollern för visualisering av musik

    OpenAIRE

    Uvman, Oliver

    2016-01-01

    An experiment was carried out, attempting to ascertain whether the Leap Motion Controller can be a useful input device for dynamically controlling graphic visualizations, e.g. by artists who use video and interactive visual arts to enhance music performances. The Leap Motion Controller was found to be too unreliable to be used as the primary controller in a professional visual arts performance.

  4. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  5. Measures and instruments for reducing emissions of greenhouse gases from Norwegian buildings. A contribution to Climate Cure 2020; Tiltak og virkemidler for redusert utslipp av klimagasser fra norske bygninger.Et innspill til Klimakur 2020

    Energy Technology Data Exchange (ETDEWEB)

    Lindberg, Karen Byskov; Magnussen, Ingrid H.

    2010-03-15

    This sector report is about energy use in buildings in the service sector and households, and is backing a report to Climate Cure 2020 who came with its main report 17.february 2010 entitled 'Measures and instruments for achieving Norwegian climate targets to 2020'. The main mandate for Climate Cure 2020 was to study the measures and costs to achieve the national emissions target of 12-14 million tonnes of CO{sub 2} reduction in 2020. In this work, the use of electricity credited with zero greenhouse gas emissions. The work in Climate Cure has been divided by sectors and industry groups in society. The Norwegian Public Roads Administration was responsible for all transportation work, Climate and Pollution Agency has also been responsible for industry, waste and agriculture, the NPD petroleum and NVE has been responsible for the district heating sector and energy use in residential and commercial buildings. It follows that industrial buildings are not included in this sector report, but is taken care of in Climate and Pollution Agency sector report for industry. Dwellings and commercial buildings outside the industry currently accounts for approximately 33% of Norwegian energy and a CO{sub 2} emissions of around 3% of the total Norwegian greenhouse gas emissions. The dwellings were energy consumption 45 TWh in 2007 and 29 TWh in commercial buildings except industrial buildings. Growth in energy consumption in these two building categories were respectively 9% and 23% since 1990, but growth has leveled off in the latter half of the period. In this study of greenhouse gas reduction measures for buildings in Norway are analyzed measures to reduce use of fossil energy in the operational phase of buildings. Life-cycle analysis for buildings with construction and demolition is therefore not considered. This as a result of sectoral division of tasks in Climate Cure and challenges of imports of construction materials to Norway. The use of fossil energy, fuel oil, kerosene and natural gas for heating buildings accounting for emissions. Today, fossil fuels make 7% of energy use in buildings. This can be reduced either by converting away from fossil fuels by adding to for example heat pump or biomass. Alternatively, you can also invest in energy efficiency buildings, but since the buildings will still have some heating needs, this alone does not eliminating fossil energy use altogether. A challenge for the building's long life, making that measures implemented today, the effect is far ahead. It is therefore important to do the right action now so that the 'error' path ahead is avoided. For example, you should switch to the best windows the day you replace the windows as these will be in the building 30 years ahead, or even longer. (AG)

  6. «Vi rigger til så godt vi kan» – konturer av praksisarkitekturer som muliggjør og hindrer undervisning i materialet tre i kunst- og håndverksfaget i norsk barneskole

    Directory of Open Access Journals (Sweden)

    Pauliina Maapalo

    2017-01-01

    Full Text Available The study presented in this article is connected to the field of arts and crafts teaching and learning in Norwegian primary school and the use of wood as material. Woodwork has had varied focus and status in educational curriculums but it seems as if this status has gradually faded. The purpose of this article is to sketch the contours of woodwork practices throughout three counties, Nordland, Nord-Trøndelag and Sør-Trøndelag using a large survey and a micro ethnographic study in eight primary schools. The empirical material of the study is analysed using the theory of practice architectures as lenses. The aim of the analysis is to identify the building blocks that enable and constrain woodworking practices in Norwegian primary schools.

  7. Global-Change research in Norway. National inventory of Global Change research in Norway i 2011; Global Change-forskning i Norge. En kartlegging av norsk Global change-forskning i 2011

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-01

    From the preface: The Norwegian Global Change (GC) Committee is appointed by the Research Council and works to strengthen the association of Norwegian researchers and research to the international GC programs and IIASA (International Institute for Applied Systems Analysis). As part of this effort, the Committee wanted a survey of Norwegian research activities linked to these programs. CICERO was engaged to carry out survey work in dialogue with the Research and GC Committee. The results of the survey are presented in this report. The GC programs are: World Climate Research Programme (WCRP), International geosphere-biosphere program (IGBP), International program of biodiversity science (DIVERSITAS), International Human Dimension Programme Wed Global Environmental Change (IHDP). In addition to IIASA. The results of the survey will be, and is, used as a basis for further activities of the Committee in terms of incentives that can increase the internationalization of Norwegian research. Furthermore, it help to ensure good coupling to these programs in their transition to a common platform in the international Future Earth Initiative (http://www.icsu.org/future-earth).(eb)

  8. EST Table: AV403989 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403989 pg--0306 10/09/28 100 %/137 aa ref|NP_037751.1| Q protein [Enterobacteria ...phage HK97] gb|AAF31144.1| Q protein [Enterobacteria phage HK97] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404408 pg-- ...

  9. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  10. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  11. EST Table: AV399879 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399879 NV120899 10/09/28 100 %/196 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  12. EST Table: AV399317 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399317 NV120063 10/09/28 100 %/262 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  13. EST Table: AV399810 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399810 NV120810 10/09/28 69 %/173 aa ref|YP_002884353.1| PP34 [Bombyx mandarina n...ucleopolyhedrovirus] gb|ACQ57304.1| PP34 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399543 NV12 ...

  14. EST Table: AV399857 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399857 NV120871 10/09/28 88 %/122 aa ref|YP_002884320.1| ODV-E25 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57271.1| ODV-E25 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399408 NV12 ...

  15. EST Table: AV399758 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399758 NV120722 10/09/28 100 %/229 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  16. EST Table: AV399854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399854 NV120868 10/09/28 86 %/123 aa ref|YP_002884262.1| BRO-A [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57213.1| BRO-A [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399449 NV12 ...

  17. EST Table: AV399743 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399743 NV120679 11/12/09 n.h 10/09/28 84 %/219 aa ref|NP_047426.1| ARIF-1 [Bombyx... mori NPV] gb|AAC63695.1| ARIF-1 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399743 NV12 ...

  18. EST Table: AV404219 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404219 pg--0716 10/09/28 88 %/150 aa ref|YP_002928933.1| Host specificity protein... J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404050 pg-- ...

  19. AVS (Application Visualization System) user`s guide

    Energy Technology Data Exchange (ETDEWEB)

    Masuko, Kenji; Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Gorai, Kazuo; Yamazaki, Kazuhiko

    1996-03-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS for image processing software and an animation processing system (video, frame scan converter). This report summarizes the information to use AVS and to develop and maintain computer and network environment for image processing. (author).

  20. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  1. EST Table: AV403342 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403342 msgV0350 11/12/09 GO hit GO:0004867(serine-type endopeptidase inhibitor ac...erpin-28 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403342 msgV ...

  2. EST Table: AV399322 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399322 NV120068 10/09/28 86 %/174 aa ref|NP_047489.1| VP39 [Bombyx mori NPV] gb|A...AC63758.1| VP39 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  3. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  4. Konstruktionen av hälsa på Instagram : En studie av unga människors uppfattning av hälsa genom bild och text

    OpenAIRE

    Danielsson, Jennifer

    2014-01-01

    Unga människor är idag väl insatta användare av olika former av sociala medier - det är ofta en självklar del i deras vardag. Det sociala mediet Instagram har blivit oerhört populärt bland såväl barn som vuxna och används dagligen via mobilen för att förmedla ögonblicksbilder till omvärlden. I den här studien kommer Instagram - utifrån begrepp som hälsa, träning och konsumtion - analyseras med hjälp av teorier om makt och genus. Hälsomedvetenheten bland unga har genom spridningen på Instagram...

  5. Implementeringsstudie : en studie av lederroller ved implementering av LUS ved Berg skole

    OpenAIRE

    Michalsen, Anne Berit; Owren, Laila

    2010-01-01

    I denne masteroppgaven studerer vi en implementeringsprosess. I 2008-2009 skulle Leseutviklingsskjema (LUS) implementeres ved Berg skole, og vi ble bedt om å følge denne prosessen på nært hold. Vi mener at vi gjennom denne oppgaven gir kunnskap om en implementeringsprosess der en ekstern veileder har en sentral rolle i prosessen. Hvordan skolens ledelse og den eksterne veilederen inntar ulike roller gjennom implementeringen er en sentral del av vår studie. Formålet med oppgaven er dels å b...

  6. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  7. Relationship of Serum Apolipoprotein A-V Levels, Oxidative Stress and Inflammatory Biomarkers with Hypertriglyceridemia in Type 2 Diabetes Mellitus.

    Science.gov (United States)

    Sharma, Devesh; Garg, Seema; Mehndiratta, Mohit; V Madhu, S; Puri, Dinesh

    2017-04-01

    Serum levels of triglycerides (TGs) are often found to be raised in type 2 diabetes mellitus (T2DM). TG levels ≥ 2.2 mM, systemic inflammation and oxidative stress (OS) are known to increase the risk of incident cardiovascular disease (CVD) substantially. In recent years, apolipoprotein A-V (Apo A-V protein) has attracted considerably as a modulator of circulating TG levels. The study was conducted in order to evaluate the levels of Apo A - V proteins and markers of inflammation and OS in patients of T2DM with and without hypertriglyceridemia (HTG) and also to assess correlation between them. T2DM patients were categorized into two groups of 40 participants, according to criteria for risk of CVD: group 1/ controls (TG ≤ 1.65 mM, n = 40) and group 2/ cases (TG ≥ 2.2 mM, n = 40). Despite the routine investigations, serum levels of Apo A-V, interleukin-6 (IL-6) and Insulin were estimated using ELISA, free fatty acids (FFA) with fluorometric assay and malondialdehyde (MDA) was measured using a spectrophotometer. Comparison of levels and correlation between variables was carried out with appropriate statistical tools. Serum Apo A-V protein levels were found significantly lower (P = 0.04) and MDA was significantly higher (P = 0.049) in cases. MDA correlated with TG levels positively (P = 0.000) and negatively with high density lipoproteins (HDL) (P = 0.000). However Apo A-V protein levels did not correlate with TG levels (P = 0.819, r = -0.027), IL-6 (r = 0.135, P = 0.269), FFA (r = 0.128, P = 0.277) and MDA (r = -0.217, P = 0.073). IL-6 levels significantly and positively correlated with HOMA-IR (r = 0.327, P = 0.004) in the all patients. In patients of T2DM, low levels of Apo A-V are associated with HTG, indicating that Apo A-V is linked with TG metabolism. Burden of oxidative stress is greater in HTG of T2DM as is evident from MDA levels and its correlation with TG levels. Since oxidative stress is an important patho-physiological basis which increases the risk

  8. Overføring av avløpsvann fra Bekkelagets rensedistrikt til Sentralrenseanlegg Vest, SRV. En vurdering av konsekvensene for forholdene i Indre Oslofjord

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1985-01-01

    Vurderingen legger særlig vekt på oksygenforholdene i Vestfjorden under sprangsjiktet . Det sikreste tiltaket ser ut til å være en ombygging av Bekkelaget R.A.til kjemisk rensing. Overføring til SRV vil gi økt direkte utslipp av oksygenforbrukende stoff til Vestfjorden. For overføring av 1/3 av avløpsvannmengden er det mulig at dette oppveies av minsket belastning fra organisk produksjon i overflaten. Overføringer på 2/3 og 3/3 ser ut til å gi uakseptable konsekvenser for oksygenforholdene i ...

  9. Guidelines - guidelines based on the experience gained in the construction and evaluating 'Hamnhuset'; Guidelines - riktlinjer baserade paa de erfarenheter som erhaallits vid uppfoerande och utvaerdering av Hamnhuset

    Energy Technology Data Exchange (ETDEWEB)

    Gervind, Pernilla; Ruud, Svein

    2011-07-01

    Based on experiences from the construction and evaluation of Hamnhuset guidelines for future project has been compiled in this report. The recommendations are addressed to constructors and entrepreneurs. The recommendations treats both the building envelope, the installations and the management of the building

  10. Do acid volatile sulfides (AVS) influence the accumulation of sediment-bound metals to benthic invertebrates under natural field conditions?

    Science.gov (United States)

    De Jonge, Maarten; Dreesen, Freja; De Paepe, Josefina; Blust, Ronny; Bervoets, Lieven

    2009-06-15

    The present study evaluates the influence of acid volatile sulfides (AVS) on accumulation of sediment-bound metals in benthic invertebrates under natural field conditions. Natural sediments, pore water, surface water, and two species of widespread benthic invertebrates (Chironomus gr. thummi and Tubifex tubifex) were collected from 17 historical polluted Flemish lowland rivers and measured for metal concentrations. Different sediment characteristics were determined (AVS, organic matter, clay content) and multiple regression was used to study their relationship with accumulated metals in the invertebrates. Physical and chemical analysis of the field samples indicated low metal concentrations in the water and pore water, but very high metal concentrations in the sediment and the invertebrates, especially for Pb (5.99 micromol/ g). In general, metal accumulation in chironomids and tubificid worms was most strongly correlated with total metal concentrations in the sediment and sediment metal concentrations normalized for organic matter and clay content. Following the results of the linear regression model, AVS did not turn out to be a significant variable in describing variation in metal accumulation. Our study clearly demonstrates that, in addition to the results gained from experiments under lab conditions, benthic invertebrates can accumulate metals from unspiked field sediments even when there's an excess of AVS.

  11. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  12. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  13. Evaluation of NO{sub x}-reduction with SNCR in a waste-fueled boiler; Utvaerdering av NO{sub x}-reduktion med SNCR i avfallspanna, Uppsala Energi AB

    Energy Technology Data Exchange (ETDEWEB)

    Gromulski, J.; Hinderson, A.; Johansson, A.; Sfiris, G.; Sjoeberg, M.; Westermark, M. [Vattenfall Utveckling AB, Vaellingby (Sweden)

    1994-10-01

    SNCR (Selective Non-Catalytic Reduction) is a method for reducing the level of nitrogen oxides in flue gas that has attracted a lot of attention and has been put to use in several units, both in Sweden and abroad. The chemical basis for this method is the fact that certain nitrogen compounds with a hydrogen content (ammonia, urea, etc) react with nitrogen oxides, forming elementary nitrogen. The maximum NO{sub x} removal is obtained when the reducing chemical is injected in the flue gas at a point where the temperature is about 870 - 1010 deg C. The measured removal of NO{sub x} using the SNCR system was 35-50%. The stoichiometric addition of urea corresponded to 0.55-0.85 moles of urea per mole of NO{sub x} in the untreated flue gas. The addition of urea seems to be the main reason for the development of N{sub 2}O gas. Most of the observations (appr 70%) during long-term evaluation indicate a NO{sub x} removal of 40-60%. The economic evaluation indicates that during 1993, with an average NO{sub x} removal of 46%, the NO{sub x} fee was reduced from 5951 kSEK/yr without treatment to 3195 kSEK/yr with treatment. With the total cost of the urea used for the SNCR system being 144 kSEK/yr, the contribution to profit becomes 2612 kSEK/yr, capital, electricity, staff and maintenance costs excluded. Thus, the pay-off time is appr. 1.7 yrs, with an investment of 4500 kSEK. 58 figs, 7 tabs

  14. Risk assessment using Analytical Hierarchy Process - Development and evaluation of a new computer-based tool; Riskvaerdering med Analytical Hierarchy Process - Utveckling och utprovning av ett nytt datorbaserat verktyg

    Energy Technology Data Exchange (ETDEWEB)

    Ritchey, Tom (Swedish Defence Research Agency, Stockholm (Sweden))

    2008-11-15

    Risk analysis concerning the management of contaminated areas involves comparing and evaluating the relationship between ecological, technical, economic and other factors, in order to determine a reasonable level of remediation. Risk analysis of this kind is a relatively new phenomenon. In order to develop methodology in this area, the Sustainable Remediation program contributes both to comprehensive risk analysis projects and to projects concentrating on specific aspects of remediation risk analysis. In the project described in this report, the Swedish Defence Research Agency (FOI) was given a grant by the Sustainable Remediation program to apply the Analytic Hierarchy Process (AHP) in order to develop a computer-aided instrument to support remediation risk analysis. AHP is one of several so-called multi-criteria decision support methods. These methods are applied in order to systematically compare and evaluate different solutions or measures, when there are many different goal criteria involved. Such criteria can be both quantitative and qualitative. The project has resulted in the development of a computer-aided instrument which can be employed to give a better structure, consistency and traceability to risk analyses for the remediation of contaminated areas. Project was carried out in two phases with two different working groups. The first phase involved the development of a generic base-model for remediation risk analysis. This was performed by a 'development group'. The second phase entailed the testing of the generic model in a specific, on-going remediation project. This was performed by a 'test group'. The remediation project in question concerned the decontamination of a closed-down sawmill in Vaeckelsaang, in the Swedish municipality of Tingsryd

  15. Showrooming. -Kvalitativt studie av mindre, uavhengige butikker i klesbransjen.

    OpenAIRE

    Hoel, Beathe

    2016-01-01

    Denne oppgaven har som hensikt å undersøke hvordan showrooming atferd hos kundene påvirker de mindre klesbutikkene som ikke er tilknyttet en kjede. Problemstillingen i denne oppgaven er: Hvordan vurderer mindre, uavhengige butikker i klesbransjen de utfordringene som knyttes til trenden showrooming og hva gjør de for å motvirke eventuelle negative virkninger av slik forbrukeratferd? Studien har som formål å undersøke hyppigheten av showrooming atferd og om dette har noen negativer konsekv...

  16. EST Table: AV399445 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399445 NV120238 11/12/09 n.h 10/09/28 100 %/284 aa ref|YP_002884369.1| IE-1 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  17. Distribusjon av Polonium i fisk, med og uten avleiringshemmer

    OpenAIRE

    Veddeng, Hanne

    2012-01-01

    I forbindelse med utvinning av petroleumsressurser blir det sluppet ut store mengder produsert vann. Produsert vann er formasjonsvann fra reservoaret som følger med ved produksjonen av olje og gass. Når formasjonsvannet kommer i kontakt med sjøvann felles det ut uorganiske salter, som BaSO4. Dette er såkalte scaleavleiringer som utgjør et problem for oljeindustrien da det blant annet tetter igjen produksjonsrørene og gir en mindre effektiv produksjon. Som løsning på problemet tilsetter oljein...

  18. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  19. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  20. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  1. Optimization and Technical/Economical Evaluation of Biogas Production from Biosludge from Pulp and Paper Mills; Optimering och teknisk/ekonomisk utvaerdering av biogasproduktion fraan bioslam fraan massa-/pappersbruk

    Energy Technology Data Exchange (ETDEWEB)

    Xu-Bin Truong; Karlsson, Anna; Ejlertsson, Joergen; Nilsson, Fredrik

    2010-04-15

    The biogas potentials from biosludges from six different pulp- and paper mills have been evaluated. It ranged from 100 - 200 mL CH{sub 4}/g VS (volatile solids) for all six mills where five of them gave results between 150 - 200 mL CH{sub 4}/g VS. Long-term semi-continuous trials with biosludges from two of the mills showed stable biogas production throughout the testing period. Pretreatments with enzymes and ultrasound were tested but showed no significant effect on the methane potential. The investment costs for two production plants were calculated. For a small plant using 7 ton biosludge TS/d (total solids per day), producing 305 000 Nm3 CH{sub 4}/yr the investment cost was estimated to 30 MSEK and for a larger plant using 20 ton biosludge TS/d, producing 871 000 Nm3 CH{sub 4}/yr the investment cost was estimated to 51 MSEK (1 USD approx 7 SEK)

  2. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  3. Analys av Arbetsmiljöverkets tillämpning av enkätverktyget NOSACQ-50

    OpenAIRE

    Andersson, Robin

    2013-01-01

    År 2013 införde Arbetsmiljöverket ett nytt webbaserat enkätverktyg som skall kunna ge ett mått av säkerhetskulturen hos företag och organisationer. Denna enkät baserades på tidigare forskning som tog fram en enkät, NOSACQ-50, för just detta ändamål. Värt att notera är att Arbetsmiljöverkets version är förkortad där vissa påståenden togs bort och vissa skrevs om. Det är detta som analysen behandlar. Hur påverkas resultaten av dessa förändringar som genomfördes av Arbetsmiljöverket? Analysen un...

  4. Visualisering av farmakologiska substanser i levervävnad med hjälp av masspketrometrisk bildtagning

    OpenAIRE

    Mäkinen, Matias

    2017-01-01

    Målet för detta forskningsprojekt var att utveckla en metod med vars hjälp det är möjligt att detektera farmakologiska substanser i levervävnad med hjälp av masspektrometrisk bildtagning, så kallad MALDI-MSI. I litteraturen finns beskrivet tillämpningar av MALDI-MSI med vars hjälp det detekterats till exempel lipider i vävnader eller såsom i denna studie farmkologiska substanser. Arbetet bestod av två delmoment. I den första delen isolerades hepatocyter ur råttlever genom att perfusera k...

  5. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...... for konflikt og hjelpeløshet. Helsefremmende arbeid basert på dialog og tidlig intervensjon kan forhindre at online-spilladferd kommer ut av kontroll....

  6. Open Source AV solution supporting In Situ Simulation and Clinical education

    DEFF Research Database (Denmark)

    Simonsen, Eivind Ortind; Pociunas, Gintas; Dahl, Mads Ronald

    2015-01-01

    for a portable AV system for VAD. The system would make use of components widely available and easily replaceable. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost and a potential continues improvement and expansion of the AV system. Summary of results...... debriefing in a mobile, in situ simulation environment using an AV system constructed from “off the shelf” components and Open Source software....

  7. Rensing av avløpsvann fra settefiskanlegg med Algas Microfilter

    OpenAIRE

    Ohren, J.A.

    1987-01-01

    Rensing av avløpsvann fra settefiskanlegg er foretatt med Algas Microfilter: Under vanlig drift var avløpsvannets innhold av suspendert stoff, TOC, total nitrogen og total fosfor lavt. Renseeffektene var følgelig også lave. Ved vask av fiskekarene i settefiskanlegget økte ovennevnte innhold av forurensninger i avløpsvannet betydelig. Renseeffektene gjennom silen økte også betydelig. Algas

  8. Undersøkelser av utfordringer og vurdering av tiltak for renseanlegg tilknyttet Orklas produksjonslokaler på Rygge

    OpenAIRE

    Langfeldt, Samson

    2017-01-01

    Bakgrunnen for oppgaven ligger i at avløpsvannet fra produksjon av syltete rødbeter, sylteagurker, surkål m.m. ikke overholder kravene som er gitt i påslippsavtalen med kommunen. Dette kan føre til konsekvenser for fabrikkeierne, og ha negative konsekvenser på avløpsnettet. Denne oppgaven har fokusert på å finne årsaken til disse problemene samtidig som den gjør en teknisk analyse av mulige løsninger som kan fungere for anlegget. På anlegget er det blitt gjort undersøkelser avløpsvannets alka...

  9. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  10. EST Table: AV401520 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401520 e96h0828 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  11. EST Table: AV398543 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398543 NV021933 10/09/28 92 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 93 %/1

  12. EST Table: AV400552 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400552 br--1440 10/09/28 93 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 94 %/1

  13. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  14. EST Table: AV404642 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404642 prgv0279 10/09/28 81 %/116 aa ref|NP_001091796.1| programmed cell death pr...otein 5-like protein [Bombyx mori] gb|ABJ97180.1| programmed cell death protein 5-like protein [Bombyx mori

  15. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  16. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  17. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  18. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  19. EST Table: AV398357 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398357 NV021720 10/09/28 44 %/103 aa ref|XP_002435218.1| charged multivesicular b...ody protein, putative [Ixodes scapularis] gb|EEC08042.1| charged multivesicular body protein, putative [Ixod

  20. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  1. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  2. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  3. EST Table: AV399390 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399390 NV120162 11/12/09 n.h 10/09/28 100 %/181 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopol

  4. EST Table: AV399744 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399744 NV120680 10/09/28 98 %/185 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  5. EST Table: AV399272 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399272 NV120003 10/09/28 100 %/126 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus

  6. EST Table: AV399898 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399898 NV120920 10/09/28 86 %/105 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  7. EST Table: AV399551 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399551 NV120385 10/09/28 99 %/123 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  8. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  9. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  10. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  11. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  12. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  13. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  14. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  15. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  16. EST Table: AV402755 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402755 heS30447 10/09/28 32 %/161 aa ref|XP_001988342.1| GH10620 [Drosophila grims...hawi] gb|EDW03209.1| GH10620 [Drosophila grimshawi] 10/08/28 32 %/161 aa FBpp0144526|DgriGH10620-PA 10/08/2

  17. EST Table: AV404071 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404071 pg--0407 11/12/09 n.h 10/09/28 100 %/244 aa ref|YP_002928933.1| Host speci...ficity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW295

  18. EST Table: AV404427 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404427 pg--0966 11/12/09 n.h 10/09/28 91 %/168 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  19. EST Table: AV404050 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404050 pg--0381 11/12/09 n.h 10/09/28 99 %/161 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  20. EST Table: AV400190 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400190 br--0867 10/09/28 67 %/134 aa ref|XP_974541.1| PREDICTED: similar to Media...%/108 aa gnl|Amel|GB13317-PA 10/09/10 67 %/134 aa gi|91083293|ref|XP_974541.1| PREDICTED: similar to Media

  1. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  2. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  3. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  4. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  5. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  6. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  7. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  8. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  9. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  10. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  11. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  12. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  13. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  14. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  15. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  16. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  17. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  18. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  19. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  20. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  1. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  2. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  3. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  4. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  5. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  6. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  7. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  8. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  9. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  10. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  11. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  12. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  13. Hvor moralsk tenker fotballspillere? – en empirisk studie av toppfotball

    Directory of Open Access Journals (Sweden)

    Lars Tore Ødegård

    2015-11-01

    Full Text Available Det er en utbredt oppfatning at det økende prestasjonskravet i toppfotball fører til en svekkelse av moral og fair play-holdninger. Men hvordan tenker toppfotballspillere i forhold til ulike dilemmaer som oppstår på banen, og er det forskjeller mellom toppfotballspillere og spillere på lavere nivå?  For å avklare dette gjennomførte vi en empirisk undersøkelse der vi intervjuet spillere og trener i én toppklubb og én breddeklubb. Vi var interessert i to hovedproblemstillinger:  1 Hva tenker fotballspillere på ulike prestasjonsnivå om etikk og moralske dilemmaer i fotball? 2 Hvilke faktorer påvirker spillerne, direkte og indirekte, i deres vurderinger og handlinger? Resultatene fra undersøkelsen viser at det er store forskjeller mellom de to prestasjonsnivåene. Spillerne på breddenivået føler generelt et større ansvar for å opptre ærlig på banen enn hva som er tilfelle på toppnivået. Vi fant 4 spesifikke faktorer i toppfotballen som bidrar til umoralsk opptreden. For det første opplever spillerne en forventning om at de prioriterer resultat foran fair play. For det andre bidrar tilstedeværelsen av supportere på kamper til en slik prioritering. For det tredje vil handlinger som er i strid med fair play signaliseres som akseptable internt i miljøet, selv om de ofte signaliseres som uakseptable overfor media og omverdenen. For det fjerde kan spillere oppleve det som vanskelig å gå i mot trenerens oppfordringer til en pragmatisk og resultatfokusert opptreden.Nøkkelord: moral, etikk, fair play, footballEnglish summary: How morally do football players think? – an empirical study of moral dilemmas in elite footballIt is a common view that the increasing focus on achievement and success in elite football leads to a weakening of moral and fair play attitudes. But how do elite players think and what do they think about different dilemmas that appear on the field, and is there a difference between elite players and lower

  14. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  15. Rekonstruering av cyanobakterien Planktothrix sine forekomster i Hålandsvatnet fra 1980 fram til 2014 under påvirkning av den vertsspesifikke parasitten Chytridiomycota

    OpenAIRE

    Westerås, Anne Charlotte

    2016-01-01

    Cyanobakterier har eksistert i ~ 3,5 milliarder år, noe som gir dem en historisk evolusjonær fordel ved tilpasning til enten menneskeskapte eller naturlige endringer. Algene kan danne oppblomstringer som ofte er giftige, hvorpå toksiske forekomster er et resultat av oligopeptid-produksjon. Slike peptider kodes av en meget gammel del av cyanobakterienes genom, og individer innenfor samme algepopulasjon kan ha ulik oligopeptid sammensetning eller profiler. Derfor antas horisontal ge...

  16. Hormoners betydning for kognitiv utvikling : en studie av jenter med adrenogenitalt syndrom (AGS)

    OpenAIRE

    Schjølberg, Katrine Luisa Fernanda

    2010-01-01

    Bakgrunn: Studier av både mennesker og dyr som har vært utsatt for unormale mengder hormonkonsentrasjoner har vist endringer i utviklingen av kognitive ferdigheter. Andrenogenitalt syndrom(AGS) er en tilstand som fører til økt produksjon av androgener i fosterlivet. Denne tilstanden har vist klar sammenheng mellom dennes atypiske hormonnivå og atferd i form av både lekepreferanse og valg av lekepartner. I motsetning er litteraturen uklar på forholdet mellom deres hormonelle miljø og utvikling...

  17. Fremre korsbåndskade og utvikling av sekundær artrose

    OpenAIRE

    Holm, Stine

    2013-01-01

    Oppgaven er en blanding av et litteraturstudie og en kohortestudie. I litteraturstudien har jeg sett på hva fremre korsbånd og artrose er, og hvilke risikofaktorer som kan bidra/progrediere utvikling av artrose hos korsbåndsopererte. I kohortestudien har jeg og veilederen sett på forekomsten av artrose hos korsbåndsopererte- 10-20 år etter ACL rekonstruksjon. Ved hjelp av røntgen og klinisk undersøkelse vurderte vi tidligere korsbåndsopererte og grad av artroseforandringer. Vi så også på hvor...

  18. Lærerstudenters kommentatorkompetanse om flerkultur og undervisning av flerspråklige elever drøftet i lys av kritisk multikulturalisme

    Directory of Open Access Journals (Sweden)

    Wenche Elisabeth Thomassen

    2016-01-01

    Full Text Available Grunnskolelærerutdanningen har som mål å utdanne studenter med både aktør- og kommentatorkompetanse. Kommentatorkompetanse innebærer evnen til kritisk refleksjon. Planer, forskrifter og retningslinjer for grunnskolelærer-utdanningene fastslår at studentene skal ha kunnskaper om flerkultur og undervisning av minoritetsspråklige elever. Slik kompetanse er fortsatt etterspurt, også blant nyutdannede lærere.I denne undersøkelsen er “kritisk multikulturalisme” brukt som teoretisk tilnærming for å analysere gruppeintervjuer med lærerstudenter. Drøftingen inkluderer også hvordan begreper fra denne teoretiske tilnærmingen fungerer for å forstå lærerstudentenes kommentatorkompetanse. Kritisk multikulturalisme er opptatt av å gi en analyse av undertrykking og institusjonalisering av ulike maktrelasjoner innen utdanning. Begreper som er særlig framtredende, er systemmakt, definisjonsmakt og avmakt. Empirien er en del av et større forskningsprosjekt ved UiS, som studerer praksis i grunnskolelærerutdanningen.Undersøkelsen viser at lærerstudentene viser oppmerksomhet og grad av kritisk kommentatorkompetanse når det gjelder systemnivå og pedagogiske praksiser, men ikke har nødvendigvis tilstrekkelig kunnskap om lover og regler for opplæringen. De savner mer oppmerksomhet på temaet innen lærerutdanningen, særlig konkret didaktikk. Funn i materialet indikerer at det ville være av betydning med en dypere forståelse og mer faglige begreper som grunnlag for refleksjon.Analysebegrepene fra kritisk multikulturalisme kan bidra til å sette studentenes utsagn inn i en større sammenheng og peke på potensielt diskriminerende diskurser, men fanger ikke alt studentene er opptatt av. Dette er et område som det ikke er mye forskning på i Norge, artikkelen er et bidrag til økt kunnskap om flerkultur i grunnskolelærerutdanningene.Nøkkelord: lærerstudenter, flerkultur, flerspråklige elever, kritisk multikulturalisme Abstract

  19. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  20. Livet med gränsen : Norsk närvaros påverkan på gränskommunen Strömstad

    OpenAIRE

    Andersson Sköld, Lisa

    2007-01-01

    Gränsers betydelse har både suddats ut och aktualiseras i och med en ökad grad av globalisering och mobilitet. Den svensk-norska gränsen har i stora drag legat fast i nästan 350 år och under tiden har kulturella och nationella identiteter skapats. Genom sitt läge vid riksgränsen påverkas Strömstad av nationella händelser på ett helt annat sätt än Sverige i stort samtidigt som det även finns ett starkt inflytande från en annan stats nationella politik. Syftet med studien har varit att undersök...

  1. Dual chamber pacing with optimal AV delay in congestive heart failure: a randomized study.

    Science.gov (United States)

    Capucci, A; Romano, S; Puglisi, A; Santini, M; Pagani, M; Cazzin, R; Zanuttini, D; Mangiameli, S; Moracchini, P V; Neri, R; De Ciuceis, P; Circo, A; Cavaglià, S; De Seta, F

    1999-07-01

    A prospective randomized trial was set up to evaluate contractile parameters and quality of life in patients with congestive heart failure. We describe the results from 38 patients in sinus rhythm and with chronic heart failure due to congestive cardiomyopathy, prospectively randomized to optimal medical therapy (Group 1, 19 patients) or optimal medical therapy plus dual chamber pacemaker programmed to optimal AV delay (Group 2, 19 patients). At a 6 month follow-up, 7/19 patients in Group 1 had died compared with 5/19 patients in Group 2. During follow-up, there were few significant changes in evaluated parameters except for mitral regurgitation time, which was prolonged in Group 1 and shortened in Group 2. The systolic left ventricular diameter shortened significantly only in Group 2. An energy and activity questionnaire showed that the effect of DDD pacing in the latter patient population was beneficial. From these results we may conclude that at the 6 month follow-up DDD pacing with echo-optimized AV interval programming can improve quality of life without affecting survival.

  2. En kvalitativ studie av sykepleiestudenters opplevelser av nye læringsaktiviteter i kritisk vurdering av kvantitative forskningsartikler

    Directory of Open Access Journals (Sweden)

    Cecilie Katrine Utheim Grønvik

    2015-01-01

    Full Text Available A qualitative study of nursing students' experience of new learning activities in critical evaluation of quantitative research articles Evidence-Based Practice is a vital part of professional health care and nurses need to have knowledge of research. This article presents nursing students' experience with new learning activities in critical evaluation of quantitative research articles. This experience was studied in focus group interviews with second-year nursing students. The students described it as challenging to understand the various quantitative designs and statistical methods. Specific requirements in the learning activities, constructive feedback, relevance and conformity between learning activities and assessments seem to promote the targeted learning outcome. How students' knowledge and skills are received in practice seems to affect students' attitudes and behavior in relation to the application of research results. To increase evidence-based practice there appears to be a need for innovative processes that can strengthen the cooperation between the nursing education and the field of practice.

  3. Främjandet av kvinnliga entreprenörer

    OpenAIRE

    Palm, Caroline; Lindqvist, Jessica

    2008-01-01

    Trots en ökande trend av antalet kvinnliga entreprenörer är proportionen till manliga entreprenörer fortfarande relativt låg. Anledningen kan bland annat bero på att entreprenörskap definieras efter egenskaper som återfinns bland typiska manliga egenskaper som till exempel riskbenägenhet och en stor självtillit. Med stor sannolikhet är detta en av orsakerna till att få kvinnor kan identifiera sig själva med rollen som entreprenör. Denna studie undersöker vad som i nuläget utförs för att främj...

  4. Energieffektivering av skolfartyget M/S Michael Sars

    OpenAIRE

    Ekebom Oscar, Lindholm Andreas

    2017-01-01

    Syftet med detta examensarbete är att undersöka och utvärdera hur värmeförbrukningen ombord på skolfartyget M/S Michael Sars kan effektiveras. Vi genomförde detta på tre olika sätt. Det första var att undersöka hur en isolering av maskinrummet och dess trapphus kan sänka uppvärmningsbehovet. Vi beräknade värmegenomgången genom skrovet samt hur mycket isoleringsmaterial som behövs. Det andra alternativet för energieffektivering är att undersöka hur ett eventuellt byte av fartygets oljeeldade p...

  5. "Det begynder næsten at bli beboeligt ogsaa i digternes verden" - samtidens resepsjon av Henrik Ibsens Lille Eyolf

    OpenAIRE

    Andersen, Torbjørn

    2010-01-01

    Avhandlingen er en undersøkelse av den skandinaviske samtidsresepsjonen av Henrik Ibsens drama Lille Eyolf (1894), begrenset til bokomtaler (ikke oppsetningskritikk). Artikler av Hans Robert Jauss, Jan Mucařovský og Felix Vodička danner det teoretiske utgangspunktet for arbeidet. I tillegg er Per Thomas Andersens klassifisering av fire hovedtyper kriterier for litteraturkritikk benyttet. Undersøkelsen bygger på et stort utvalg av tradisjonelle avisanmeldelser og tidsskriftartikler fra 1...

  6. The Learning A-V Awards 1982.

    Science.gov (United States)

    Abraham, Lisanne

    1982-01-01

    Teachers, audiovisual librarians, and curriculum specialists evaluated educational films and filmstrips for "Learning" magazine and selected 39 outstanding examples. Their choices are categorized under: (1) language arts/reading; (2) social studies; (3) science; (4) music; (5) values and guidance; (6) health and safety; and (7) computer science.…

  7. EST Table: AV399321 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx manda...rina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  8. EST Table: AV399146 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399146 NV060720 10/09/28 91 %/173 aa ref|YP_002884350.1| GP64/67 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57301.1| GP64/67 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP121286 NV06 ...

  9. EST Table: AV399657 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  10. EST Table: AV399890 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399890 NV120911 10/09/28 83 %/222 aa ref|YP_002884341.1| PIF-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57292.1| PIF-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP120262 NV12 ...

  11. EST Table: AV399458 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884259.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63702.1| LEF-6 [Bombyx mori NPV] gb|ACQ...57210.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399457 NV12 ...

  12. EST Table: AV398266 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV02 ...

  13. EST Table: AV399527 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884325.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63769.1| LEF-5 [Bombyx mori NPV] gb|ACQ...57276.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399374 NV12 ...

  14. EST Table: AV403832 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403832 pg--0107 10/09/28 99 %/175 aa ref|NP_001103774.1| receptor expression enhancing... protein isoform 1 [Bombyx mori] gb|ABD36360.1| receptor expression enhancing protein isoform 1 [Bombyx.../10 56 %/174 aa gi|189239379|ref|XP_971918.2| PREDICTED: similar to receptor expression enhancing protein [Tribolium castaneum] NM_001110304 pg-- ...

  15. EST Table: AV399230 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399230 NV060841 10/09/28 97 %/150 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  16. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  17. EST Table: AV399150 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399150 NV060726 10/09/28 98 %/124 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  18. EST Table: AV399180 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399180 NV060769 10/09/28 57 %/213 aa ref|XP_391845.2| PREDICTED: similar to tout-...:AGAP010388 10/09/10 57 %/213 aa gnl|Amel|GB17343-PA 10/09/10 55 %/209 aa gi|91076108|ref|XP_968944.1| PREDICTED: similar to tout-velu CG10117-PA [Tribolium castaneum] FS931854 NV06 ...

  19. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  20. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  1. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  2. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  3. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  4. Data basis for materials for a new North Sea Agreement 1995 - Collecting and assembling of data basis for assigning priorities to possible Norwegian proposals for new materials in the North Sea Agreement; Datagrunnlag for stoffer til ny Nordsjoeavtale 1995. Innhenting og sammenstilling av datagrunnlag for prioritering av eventuelle norske forslag til nye stoffer i Nordsjoeavtalen

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, H.E.; Tobiesen, A.

    1994-03-12

    In connection with the new North Sea Agreement in 1995, Norway may propose that the addition of certain environmentally hazardous chemicals should be reduced. Norway may propose 5-10 substances or groups of substances. This report lists available information about 28 contaminants as a basis for prioritizing. The relevant data shown are physical and chemical properties, quantities produced, emissions, toxicity, decomposition and bioaccumulation. The report also suggests a rough priority. 36 refs., 3 tabs.

  5. Inkludering av ungdom med minoritetsbakgrunn i NIF-organisert idrett

    Directory of Open Access Journals (Sweden)

    Mari Kristin Sisjord

    2014-10-01

    Full Text Available Norges Idrettsforbund og Olympiske og Paralympiske Komité (NIF har en uttalt målsetting om en åpen og inkluderende idrett. Hvordan kommer dette til uttrykk i den praktiske virksomheten? Denne artikkelen, som bygger på data fra en undersøkelse om likestilling og mangfold i den organiserte idretten (NIF, retter søkelyset mot arbeid med inklusjon av ungdom med minoritetsbakgrunn på ulike organisasjonsnivå i NIF: særforbund, idrettskretser og idrettslag. Datamaterialet er kvalitative intervju med representanter fra ulike organisasjonsnivå. Resultatene viser at NIFs overordnede politikk i varierende grad nedfelles i særforbundenes virksomhet, i idrettskretsene og i idrettslagene. Av særforbundene skiller Fotballforbundet og Klatreforbundet seg ut som aktive pådrivere i arbeidet med inkludering. Mange idrettslag oppfattet slike spørsmål som lite aktuelle i sitt rekrutteringsområde. Representanter for lag som hadde erfaring med inkludering og rekruttering av minoritetsungdom, tilkjennega varierte erfaringer og synspunkter.

  6. O tornar-se avó no processo de individuação

    Directory of Open Access Journals (Sweden)

    Caroline Dal Ri Kipper

    Full Text Available O tornar-se avó assinala um período de transição no ciclo de vida familiar, marcado por transformações psíquicas significativas para os avós, caracterizando a quarta individuação. Este trabalho teve como objetivo investigar a experiência de tornar-se avó e sua importância no processo de individuação. Foi utilizado delineamento de estudo de caso coletivo. Onze avós maternas, com idades entre 49 e 66 anos, cujas filhas tiveram seu primeiro filho, responderam a uma entrevista semi-estruturada. Todas as avós tinham tido seus primeiros netos e a entrevista referia-se a sua experiência como avós desses netos. Os dados mostraram que o ser avó é uma fonte de renovação e renascimento. O estudo propiciou que as participantes refletissem sobre seus diferentes papéis familiares: avó, mãe, neta e filha. Os dados sugerem que tornar-se avó possibilita que antigos conflitos sejam repensados, renovando antigos vínculos e desejos, o que permite que a avó dê mais um passo rumo à sua individuação.

  7. Balanced scorecard i Durapart AS : en studie av balanced scorecard i en attføringsbedrift

    OpenAIRE

    Haugetun, Roar; Aarnes, John Christian Akre

    2008-01-01

    Masteroppgave i Industriell økonomi og informasjonsledelse, Universitetet i Agder, Grimstad Temaet for utredningen er Balanced Scorecard, også på norsk kalt balansert målstyring, på toppledernivå og avdelingsnivå i attføringsbedriften Durapart AS. Robert S. Kaplan og David P. Norton har laget en modell, Balanced Scorecard, som hovedsakelig er et verktøy som handler om at bedrifter skal kunne styre etter og måle andre områder enn kun de finansielle, som tradisjonelt og historisk...

  8. T-760/15: Nederländerna mot Kommissionen : Analys av kommissionens prövning av selektivitet

    OpenAIRE

    Elofsson, Niklas

    2016-01-01

    I takt med att den ökade globaliseringen av den internationella handeln har möjligheterna för multinationella företag att påverka sin beskattning ökat. Företags olika upplägg för att minska sina skattekostnad har bekämpats allt eftersom de har växt fram. Under 2010-talet uppdagades att multinationella företag har fått minskade skatte-kostnader genom tillämpning av APA:or med medlemsstater. Kommissionen har påbörjat ett nitiskt arbete för att stoppa och återvinna dessa skattelättnader. Kommiss...

  9. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  10. Diffusjon av influensa i Norge under spanskesyken 1918-19

    Directory of Open Access Journals (Sweden)

    Svenn-Erik Mamelund

    2009-10-01

    Full Text Available  SAMMENDRAGSpanskesyken var en verdensomspennende influensaepidemi som tok livet av minst 30 millioner mennesker,de fleste i løpet av noen få høstmåneder i 1918, men den strakk seg også inn i 1919. En siste svakbølge fant sted vinteren 1920. De første sporadiske tilfellene av spanskesyken i Norge oppsto i militærleirei begynnelsen av april 1918. Over tre måneder senere kom de første spredte tilfellene av det som skullevise seg å være starten på en ny stor influensapandemi. De første av disse oppsto i Kristiania, mest sannsynligetter smitteimport fra Skottland over Nordsjøen. Sommeren 1918 spredte spanskesyken seg raskt frasør til nord, fra kysten til innlandet innover fjordene, og fra de største byene og industrisentra via mindrebyer og andre tettsteder til landsbygda langs de viktigste ferdselsveiene. Da spanskesyken blusset opp igjenhøsten 1918 spredte den seg langsommere og trolig fra nord til sør, fortsatt fra kysten innover fjordene,men spredning fra byene langs kommunikasjonsveiene var mindre fremtredende. Vinteren 1918/19opptrådte influensaen spredt og sporadisk, tilsynelatende uten bestemt spredningsmønster og rekkefølge.Jernbanen, hurtigruten og automobilrutene spilte trolig en viktig rolle i spredningsprosessen, spesielt andrehalvår 1918. Ulik sosial interaksjon, for eksempel et marked som samlet store folkemengder, kan bidra til åforklare eksplosive utbrudd av influensa og diffusjon på lavt geografisk nivå.Mamelund S-E. The diffusion of influenza in Norway during the 1918-19 Pandemic.Nor J Epidemiol ENGLISH SUMMARYIn 1918-1919, a world-wide pandemic, the Spanish Influenza, swept over the entire globe, killing at least30 million people, most of them during the fall of 1918. A last, but small and less defined wave occurred inthe winter of 1920. The first sporadic cases of Spanish Influenza in Norway are known from army campsin the early days of April 1918. More than three months later, the first scattered

  11. Experiences of membrane technique in flue gas condensate treatment applications; Utvaerdering av erfarenheter av membranteknik foer rening av roekgaskondensat

    Energy Technology Data Exchange (ETDEWEB)

    Goldschmidt, Barbara; Ekdahl, Emma; Hellman, Mats

    2009-07-01

    Investing in a flue gas condensate treatment plant often turns out to be very profitable. The profitability comes from savings in energy and water consumption when treated waste water is recirculated, and also from savings in the NO{sub x} fee as condensate treatment allows for higher ammonia injection rates in the SNCR (NO{sub x} reduction) system. The membrane based technologies for flue gas treatment, which were investigated in this report, have proven to be successful and are operating well. However, they require that the project management is committed and acquaint themselves with the technology to avoid problems during commissioning and operation. In this project, experience with membrane based flue gas condensate treatment at ten different plants was investigated and evaluated. The ten plants are either biomass fired plants or co-combustion plants using a mixture of biomass and industrial waste. Membrane based flue gas condensate treatment is used by circa ten Swedish plants (Ultra Filtration membranes and/or Reverse Osmosis membranes, and at some plants also membranes for ammonia and carbon dioxide removal). All plants are biomass fired plants or co-combustion plants using a mixture of biomass and industrial waste. In Sweden, no plant firing municipal waste has yet been equipped with membrane based flue gas condensate treatment. These plants usually use precipitation and filtration technologies instead. Also the purpose of the condensation step is primarily to operate as a wet flue gas cleaning step. The heat recovery is of subordinate importance. Typical for these plants is also that they use condensation in several steps. The condensates from the different steps are often treated separately, as they may be of very different qualities. The RO unit is the main equipment in a membrane based water treatment plant. Pre-treatment and post-treatment of the RO water is adjusted to the incoming condensate quality, and to the requirements on the effluent. The

  12. Rendyrking av funksjoner i NAV – renere eller mer kaotisk sosialt arbeid?

    OpenAIRE

    Myhre, Tone

    2017-01-01

    Det overordnede temaet for denne oppgaven er sosialt arbeid i NAV. Sosialtjenesten i NAV utgjør en av de største arbeidsplassene for sosialarbeidere i Norge. For å utøve sosialt arbeid i NAV, er det viktig med gode rammebetingelser. I denne oppgaven ønsker jeg derfor å se på hvordan organiseringen av NAV kan påvirke sosialarbeideres utøvelse av det sosiale arbeidet.

  13. Iodine chemistry at severe accidents. A review and evaluation of the state-of-the-art in the field. APRI 5 report. Part I: Iodine chemistry at hypothetical severe accidents. A review of the state-of-the-art 2003. Part II: A comparison of our knowledge on iodine chemistry and fission products with the current models used in MAAP 4.0.5; Jodkemi under svaara haverier. En sammanstaellnig och vaerdering av kunskapslaeget inom omraadet. APRI 5 rapport. Del I: Jodkemi vid hypotetiska svaara haverier. En genomgaang av kunskapslaeget aar 2003. Del II: Jaemfoerelse av kunskapslaeget om jodkemi och fissionsprodukter med aktuella modeller i MAAP 4.0.5

    Energy Technology Data Exchange (ETDEWEB)

    Liljenzin, Jan-Olov [Liljenzins data och kemikonsult, Goeteborg (Sweden)

    2005-01-01

    The current report tries to summarize and analyze the state-of-the-art on Iodine chemistry relevant to the conditions expected during severe accidents in nuclear power plants. This has made it necessary to compare a considerable amount of data, new as well as old, in order to try to find the reasons behind some changes in the expected chemical behaviour of Iodine. In a few cases this has been far from simple. Many numerical values are given in this report. However, me numbers given should not be used in a non-critical way because they are often deduced from measurements whose interpretation depends on various kinds of systematic differences and assumptions with regard to technique, 'known' constants, and models applied. The most important observation today is that one can no longer uncritically assume that iodine is only released and transported as cesium iodide. The considerable effect that control rod material (including other construction materials) can have on the way in which an accident develops and on its iodine chemistry is clearly seen from the results of the experiments performed within the PHEBUS FP project. The second part of the report evaluates new knowledge on Iodine chemistry and Iodine behaviour of importance in severe nuclear reactor accidents. Also some new information regarding the behaviour and chemistry of other fission products has been collected. In the light of this information, the current modelling of Iodine behaviour in the MAAP code version 4.0.5 has been investigated. No modelling errors have been found. However, some of the equations used to calculate the vapour pressure of the components in the AlC-alloy used in PWR control rods give questionable results. An error in the MAAP manual was found which should be corrected. Finally, some suggestions are given for future improvements in the modelling of severe accidents used in MAAP for both BWRs and PWRs.

  14. An evaluation of business implications of the Kyoto Protocol

    Energy Technology Data Exchange (ETDEWEB)

    Torvanger, Asbjoern

    2001-12-01

    This report has been commissioned by Norsk Hydro ASA and written in November-December 2001. The aim of the report is to present and analyze the newest developments in the climate negotiations, particularly the seventh Conference of the Parties to the Climate Convention in Marrakech, Morocco, in October/November 2001, and to provide an evaluation of what the finalized Kyoto Protocol means for business. The report is organized as a collection of slides with supporting text explaining the background and contents of each slide. (author)

  15. Tangofilmer - en genreanalyse : nærstudie av tangofilmgenren som fenomen innen den argentinske filmindustrien

    OpenAIRE

    Hjorteset, Rita

    2007-01-01

    Den argentinske tangoen gjør seg i dag gjeldende både i argentinsk og internasjonal film, noe som har vært utgangspunktet for ideen til denne oppgaven. ”Los muchachos de antes no usaban gomina” (Karene den gang brukte ikke bryl) (1937) regissert av Manuel Romero og ”Tango” (1997) regissert av Carlos Saura representerer to forskjellige eksempler fra tangofilmgenren. I denne oppgaven gjennomgås et korpus av filmer sammensatt av tre kilder i forhold til Rick Altmans 10 påstander om genre i b...

  16. Er selvrapportert fysisk aktivitet egnet til å belyse helsevirkninger av lett fysisk aktivitet?

    Directory of Open Access Journals (Sweden)

    Victoria Telle Hjellset

    2011-08-01

    Full Text Available Fysisk aktivitet kan redusere risikoen for flere kroniske sykdommer, og kan vurderes ved bruk av spørreskjema, eller måles objektivt. I en undersøkelse blant innvandrerkvinner fra Pakistan (n=86 har vi sammenlignet selvrapportert (International Physical Activity Questionnaire, IPAQ og objektivt målt fysisk aktivitet (SenseWear Armband. For å sikre at kvinnene forsto hva det ble spurt om ble det benyttet prosjektmedarbeidere fra Pakistan og India som hjalp deltakerne til å svare på spørreskjemaet, som dessuten var oversatt til urdu, punjabi og engelsk. Vi fant ingen signifikant korrelasjon (Spearman mellom de to målemetodene. Selvrapportert fysisk aktivitet var ikke signifikant korrelert med: alder, BMI, livvidde, HbA1c, fastende og ’2-timers glukose’, fastende insulin, C-peptid, sittende systolisk- og diastolisk blodtrykk, totalkolesterol, LDL-kolesterol og triglyserider. På den annen side fant vi en invers relasjon mellom objektivt målt fysisk aktivitet og nevnte variabler. Sammenhengene holdt seg ved aldersjustering (lineær regresjon. Deltakere med selvrapportert god fysisk form hadde lavere BMI, livvidde, serum insulin, triglyserider og diastolisk blodtrykk. Resultatene tyder på at selvrapportering av fysisk aktivitet ikke alltid gir god nok opplysning til å bedømme graden av fysisk aktivitet, slik det ble funnet ved å bruke spørreskjemaet IPAQ på dette utvalget av innvandrerkvinner. Objektiv måling av energiomsetning kan synes nødvendig for å få gode estimater på fysisk aktivitet og dens gunstige helseeffekter. Hjellset VT, Høstmark AT. Is self-reported physical activity suitable for studying health effects of light physical activity?    Nor J Epidemiol 2011; 20 (2: 135-142.ENGLISH SUMMARYPhysical activity can reduce the risk of many chronic diseases, and may be estimated using questionnaires, or measured objectively. In a group of Pakistani immigrant women living in Oslo, Norway, we found no significant

  17. Ekspressiv skriving som egenterapeutisk verktøy ett år etter brystkreftdiagnosen - resultater fra en norsk pilotstudie

    Directory of Open Access Journals (Sweden)

    Birgitta Haga Gripsrud

    2015-01-01

    Full Text Available Expressive writing as a self-help tool one year after the breast cancer diagnosis – results from a Norwegian pilot study The article presents findings from a pilot study on expressive writing, a therapeutic method undescribed in a Norwegian scientific context. Objective: 1. Gain qualitative data on breast cancer women’s experiences with expressive writing. 2. Evaluate the intervention’s feasibility, based on participants’ experiences of the instruction, procedure, and circumstances for writing. Method & design: The study has an exploratory descriptive design. Data collection was achieved through in-depth interviews, followed by experiential thematic analysis of transcripts. Results: Two women enrolled, participating in writing/interviews. Analysis revealed three themes: "The experience of the writing process", "Writing as working through and work to clear the mind", "Strength and vulnerability in relation to others". Conclusion: Findings reveal that expressive writing was experienced as achievable for two breast cancer women, one year after diagnosis. Writing provided an opportunity to work through, and sort out, feelings and thoughts connected to participants’ lives and illness experiences. The instruction was evaluated as easy to understand and inspiring. The women became absorbed in electronic writing in their own homes. They both recommended expressive writing for other women with breast cancer, especially in the period after initial diagnosis.

  18. Development in risk level - Norwegian Shelf. Phase 7 main report 2006; Utvikling i risikonivaa - norsk sokkel. Fase 7 hovedrapport 2006

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-04-15

    The project's main objective is to establish and evaluate status and trends for the risk level for the petroleum industry as a whole. The project has been based on two complementary assessment processes: 1. Register, analyze and evaluate data for defined risk and accident situations and contribution from barriers. 2. To conduct social science analyses, in phase 7, mainly by means of field work in two installations. On the basis of these data and indicators, a neutral development is observed in 2006. This includes central indicators related to major accidents, also helicopter accidents, as well as the frequency for severe personal injuries. For major accidents there has been a persistent trend that the frequency is declining, but the degree of seriousness ascends. There has been no fatal accidents in 2006, within the Petroleum Safety Authority Norway's jurisdiction. The field work points towards well service personnel as a challenging group, but a few arrangements have succeeded in improving conditions for this group (ml)

  19. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  20. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  1. Kvällspressen, ledaren och könet : En studie om mediebevakningen av Mona Sahlin och Fredrik Reinfeldt

    OpenAIRE

    Yazdanfar, Sara

    2010-01-01

    Mona Sahlin och Fredrik Reinfeldt har under valet 2010 varit bevakade av medier som statsministerkandidater. Uppsatsen analyserar vilka likheter och skillnader det finns rapporteringen av dem på kvällspressens framsidor, hur genus framställs och vad kvällspressen fokuserar på i rapporteringen av dem. Med hjälp av tabloidformats- och genusteorier av text och bild samt en kritisk diskursanalys och semiotisk analys som metod har slutsatser framkommit. Rapporteringen av dem har inte varit positiv...

  2. Artificial vision support system (AVS(2)) for improved prosthetic vision.

    Science.gov (United States)

    Fink, Wolfgang; Tarbell, Mark A

    2014-11-01

    State-of-the-art and upcoming camera-driven, implanted artificial vision systems provide only tens to hundreds of electrodes, affording only limited visual perception for blind subjects. Therefore, real time image processing is crucial to enhance and optimize this limited perception. Since tens or hundreds of pixels/electrodes allow only for a very crude approximation of the typically megapixel optical resolution of the external camera image feed, the preservation and enhancement of contrast differences and transitions, such as edges, are especially important compared to picture details such as object texture. An Artificial Vision Support System (AVS(2)) is devised that displays the captured video stream in a pixelation conforming to the dimension of the epi-retinal implant electrode array. AVS(2), using efficient image processing modules, modifies the captured video stream in real time, enhancing 'present but hidden' objects to overcome inadequacies or extremes in the camera imagery. As a result, visual prosthesis carriers may now be able to discern such objects in their 'field-of-view', thus enabling mobility in environments that would otherwise be too hazardous to navigate. The image processing modules can be engaged repeatedly in a user-defined order, which is a unique capability. AVS(2) is directly applicable to any artificial vision system that is based on an imaging modality (video, infrared, sound, ultrasound, microwave, radar, etc.) as the first step in the stimulation/processing cascade, such as: retinal implants (i.e. epi-retinal, sub-retinal, suprachoroidal), optic nerve implants, cortical implants, electric tongue stimulators, or tactile stimulators.

  3. Rettferdige minutter: Fordeling av spilletid i fotballkamper for aldersbestemte klasser

    Directory of Open Access Journals (Sweden)

    Trine Anker

    2010-01-01

    Full Text Available På et fotballag i overgangen mellom barne- og ungdomsfotballen er spilletid på fotballbanen under kamp både en knapp ressurs og en kilde til diskusjoner om fordeling. Spørsmålet som er utgangspunkt for denne artikkelen, er hvilke hensyn som bør tas når trener og lagleder skal fordele samlet spilletid på enkeltspillere. Er det viktigst å vinne fotballkampen, eller har det størst betydning å fordele spilletiden mest mulig likt mellom spillerne? Skal det tas hensyn til guttenes evner, motivasjon og preferanser? Er deres familiebakgrunn og personlighet av betydning? Diskusjonen baserer seg på en gjennomgang av ulike politiske rettferdighetsteorier for fordeling av knappe goder.Nøkkelord: rettferdighet, practice, fordelingsrettferdighet, diskursetikk, idrettsetikkEnglish summary: Minutes of justice: Distribution of time during football matches in a boys' teamDuring a football match, time for playing can be considered as a limited good. In this article the point of departure is the redistribution of time in a boys' football team in the transition phase between children and youth football. The questions are how and under which conditions time for playing should be distributed among the players. Is winning the game more important than trying to let every player play for an equal amount of time? Should the boys' talents, motivation, and preferences be considered while distributing time, or are family background and personality of importance? Different theories of political justice for the distribution of limited goods underpin the discussion of how to distribute the minutes of playing time during a football match.http://dx.doi.org/10.5324/eip.v4i1.1737

  4. EST Table: AV403753 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403753 pg--0010X 11/12/09 GO hit GO:0000287(magnesium ion binding)|GO:0004427(inorganic...39 aa ref|NP_290858.1| inorganic pyrophosphatase [Escherichia coli O157:H7 EDL933] ref|NP_313231.1| inorganic... pyrophosphatase [Escherichia coli O157:H7 str. Sakai] ref|NP_418647.1| inorganic... pyrophosphatase [Escherichia coli str. K-12 substr. MG1655] ref|YP_313123.1| inorganic pyrophosphatase [Sh...igella sonnei Ss046] ref|YP_410472.1| inorganic pyrophosphatase [Shigella boydii Sb227] ref|YP_405834.1| inorganic

  5. EST Table: AV401507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401507 e96h0814 10/09/28 95 %/238 aa dbj|BAG15923.1| transposase [Bombyx mandarin...a] dbj|BAG15924.1| transposase [Bombyx mandarina] dbj|BAG15925.1| transposase [Bombyx mandarina] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS797048 e96h ...

  6. Implementering av multivariabel reglering i DCS-miljö

    OpenAIRE

    Winberg, Johan

    2009-01-01

    Inom processindustrin finns en etablerad reglerhierarki där basreglering sker med PID-regulatorer och där avancerad, multivariabel styrning sköts av MPC-programvara. Steget mellan dessa två nivåer kan upplevas som stort. För mindre och snabba multivariabla processer undvikes helst en multivariabel ansats, med försämrad reglering som följd. På Preem AB har detta upplevts som ett problem. Syftet med examensarbetet har varit att utveckla en alternativ, multivariabel styrstrategi för en process m...

  7. En brukbarhetsanalys av avancerad fastighetsautomation under förvaltningsskedet

    OpenAIRE

    Esselin, Frida; Selimovic, Seherzada

    2015-01-01

    Avancerad fastighetsautomation intog marknaden under 2000-talets första år. Visionen var att skapa smarta byggnader där fastighetsövervakning, klimatstyrning och belysning sammankopplades mot en central huvuddator för att eliminera manuell styrning. Syftet med examensarbetet är att undersöka funktionalitet och reell brukbarhet hos ett av de första installationsobjekten, PostNords huvudkontor. Rapporten presenterar fastighetens övergripande funktioner samt analyserar hur systemstyrningen kan o...

  8. Guerrillero Heroico : Alberto Kordas fotografiske portrett av Che Guevara

    OpenAIRE

    Gulljord, Hanne Gudrun

    2010-01-01

    Fotografen Alberto Diaz Gutiérrez (1928-2001), bedre kjent som Alberto Korda, tok i 1960 et snapshot av Ernesto ”Che” Guevara de la Serna (1928-1967). Korda ga senere dette portrettet tittelen Guerrillero Heroico. Portrettet blir omtalt som vår tids mest reproduserte fotografi. Denne oppgaven behandler den visuelle kulturen som har oppstått rundt dette fotografiet, og tar i den sammenhengen utgangspunkt i de historiske kontekstene som synes medvirkende til at Guerrillero Heroico forflytter...

  9. Konservering av et knust vannfilter i steingods : redde et familieklenodium

    OpenAIRE

    Heggtveit, Hilde

    2007-01-01

    Oppgaven gikk ut på å konservere et vannfilter i privat eie som hadde blitt knust under en flytteprosess. Det var ulike problemstillinger som måtte løses for å gi et best mulig resultat for gjenstand og eier. Gjenstanden er i privat eie og det vil dermed bli andre etiske problemstillinger å ta hensyn til enn med en gjenstand som tilhører et museum. Museer har retningslinjer og strenge etiske regler å forholde seg til vedtekter som er vedtatt av styret til museet og internasjonale komitee...

  10. EST Table: AV398143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398143 NV021176 10/09/28 100 %/213 aa ref|NP_001040254.1| beadex/dLMO protein [Bo...mbyx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 74 %/175 aa FBpp0262745|DyakGE17735-PA ... gnl|Amel|GB11268-PA 10/09/10 81 %/180 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  11. EST Table: AV398425 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398425 NV021796 10/09/28 92 %/176 aa ref|NP_001040254.1| beadex/dLMO protein [Bom...byx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 87 %/123 aa FBpp0262745|DyakGE17735-PA 1...a gnl|Amel|GB11268-PA 10/09/10 76 %/156 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  12. Konstruksjon av GaAs MMIC effektforsterker med integrert linearisering

    OpenAIRE

    Kippernes, Frank Åge

    2009-01-01

    Denne oppgaven tar for seg linearisering av GaAs MMIC effektforsterkere. Det er brukt en pHEMT-prosess og senterfrekvensen ligger på 2,45 GHz. Effektforsterkerne som er konstruert kan levere utgangseffekter i størrelsesorden 1 W. Agilent Advanced Design System (ADS) ble brukt til konstruksjon og simulering. Moderne modulasjonsteknikker med varierende envelope krever lineære forsterkere for å fungere. Ulinearitetene i forsterkeren vil forvrenge signalet og skape støy både i og utenfor båndet...

  13. EST Table: AV403042 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403042 heS30974 10/09/28 62 %/228 aa ref|XP_321040.4| AGAP002015-PA [Anopheles ga...|DwilGK17594-PA 10/08/27 39 %/210 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:P...62 %/230 aa gi|91087317|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 heS3 ...

  14. EST Table: AV404085 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404085 pg--0423X 10/09/28 100 %/117 aa gb|ACH69160.1| myosin heavy chain [Bombyx ...mori] 10/08/28 84 %/116 aa FBpp0291042|Mhc-PO 10/08/27 60 %/116 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... gnl|Amel|GB30329-PA 10/09/10 83 %/116 aa gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] FJ029109 pg-- ...

  15. EST Table: AV404226 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404226 pg--0725 10/09/28 81 %/264 aa gb|ACQ72825.1| myosin heavy chain [Bombyx ma...ndarina] 10/08/28 78 %/264 aa FBpp0291043|Mhc-PP 10/08/27 51 %/264 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... aa gnl|Amel|GB30329-PE 10/09/10 78 %/264 aa gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] FJ029109 pg-- ...

  16. Effects of AV-delay optimization on hemodynamic parameters in patients with VDD pacemakers.

    Science.gov (United States)

    Krychtiuk, Konstantin A; Nürnberg, Michael; Volker, Romana; Pachinger, Linda; Jarai, Rudolf; Freynhofer, Matthias K; Wojta, Johann; Huber, Kurt; Weiss, Thomas W

    2014-05-01

    Atrioventricular (AV) delay optimization improves hemodynamics and clinical parameters in patients treated with cardiac resynchronization therapy and dual-chamber-pacemakers (PM). However, data on optimizing AV delay in patients treated with VDD-PMs are scarce. We, therefore, investigated the acute and chronic effects of AV delay optimization on hemodynamics in patients treated with VDD-PMs due to AV-conduction disturbances. In this prospective, single-center interventional trial, we included 64 patients (38 men, 26 women, median age: 77 (70-82) years) with implanted VDD-PM. AV-delay optimization was performed using a formula based on the surface electrocardiogram (ECG). Hemodynamic parameters (stroke volume (SV), cardiac output (CO), heart rate (HR), and blood pressure (BP)) were measured at baseline and follow-up after 3 months using impedance cardiography. Using an ECG formula for AV-delay optimization, the AV interval was decreased from 180 (180-180) to 75 (75-100) ms. At baseline, AV-delay optimization led to a significant increase of both SV (71.3 ± 15.8 vs. 55.3 ± 12.7 ml, p < 0.001, for optimized AV delay vs. nominal AV interval, respectively) and CO (5.1 ± 1.4 vs. 3.9 ± 1.0 l/min, p < 0.001), while HR and BP remained unchanged. At follow-up, the improvement in CO remained stable (4.9 ± 1.3 l/min, p = 0.09), while SV slightly, but significantly, decreased (to 65.1 ± 17.6, p < 0.01). AV-delay optimization in patients treated with VDD-PMs exhibits immediate beneficial effects on hemodynamic parameters that are sustained for 3 months.

  17. InterProScan Result: AV402889 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402889 AV402889_3_ORF1 82B713D3A4F3515D SUPERFAMILY SSF103473 MFS general substra...te transporter 2.6e-13 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  18. InterProScan Result: AV404113 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404113 AV404113_2_ORF2 F3297275DB9590B8 PRODOM PD020518 Q8X5H1_ECO57_Q8X5H1; 9e-3...3 T IPR004195 Bacteriophage lambda head decoration protein D, HDPD Cellular Component: viral capsid (GO:0019028) ...

  19. InterProScan Result: AV399408 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399408 AV399408_2_ORF1 5D6D9219C673BB29 PFAM PF05274 Baculo_E25 1.3e-78 T IPR007938 unintegrated Cellular... Component: viral envelope (GO:0019031)|Cellular Component: host cell nucleus (GO:0042025) ...

  20. Temporal dynamics of AVS and SEM in sediment of shallow freshwater floodplain lakes

    NARCIS (Netherlands)

    Griethuysen, van C.; Lange, de H.J.; Heuij, van der M.; Bies, S.C.; Gillissen, F.; Koelmans, A.A.

    2006-01-01

    Acid volatile sulfide (AVS) is an operationally defined sulfide fraction, which is considered important for trace metal fate in reduced sediments. Understanding AVS formation rates is important for the management of metal polluted sediment. However, little lis known about the fate and dynamics of

  1. InterProScan Result: AV399344 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399344 AV399344_1_ORF2 5604F45CA0D42E5E PFAM PF05314 Baculo_ODV-E27 1.4e-47 T IPR007978 Baculovirus occlus...ion-derived virus envelope EC27 Cellular Component: viral envelope (GO:0019031) ...

  2. InterProScan Result: AV405377 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405377 AV405377_1_ORF1 5614E1377E837F70 SUPERFAMILY SSF103473 MFS general substra...te transporter 2.1e-06 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  3. AVS/Express (application visualization system) user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Kume, Etsuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-09-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS/Express for image processing software and Stereo viewing system. This report summarizes the information to use AVS/Express efficiently in the computer environment for image processing. (author)

  4. InterProScan Result: AV399409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 429 Baculovirus LEF-11 Biological Process: viral infectious cycle (GO:0019058)|Biological Process: regulation of transcription (GO:0045449) ... ...AV399409 AV399409_1_ORF2 07DC81A7C7B2FA42 PFAM PF06385 Baculo_LEF-11 3e-33 T IPR009

  5. InterProScan Result: AV399297 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ulovirus p35, apoptosis preventing protein Biological Process: anti-apoptosis (GO:0006916)|Molecular Function: caspase inhibitor activity (GO:0043027) ... ...AV399297 AV399297_3_ORF2 F5C6B0DD046B3A9D PFAM PF02331 P35 5.2e-107 T IPR003429 Bac

  6. InterProScan Result: AV401371 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401371 AV401371_2_ORF2 4E899180012BEB2A GENE3D G3DSA:3.30.465.10 no description 7...e-07 T IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 Molecular Function: catalytic

  7. InterProScan Result: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 AV404903_2_ORF1 4CB4FF124EAAC1C5 PFAM PF05187 ETF_QO 1.7e-14 T IPR007859 Electron transfer flav...oprotein-ubiquinone oxidoreductase Molecular Function: electron-transferring-flavoprote

  8. Systemisk psykoterapi och affektiv neurobiologi : en studie av psykoterapeuters upplevelse av sitt arbete på en dagverksamhet kopplat till aktuell evidensbaserad forskning

    OpenAIRE

    Rizzo, Michelangelo

    2015-01-01

    Studien har sin bakgrund i systemisk psykoterapeutisk teori och aktuell affektiv neurobiologi enligt Jaak Panksepps evidensbaserade forskning. Syftet är att undersöka psykoterapeuters beskrivning och erfarenhet av att arbeta systemiskt psykoterapeutiskt och analysera huruvida arbetet ligger i linje med systemisk teori och affektiv neurobiologisk forskning. Studien genomförs vid dagverksamheter av typen behandlingsskolor för barn och ungdomar med stora skolbekymmer och intervjuer har genomfört...

  9. Samtalegrupper for personer med Aspergers syndrom. En kvalitativ studie av hva fagpersoner forteller om planlegging, gjennomføring og effekt av samtalegrupper for personer med Aspergers syndrom

    OpenAIRE

    Jensen, Øyvind

    2014-01-01

    Denne oppgaven er skrevet ut fra problemstillingen: Hvordan beskriver fagpersoner planlegging, gjennomføring og effekt av samtalegrupper for personer med Aspergers syndrom? Den belyser teori om Aspergers syndrom, effekt av samtalegrupper samt andre viktige forhold i tilknytning til samtalegruppe, som kommunikasjon, veiledning og psykoedukasjon. Fire informanter fra nettverket «Nasjonalt fagutviklingsnettverk om psykoedukative grupper for personer med Aspergers syndrom» ble intervjuet, ...

  10. Apolipoprotein AV does not contribute to hypertriglyceridaemia or triglyceride lowering by dietary fish oil and rosiglitazone in obese Zucker rats

    NARCIS (Netherlands)

    Dorfmeister, B.; Brandlhofer, S.; Schaap, F. G.; Hermann, M.; Fürnsinn, C.; Hagerty, B. P.; Stangl, H.; Patsch, W.; Strobl, W.

    2006-01-01

    AIMS/HYPOTHESIS: Apolipoprotein AV (apoAV) is a recently discovered apolipoprotein with a triglyceride-lowering effect in genetically modified mice. Transcription of the human gene encoding apoAV (APOA5) is suppressed by insulin and stimulated by fibrates. Our goal was to study the expression of

  11. Evaluation of lambda sensors for optimization of moving grate combustion; Utvaerdering av lambdasensorer foer optimering av foerbraenning paa roerlig rost

    Energy Technology Data Exchange (ETDEWEB)

    Boman, Katarina; Edvardsson, Elin [Vattenfall Research and Development AB, S tockholm (Sweden)

    2007-10-15

    Irregular distribution in grate boilers is often caused by insufficient mixing of fuel and air in the lower part of the furnace. These problems can arise at large variations in fuel moisture or volatile content. Besides increased emissions, streak formation causes problems with deposits and corrosion. In grate boilers, the covering of the grate by the fuel bed is important for a good mixing of fuel and air. Optimization of the fuel feeding to the grate to obtain a more even distribution along both width and length normally decreases the CO emissions substantially. A uniform coverage of the grate with fuel also leads to a more evenly distributed gas velocity through the bed, which decreases the entrainment of unburned material and ash from the grate. The project objective was to investigate if lambda sensor signals can be used during continuous operation in order to counteract irregular distribution of fuel and air in the furnace. The target group of the project includes owners, operators and constructor of grate boilers, and everyone with interest of reducing imbalanced distributions in boilers. Tests with eight lambda sensors installed in the flue gas duct of the Karskaerverket biofuelled grate boiler were performed. Step responses in oxygen content from varied supply of air and fuel (total and irregular distribution across the grate) were measured. Additionally, the measurement system was tested during a period of three weeks. The measured oxygen levels showed irregular distribution across the width of the flue gas duct. The lateral distribution of primary air clearly influenced the measured oxygen levels, although the response was not the same in all measurement positions as the character of the bed in each fuel line strongly affected the response. Consequently, a different response was obtained if the step change was repeated during a new bed situation. An irregular fuel distribution clearly influenced the oxygen levels, although the time lag was long. This response also depended on the bed situation at the beginning of the step change. No clear change in oxygen levels was noticed at varied total fuel feed. Lambda sensors have previously been used during campaign measurements in solid fuel boilers. This is the first time that testing of such a measurement system during a longer time period has been carried out. It was, however, difficult to quantify the deviation of the lambda sensor signals with time, as the gas extraction probe used proved unsuitable for long term operation. The reason was that flue gas components could condensate and form deposits inside the probe, ultimately clogging the system. Provided the gas extraction system is further developed to adjust it to long term operation, measurement with lambda sensors early in the flue gas duct, in combination with flame front cameras, can be a useful tool to counteract irregular distribution of combustion in grate boilers. A brief economical analysis of a future successful installation indicates that larger boilers (at least 30-40 MW) could benefit from installing an instrument to handle uneven distribution of fuel and air. The profit comes mainly for decreased NO{sub x}-costs and less downtime. In practice, OandM costs will probably determine if the system is profitable or not. In total the project has had several obstacles, mainly due to the properties of the Karskaer boiler. For example leakage between primary air channels caused troubles to control primary air distribution. Unusual boiler construction made good fuel and air mixing difficult. Also the measurement probe design caused trouble due to deposits from condensation. The project also had some positive results: It was found out that uneven distribution could be detected and the lambda sensors' signals have shown fairly stable values also during longer measurement periods.

  12. Modulation of Interleukin-8 and staphylococcal flora by Avène hydrotherapy in patients suffering from chronic inflammatory dermatoses.

    Science.gov (United States)

    Casas, C; Ribet, V; Alvarez-Georges, S; Sibaud, V; Guerrero, D; Schmitt, A-M; Redoulès, D

    2011-02-01

    A number of studies argue in favour of an important role of microbial colonization, in particular of Staphylococcus aureus, in triggering atopic dermatitis (AD) flare-up and psoriasis, in particular through the superantigenic properties of toxins generated by S. aureus. The aim of this study was to assess the efficacy of a 3-week Avène hydrotherapy on the skin surface of patients suffering from psoriasis or atopic dermatitis. Skin samples were taken from healthy subjects or atopic (n = 18) or psoriatic patients (n = 39) undergoing hydrotherapy at Avène at the beginning (D0) and the end of treatment (D18). The severity of the dermatosis was evaluated according to SCORing Atopic Dermatitis (SCORAD) or Psoriasis Area Severity Index (PASI) scores at D0 and D18. Marker of inflammation interleukin 8 (IL-8), S. aureus colonization (protein A) and enterotoxins were assessed in skin samples using RT-PCR. At D0, significant differences were observed between healthy subjects and atopic or psoriatic patients in all the parameters evaluated (IL-8, protein A). At the end of the hydrotherapy, a significant decrease in SCORAD was associated with a significant reduction of IL-8, S. aureus colonization and enterotoxin D in patients with atopic dermatitis. Similarly, a significant decrease in PASI was associated with a significant reduction of IL-8, S. aureus colonization and enterotoxin N in patients with psoriasis. This study demonstrates the positive effects of Avène hydrotherapy on the skin of patients suffering from chronic dermatosis, with decreased inflammation and reduced colonization by S. aureus. © 2010 The Authors. JEADV © 2010 European Academy of Dermatology and Venereology.

  13. Avaliação do uso de ventilação mínima em galpões avícolas e de sua influência no desempenho de aves de corte no período de inverno Evaluation of minimal ventilation and animal performance of broiler chickens in poultry houses during winter

    Directory of Open Access Journals (Sweden)

    Ricardo Brauer Vigoderis

    2010-06-01

    Full Text Available Objetivou-se com este trabalho avaliar um sistema de ventilação mínima ou de higiene e sua influência no conforto térmico, na qualidade do ar e no desempenho zootécnico de aves criadas durante o inverno. Foram utilizados dois galpões similares, cada um com 9.500 aves, da linhagem Cobb, durante um ciclo produtivo completo. Em um dos galpões, foi instalado um sistema de ventilação positiva que atendia à necessidade mínima de renovação de ar, composto por três ventiladores com vazão de 300 m³/min, instalados no forro, paralelamente ao piso. O outro galpão foi considerado controle e não possuía sistema de ventilação. Houve diferença na temperatura e umidade relativa do ar nas duas primeiras semanas de vida das aves, sobretudo no sistema de ventilação mínima que apresentou as piores condições de conforto. As aves mantidas no galpão sem sistema de ventilação tiveram os melhores resultados de peso ao abate (com ventilação - 1,549 kg; e sem ventilação - 1,577 kg, conversão alimentar (com ventilação - 1,63 kg/kg; sem ventilação - 1,59 kg/kg e eficiência produtiva (com ventilação - 285 e sem ventilação - 297. Houve diferença também na concentração de gases contaminantes, que foi menor no sistema com ventilação mínima. O sistema com ventilação mínima, da maneira como foi concebido no experimento, diminui significativamente a temperatura no interior do galpão avícola, comprometendo o conforto térmico e o desempenho animal. Apesar de o sistema com ventilação mínima resultar em menores concentrações de gases, nenhum dos sistemas promove concentração média de dióxido de carbono e monóxido de carbono prejudicial às aves.The objective of this work was to evaluate a system of minimal or hygienic ventilation and its influence on thermal comfort, air quality and broiler zootechnical performance of poultries raised during the winter. Two similar sheds were used, with 9,500 Cobb broiler chickens per

  14. "La viljen din skje på jorden slik som i himmelen" : kan en analyse av ordet "thelema" i Matteusevangeliet kaste lys over forståelsen av Fadervårs tredje bønn?

    OpenAIRE

    Medhaug, Sveinar

    2011-01-01

    Tolkninger av Fadervår og den tredje bønnen finner vi bevitnet allerede fra oldkirken av. Interessen for Fadervår har ikke stilnet siden den gang. Bare det siste tiåret har det kommet flere bidrag til forskningen. Noen av disse er gjengitt i min presentasjon av nyere forsknings-historie til Fadervårs tredje bønn. Slik Raymond E. Brown poengterte det allerede i 1965, er hovedproblemstillingen i tolkningen av den tredje bønnen spørsmålet om bønnens logiske subjekt. Er dette en bønn om at Gud se...

  15. Effect of Digoxin on A-V Conduction

    Science.gov (United States)

    Spurrell, R. A. J.; Harris, A. M.; Howard, M. R.

    1971-01-01

    The effect of digoxin on A-V conduction in 19 patients with known disease of their conduction tissue was studied while a demand pacing system was in position. Fifteen had transient complete heart block after myocardial infarction and four had chronic intermittent complete heart block. The patients were studied on return to sinus rhythm. In no instance was a return to either second- or third-degree heart block precipitated in these patients despite therapeutic levels and, in some cases, high serum level of digoxin for a period of seven days. The duration of complete heart block after myocardial infarction was 4·3 days in those taking digoxin while in heart block and 3·3 days in those who started digoxin only after return to sinus rhythm. PMID:5106313

  16. Det sociala ansvaret i skapandet av skönhetsidealen

    OpenAIRE

    Koleva, Teodora

    2014-01-01

    Kandidatarbetet undersöker och diskuterar frågeställningen "Vilket socialt ansvar har jag som grafisk formgivare i skapandet av skönhetsidealen?". Kandidatarbetet fokuserar på att skapa en diskussion kring ämnet skönhetsideal, hur dessa påverkar unga kvinnor samt vilka möjligheter det finns för att bryta samhällsnormer och göra en förändring, en större skillnad. Utifrån mitt forskringsresultatet kring skönhetshistorian och dess utveckling under åren, har jag skapat en produktion i f...

  17. American AV: Edgar Dale and the Information Age Classroom.

    Science.gov (United States)

    Acland, Charles R

    2017-01-01

    This article demonstrates how the influential scholar Edgar Dale, alongside a generation of educational technologists, helped build an essential place for AV materials and pedagogical methods in the American classroom. It also shows that, for decades, the Payne Fund philanthropy supported multimedia research agendas that shaped ideas about teaching and technology, far beyond involvement in their famed studies on motion pictures and children in the 1930s. With his writings and research programs, Dale advanced concepts of media experience and systematicity, which came to be understood as common sense to the information society. In so doing he was a leading contributor to the discursive and ideological structure of our age of technological and informational abundance.

  18. Developing a computational model of human hand kinetics using AVS

    Energy Technology Data Exchange (ETDEWEB)

    Abramowitz, Mark S. [State Univ. of New York, Binghamton, NY (United States)

    1996-05-01

    As part of an ongoing effort to develop a finite element model of the human hand at the Institute for Scientific Computing Research (ISCR), this project extended existing computational tools for analyzing and visualizing hand kinetics. These tools employ a commercial, scientific visualization package called AVS. FORTRAN and C code, originally written by David Giurintano of the Gillis W. Long Hansen`s Disease Center, was ported to a different computing platform, debugged, and documented. Usability features were added and the code was made more modular and readable. When the code is used to visualize bone movement and tendon paths for the thumb, graphical output is consistent with expected results. However, numerical values for forces and moments at the thumb joints do not yet appear to be accurate enough to be included in ISCR`s finite element model. Future work includes debugging the parts of the code that calculate forces and moments and verifying the correctness of these values.

  19. EST Table: AV404292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404292 pg--0798 10/09/28 100 %/131 aa pdb|3FZB|A Chain A, Crystal Structure Of Th...e Tail Terminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|B Chain B, Crystal Structure Of The Tail Termi...nator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|C Chain C, Crystal Structure Of The Tail Terminator Protei...n From Phage Lambda (Gpu-Wt) pdb|3FZB|D Chain D, Crystal Structure Of The Tail Te...rminator Protein From Phage Lambda (Gpu-Wt) pdb|3FZB|E Chain E, Crystal Structure Of The Tail Terminator Pro

  20. UTVÄRDERING AV UTVALDA SD-WAN PRODUKTER

    OpenAIRE

    Åkerblom, Jacob

    2016-01-01

    Denna jämförelsestudie ämnar att undersöka marknadens leverantörer av nätverksutrustning de- finierade som Software Defined Wide Area Networks(SD-WAN). SD-WAN är en innovativ teknik som applicerar virtualisering och Software defined networking koncept i Wide Area Networks (WAN) för att skapa kostnadseffektiva nätverk. Studien har utförts på företaget Curitiba som idag arbetar med konsulttjänster inom utvalda WAN-optimering och SD-WAN-produkter. Arbetets syfte är att utvärdera SD-WAN-lösningar...

  1. Stöttning av skrivande i ett digitalt diskussionsforum

    Directory of Open Access Journals (Sweden)

    Stina Hållsten

    2017-07-01

    Full Text Available Vi vet att studenter ofta upplever akademiskt skrivande som svårt. Att skrivandet dessutom förläggs till en digital lärplattform underlättar kanske inte alltid. Större studentgrupper och minskade resurser, parallellt med ett större utbud av distanskurser, gör att digitala lärplattformar blir än viktigare inom högre utbildning. Forskning visar dock att vi i första hand använder lärplattformar i administrativt syfte, trots möjligheter till en mer pedagogisk användning, exempelvis genom mer interaktion och ett större fokus på skrivandet. Hur kan lärplattformens design och användning utvecklas pedagogiskt, närmare bestämt med ett genrepedagogiskt upplägg?Empirin för artikeln är en distanskurs i kriminologi, där all kursaktivitet skedde över utbildningens lärplattform. Kursdesignen och lärarnas aktivitet (instruktioner, responsgivande och annan stöttning analyserades tillsammans med ett mindre antal studenters användande av lärplattformen i arbetet med uppgiften Lärandedialogen. Vilka genrepedagogiska drag uppvisas redan i kursdesignen, och vilka skulle kunna förstärkas? Genrepedagogiken tar fasta på den muntliga dialogen kring text och innehåll. Därför diskuteras även hur man kan se den skriftliga, asynkrona diskussionen som något liknande det muntliga seminariesamtalet.

  2. Robotplattform för utvärdering av adaptiv bildstabilisering av kamera

    OpenAIRE

    Landgren, Axel

    2010-01-01

    This thesis describes the development of a robotic platform for evaluation of gaze stabilization algorithms built for the Sensorimotor Systems Laboratory at the University of British Columbia. The primary focus of the work was to measure the performance of a biomimetic vestibulo-ocular reflex controller for gaze stabilization using cerebellar feedback. A flexible robotic system was designed and built in order to run reproducible test sequences at high speeds featuring three dimensional linear...

  3. Mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet

    Directory of Open Access Journals (Sweden)

    Sven B Eriksson

    2013-01-01

    Full Text Available Det pedagogiska ledarskapet inom högre utbildning fokuseras allt mer. Det understryks genom att flera lärosäten föreskriver såväl att pedagogiska ledare ska finnas på olika nivåer, som vilka övergripande uppgifter dessa ska ha. Denna artikel är ett resultat av en fallstudie av hur de tillägnade kunskaperna och färdigheterna från kursen Pedagogiskt ledarskap, en kurs för målgruppen studierektorer/pedagogiskt ansvariga eller motsvarande arrangerad av Universitetspedagogiskt centrum, har bidragit till deltagarnas professionalisering av det pedagogiska ledarskapet ett år efter kursens slut. Fallstudien genomfördes genom gruppintervjuer. Respondenterna uttryckte att de fått ett stärkt självförtroende i rollen som pedagogiska ledare samt att kursen bidrog till en professionalisering av rollen som pedagogiska ledare genom att stärka identiteten, att skapa en början till en handlingsetik bestående av delvis delade värderingar kring det pedagogiska ansvaret samt ge utbildning och träning i färdigheter som har sin grund i teoretisk kunskap. Kursen Pedagogiskt ledarskap ger därmed ett stöd i en process mot en professionalisering av det pedagogiska ledarskapet vid Umeå universitet.

  4. Metals sediment toxicity: Chemical approach by SEM/AVS ratio. Application on Seine estuary sediments

    Science.gov (United States)

    Clarisse, O.; Ouddane, B.; Fischer, J. C.; Wartel, M.

    2003-05-01

    Within the framework of environmental quality criteria for certain heavy metals in sediment, Acid Volatile Sulphides (AVS) has been proposed as the primary standardisation parameter in combination with the amount of simultaneously extracted metals (SEM) [1]. AVS, comprising essentially iron monosulphides in sediments, are available for binding divalent cationic metals through the formation of insoluble metal-sulphide complexes, thereby controlling the metal bioavailability and subsequent toxicity for benthic biocommunities. AVS is operationally defined as the amount of sulphides that can be volatilised during a cold acid extraction. The AVS-bound metals, with environmental concern (usually Cd, Cu, Ni, Pb and Zn), are extracted at the same time and are called simultaneously extracted metals (SEM). The ratio or the difference between AVS and SEM gives an indication of the potential sediment toxicity. Such problems on extraction procedure appears: for AVS hydrochloric acid 6 mol.dm^{-3} is current1y used [2-3] even so for SEM use of hydrochloric acid 1 mol.dm^{-3} is advised [4-5]. To investigate the influence of acid strength, sulphides and metals extractions are realized on anoxic sediments from seine estuary. SEM/AVS ratio for different acid was calculated and toxicity associated is discussed.

  5. A 2:1 AV rhythm: an adverse effect of a long AV delay during DDI pacing and its prevention by the ventricular intrinsic preference algorithm in DDD mode.

    Science.gov (United States)

    Minamiguchi, Hitoshi; Oginosawa, Yasushi; Kohno, Ritsuko; Tamura, Masahito; Takeuchi, Masaaki; Otsuji, Yutaka; Abe, Haruhiko

    2012-07-01

    A 91-year-old woman received a dual-chamber pacemaker for sick sinus syndrome and intermittently abnormal atrioventricular (AV) conduction. The pacemaker was set in DDI mode with a 350-ms AV delay to preserve intrinsic ventricular activity. She complained of palpitation during AV sequential pacing. The electrocardiogram showed a 2:1 AV rhythm from 1:1 ventriculoatrial (VA) conduction during ventricular pacing in DDI mode with a long AV interval. After reprogramming of the pacemaker in DDD mode with a 250-ms AV interval and additional 100-ms prolongation of the AV interval by the ventricular intrinsic preference function, VA conduction disappeared and the patient's symptom were alleviated without increasing unnecessary right ventricular pacing. ©2011, The Authors. Journal compilation ©2011 Wiley Periodicals, Inc.

  6. Miljöbelastning vid förtida utbyte av enstegstätad putsfasad : Orsakad av fuktskador

    OpenAIRE

    Sundström, Olle; Sundström, David

    2012-01-01

    När en konstruktion blir fuktskadad påverkas de ingående materialen på olika sätt och i vissa fall uppstår så kallad mikrobiell tillväxt som kan påverka människans hälsa. Det finns studier om hur människor reagerar på sådan mikrobiell tillväxt, hur materialen påverkas av olika fuktbelastningar och hur mycket pengar det kostar att byta ut denna konstruktion. Vad som inte finns är hur miljön påverkas att i förtid behöva byta ut en fuktskadad konstruktion. Utifrån ovan nämnda har detta examensar...

  7. Betydningen av drektige reinsimlers ernæring for kalvers vekst, klimatiske toleranse og overlevelse

    OpenAIRE

    Arne Rognmo; Karl Annar Markussen; Endre Jacobsen; Arnoldus Schytte Blix

    2013-01-01

    Forsøkene (viste) at tilleggsforing av underernærte simler i siste del av drektighetsperioden kun synes å ha effekt på fødselsvekten for kalvene forutsatt at simlene får høyverdig ernæring etter kalving. Den forskjellige ernæringsbakgrunn før kalving synes således ikke å innvirke på melkeproduksjon/kvalitet, da vektutviklingen for alle grupper av kalver i dette forsøket gikk parallelt i de tre førs...

  8. Middelalderkeramikk : en synkron og diakron analyse av keramikkmaterialet fra Oslogate 6

    OpenAIRE

    Bueklev, Ann Monica Jensen

    2006-01-01

    Denne avhandlingen tar for seg keramikk materialet fra utgravingen på feltet Oslogate 6 i Gamlebyen, Oslo. Under utgravinger i byer med røtter i middelalderen er keramikk en av de vanligste funngruppene. Så vidt vites har man ikke hatt en egen produksjon av keramikk her til lands under middelalderen, trolig er det meste av keramikken importert. Dette har ført til at man tradisjonelt har brukt keramikk til å belyse spørsmål rundt handelskontakter og variasjoner innen denne. Keramikk har også o...

  9. Fototerapi av nyfødte med hyperbilirubinemi: behov for bedre behandling og oppfølging, 93-98

    Directory of Open Access Journals (Sweden)

    Ellen B. Roll

    2009-10-01

    Full Text Available   Lysbehandling av nyfødte med gulsott har vært brukt i mer enn 30 år uten at metoden har blitt videreutvikleti noen særlig grad. Man regner med at mellom 5 og 10% av alle nyfødte blir lysbehandlet. Behandlingengjennomføres ved at barnet legges i synlig lys fra spesielle fototerapilamper i mange timer, opptilflere dager. Lysets bølgelengde og intensitet har stor betydning for effektiviteten av behandlingen, og enskal ikke se bort fra risikoen for bivirkninger. Resultater av behandlingen bør undersøkes grundigere, bådefor å vurdere hvor mye bilirubinmengden reduseres, og for å oppdage mulige bivirkninger. Med tanke påbivirkninger kan det ta mer enn 30 år før disse er manifestert. Oppfølgingsstudier som har blitt foretatt, kanha for små tidsrammer, og det kan være spørsmål om det er lyseffekter eller effekter av bilirubintoksisitetsom har blitt registrert. Målet med vårt kliniske og eksperimentelle arbeid på området er å foreta studiersom kan bidra til at behandlingen kan bli mer optimal, særlig med hensyn til lysets intensitet og bølgelengde.I vårt epidemiologiske arbeid ønsker vi å se på langtidseffekter av lysbehandling, spesielt kreftutvikling(lymfatisk leukemi og malignt melanom.Roll EB, Christensen T. Phototherapy of newborns with hyperbilirubinemia – need for better  . Nor J Epidemiol 1997; 7 (1: 93-98.  ENGLISH SUMMARYTreating jaundiced newborns with artificial light has been done for the last three decades without substantialimprovements of the method. It can be estimated that between 5 and 10% of all newborns receivephototherapy. The standard treatment is the use of artificial, visible light sources for many hours up toseveral days. The wavelength and intensity of the light are factors influencing the effect of the treatment,however, the risk for long-term side effects should be considered. The results of the treatment need morethorough investigation for two purposes; to evaluate the therapeutic

  10. Jämförelse av vertikala accelerationer av järnvägsbroar för höghastighetståg.

    OpenAIRE

    Shoaibi, Martin

    2014-01-01

    Under de senaste decennierna parallellt med klimatdiskussionen har det vuxit fram ett stort intresse för höghastighetståg och en förbättrad infrastruktur i Sverige. I delar av Europa men speciellt i Kina och Japan har utvecklingen av höghastighetståg fått ett enormt lyft. Ett problem vid höjda tåghastigheter är att broarna vid en kombination av låg massa och låg egenfrekvens riskerar att orsaka resonans och höga accelerationsnivåer vid passage. Ballastspår är namnet för det traditionella järn...

  11. Overføring av avløpsvann fra Bekkelaget rensedistrikt til Sentralrenseanlegget Vest (SRV). Noen vurderinger av VA-tekniske konsekvenser. VA 12/85

    OpenAIRE

    Vråle, L.

    1985-01-01

    Undersøkelsen viser at en overføring av 1/3 part av avløpsvannet fra Bekkelaget rensedistrikt til SRV, vil redusere utslippet fra Bekkelaget vesentlig og totalbelastningen fra de to renseanleggene til fjorden fra 113 tonn P/år i 1984 til 46 tonn P/år med alt. høy rensegrad ved SRV. Oksygenbehovet i utslippet vil reduseres lite, fra 14.000 tonn O/år til 13.000 tonn O/år. Ved overføring av alt avløpsvann til SRV viser beregningene at fosforutslippene kan reduseres til 48 tonnP/år med alt. høy r...

  12. Patientens upplevelse av oro i samband med den preoperativa omvårdnaden : En litteraturstudie

    OpenAIRE

    Hellman, Kelly; Zhao Chen, Lijun

    2016-01-01

    Bakgrund: Oro drabbar de flesta patienter inför operation. Det finns många faktorer som påverkar patientens upplevelser av oro både inom vården och det liv patienten befinner sig i. Det är av stor vikt att få en ökad förståelse av hur den preoperativa omvårdnaden kan minska patientens oro och lidande utifrån patientens perspektiv.  Syfte: Att beskriva patientens upplevelse av oro i samband med den preoperativa omvårdnaden.  Metod: En deskriptiv litteraturstudie baserad på kvalitativa artiklar...

  13. Neurofibromatosis with vertebral artery A-V fistula and cervical meningocele -a case report-

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yong Joo; Suh, Kyung Jin; Kim, Tae Heon; Kang, Duk Sik; Park, Yeun Mook; Park, June Sik [College of Medicine, Kyungpook National University, Daegu (Korea, Republic of)

    1988-06-15

    Arteriovenous fistula is a rare abnormality in patient with neurofibromatosis. A review of English-language literature revealed only 3 reported cases. We report a case of neurofibromatosis with vertebral artery A-V fistula and cervical meningocele.

  14. Förändringar av arbetssätt vid implementering av BIM : En kvalitativ studie av två traditionella projekteringars arbetssätt och tid- och resursplanering samt vilka förändringar som är nödvändiga vid implementering av BIM

    OpenAIRE

    Jansson, Magnus; Knutsson, Kristian

    2012-01-01

    I en rapport från 2005 framtagen av FoU-Väst i samverkan med Centrum för management i byggsektorn (CMB) konstateras att en betydande del av allt slöseri i byggsektorn är kopplat till fel och konsekvenserna av dessa, med andra ord felkostnader. Studien visar att felkostnader står för cirka 10 % av ett projekts produktionskostnad.   Byggsektorn står nu, år 2012, inför förändringar i sitt arbetssätt för att minska antalet fel, öka kvaliteten och effektiviteten. BIM – Building Information Modelin...

  15. Språklige og verdimessige utfordringer ved innføring av klassifikasjonssystemet NANDA

    Directory of Open Access Journals (Sweden)

    Lisa Øien

    2009-02-01

    Full Text Available Artikkelen setter fokus på sykepleielederes opplevelse av språk og innhold i kodeverket NANDA (North American Nursing Diagnoses Association, et klassifikasjonssystem for sykepleiediagnoser. Funnene som presenteres er framkommet gjennom semistrukturerte intervju med tre sykepleieledere fra tre ulike avdelinger innen samme helseforetak. Det er brukt fenomenologisk hermeneutisk metode i analysen. Studien viser at språket oppleves som fremmed og stigmatiserende, og at det derfor finnes motstand mot å ta klassifiseringsverktøyet i bruk. Det foreligger en verdikonflikt mellom sykepleierens humanistiske grunnsyn og den grunnlagstenkningen sykepleieren opplever i møte med NANDA. Funnene blir viktige med tanke på utvikling og videreutvikling av klassifikasjonssystemer for bruk av sykepleiere i Norge. Videre arbeid med standardisering av sykepleiedokumentasjon må ta hensyn til at klassifikasjonssystemer ikke er verdinøytrale.

  16. Postprandial increase of plasma apoAV concentrations in Type 2 diabetic patients.

    Science.gov (United States)

    Pruneta-Deloche, Valérie; Ponsin, Gabriel; Groisne, Laure; Fruchart-Najib, Jamila; Lagarde, Michel; Moulin, Philippe

    2005-08-01

    Postprandial hypertriglyceridemia is considered as a risk factor for cardiovascular disease in Type 2 diabetes. However, little is known about the underlying mechanisms. Since the recently discovered apolipoprotein (apo) AV was identified as a modulator of triglyceride (TG) metabolism, the aim of the study was to determine the postprandial apoAV profile of Type 2 diabetic patients. We compared data from 11 patients with Type 2 diabetes mellitus to that of 12 non-diabetic normolipidemic subjects following the ingestion of a lipid-rich cream. Postprandial apoAV was elevated in diabetic patients but no correlation was observed either with plasma TG concentration or with the intensity of lipoprotein lipase-dependent lipolysis. These data obtained in human subjects suggest that plasma apoAV concentration does not play an acute or a direct role in the regulation of plasma TG in the postprandial state.

  17. Påvisning av nye biomarkører i plasma-proteomet

    Directory of Open Access Journals (Sweden)

    Jens P. Berg

    2009-10-01

    Full Text Available Svar på laboratorieanalyser er av avgjørende betydning for ressursbruk i helsevesenet i forbindelse med utredning, behandling og oppfølgning av pasienter. Undersøkelser fra USA viser at ca. 70% av alle beslutninger som foretas i helsevesenet i stor grad er basert på resultater fra laboratoriene (1. Størst betydning for bruk av ressurser og folkehelse har laboratorieanalyser som kan brukes til å identifisere personer med økt risiko for sykdom som kan forebygges eller kureres. De mest dramatiske eksempler på dette finner man for noen dominant arvelige kreftformer hvor en enkelt genetisk undersøkelse kan påvise personer som trenger ekstra oppfølgning og i enkelte tilfeller profylaktisk kirurgisk behandling. Blod utgjør det viktigste materialet for laboratorieundersøkelser. I denne artikkelen vil vi beskrive noen av mulighetene som finnes i letingen etter nye biomarkører i form av proteiner og peptider i plasmaproteomet som betegner det totale uttrykket av proteiner i plasma. Utviklingen av immunometriske og massespektrometriske metoder har åpnet nye muligheter til å finne nye sykdomsmarkører både som ”nye” proteiner og i form av modifikasjoner som er dannet etter at proteinet er syntetisert (post-translasjonelle modifikasjoner. Effektiv testing av kombinasjoner av flere titalls markører gjør det mulig å lete etter sykdomsspesifikke ”fingeravtrykk” i proteomet. Plasma-proteomet karakteriseres imidlertid også av at bare noen få proteiner utgjør kvantitativt det meste av proteomet og av store konsentrasjonsforskjeller mellom de ulike proteinene. God tilgang på godt karakteriserte kliniske materialer er helt nødvendig for å kunne validere nytten av en ny biomarkør. Et effektivt samarbeid mellom metode-utviklere og biobanker er derfor av avgjørende betydning for hvor raskt en ny biomarkør kan bli en diagnostisk eller prognostisk faktor.Determination of new biomarkers in the plasma proteome. Decision making and use

  18. Consequences of increased extraction of forest fuel; Konsekvenser av ett oekat uttag av skogsbraensle

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-07-01

    Sweden, but it might increase and it is often mixed with other solid biofuel at the plants. The review is based on a large number of scientific reports. It focuses mainly on Swedish conditions, consequently studies from northern Europe dominates, but we refer also to a large number of studies from other parts of the world. In Sweden, most of the relevant studies have been financed by the Swedish Energy Agency. Therefore, we have analysed all projects within the research programmes funded by the Swedish Energy Agency. This means not only reading scientific papers, but also all kinds of reports, as well as interviews with project leaders. Our result has been examined and discussed at a number of seminars and workshops. Connected to our work we had a reference group with members representing authorities, forestry companies and NGOs. To be able to evaluate the consequences of increased biomass extraction we have related our result to environmental objectives, and goals for forest production, set up by the society (the Swedish parliament). In Sweden we have adopted 16 environmental objectives (http://www.miljomal.nu/Environmental-Objectives-Portal/, in English). Of these especially five objectives are most relevant for our analysis: Reduced climate impact, Natural acidification only, A non-toxic environment, Zero eutrophication and Sustainable forests. The forest production goal is described in the forestry policy (Government proposition 1992/92: 226, in Swedish)

  19. FabAV antivenin use after copperhead snakebite: clinically indicated or knee-jerk reaction?

    OpenAIRE

    Gale, Stephen C.; Peters, Jo Ann; Allen, LaDonna; Creath, Robert; Dombrovskiy, Viktor Y

    2016-01-01

    Abstract Background Crotalidae Polyvalent Immune Fab (Ovine) (FabAV) antivenin is commonly recommended after pit viper snakebites. Because copperhead envenomations are usually self-limited, some physicians are reluctant to use this costly treatment routinely, while others follow a more liberal approach. We hypothesized that, in practice, only patients with evidence of significant (moderate or severe) copperhead envenomation [those with snakebite severity score (SSS) > 3] receive FabAV and e...

  20. Et sosiologisk blikk på mobbing. En teoretisk studie av paradigmet og fenomenet mobbing

    OpenAIRE

    Stemland, Linn

    2007-01-01

    Mobbing er et tema som har fått stadig mer oppmerksomhet i samfunnsdebatten. Det er gjort lite sosiologisk forskning omkring fenomenet mobbing. Forskningsfeltet mobbing er i dag konstruert og dominert av psykologiens begreper og forståelse. I denne oppgaven prøver jeg å nærme meg en sosiologisk forståelse av begrepet og fenomenet mobbing.

  1. [F-18]-AV-1451 binding correlates with postmortem neurofibrillary tangle Braak staging.

    Science.gov (United States)

    Marquié, Marta; Siao Tick Chong, Michael; Antón-Fernández, Alejandro; Verwer, Eline E; Sáez-Calveras, Nil; Meltzer, Avery C; Ramanan, Prianca; Amaral, Ana C; Gonzalez, Jose; Normandin, Marc D; Frosch, Matthew P; Gómez-Isla, Teresa

    2017-06-13

    [F-18]-AV-1451, a PET tracer specifically developed to detect brain neurofibrillary tau pathology, has the potential to facilitate accurate diagnosis of Alzheimer's disease (AD), staging of brain tau burden and monitoring disease progression. Recent PET studies show that patients with mild cognitive impairment and AD dementia exhibit significantly higher in vivo [F-18]-AV-1451 retention than cognitively normal controls. Importantly, PET patterns of [F-18]-AV-1451 correlate well with disease severity and seem to match the predicted topographic Braak staging of neurofibrillary tangles (NFTs) in AD, although this awaits confirmation. We studied the correlation of autoradiographic binding patterns of [F-18]-AV-1451 and the stereotypical spatiotemporal pattern of progression of NFTs using legacy postmortem brain samples representing different Braak NFT stages (I-VI). We performed [F-18]-AV-1451 phosphor-screen autoradiography and quantitative tau measurements (stereologically based NFT counts and biochemical analysis of tau pathology) in three brain regions (entorhinal cortex, superior temporal sulcus and visual cortex) in a total of 22 cases: low Braak (I-II, n = 6), intermediate Braak (III-IV, n = 7) and high Braak (V-VI, n = 9). Strong and selective [F-18]-AV-1451 binding was detected in all tangle-containing regions matching precisely the observed pattern of PHF-tau immunostaining across the different Braak stages. As expected, no signal was detected in the white matter or other non-tangle containing regions. Quantification of [F-18]-AV-1451 binding was very significantly correlated with the number of NFTs present in each brain region and with the total tau and phospho-tau content as reported by Western blot and ELISA. [F-18]-AV-1451 is a promising biomarker for in vivo quantification of brain tau burden in AD. Neuroimaging-pathologic studies conducted on postmortem material from individuals imaged while alive are now needed to confirm these observations.

  2. Kvalitetsutvärdering av biomedicin och närliggande huvudområden

    DEFF Research Database (Denmark)

    Leffler, Hakon; Fex Svenningsen, Åsa; Emgård, Mia

    2014-01-01

    UKÄ:s utvärdering av biomedicinutbildningar visar på en mycket varierad kvalitet. Nio av 21 utbildningar håller toppklass medan mer än hälften bedöms vara bristande. 21 utbildningar inom biomedicin har satts under lupp. Kvaliteten bedöms som vanligt efter en tregradig skala: mycket hög kvalitet, ...

  3. GPS, RT90 og Rikets nät. Om posisjonsbestemmelse av svenske grotter

    OpenAIRE

    Brattli, Tore

    2006-01-01

    Om unøyaktighet i posisjonsbestemmelse ved bruk av Garmin sitt svenske rutenett "Rikets nät". For sentrale deler av Sverige er avviket minimalt (6m i Stockholm), mens det i nord og sør kan være opp til 28m. For nøyaktige posisjoner i Rikets nät på Garmin GPS, skal både datum og rutenett stilles til RT90.

  4. Molecular Analysis and Effectiveness Assay of AV1 Gene in Transgenic Tobacco for Resistance to Begomovirus

    OpenAIRE

    Santoso, Tri Joko; Herman, Muhammad; Hidayat, Sri H; Aswidinnoor, Hajrial; Sudarsono, Sudarsono

    2012-01-01

    Genetic transformationof tobacco plant using AV1 gene was conducted atthe previously experiment and generated transgenic tobaccoplants positively carrying the selectable marker nptII gene.The objectives of this experiment were to (1) analyze thepresence of Begomovirus AV1 gene in T0 generation putativetransgenic tobacco plants using PCR technique with specificprimers and its correlation with resistance phenotype, (2)analyze the integration and copy number of the transgene inT0 generation puta...

  5. Helhetsorienterad utvärdering av kollektivtrafikåtgärder

    DEFF Research Database (Denmark)

    Hiselius, Lena Winslott; Barfod, Michael Bruhn; Leleur, Steen

    Under hösten 2008 och våren 2009 har forskare vid Avd. Trafik och väg vid Lunds Tekniska Högskola, DTU Transport vid Danmarks Tekniska Universitet samt National-ekonomiska institutionen vid Lunds Universitet genomfört ett forskningsprojekt med syfte att studera tillämpningen av en sammansatt...... (helhetsorienterad) analys av kollektiv-trafikåtgärder....

  6. The Galactic NH - AV Relation and its Application to Historical Galactic SNRs

    OpenAIRE

    Tian, Wen-Wu; Su, Hongquan; Xiang, F. Y.

    2013-01-01

    We refine a classic relation between the hydrogen column density (NH) and optical extinction (Av) by employing 39 Galactic Supernova Remnants (SNRs) with X-rays, optical and/or infra-red data available. We find NH = (1.69+/-0.07)*10^21 Av cm^(-2) mag^(-1) . Applying this relation to three Galactic SNRs with good historical records allows us to further constrain either their progenitor's distances or magnitudes, which is independent access to their distances.

  7. ADHD og atypisk hånddominans : en studie av forekomst av atypisk hånddominans hos barn og ungdom med ADHD

    OpenAIRE

    Seim, Ronny

    2008-01-01

    Bakgrunn og formål Formålet med undersøkelsen er å undersøke om det blant barn og ungdom med ADHD forekommer høyere grad av atypisk hånddominans sammenliknet med gjennomsnittsbefolkningen, og å gjennom teori undersøke hva årsakene kan være hvis dette forekommer. Problemstilling og forskningsspørsmål Problemstillingen er formulert slik: Finnes det en høyere forekomst av atypisk hånddominans blant barn og ungdom med ADHD, og hvilke(n) årsak(er) kan dette ha hvis en slik forekomst eksi...

  8. Stop-motion i filmen ”Du som inte fanns” : En processbeskrivning av den visuella stilen och användandet av stop-motion

    OpenAIRE

    Lönnberg, Christer

    2012-01-01

    I mitt examensarbete berättar jag om processen bakom den visuella stilen i dokumentär-filmen ”Du som inte fanns”. Jag behandlar teorierna och bakgrunden till de inspel-ningsmetoder jag valt till filmen. De inspelninsmetoder jag valt för att skapa den visuella stilen grundar sig på stillbilder tagna med stillbildkamera och kallas för stop-motion. Det finns olika typer av stop-motion och i filmen ”Du som inte fanns” använde jag mig av pixilation och timelapse. I detta examensarbete går jag ocks...

  9. First application of the meteorological Mini-UAV 'M{sup 2}AV'

    Energy Technology Data Exchange (ETDEWEB)

    Spiess, T.; Bange, J.; Buschmann, M.; Voersmann, P. [Braunschweig Univ. (Germany). Inst. fuer Luft- und Raumfahrttechnik

    2007-04-15

    The limitations of manned airborne meteorological measurements led to a new unmanned system, the Meteorological Mini-UAV (M{sup 2}AV), recently developed by the Institute of Aerospace Systems, Technical University of Braunschweig. The task was to develop, test and verify a meteorological sensor package as payload for an already available carrier aircraft, the UAV 'Carolo T200'. Thereby the limitations in size and mass had to be respected. The M{sup 2}AV is capable of performing turbulence and wind vector measurements within the atmospheric boundary layer and permits very short measurement cycles as an economic supplement during meteorological campaigns. The article gives details on the technical items. Results from meteorological data sets measured by the M{sup 2}AV are used for data quality assessment. In October 2005 the M{sup 2}AV participated in the meteorological field experiment 'LAUNCH 2005' in Lindenberg near Berlin. The M{sup 2}AV data were compared with lidar and sodar/RASS measurements. Furthermore, an in situ comparison of temperature, humidity and wind vector data with the helicopter-borne turbulence probe Helipod was analysed and gave information about the M{sup 2}AV data quality. (orig.)

  10. BMP-2 induces versican and hyaluronan that contribute to post-EMT AV cushion cell migration.

    Directory of Open Access Journals (Sweden)

    Kei Inai

    Full Text Available Distal outgrowth and maturation of mesenchymalized endocardial cushions are critical morphogenetic events during post-EMT atrioventricular (AV valvuloseptal morphogenesis. We explored the role of BMP-2 in the regulation of valvulogenic extracellular matrix (ECM components, versican and hyaluronan (HA, and cell migration during post-EMT AV cushion distal outgrowth/expansion. We observed intense staining of versican and HA in AV cushion mesenchyme from the early cushion expansion stage, Hamburger and Hamilton (HH stage-17 to the cushion maturation stage, HH stage-29 in the chick. Based on this expression pattern we examined the role of BMP-2 in regulating versican and HA using 3D AV cushion mesenchymal cell (CMC aggregate cultures on hydrated collagen gels. BMP-2 induced versican expression and HA deposition as well as mRNA expression of versican and Has2 by CMCs in a dose dependent manner. Noggin, an antagonist of BMP, abolished BMP-2-induced versican and HA as well as mRNA expression of versican and Has2. We further examined whether BMP-2-promoted cell migration was associated with expression of versican and HA. BMP-2- promoted cell migration was significantly impaired by treatments with versican siRNA and HA oligomer. In conclusion, we provide evidence that BMP-2 induces expression of versican and HA by AV CMCs and that these ECM components contribute to BMP-2-induced CMC migration, indicating critical roles for BMP-2 in distal outgrowth/expansion of mesenchymalized AV cushions.

  11. ADVANCED VITRIFICATION SYSTEM (RIC AVS) RESEARCH AND DEVELOPMENT PROJECT

    Energy Technology Data Exchange (ETDEWEB)

    J.R. Powell; M. Reich

    2003-06-30

    The objective of this AVS testing program is to use bench-scale test equipment to produce a vitrified product at maximum waste loading from the specified AZ-101 waste simulant and conduct a TTT analysis using laboratory scale melts to show compliance with the DOE Waste Acceptance Product Specifications for Vitrified High-Level Waste Forms (WAPS). The vitrified product complies with the following WAPS. A borosilicate glass with a waste loading of 60.9-wt% was produced from a slurry feed of AZ101 simulant. Glass durability testing, glass characterization testing, and testing methodology were performed in accordance with the Department of Energy approved Test Plan. The glass has two crystalline phases and good uniformity of composition. The Product Consistency Test on the 6 location-specific samples are at least 1 to 2 orders of magnitude below the mean PCT results for the EA glass. Standard deviations were less than 10% of measured values. The glass transition temperature averaged 658 {+-} 9 C. A TTT diagram was produced. There was measured cesium loss of about 2%, and compliance with the Universal Treatment Standards.

  12. Eye-tracking studie av vektoranalys på LTH

    DEFF Research Database (Denmark)

    Ögren, Magnus; Nyström, Marcus

    detaljerad inblick i hur studenterna tänkte medan de löste problemet. Vi använder modern eye-tracking teknik för att mäta hur LTH-studenters visuella uppmärksamhet fördelar sig mellan texter, matematiska formler och figurer när de löser problem inom vektoranalys. Genom att filma studenters ögonrörelser med...... en höghastighetskamera ger eye-tracking data information om var man tittar med väldigt hög spatial och temporal upplösning. Detta gör att man kan följa lösningsprocessen millisekund för millisekund från problempresentation till svar. Med eye-tracking kan man alltså skilja på process och produkt....... Vektoranalys är ett mycket visuellt ämne där matematiska formler ofta har en konkret grafisk tolkning. Detta gör vektoranalysen till ett speciellt lämpligt ämne att studera med eye-tracking teknologin, då försökspersonens byte av fokus mellan formler och figurer kan utvärderas. Vi kommer att presentera...

  13. Risk assessment of heavy metals in Vembanad Lake sediments (south-west coast of India), based on acid-volatile sulfide (AVS)-simultaneously extracted metal (SEM) approach.

    Science.gov (United States)

    Shyleshchandran, Mohanachandran Nair; Mohan, Mahesh; Ramasamy, Eswara Venkatesaperumal

    2017-12-23

    Contamination of estuarine system due to heavy metals is a severe issue in tropical countries, especially in India. For the evaluation of the risk due to heavy metals, the current study assessed spatial and temporal variation of acid-volatile sulfide (AVS), simultaneously extracted metal (SEM), and total metal concentration as toxicity indicator of aquatic sediments in Vembanad Lake System (VLS), India. Surface sediment samples collected from 12 locations from the northern portion of VLS for 4 years during different seasons. The results suggest, in post-monsoon season, 91% of the sampling locations possessed high bioavailability of metals and results in toxicity to aquatic biota. The average seasonal distribution of SEM during the period of observations was in the order post-monsoon > pre-monsoon > monsoon (1.76 ± 2.00 > 1.35 ± 0.60 > 0.80 ± 0.54 μmol/g). The concentration of individual metals on ∑SEM are in the order SEM Zn > SEM Cu> SEM Cd ≈ SEM Pb > SEM Hg. Considering annual ΣSEM/AVS ratio, 83% of the sites cross the critical value of 'One,' reveals that active sulfide phase of the sediment for fixing the metals is saturated. The molar ratio (differences between SEM and AVS) and its normalized organic carbon ratio reveals that in the post-monsoon season, about 42% of the sites are in the category of adverse effects are possible. The study suggests the toxicity and mobility of the metals largely depend on the available AVS, and the current situation may pose harm to benthic organisms.

  14. Left-sided approach of AV junction ablation for drug refractory atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Yoga Yuniadi

    2006-06-01

    Full Text Available AV junction ablation has been proven effective to treat symptomatic atrial fibrillation refractory to antiarrhythmias or fail of pulmonary vein isolation. However, about 15% of conventional right-sided approach AV junction ablation failed to produce complete heart block. This study aimed to characterize His bundle potential at ablation site during conventional or left-sided approach of AV junction ablation. Twenty symptomatic AF patient (age of 60.5 ± 9.28 and 11 are females underwent conventional AV junction ablation. If 10 applications of radiofrequency energy are failed, then the ablation was performed by left-sided approach. Seventeen patients are successfully ablated by conventional approach. In 3 patients, conventional was failed but successfully ablated by left-sided approach. The His bundle amplitude at ablation site was significantly larger in left-sided than correspondence right-sided (16.0 ± 4.99 mm vs. 6.9 ± 4.02 mm respectively, p = 0.001, 95% CI -14.0 to -4.3. ROC analysis of His bundle potential amplitude recorded from right-sided revealed that cut off point of > 4.87 mm given the sensitivity of 81.3% and specificity of 53.8% for successful right-sided approach of AV junction ablation. In case of failed conventional approach, the left-sided approach is effective for AV junction ablation. An early switch to the left-sided approach may avoid multiple RF applications in patients with a low amplitude His-bundle potential (< 4.87 mm. (Med J Indones 2006; 15:109-14Keywords: Atrial fibrillation, AV junction ablation, left-sided approach

  15. Englischsprachige Erweiterung des TIB|AV-Portals: Ein GND-DBpedia-Mapping zur Gewinnung eines englischen Begriffssystems

    OpenAIRE

    Sven Strobel

    2014-01-01

    Die Videos des TIB|AV-Portals werden mit insgesamt 63.356 GND-Sachbegriffen aus Naturwissenschaft und Technik automatisch verschlagwortet. Neben den deutschsprachigen Videos verfügt das TIB|AV-Portal auch über zahlreiche englischsprachige Videos. Die GND enthält zu den in der TIB|AV-Portal-Wissensbasis verwendeten Sachbegriffen nur sehr wenige englische Bezeichner. Es fehlt demnach ein englisches Indexierungsvokabular, mit dem die englischsprachigen Videos automatisch verschlagwortet werden k...

  16. Atrial rate adaptive pacing: what happens to AV conduction?

    Science.gov (United States)

    Linde, C; Nordlander, R; Rosenqvist, M

    1994-10-01

    To investigate if an nonphysiological prolongation of the AV interval is common during activity sensor modulated atrial rate adaptive (AAIR) pacing, 21 patients with sinus node disease treated with fixed rate atrial (AAI) or AAIR pacemakers were examined. Spike-Q intervals were compared at different heart rates obtained by overdrive pacing at rest and during exercise (Study I), measured during exercise at unresponsive (AAI), optimal (AAIR) and over responsive programming (AAIR+) of the activity sensor (Study II), and finally examined by 24-hour Holter recording in AAI and AAIR pacing modes (Study III). Study I: The spike-Q interval increased significantly with increasing heart rate at rest, but not during exercise. At rest the spike-Q interval was significantly higher at all heart rates compared to exercise. There was a significant positive correlation between the maximal spike-Q interval at rest and the maximal spike-Q interval during exercise (r = 0.63). Study II: The spike-Q interval was shortest in the AAI and longest in the AAIR+ mode in all patients. Study III: During AAI or AAIR pacing the spike-Q interval was longest at night and shortest in the morning. The mean spike-Q interval was longer in AAIR than in AAI pacing. No statistical difference between the maximal spike-Q intervals observed during the two modes was, however, found. Variations in spike-Q interval are generally caused by changes in autonomic tone or medication with drugs with antiarrhythmic effect.(ABSTRACT TRUNCATED AT 250 WORDS)

  17. Kjøring med mistanke om påvirkning av andre rusmidler enn alkohol

    Directory of Open Access Journals (Sweden)

    Asbjørg S. Christophersen

    2009-10-01

    Full Text Available  SAMMENDRAGStatens rettstoksikologiske institutt har i løpet av de siste år registrert en stor økning av prøver fra bilføreremistenkt for kjøring under påvirkning av andre rusmidler enn alkohol. Antall positive saker økte 42% fra1994 til 1995. De hyppigste påviste stoffer er tetrahydrocannabinol, amfetamin, benzodiazepiner og opiater(morfin/kodein. Bruk av tyngre narkotiske stoffer har blitt mer vanlig i trafikksammenheng og antall positivetilfeller har økt betydelig mer enn totalt antall saker. Fra 1994 til 1995 økte antall positive amfetaminprøvermed 75% (fra 533 til 937 og antall positive prøver som følge av heroininntak økte med 87% (fra 92 til 172.Bruk av flere stoffer samtidig er vanlig, over 60 % av sakene i 1995 var positive på mer enn ett stoff, alkoholikke medregnet. De fleste tilfeller var representert av menn i alderen 25-32 år (37%. Kvinner var representerti ca. 11% av sakene.Christophersen AS, Skurtveit S, Mørland J. Drivers suspected to drive under the influence of drugs otherthan alcohol. Nor J Epidemiol 1996; 6 (1: 45-48.ENGLISH SUMMARYThe National Institute of Forensic Toxicology has registered a large increase in the number of samples fromdrivers suspected to drive under influence of drugs other than alcohol. The number of drug positive casesincreased 42% from 1994 to 1995. The most frequent drugs detected are tetrahydrocannabinol, amphetamine,benzodiazepines and opiates (morphine/codeine. The frequency of hard narcotic drug use has increased morethan the total number of cases. From 1994 to 1995, the number of amphetamine positive samples increased75% (from 533 to 937 and the number of samples positive due to heroin use (detection of the metabolite 6-monoacetylmorphine in urine increased 87%. Multi-drug use is common and more than one drug wasdetected in more than 60% of the cases from 1995, alcohol not included. Most of the cases were representedby men 25-32 years old (37%. Women were represented in about

  18. Context-Aware UPnP-AV Services for Adaptive Home Multimedia Systems

    Directory of Open Access Journals (Sweden)

    Roland Tusch

    2008-01-01

    Full Text Available One possibility to provide mobile multimedia in domestic multimedia systems is the use of Universal Plug and Play Audio Visual (UPnP-AV devices. In a standard UPnP-AV scenario, multimedia content provided by a Media Server device is streamed to Media Renderer devices by the initiation of a Control Point. However, there is no provisioning of context-aware multimedia content customization. This paper presents an enhancement of standard UPnP-AV services for home multimedia environments regarding context awareness. It comes up with context profile definitions, shows how this context information can be queried from the Media Renderers, and illustrates how a Control Point can use this information to tailor a media stream from the Media Server to one or more Media Renderers. Moreover, since a standard Control Point implementation only queries one Media Server at a time, there is no global view on the content of all Media Servers in the UPnP-AV network. This paper also presents an approach of multimedia content integration on the Media Server side that provides fast search for content on the network. Finally, a number of performance measurements show the overhead costs of our enhancements to UPnP-AV in order to achieve the benefits.

  19. Vorticity-divergence semi-Lagrangian global atmospheric model SL-AV20: dynamical core

    Science.gov (United States)

    Tolstykh, Mikhail; Shashkin, Vladimir; Fadeev, Rostislav; Goyman, Gordey

    2017-05-01

    SL-AV (semi-Lagrangian, based on the absolute vorticity equation) is a global hydrostatic atmospheric model. Its latest version, SL-AV20, provides global operational medium-range weather forecast with 20 km resolution over Russia. The lower-resolution configurations of SL-AV20 are being tested for seasonal prediction and climate modeling. The article presents the model dynamical core. Its main features are a vorticity-divergence formulation at the unstaggered grid, high-order finite-difference approximations, semi-Lagrangian semi-implicit discretization and the reduced latitude-longitude grid with variable resolution in latitude. The accuracy of SL-AV20 numerical solutions using a reduced lat-lon grid and the variable resolution in latitude is tested with two idealized test cases. Accuracy and stability of SL-AV20 in the presence of the orography forcing are tested using the mountain-induced Rossby wave test case. The results of all three tests are in good agreement with other published model solutions. It is shown that the use of the reduced grid does not significantly affect the accuracy up to the 25 % reduction in the number of grid points with respect to the regular grid. Variable resolution in latitude allows us to improve the accuracy of a solution in the region of interest.

  20. Güneydoğu Marmara'da Algarna ile Karides Avcılığında Av Kompozisyonu ve Hedef Dışı Av.

    Directory of Open Access Journals (Sweden)

    Yusuf Kenan Bayhan

    2015-12-01

    Full Text Available Bir yıl süre ile yürütülen bu çalışma, Kasım 2000 - Ekim 2001 tarihleri arasında Güneydoğu Marmara’da gerçekleştirilmiştir. Çalışmada, algarna ile avcılıkta hedef tür olan derin su pembe karidesi (Parapenaeus longirostris’in ağırlık ve sayısal miktarları ile bunun dışındaki av kompozisyonu, türlerin boy dağılımları ve toplam av içerisindeki sayısal oranları araştırılmıştır. Yapılan çekimler sonucunda, toplam avın sayısal olarak % 64.5’ni hedef tür olan Parapenaeus longirostris, % 35.5’ini hedef dışı av oluşturmuştur. 50 türün bulunduğu hedef dışı avın % 17.16’sını Kemikli balıklar (Osteichthyes, % 8.58’ini Kabuklular (Crustacea-Decapoda, % 4.94’ünü Derisi Dikenliler (Echinodermata, % 2.53’ünü Yumuşakçalar (Mollusca, % 2.14’ünü Cnidaria ve % 0.13’ünü kıkırdaklı balıklar (Chondrichthyes oluşturmuş, toplam av içerisinde Parapenaeus longirostris’in dışında sayısal olarak en çok yakalanan türlerin başında ise Kaya balığı, Mezgit, Kancaağız pisi, Yengeç, Deniz yıldızı ve Deniz hıyarı’nın geldiği belirlenmiştir

  1. Mineralogic mapping of the Av-9 Numisia quadrangle of Vesta

    Science.gov (United States)

    Frigeri, A.; De Sanctis, M. C.; Ammannito, E.; Buczkowski, D.; Combe, J. P.; Tosi, F.; Zambon, F.; Rocchini, D.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2015-10-01

    In this manuscript we present the mineralogic mapping of the Av-9 Numisia quadrangle of Vesta using the most up-to-date data from the NASA-Dawn mission. This quadrangle is located in Vesta's equatorial zone (22° south to 22° north, 218° to 288° east, in Claudia coordinate system) and takes its name from the impact crater Numisia. The main feature, which dominates the quadrangle, is the Vestalia Terra plateau, a topographic high about 10 km above the surrounding areas. To the south, this region fades into the Rheasilvia basin, while to the north it is bounded by the steep scarp of Postumia basin. The Visible and Infrared mapping spectrometer (VIR) onboard NASA/Dawn provided the main data source for this work, at an unprecedented level of spatial and spectral resolution. In particular we are using spectral parameters to synthesize characteristics of the whole spectra into a single value. Pyroxene-related spectral parameters allow for the detection of lower crust or mantle material (diogenites) and upper crust material (eucrites) in the study area. The combined analysis of albedo from the Framing Camera, the geologic map and the spectroscopic data offer an interesting opportunity to understand better the surface features of this region of Vesta, and their evolution. Numisia, Cornelia, Fabia, Teia and Drusilla are the main craters in the study area, rich in bright and dark material outcrops, pitted terrains and OH-rich materials. Using the spectral parameters we demonstrate that the internal composition of Vestalia Terra is mainly diogenite-rich howardite, as shown by materials excavated by Cornelia and Fabia, and the composition of the slope north of Vestalia Terra. This agrees with the strong positive Bouguer Anomaly observed in the area, indicating a higher density of these features in relation to the surrounding areas. Besides the recently published works based on gravimetric modeling and geologic interpretation, the mineralogic mapping presented herein gives

  2. Testbatteri för talapraxi : Utformning och pilotnormering av ett artikulationstest

    OpenAIRE

    Albinsson, Sophie; Berglund, Julia

    2010-01-01

    Talapraxi är en talmotorikstörning som drabbar planeringen och programmeringen av talet, vilket visar sig som avvikelser i artikulation och prosodi. I dag finns inget svenskt test för utredning av talapraxi. Syftet med studien var därför att utforma ett testbatteri på svenska som är känsligt även för lindriga grader av talapraxi. Detta test pilotnormerades på 50 friska deltagare.  För att kunna studera hur kön, ålder och utbildningsnivå kan inverka på prestationen i testbatteriet, eftersträva...

  3. FastVDO enhancements of the AV1 codec and comparison to HEVC and JVET codecs

    Science.gov (United States)

    Topiwala, Pankaj; Dai, Wei; Krishnan, Madhu

    2017-09-01

    This paper describes a study to investigate possible ways to improve the AV1 codec, in several directions, most particularly in the context of 10-bit HDR video content, and 8/10 bit image content. Applications to SDR video, and 360 content are discussed elsewhere. For HDR content, a data adaptive grading technique in conjunction with the AV1 codec is studied. For image content, lapped biorthogonal transforms for (near) lossless compression is studied. For scalability-type applications, we introduce advanced resampling filters which outperform current ones. It is asserted that useful improvements are possible in each of these categories. In particular, substantial value is offered in the coding of HDR content, very competitive with HEVC HDR10, in a coding framework offering backwards compatibility with SDR. We also provide a rudimentary comparison of AV1 to the standard HEVC as well as the developing JVET codecs.

  4. Amerikanimerad kultur : En kritisk diskursanalys av kulturella värderingar i Inside Out och Minions

    OpenAIRE

    Ragnhage, Lukas; Wendel, Erik

    2016-01-01

    Animerad film har under de senaste 100 åren utvecklats i en snabb takt, från korta tecknade Disney-filmer till dagens datoranimerade långfilmer. Ledande inom denna utveckling är USA som med sina lättsmälta animerade filmer etablerat sig som underhållningsform i många familjers hem världen över. Amerika har med hjälp av företag som Disney och Pixar blivit pionjärer inom genren och dominerar distributionen av animerad film i världen.   Med ett av världens mest inflytelserika länder som största ...

  5. Replikprovning som metod för prognos av kryplivslängd.

    OpenAIRE

    Hansson, Sofia

    2016-01-01

    Replikprovning är en oförstörande provningsmetod som ofta tillämpas på komponenter i högtemperaturanläggningar i syfte att studera utveckling av krypskador. Metoden går ut på att man i fält tar en kopia, benämnd replik, av stålets ytliga mikrostruktur genom att lägga en plastfilm eller gummimassa på en noggrant preparerad yta. Genom att studera mikrostrukturen i mikroskop kan man på ett tidigt stadium upptäcka krypskador i form av kaviteter, håligheter, i korngränserna och därigenom göra en b...

  6. Editering i Double Indemnity & Body Heat : En analys av klassisk film noir och modern neo noir

    OpenAIRE

    Sandberg, Nicklas

    2015-01-01

    Mitt examensarbete är en analys av två filmers tidsperiodiska skillnader i editeringsstilar. Filmerna som ingår i analysen är Double Indemnity (1944) och Body Heat (1981). Syftet med arbetet är att se hur dessa filmer med liknande berättelser och 30 år mellan varandra använder sig av olika editeringsstilar som är representativa av tidsperioden de är gjorda i. På samma gång vill jag se hur dessa stilar påverkar hur en åskådare upplever filmen. Arbetet är begränsat såvida att jag enbart fokuser...

  7. In vivo imaging of amyloid deposition in Alzheimer disease using the radioligand 18F-AV-45 (florbetapir [corrected] F 18).

    Science.gov (United States)

    Wong, Dean F; Rosenberg, Paul B; Zhou, Yun; Kumar, Anil; Raymont, Vanessa; Ravert, Hayden T; Dannals, Robert F; Nandi, Ayon; Brasić, James R; Ye, Weiguo; Hilton, John; Lyketsos, Constantine; Kung, Hank F; Joshi, Abhinay D; Skovronsky, Daniel M; Pontecorvo, Michael J

    2010-06-01

    An (18)F-labeled PET amyloid-beta (Abeta) imaging agent could facilitate the clinical evaluation of late-life cognitive impairment by providing an objective measure for Alzheimer disease (AD) pathology. Here we present the results of a clinical trial with (E)-4-(2-(6-(2-(2-(2-(18)F-fluoroethoxy)ethoxy)ethoxy)pyridin-3-yl)vinyl)-N-methyl benzenamine ((18)F-AV-45 or florbetapir [corrected] F 18). An open-label, multicenter brain imaging, metabolism, and safety study of (18)F-AV-45 was performed on 16 patients with AD (Mini-Mental State Examination score, 19.3 +/- 3.1; mean age +/- SD, 75.8 +/- 9.2 y) and 16 cognitively healthy controls (HCs) (Mini-Mental State Examination score, 29.8 +/- 0.45; mean age +/- SD, 72.5 +/- 11.6 y). Dynamic PET was performed over a period of approximately 90 min after injection of the tracer (370 MBq [10 mCi]). Standardized uptake values and cortical-to-cerebellum standardized uptake value ratios (SUVRs) were calculated. A simplified reference tissue method was used to generate distribution volume ratio (DVR) parametric maps for a subset of subjects. Valid PET data were available for 11 AD patients and 15 HCs. (18)F-AV-45 accumulated in cortical regions expected to be high in Abeta deposition (e.g., precuneus and frontal and temporal cortices) in AD patients; minimal accumulation of the tracer was seen in cortical regions of HCs. The cortical-to-cerebellar SUVRs in AD patients showed continual substantial increases through 30 min after administration, reaching a plateau within 50 min. The 10-min period from 50 to 60 min after administration was taken as a representative sample for further analysis. The cortical average SUVR for this period was 1.67 +/- 0.175 for patients with AD versus 1.25 +/- 0.177 for HCs. Spatially normalized DVRs generated from PET dynamic scans were highly correlated with SUVR (r = 0.58-0.88, P < 0.005) and were significantly greater for AD patients than for HCs in cortical regions but not in subcortical white

  8. Helsekonsekvenser av vektendring - er slanking fordelaktig? En litteraturoversikt

    Directory of Open Access Journals (Sweden)

    Anne Johanne Søgaard

    2009-11-01

    Full Text Available  SAMMENDRAGLangsom vektøkning gjennom livet inntil kroppsmasseindeks (KMI 27 ser ikke ut til å gi særlige negative utfallmht. total dødelighet. En økning på ! 20 kg fra 18 års alder er trolig negativt – det samme er vektøkning ut fra enhøy utgangsvekt. Selv om mange studier finner økt dødelighet hos yngre og middelaldrende personer med KMI > 27,er det foreløpig ingen studier som har vist at vektreduksjon blant friske overvektige personer gir økt levetid. Flerestudier viser tvert imot en assosiasjon mellom vektreduksjon og økt dødelighet. Heller ikke studier som prøver åbegrense analysene til personer med frivillig vekttap, finner redusert dødelighet etter vektreduksjon blant friskeovervektige individer. Noen få studier har vist redusert dødelighet blant overvektige personer med etablertesykdommer eller høy risiko for hjerte-karsykdom og diabetes. Når det gjelder sykelighet har de fleste studier entenikke funnet noen assosiasjon mellom vektreduksjon og sykelighet, eller funnet økt sykelighet. Unntaket er diabetes,der vekttap i enkelte studier samvarierer med redusert sykelighet. Det er i mange studier funnet sammenheng mellomvekttap og økt risiko for lårhalsbrudd og gallesten. De fleste studier har imidlertid vist at moderat vektreduksjon(vekttap på opp til 10% fører til redusert blodtrykk, forbedret glukosekontroll, redusert kolesterolnivå, forbedretdyslipidemi, forbedret lungefunksjon, bedre søvnkvalitet og redusert søvnapnè. Moderat vekttap vil også kunnelindre leddsmerter. Dette tilsynelatende paradoks diskuteres i artikkelen – bl.a. drøftes de metodeproblemer som erinnebygget i mange av studiene. Fordi det har vist seg vanskelig for personer med kraftig overvekt å redusere vektenpermanent – og fordi resultatene mht. helseeffektene av vektreduksjon er usikre, bør hovedinnsatsen settes inn iforhold til å forebygge overvekt/fedme overfor enkeltpersoner med potensielle problemer. Personer med

  9. Saken är biff : En granskning av samförstånd och motsättningar vid införandet av en minskad nötköttskonsumtion

    OpenAIRE

    Molin, Elvira

    2017-01-01

    Svenskarna är ibland de som konsumenterna konsumerar mest nötkött i världen, de äter 26 kg per person och år. Matkonsumtionen generellt står för en tredjedel av de svenska hushållens utsläpp av växthusgaser, och g. Globalt sett står djuruppfödningen till köttproduktion för 14,5 % av utsläppen av alla växthusgaser. Kor är idisslare och deras matsmältning avger metangas vilket bidrar mer till växthuseffekten jämfört med uppfödning av andra djur som inte idisslar. För att minska de utsläppen kan...

  10. Sammenhengen mellom livserfaringer og utvikling av langvarige muskelplager og fibromyalgi; en fenomenologisk livsverdenstudie av 5 kvinners livserfaringer i årene før de fikk diagnosen fibromyalgi

    Directory of Open Access Journals (Sweden)

    Anne Kristin Wanvik

    2011-06-01

    Resultater; En sterk andreorientering og smerter og trøtthet i kroppen og lange perioder med fysisk og psykisk stress i årene før de fikk diagnosen fibromyalgi. Plagene ble forsøkt skjøvet bort og ignorert og symptomene ble verre med årene. En opplevelse av kroppen som noe annet enn ”dem selv”. Konklusjon; Kvinner som utvikler fibromyalgi viser i denne studien en splittelse mellom kroppen og selvet, og at kroppen ofte oppleves som et objekt.  Dette kan sees som en manglende identifisering med og en objektgjøring av egen kropp.  Denne fremmedgjøringen og objektgjøringen av egen kropp synes å ha vært medvirkende til overbelastning av kroppen og utvikling av langvarige muskelplager for kvinnene i studien.

  11. Evaluation of full seismic moment tensor from isotropic, LCVD and double-couple components

    Czech Academy of Sciences Publication Activity Database

    Kolář, Petr

    2006-01-01

    Roč. 3, č. 4 (2006), s. 105-107 ISSN 1214-9705 R&D Projects: GA AV ČR IAA300120502 Institutional research plan: CEZ:AV0Z30120515 Keywords : evaluation * full seismic moment tensor * point source representation Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  12. Kompatibilitetstesting av TPN og legemidler gitt som Y-infusjon til barn

    OpenAIRE

    Iqbal, Herra

    2014-01-01

    Total parenteral ernæring (TPN) inneholder glukose, fett og aminosyrer i tillegg til vitaminer, sporelementer og elektrolytter. TPN er en olje-i-vann emulsjon som er stabilisert med emulgatorer. Parallellinfusjon av TPN og legemidler kan være ønskelig i tilfeller hvor det er mangel på intravenøse innganger. Ved å administrere TPN og legemiddel gjennom et Y-sett kan en muliggjøre administrering av to komponenter parallelt, men det er samtidig en risiko for inkompatibilitet mellom legemidlet og...

  13. Kamerabasert navigasjon ved hjelp av landemerker med ukjent avstand fra kameraplanet

    OpenAIRE

    Engen, Simen Tvedt

    2015-01-01

    Kamerabasert navigasjon er en metode for å estimere posisjon og orientering til en plattform ved hjelp av informasjon fra optiske kamerabilder. Det kan være aktuelt i flere situasjoner. Eksempler på dette kan være der det ikke finnes eller er dårlig GPS dekning som innendørs, i et urbant miljø, under vann eller i situasjoner der hvor GPS signalet blir jammet . Oppgavens mål er å gjøre seg kjent med kamerabasert navigasjon og videre se om implementering av akselerasjon- og vinkelhastighetsmål...

  14. Friluftsliv som del av behandling for sykelig fedme - opplevelser og meninger fra deltagernes perspektiv

    OpenAIRE

    Haugen, Anders Lund; Tangen, Steffen

    2010-01-01

    Begrunnelse for valg av tema: Overvekt og fedme er et økende problem over hele verden, og WHO omtaler dette som en epidemi som må behandles og forebygges. Overvekt og fedme gir forringet livskvalitet for den enkelte og har en betydelig samfunnskostnad med tanke på tapt arbeidskapasitet og sykdomsbehandling. Behovet for å finne behandlingstiltak som fungerer, øker i tråd med utviklingen av problemet. Konservativ behandling har varig livsstilsendring som mål og retter seg mot forhold som kostho...

  15. Friluftsliv som del av behandling for sykelig fedme - opplevelser og meninger fra deltagernes perspektiv

    OpenAIRE

    Haugen, Anders Lund; Tangen, Steffen

    2010-01-01

    En kombinert studie, med innhenting av både kvalitative og kvantitative data. Har som formål å få innsikt i hvordan friluftsliv oppleves blant mennesker som er til behandling for sykelig fedme ved en behandlingssinstitusjon. Begrunnelse for valg av tema: Overvekt og fedme er et økende problem over hele verden, og WHO omtaler dette som en epidemi som må behandles og forebygges. Overvekt og fedme gir forringet livskvalitet for den enkelte og har en betydelig samfunnskostnad med tanke på tapt...

  16. Millennials och baby boomers attityder till fake news : Generationernas upplevelser av nyhetsmediers sanningshalt

    OpenAIRE

    Adolfsson, Claes; Strömberg, Markus; Stenberg, John

    2017-01-01

    Syftet med denna uppsats var att ta reda på generationerna millennials och baby boomers inställning till mediernas sanningshalt och politiska neutralitet. Detta gjordes med hjälp av följande frågeställningar: Vilka attityder och vilken inställning har millennials och baby boomers till nyhetsmediernas sanningshalt? Finns skillnader och likheter kvar när vi väger in variablerna kön och politiskt ställningstagande?   För att definiera generationerna använde vi oss av Cliff Zukins generationsteor...

  17. Betydningen av drektige reinsimlers ernæring for kalvers vekst, klimatiske toleranse og overlevelse

    Directory of Open Access Journals (Sweden)

    Arne Rognmo

    2013-03-01

    Full Text Available Forsøkene (viste at tilleggsforing av underernærte simler i siste del av drektighetsperioden kun synes å ha effekt på fødselsvekten for kalvene forutsatt at simlene får høyverdig ernæring etter kalving. Den forskjellige ernæringsbakgrunn før kalving synes således ikke å innvirke på melkeproduksjon/kvalitet, da vektutviklingen for alle grupper av kalver i dette forsøket gikk parallelt i de tre første ukene etter kalving. Det ble heller ikke på noe punkt funnet signifikante forskjeller gruppene imellom når det gjelder kalvenes klimatiske toleranse. Det er dog bemerkelsesverdig at det var stor dødelighet blant de små kalvene etter unge små simler i GRUPPE L. Dette funn er interessant sett i sammenheng med resultatene fra Røros (se bidrag fra Dag Lenvik, side som viser at avkastningen fra en flokk kan økes markant om man konsentrerte slakteuttaket på små kalver og forhindrer bedekning av små, unge simler gjennom fjerning av eldre, store bukker. Med det forbehold at våre forsøk er utført på dyr i innhegning med et lavt aktivitetsnivå, kan man fra våreforsøk foreløpig konkludere med at tillegsfor ing av simler i siste halvdel av drektighetsperioden har effekt på kalvenes fødselsvekt, men at vektutviklingen for kalven er uavhengig av simlenes ernæringshistorie, om sistnevnte tilbys høyverdig ernæring etter kalving. Da små kalver etter underernærte simler viste høy dødelighet like etter fødselen, vil imidlertid tilleggsforing kunne øke avkastningen om det er mange unge simler i flokken. Resultatene fra Røros tyder imidlertid på at dette resultat normalt kan oppnås uten ekstra omkostninger gjennom et selektivt slakteuttak.

  18. Erfarenheter av att leva med stomi efter kolo-/rektalcancer : En litteraturstudie

    OpenAIRE

    Rydelius, Linn; Proena, Antonia

    2015-01-01

    Erfarenheter av att leva med stomi efter kolo-/rektalcancer Bakgrund: Vanligaste orsaken till att en stomi anläggs är kolorektalcancer. En stomioperation kan orsaka förändringar i personens liv. Det kirurgiska ingreppet har stor inverkan på personens kropp. Personen kan uppleva oro, nedsatt självbild och försämrad livskvalitet. Personen med stomi kan även uppleva förändringar i det sociala livet och sexualiteten. Syfte: Syftet med studien var att belysa personers erfarenheter av att leva med...

  19. Apolipoprotein A-V interaction with members of the low density lipoprotein receptor gene family

    DEFF Research Database (Denmark)

    Nilsson, Stefan K; Lookene, Aivar; Beckstead, Jennifer A

    2007-01-01

    lipoprotein receptor family, the low density lipoprotein receptor-related protein and the mosaic type-1 receptor, SorLA. Experiments using surface plasmon resonance showed specific binding of both free and lipid-bound apolipoprotein A-V to both receptors. The binding was calcium dependent and was inhibited...... by the receptor associated protein, a known ligand for members of the low density lipoprotein receptor family. Preincubation with heparin decreased the receptor binding of apolipoprotein A-V, indicating that overlap exists between the recognition sites for these receptors and for heparin. A double mutant...

  20. Fortellingens autonomi versus avhengighet til konteksten : en komparativ analyse av to fortelleteoretiske perspektiver

    OpenAIRE

    Knappen, Ingvild Viker

    2004-01-01

    Sammendrag Denne oppgaven handler om en diskusjon mellom Seymour Chatman og Barbara Herrstein Smith om hvordan forstå fortellingens natur. Disse representerer hvert sitt syn på dette. Er fortellingen autonom, og uavhengig mediet det realiseres i, eller er fortellingen avhengig av fortellekonteksten, det vil si at man må ta konteksten i betraktning hvis man skal skjønne hvorfor fortellingen har den form den har. Mitt formål er ikke å avgjøre hvilke av disse teoretiske perspektivene som har...