WorldWideScience

Sample records for erle stanley gardner

  1. A gathering for Gardner

    Science.gov (United States)

    Crease, Robert P.

    2008-07-01

    Martin Gardner, who turns 94 this autumn, seems to have pulled off an astounding trick. Every other year hundreds of people gather to honour Gardner, who is the author of over 70 books and wrote the popular "Mathematical Games" column that appeared in Scientific American for a quarter of a century from 1956. What is astonishing is that the people come from a bewildering variety of professions and include jugglers, magicians, artists, puzzle-makers, logicians, computer scientists, pseudoscience debunkers and mathematicians.

  2. R&D ERL: Vacuum

    Energy Technology Data Exchange (ETDEWEB)

    Mapes, M.; Smart, L.; Weiss, D.; Steszyn, A.; Todd, R.

    2010-01-01

    The ERL Vacuum systems are depicted in a figure. ERL has eight vacuum volumes with various sets of requirements. A summary of vacuum related requirements is provided in a table. Five of the eight volumes comprise the electron beamline. They are the 5-cell Superconducting RF Cavity, Superconducting e-gun, injection, loop and beam dump. Two vacuum regions are the individual cryostats insulating the 5-cell Superconducting RF Cavity and the Superconducting e-gun structures. The last ERL vacuum volume not shown in the schematic is the laser transport line. The beamline vacuum regions are separated by electropneumatic gate valves. The beam dump is common with loop beamline but is considered a separate volume due to geometry and requirements. Vacuum in the 5-cell SRF cavity is maintained in the {approx}10{sup -9} torr range at room temperature by two 20 l/s ion pumps and in the e-gun SRF cavity by one 60 l/s ion pump. Vacuum in the SRF cavities operated at 2{sup o}K is reduced to low 10{sup -11} torr via cryopumping of the cavity walls. The cathode of the e-gun must be protected from poisoning, which can occur if vacuum adjacent to the e-gun in the injection line exceeds 10-11 torr range in the injection warm beamline near the e-gun exit. The vacuum requirements for beam operation in the loop and beam dump are 10-9 torr range. The beamlines are evacuated from atmospheric pressure to high vacuum level with a particulate free, oil free turbomolecular pumping cart. 25 l/s shielded ion pumps distributed throughout the beamlines maintain the vacuum requirement. Due to the more demanding vacuum requirement of the injection beamline proximate to the e-gun, a vacuum bakeout of the injection beamline is required. In addition, two 200 l/s diode ion pumps and supplemental pumping provided by titanium sublimation pumps are installed in the injection line just beyond the exit of the e-gun. Due to expected gas load a similar pumping arrangement is planned for the beam dump. The

  3. eRHIC ERL modeling in Zgoubi

    Energy Technology Data Exchange (ETDEWEB)

    Meot, F. [Brookhaven National Lab. (BNL), Upton, NY (United States); Brooks, S. [Brookhaven National Lab. (BNL), Upton, NY (United States); Hao, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States); Jing, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ptitsyn, V. [Brookhaven National Lab. (BNL), Upton, NY (United States); Trbojevic, D. [Brookhaven National Lab. (BNL), Upton, NY (United States); Tsoupas, N. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-01-01

    This Note discusses on-going work regarding the modeling of eRHIC ERL in the ray-tracing code Zgoubi. The various pieces of the recirculator puzzle, their optical properties and their assemblage into an operational input data file in are addressed. The Note reports in particular on preparatory stages toward extensive end-to-end 6D polarized electron bunch transport simulations, which yield methods, as well a series of preliminary qualitative outcomes, discussed as well.

  4. Síndrome de Gardner Gardner´s syndrome

    OpenAIRE

    Juan Carlos Quintana Díaz; Rafael Pinilla González; Mayrim Quintana Giralt

    2012-01-01

    El síndrome de Gardner, una variante de la poliposis adenomatosa familiar, es una enfermedad hereditaria autosómica dominante caracterizada por la presencia combinada de múltiples pólipos intestinales y manifestaciones extraintestinales que incluyen osteomas múltiples, tumores del tejido conectivo carcinoma de tiroides hipertrofia del epitelio pigmentado de la retina, también son frecuentes la presencia de dientes supernumerarios retenidos y odontomas. Se presenta un caso clínico de un pacien...

  5. Method for energy recovery of spent ERL beams

    Energy Technology Data Exchange (ETDEWEB)

    Marhauser, Frank; Hannon, Fay; Rimmer, Robert; Whitney, R. Roy

    2018-01-16

    A method for recovering energy from spent energy recovered linac (ERL) beams. The method includes adding a plurality of passive decelerating cavities at the beam dump of the ERL, adding one or more coupling waveguides between the passive decelerating cavities, setting an adequate external Q (Qext) to adjust to the beam loading situation, and extracting the RF energy through the coupling waveguides.

  6. Síndrome de Gardner

    OpenAIRE

    Juan Carlos Quintana Díaz; Rafael Pinilla González; Mayrim Quintana Giralt

    2012-01-01

    El síndrome de Gardner, una variante de la poliposis adenomatosa familiar, es una enfermedad hereditaria autosómica dominante caracterizada por la presencia combinada de múltiples pólipos intestinales y manifestaciones extraintestinales que incluyen osteomas múltiples, tumores del tejido conectivo carcinoma de tiroides hipertrofia del epitelio pigmentado de la retina, también son frecuentes la presencia de dientes supernumerarios retenidos y odontomas. Se presenta un caso clínico de un pacien...

  7. Gardner's Minichess Variant is solved

    OpenAIRE

    Mhalla, Mehdi; Prost, Frederic

    2013-01-01

    A 5x5 board is the smallest board on which one can set up all kind of chess pieces as a start position. We consider Gardner's minichess variant in which all pieces are set as in a standard chessboard (from Rook to King). This game has roughly 9x10^{18} legal positions and is comparable in this respect with checkers. We weakly solve this game, that is we prove its game-theoretic value and give a strategy to draw against best play for White and Black sides. Our approach requires surprisingly sm...

  8. Selected works of Richard P. Stanley

    CERN Document Server

    Stanley, Richard P; Lam, Thomas; Reiner, Victor; Reiner, Victor

    2017-01-01

    Richard Stanley's work in combinatorics revolutionized and reshaped the subject. Many of his hallmark ideas and techniques imported from other areas of mathematics have become mainstays in the framework of modern combinatorics. In addition to collecting several of Stanley's most influential papers, this volume also includes his own short reminiscences on his early years, and on his celebrated proof of The Upper Bound Theorem.

  9. Controls system developments for the ERL facility

    Energy Technology Data Exchange (ETDEWEB)

    Jamilkowski, J.; Altinbas, Z.; Gassner, D.; Hoff, L.; Kankiya, P.; Kayran, D.; Miller, T.; Olsen, R.; Sheehy, B.; Xu, W.

    2011-10-07

    The BNL Energy Recovery LINAC (ERL) is a high beam current, superconducting RF electron accelerator that is being commissioned to serve as a research and development prototype for a RHIC facility upgrade for electron-ion collision (eRHIC). Key components of the machine include a laser, photocathode, and 5-cell superconducting RF cavity operating at a frequency of 703 MHz. Starting with a foundation based on existing ADO software running on Linux servers and on the VME/VxWorks platforms developed for RHIC, we are developing a controls system that incorporates a wide range of hardware I/O interfaces that are needed for machine R&D. Details of the system layout, specifications, and user interfaces are provided.

  10. Ferrite HOM Absorber for the RHIC ERL

    Energy Technology Data Exchange (ETDEWEB)

    Hahn,H.; Choi, E.M.; Hammons, L.

    2008-10-01

    A superconducting Energy Recovery Linac is under construction at Brookhaven National Laboratory to serve as test bed for RHIC upgrades. The damping of higher-order modes in the superconducting five-cell cavity for the Energy-Recovery linac at RHIC is performed exclusively by two ferrite absorbers. The ferrite properties have been measured in ferrite-loaded pill box cavities resulting in the permeability values given by a first-order Debye model for the tiled absorber structure and an equivalent permeability value for computer simulations with solid ring dampers. Measured and simulated results for the higher-order modes in the prototype copper cavity are discussed. First room-temperature measurements of the finished niobium cavity are presented which confirm the effective damping of higher-order modes in the ERL. by the ferrite absorbers.

  11. Revisiting Vygotsky and Gardner: Realizing Human Potential

    Science.gov (United States)

    Beliavsky, Ninah

    2006-01-01

    In this article, the author discusses her views on philosophies and theories by Lev Semenovich Vygotsky and Howard Gardner. Here, she argues that Vygotsky's ideas should be viewed through the prism of Gardner's theory of Multiple Intelligences, and that the combination of these concepts can shed new light on education--on teaching and learning.…

  12. Multiple Intelligences: Gardner's Theory. ERIC Digest.

    Science.gov (United States)

    Brualdi, Amy C.

    This digest discusses the origins of Howard Gardner's Theory of Multiple Intelligences, his definition of intelligence, the incorporation of the theory into the classroom, and its role in alternative assessment practices. Gardner defines intelligence as the "capacity to solve problems or to fashion products that are valued in one or more…

  13. Síndrome de Gardner Gardner´s syndrome

    Directory of Open Access Journals (Sweden)

    Juan Carlos Quintana Díaz

    2012-09-01

    Full Text Available El síndrome de Gardner, una variante de la poliposis adenomatosa familiar, es una enfermedad hereditaria autosómica dominante caracterizada por la presencia combinada de múltiples pólipos intestinales y manifestaciones extraintestinales que incluyen osteomas múltiples, tumores del tejido conectivo carcinoma de tiroides hipertrofia del epitelio pigmentado de la retina, también son frecuentes la presencia de dientes supernumerarios retenidos y odontomas. Se presenta un caso clínico de un paciente masculino, de 20 años de edad que acude a consulta por presentar aumento de volumen en tres localizaciones de la región facial. Radiográficamente se constataron las imágenes radiopacas características del osteoma y con la rectosigmoidescopia la presencia de pólipos intestinales. La intervención quirúrgica de los osteomas se realizó bajo anestesia general que incluyó condilectomía del lado izquierdo. El diagnóstico histopatológico fue de osteoma ebúrneo. Un año después del procedimiento se observó clínicamente recuperación estética y funcional y radiográficamente buena regeneración ósea en al ángulo mandibular donde se encontraba el osteoma de mayor diámetro. El paciente ha tenido hasta la actualidad una evolución muy satisfactoria, con excelente apertura bucal. El objetivo es describir el manejo que se tuvo con un paciente con síndrome de Gardner en el Servicio de Cirugía Maxilofacial de Artemisa.Gardner's syndrome, a variant of familial adenomatous polyposis, is a dominant autosomal inherited disease characterized by multiple intestinal polyps together with extra-intestinal manifestations including multiple osteomas, connective tissue tumors, thyroid carcinomas, hypertrophied pigmented epithelium of the retina, and also frequent retained supernumerary teeth and odontomas. The objective of this paper was to describe the management of a patient with Gardner's syndrome at the maxillofacial surgery service in the province

  14. Síndrome de Gardner

    Directory of Open Access Journals (Sweden)

    Juan Carlos Quintana Díaz

    2012-09-01

    Full Text Available El síndrome de Gardner, una variante de la poliposis adenomatosa familiar, es una enfermedad hereditaria autosómica dominante caracterizada por la presencia combinada de múltiples pólipos intestinales y manifestaciones extraintestinales que incluyen osteomas múltiples, tumores del tejido conectivo carcinoma de tiroides hipertrofia del epitelio pigmentado de la retina, también son frecuentes la presencia de dientes supernumerarios retenidos y odontomas. Se presenta un caso clínico de un paciente masculino, de 20 años de edad que acude a consulta por presentar aumento de volumen en tres localizaciones de la región facial. Radiográficamente se constataron las imágenes radiopacas características del osteoma y con la rectosigmoidescopia la presencia de pólipos intestinales. La intervención quirúrgica de los osteomas se realizó bajo anestesia general que incluyó condilectomía del lado izquierdo. El diagnóstico histopatológico fue de osteoma ebúrneo. Un año después del procedimiento se observó clínicamente recuperación estética y funcional y radiográficamente buena regeneración ósea en al ángulo mandibular donde se encontraba el osteoma de mayor diámetro. El paciente ha tenido hasta la actualidad una evolución muy satisfactoria, con excelente apertura bucal. El objetivo es describir el manejo que se tuvo con un paciente con síndrome de Gardner en el Servicio de Cirugía Maxilofacial de Artemisa.

  15. Accelerator physics in ERL based polarized electron ion collider

    Energy Technology Data Exchange (ETDEWEB)

    Hao, Yue [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.

    2015-05-03

    This talk will present the current accelerator physics challenges and solutions in designing ERL-based polarized electron-hadron colliders, and illustrate them with examples from eRHIC and LHeC designs. These challenges include multi-pass ERL design, highly HOM-damped SRF linacs, cost effective FFAG arcs, suppression of kink instability due to beam-beam effect, and control of ion accumulation and fast ion instabilities.

  16. Superconducting RF Linac Technology for ERL Light Sources

    Energy Technology Data Exchange (ETDEWEB)

    Tennant, Chris

    2005-08-01

    Energy Recovering Linacs (ERLs) offer an attractive alternative as drivers for light sources as they combine the desirable characteristics of both storage rings (high efficiency) and linear accelerators (superior beam quality). Using superconducting RF technology allows ERLs to operate more efficiently because of the inherent characteristics of SRF linacs, namely that they are high gradient-low impedance structures and their ability to operate in the long pulse or CW regime. We present an overview of the physics challenges encountered in the design and operation of ERL based light sources with particular emphasis on those issues related to SRF technology. These challenges include maximizing a cavity's Qo to increase cryogenic efficiency, maintaining control of the cavity field in the presence of the highest feasible loaded Q and providing adequate damping of the higher-order modes (HOMs). If not sufficiently damped, dipole HOMs can drive the multipass beam breakup (BBU) instability which ERLs are particularly susceptible to. Another challenge involves efficiently extracting the potentially large amounts of HOM power that are generated when a bunch traverses the SRF cavities and which may extend over a high range of frequencies. We present experimental data from the Jefferson Lab FEL Upgrade, a 10 mA ERL light source presently in operation, aimed at addressing some of these issues. We conclude with an outlook towards the future of ERL based light sources.

  17. Morgan Stanley viib Eesti maailma / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2007-01-01

    Finantsteenuste pakkuja Morgan Stanley allüksus MSCI Barra kavandab indeksite loomist teiste nn. piiriturgude seas ka Eestile, mis peaks kasvatama välisinvestorite huvi Tallinna börsi vastu. Vt. samas: MSCI Barra. Kommenteerib Tõnis Oja

  18. Education for All: Gardner's Multiple Intelligences Theory

    OpenAIRE

    Gisela Emst-Slavit

    2001-01-01

    In the last years the Theory of the Multiple Intelligences developed by Howard Gardner has had a tremendous impact in elementary and secondary classrooms in the United States. Gardner(1983) defines intelligence as the ability to solve a problem or fashion a product that is valued in one or more cultural settings. His definition expands our understanding of "intelligence" beyond the familiar linguistic and Logical-mathematical intelligences, to include the spatial, musical,bodily-kinesthetic, ...

  19. HIGH-CURRENT ERL-BASED ELECTRON COOLING FOR RHIC.

    Energy Technology Data Exchange (ETDEWEB)

    BEN-ZVI, I.

    2005-09-18

    The design of an electron cooler must take into account both electron beam dynamics issues as well as the electron cooling physics. Research towards high-energy electron cooling of RHIC is in its 3rd year at Brookhaven National Laboratory. The luminosity upgrade of RHIC calls for electron cooling of various stored ion beams, such as 100 GeV/A gold ions at collision energies. The necessary electron energy of 54 MeV is clearly out of reach for DC accelerator system of any kind. The high energy also necessitates a bunched beam, with a high electron bunch charge, low emittance and small energy spread. The Collider-Accelerator Department adopted the Energy Recovery Linac (ERL) for generating the high-current, high-energy and high-quality electron beam. The RHIC electron cooler ERL will use four Superconducting RF (SRF) 5-cell cavities, designed to operate at ampere-class average currents with high bunch charges. The electron source will be a superconducting, 705.75 MHz laser-photocathode RF gun, followed up by a superconducting Energy Recovery Linac (ERL). An R&D ERL is under construction to demonstrate the ERL at the unprecedented average current of 0.5 amperes. Beam dynamics performance and luminosity enhancement are described for the case of magnetized and non-magnetized electron cooling of RHIC.

  20. Education for All: Gardner's Multiple Intelligences Theory

    Directory of Open Access Journals (Sweden)

    Gisela Emst-Slavit

    2001-12-01

    Full Text Available In the last years the Theory of the Multiple Intelligences developed by Howard Gardner has had a tremendous impact in elementary and secondary classrooms in the United States. Gardner(1983 defines intelligence as the ability to solve a problem or fashion a product that is valued in one or more cultural settings. His definition expands our understanding of "intelligence" beyond the familiar linguistic and Logical-mathematical intelligences, to include the spatial, musical,bodily-kinesthetic, naturalist. interpersonal, and intrapersonal intelligences. This new wayof conceptualizing human intelligence has profound implications for educators whose task needs to include the identification and nourishment of the different talents brought by al students.

  1. Cyril Stanley Smith's Translations of Metallurgical Classics

    Indian Academy of Sciences (India)

    The contributions of Cyril Stanley Smith to the science of nonferrous metallurgy and his historic involvement in the de- velopment of the atom bomb are well known. He also was signal in the development of the scholarly field known as the history of technology. Not only did he publish a number of books and papers on the ...

  2. Cyril Stanley Smith's Translations of Metallurgical Classics

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 6. Cyril Stanley Smith's Translations of Metallurgical Classics. Martha Goodway. General Article Volume 11 Issue 6 June 2006 pp 63-66. Fulltext. Click here to view fulltext PDF. Permanent link:

  3. Howard Gardner on Learning for Understanding.

    Science.gov (United States)

    Steinberger, Elizabeth Donohoe

    1994-01-01

    Howard Gardner is known for his theory of multiple intelligences, which holds that each individual's unique smartness cannot be measured by conventional IQ tests. Even the best students have flawed theories about existence and human behavior. Schools teach and assess everybody as though each has the same kind of mind. The ATLAS project respects…

  4. ERL Based Electron-Ion Collider eRHIC

    CERN Document Server

    Litvinenko, Vladimir N; Bai, Mei; Beebe-Wang, Joanne; Ben-Zvi, Ilan; Blaskiewicz, Michael; Brennan, Joseph M; Calaga, Rama; Chang, Xiangyun; Deshpande, Abhay A; Farkhondeh, Manouchehr; Fedotov, Alexei V; Fischer, Wolfram; Kayran, Dmitry; Kewisch, Jorg; MacKay, William W; Montag, Christoph; Parker, Brett; Peggs, Steve; Ptitsyn, Vadim; Roser, Thomas; Ruggiero, Alessandro; Satogata, Todd; Surrow, Bernd; Tepikian, Steven; Trbojevic, Dejan; Yakimenko, Vitaly; Zhang, S Y

    2005-01-01

    We present the designs of a future polarized electron-hadron collider, eRHIC* based on a high current super-conducting energy-recovery linac (ERL) with energy of electrons up to 20 GeV. We plan to operate eRHIC in both dedicated (electron-hadrons only) and parallel(with the main hadron-hadron collisions) modes. The eRHIC has very large tunability range of c.m. energies while maintaining very high luminosity up to 1034 cm-2 s-1 per nucleon. Two of the most attractive features of this scheme are full spin transparency of the ERL at all operational energies and the capability to support up to four interaction points. We present two main layouts of the eRHIC, the expected beam and luminosity parameter, and discuss the potential limitation of its performance.

  5. Skattesagen - Spillet mellem Peter Loft og Erling Andersen

    OpenAIRE

    Christiansen, Cecilie Gorud; Alsawafi, Sara; Jacobsen, Karsten Hald; Knappmann, Camilla

    2014-01-01

    The project investigate the relationship between the two actors Peter Loft and Erling Andersen in the political case known as “skattesagen” and which implications this may have on the Danish central administration, the structure of the Ministry of Taxation and the role of the civil servant. The project utilizes the theoretical approaches of Rational Choice, game theory, and Principal-agent theory in order to investigate the underlying motivation behind the behavior of the actors. Rational Cho...

  6. Generation of Coherent Synchrotron Radiation from JAERI-ERL

    CERN Document Server

    Hajima, R; Kikuzawa, N; Minehara, E J; Nagai, R; Nishitani, T; Sawamura, M

    2005-01-01

    An electron beam with high-average current and short bunch length can be accelerated by energy-recovery linac. Coherent synchrotron radiation (CSR) from such an electron beam will be a useful light source around millimeter wavelength. We report results from a preliminary measurement of CSR emitted from a bending magnet of JAERI-ERL. Possible enhancement of CSR power by FEL micro-bunching is also discussed.

  7. Status of a Plan for an ERL Extension to CESR

    CERN Document Server

    Hoffstaetter, Georg Heinz; Belomestnykh, Sergey; Bilderback, Donald H; Billing, Michael G; Greenwald, Zipi; Gruner, Sol M; Li, Yulin; Liepe, Matthias; Padamsee, Hasan; Sagan, David; Sinclair, Charles K; Smolenski, Karl W; Song, Changsheng; Sung-Hwoon Choi, Joseph; Talman, Richard M; Tigner, Maury

    2005-01-01

    We describe the status of plans to build an Energy-Recovery Linac (ERL) X-ray facility at Cornell University. This 5 GeV ERL is an upgrade of the CESR ring that currently powers the Cornell High Energy Synchrotron Source (CHESS). Due to its very small electron-beam emittances, it would dramatically improve the capabilities of the light source and result in X-ray beams orders of magnitude better than any existing storage ring light source. The emittances are based upon simulations for currents that are competitive with ring-based sources. The ERL design that is presented has to allow for non-destructive transport of these small emittances. The design includes a series of X-ray beamlines for specific areas of research. As an upgrade of the existing storage ring, special attention is given to reuse of many of the existing ring components. Options of bunch compression are discussed, tolerances for emittance growth are specified, and simulations of the beam-breakup instability and methods of increasing its thresho...

  8. Design study of an ERL Test Facility at CERN

    CERN Document Server

    Jensen, E; Brüning, O; Calaga, R; Catalan-Lasheras, N; Goddard, B; Klein, M; Torres-Sanchez, R; Valloni, A

    2014-01-01

    The modern concept of an Energy Recovery Linac allows providing large electron currents at large beam energy with low power consumption. This concept is used in FEL’s, electron-ion colliders and electron coolers. CERN has started a Design Study of an ERL Test Facility with the purpose of 1) studying the ERL principle, its specific beam dynamics and operational issues, as relevant for LHeC, 2) providing a test bed for superconducting cavity modules, cryogenics and integration, 3) studying beam induced quenches in superconducting magnets and protection methods, 4) providing test beams for detector R&D and other applications. It will be complementary to existing or planned facilities and is fostering international collaboration. The operating frequency of 802 MHz was chosen for performance and for optimum synergy with SPS and LHC; the design of the cryomodule has started. The ERL Test Facility can be constructed in stages from initially 150 MeV to ultimately 1 GeV in 3 passes, with beam currents of up to 8...

  9. ER stress inhibitor attenuates hearing loss and hair cell death in Cdh23erl/erl mutant mice.

    Science.gov (United States)

    Hu, Juan; Li, Bo; Apisa, Luke; Yu, Heping; Entenman, Shami; Xu, Min; Stepanyan, Ruben; Guan, Bo-Jhih; Müller, Ulrich; Hatzoglou, Maria; Zheng, Qing Yin

    2016-11-24

    Hearing loss is one of the most common sensory impairments in humans. Mouse mutant models helped us to better understand the mechanisms of hearing loss. Recently, we have discovered that the erlong (erl) mutation of the cadherin23 (Cdh23) gene leads to hearing loss due to hair cell apoptosis. In this study, we aimed to reveal the molecular pathways upstream to apoptosis in hair cells to exploit more effective therapeutics than an anti-apoptosis strategy. Our results suggest that endoplasmic reticulum (ER) stress is the earliest molecular event leading to the apoptosis of hair cells and hearing loss in erl mice. We also report that the ER stress inhibitor, Salubrinal (Sal), could delay the progression of hearing loss and preserve hair cells. Our results provide evidence that therapies targeting signaling pathways in ER stress development prevent hair cell apoptosis at an early stage and lead to better outcomes than those targeting downstream factors, such as tip-link degeneration and apoptosis.

  10. Cell scientist to watch - Lei Stanley Qi.

    Science.gov (United States)

    Bobrowska, Anna

    2016-01-15

    Originally from China, Lei (Stanley) Qi obtained his first degree in physics and mathematics at the Tsinghua University. He then moved to University of California, Berkeley, where he graduated with an MA in physics and worked in the laboratory of Steven Chu, Noble Laureate in Physics (1997), before switching fields to pursue a PhD in bioengineering in the laboratories of Adam Arkin and Jennifer Doudna. Stanley's work earned him the National Institutes of Health Director's Early Independence Award, which allowed him to start his own laboratory at the University of California, San Francisco, as a Systems Biology Fellow without a postdoctoral training period. In 2014, he moved to Stanford, where he is now Assistant Professor at the Department of Bioengineering and of Chemical and Systems Biology, and is affiliated with Stanford Chemistry, Engineering and Medicine for Human Health (ChEM-H). He invented the use of the CRISPR-dCas9 system for transcriptional modulation and genome imaging. His current research is focused on developing new tools and technologies for genome editing and transcriptional modulation, manipulating molecular networks to understand fundamental principles of biology and engineering cells to exhibit desired behaviors, such as teaching immune cells to recognise and eliminate cancers. © 2016. Published by The Company of Biologists Ltd.

  11. HOM identification by bead pulling in the Brookhaven ERL cavity

    CERN Document Server

    Hahn, H; Jain, Puneet; Johnson, Elliott C; Xu, Wencan

    2014-01-01

    Exploratory measurements of the Brookhaven Energy Recovery Linac (ERL) cavity at superconducting temperature produced a long list of high order modes (HOMs). The niobium 5-cell cavity is terminated at each end with HOM ferrite dampers that successfully reduce the Q-factors to levels required to avoid beam break up (BBU) instabilities. However, a number of un-damped resonances with Q≥106 were found at 4 K and their mode identification forms the focus of this paper. The approach taken here consists of bead pulling on a copper (Cu) replica of the ERL cavity with dampers involving various network analyzer measurements. Several different S21 transmission measurements are used, including those taken from the fundamental input coupler to the pick-up probe across the cavity, others between beam-position monitor probes in the beam tubes, and also between probes placed into the cells. The bead pull technique suitable for HOM identification with a metallic needle or dielectric bead is detailed. This paper presents the...

  12. Thermal Calculations Of Input Coupler For Erl Injector

    CERN Document Server

    Sobenin, N P; Bogdanovich, B Yu; Kaminsky, V I; Krasnov, A A; Lalayan, M V; Veshcherevich, V G; Zavadtsev, A A; Zavadtsev, D A

    2004-01-01

    The thermal calculation results of input coupler for ERL injector cavities are presented [1]. A twin coaxial coupler of TTF-3 type was chosen for 2×75 kW RF power transfer. TTF-3 coupler was intended for high pulse and not high average power transmission, so there were revisings proposed in its design. New coupler configuration provides thermal leakage not more than 0.2 W at temperature 2.0K, 2 W at the temperature 4,0K and 50 W at temperature 80K. Construction revising was made at "cold" and "warm" bellows. In particularly, bellows separating was proposed to install additional heat sink. Coupler configuration with "warm" window of choke type was examined. It provides mechanical uncoupling of input waveguide and ceramic insulator. Electrodynamics simulations were carried out by MicroWaveStudio and HFSS codes, thermal analysis was maid using ANSYS.

  13. THE ERL HIGH-ENERGY COOLER FOR RHIC.

    Energy Technology Data Exchange (ETDEWEB)

    BEN-ZVI, I.

    2006-06-23

    Electron cooling [1] entered a new era with the July 2005 cooling of the Tevatron recycler ring [2] at Fermilab, using {gamma} = 9.5. Considering that the cooling rate decreases as faster than {gamma}{sup 2} and the electron energy forces higher electron currents, new acceleration techniques, high-energy electron cooling presents special challenges to the accelerator scientists and engineers. For example, electron cooling of RHIC at collisions requires electron beam energy up to about 54 MeV at an average current of between 50 to 100 mA and a particularly bright electron beam. The accelerator chosen to generate this electron beam is a superconducting Energy Recovery Linac (ERL) with a superconducting RF gun with a laser-photocathode.

  14. Foundations of educational psychology: Howard Gardner's neoclassical psyche.

    Science.gov (United States)

    Diessner, R

    2001-12-01

    This article is a theoretical examination of the implications of Howard Gardner's work in developmental and educational psychology (1983, 1993, 1999a, 1999b) for the structure of the psyche. The author accepts as axiomatic, in the context of this article, Gardner's educational manifesto (1999a) that all students should be taught disciplinary understandings of truth, beauty, and goodness. Rational inferences are then made indicating that the psyche that Gardner intends to educate and help develop is in the form of a neoclassical psyche and that it is structured by the capacities to know truth, to love beauty, and to will goodness.

  15. Stanley N. Cohen - an interview by Judy Peng.

    Science.gov (United States)

    Cohen, Stanley N

    2012-12-01

    Biotechnology Journal talks to Prof. Stanley Cohen after his plenary lecture at the International Biotechnology Symposium, Sept 2012, in Daegu, Korea. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. A virtual reprise of the Stanley Milgram obedience experiments

    National Research Council Canada - National Science Library

    Slater, Mel; Antley, Angus; Davison, Adam; Swapp, David; Guger, Christoph; Barker, Chris; Pistrang, Nancy; Sanchez-Vives, Maria V

    2006-01-01

    Stanley Milgram's 1960s experimental findings that people would administer apparently lethal electric shocks to a stranger at the behest of an authority figure remain critical for understanding obedience...

  17. R&D ERL: Beam dynamics, parameters, and physics to be learned

    Energy Technology Data Exchange (ETDEWEB)

    Kayran, D.

    2010-02-01

    The R&D ERL facility at BNL aims to demonstrate CW operation of ERL with average beam current in the range of 0.1-1 ampere, combined with very high efficiency of energy recovery. The ERL is being installed in one of the spacious bays in Bldg. 912 of the RHIC/AGS complex (Fig. 1). The bay is equipped with an overhead crane. The facility has a control room, two service rooms and a shielded ERL cave. The control room is located outside of the bay in a separate building. The single story house is used for a high voltage power supply for 1 MW klystron. The two-story unit houses a laser room, the CW 1 MW klystron with its accessories, most of the power supplies and electronics. The ERL R&D program has been started by the Collider Accelerator Department (C-AD) at BNL as an important stepping-stone for 10-fold increase of the luminosity of the Relativistic Heavy Ion Collider (RHIC) using relativistic electron cooling of gold ion beams with energy of 100 GeV per nucleon. Furthermore, the ERL R&D program extends toward a possibility of using 10-20 GeV ERL for future electron-hadron/heavy ion collider, MeRHIC/eRHIC. These projects are the driving force behind the development of ampere-class ERL technology, which will find many applications including light sources and FELs. The intensive R&D program geared towards the construction of the prototype ERL is under way: from development of high efficiency photo-cathodes to the development of new merging system compatible with emittance compensation.

  18. USA suursaadik : toetame Eestit / Stanley Davis Phillips ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2007-01-01

    USA suursaadik Eestis Stanley Davis Phillips vastab küsimustele, mis puudutavad USA positsiooni Tõnismäe pronkssõduri suhtes, Eesti saatkonna piiramist Moskvas, USA ja Venemaa suhteid ning koostööd, sõda terrorismiga, USA kava paigutada Tšehhi ja Poolasse raketitõrjebaasid, Eesti presidendi Toomas Hendrik Ilvese visiiti USAsse. Lisa: Stanley Davis Phillips. Ilmunud ka: Postimees : na russkom jazõke 16. mai lk. 5

  19. Dynamical systems theory for the Gardner equation

    Science.gov (United States)

    Saha, Aparna; Talukdar, B.; Chatterjee, Supriya

    2014-02-01

    The Gardner equation ut+auux+bu2ux+μuxxx=0 is a generic mathematical model for weakly nonlinear and weakly dispersive wave propagation when the effects of higher-order nonlinearity become significant. Using the so-called traveling wave ansatz u (x,t)=φ(ξ), ξ =x-vt (where v is the velocity of the wave) we convert the (1+1)-dimensional partial differential equation to a second-order ordinary differential equation in ϕ with an arbitrary constant and treat the latter equation by the methods of the dynamical systems theory. With some special attention on the equilibrium points of the equation, we derive an analytical constraint for admissible values of the parameters a, b, and μ. From the Hamiltonian form of the system we confirm that, in addition to the usual bright soliton solution, the equation can be used to generate three different varieties of internal waves of which one is a dark soliton recently observed in water [A. Chabchoub et al., Phys. Rev. Lett. 110, 124101 (2013), 10.1103/PhysRevLett.110.124101].

  20. Optics correction for the multi-pass FFAG ERL machine eRHIC

    Energy Technology Data Exchange (ETDEWEB)

    Liu, C. [Brookhaven National Lab. (BNL), Upton, NY (United States); Brooks, S. [Brookhaven National Lab. (BNL), Upton, NY (United States); Litvinenko, V. [Brookhaven National Lab. (BNL), Upton, NY (United States); Minty, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ptitsyn, V. [Brookhaven National Lab. (BNL), Upton, NY (United States); Trbojevic, D. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2015-05-03

    Gradient errors in the multi-pass Fixed Field Alternating Gradient (FFAG) Energy Recovery Linac (ERL) machine, eRHIC, distort the beam orbit and therefore cause emittance increase. The localization and correction of gradient errors are essential for an effective orbit correction and emittance preservation. In this report, the methodology and simulation of optics correction for the multi-pass FFAG ERL machine eRHIC will be presented.

  1. Learners Test Performance and Gardner`s MI Theory: Intercorrelation in a Bilingual Context

    Directory of Open Access Journals (Sweden)

    Bagher Azarmi

    2012-05-01

    Full Text Available Although decisions and inferences made based on test scores depend both on the characteristics of test takers and testing environment, the former seems to have the most overriding importance. The present study which was conducted in a bilingual environment is in line with this assumption and is aimed at investigating intelligence as one of the test taker characteristics. First, it aimed at finding the possible correlation between any of the eight types of intelligences in Gardner`s MI theory and EAP test performance. Second, it intended to survey the intercorrelation
    among the eight types of intelligences themselves. To that end, 122 male bilingual EFL learners who were all sophomore university students were chosen as the participants of the study. They sat for the final EAP exam and filled the questionnaire on multiple intelligence. The test takers' scores on EAP exam were correlated with their multiple intelligences. The result did not demonstrate any statistically significant go-togetherness between EAP test performance and any types of intelligence; however, a significantly positive correlation was observed among the eight types of
    intelligences themselves showing that all types of intelligences are equally important and ought to be equally dealt with in EFL context.

  2. High power RF systems for the BNL ERL project

    Energy Technology Data Exchange (ETDEWEB)

    Zaltsman, A.; Lambiase, R.

    2011-03-28

    The Energy Recovery Linac (ERL) project, now under construction at Brookhaven National Laboratory, requires two high power RF systems. The first RF system is for the 703.75 MHz superconducting electron gun. The RF power from this system is used to drive nearly half an Ampere of beam current to 2 MeV. There is no provision to recover any of this energy so the minimum amplifier power is 1 MW. It consists of 1 MW CW klystron, transmitter and power supplies, 1 MW circulator, 1 MW dummy load and a two-way power splitter. The second RF system is for the 703.75 MHz superconducting cavity. The system accelerates the beam to 54.7 MeV and recovers this energy. It will provide up to 50 kW of CW RF power to the cavity. It consists of 50 kW transmitter, circulator, and dummy load. This paper describes the two high power RF systems and presents the test data for both.

  3. Obituary: Geoffrey Gardner Douglass, 1942-2005

    Science.gov (United States)

    Mason, Brian D.; Hartkopf, William; Corbin, Thomas

    2005-12-01

    Geoffrey Gardner Douglass passed away on 15 February 2005, following a long illness. Geoff was born 11 June 1942 in Rocky River, Ohio, and grew up there with a passion for science, theatre, and pets. He attended the nearby Case Institute of Technology (Cleveland, Ohio) before coming to the U.S. Naval Observatory on 28 April 1967. He worked at the USNO for over 30 years, until his retirement in January 1999. He was involved in the observing and measurement of parallax and double star plates on the SAMM and MANN measuring engines, and was stationed at Blenheim, New Zealand from 1985-1988 working at the Black Birch site on the Twin Astrograph Telescope. While there he and his wife Doris travelled extensively throughout New Zealand and Australia, He later worked with an early iteration of the USNO StarScan measuring machine. However, most of his work involved observations of visual double stars with the USNO 26-inch Clark Refractor, collaborating with F.J. ("Jerry") Josties on the photographic program in the late 1960s to the development of the USNO's speckle interferometry program throughout the 1990s. Geoff collaborated closely with Charles Worley from 1968 until Charles's death in December 1997, writing much of the double star software and assisting in the production of the USNO's double star catalogs. This was a period of transition, when some 200,000 punch cards of the Lick IDS (Index Catalog of Double Stars) were transferred from Lick Observatory to the USNO, then converted to magnetic tape. This ultimately resulted in the 1984 WDS catalog (currently maintained online). It was often joked that the "W" and "D" in the WDS (officially the "Washington Double Star" catalog) really stood for "Worley" and "Douglass." The "Curmudgeon" and the "Dour Scot" were a team for nearly thirty years. Geoff's first observation, of BU 442, was made 2 June 1967 with the USNO double star (photographic) camera, and his last, STF 342, was made on 28 November 1998 with the USNO speckle

  4. A new Squirrel from the Stanley-falls

    NARCIS (Netherlands)

    Jentink, F.A.

    1906-01-01

    This beautiful greenish tinged Squirrel has been procured by Mr. G. J. A. Pool at the Stanley-falls, Congostate, in August 1905; Professor Dr. A. A. W. Hubrecht (Utrecht) had the kindness as to present it to our National Museum. It apparently is an animal belonging to a hitherto undescribed species;

  5. Lööme kaasa! / Stanley Davis Phillips

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2008-01-01

    USA Eesti-suursaadik Stanley Davis Phillips ütleb, et nad on saatkonnas moodustanud meeskonna, mis koosneb ameeriklastest kui ka eestlastest, et liituda üleriigilise ebaseaduslike prügilate likvideerimise üritusega "Teeme ära 2008"

  6. G. Stanley Hall's Adolescence: A centennial reappraisal introduction.

    Science.gov (United States)

    Arnett, Jeffrey Jensen; Cravens, Hamilton

    2006-08-01

    This article is an overview of the special issue "G. Stanley Hall's Adolescence: A Centennial Reappraisal." First, a brief biography of Hall is presented. Then each of the six articles in the special issue is summarized. Three of the articles are by historians and three are by psychologists, but all six articles integrate history and psychology.

  7. Obstructive Sleep Apnoea | Gardner | South African Family Practice

    African Journals Online (AJOL)

    South African Family Practice. Journal Home · ABOUT · Advanced Search · Current Issue · Archives · Journal Home > Vol 56, No 2 (2014) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Obstructive Sleep Apnoea. BM Gardner. Abstract. No Abstract. Full Text:.

  8. An Analysis of Gardner's Theory of Multiple Intelligence.

    Science.gov (United States)

    Morgan, Harry

    The theory of multiple intelligence (MI) propounded by Gardner and Hatch suggests that human beings have seven distinct units of intellectual functioning, and that these units are actually separate intelligences with their own observable and measurable abilities. These intelligences were identified as logical-mathematical, linguistic, musical,…

  9. Eight Biblical Interactive Learning Centers (Based on Gardner's Multiple Intelligences).

    Science.gov (United States)

    Goldstein, Semadar

    This report describes how to implement Howard Gardner's multiple intelligences (MI) into Israel's Tanakh classrooms and includes samples of implemented materials. It also notes goals and obstacles encountered during this process and how they were overcome. To illustrate this process, the report provides an overview of Tanakh-centered activities…

  10. Solitary wave solution to a singularly perturbed generalized Gardner ...

    Indian Academy of Sciences (India)

    2017-03-24

    Mar 24, 2017 ... Abstract. This paper is concerned with the existence of travelling wave solutions to a singularly perturbed gen- eralized Gardner equation with nonlinear terms of any order. By using geometric singular perturbation theory and based on the relation between solitary wave solution and homoclinic orbits of the ...

  11. The Importance of Early Diagnosis of Gardner's syndrome in Dental ...

    African Journals Online (AJOL)

    2018-02-07

    Feb 7, 2018 ... body on clinical examination. In addition, there were no extraoral or intraoral findings such as swelling, stiffness, or evidence of facial asymmetry related to the lesions. [Figure 2b] and he did not complain of any symptoms. Case Report. INTRODUCTION. Gardner syndrome (GS) is a rare genetic disorder.

  12. Solitary wave solution to a singularly perturbed generalized Gardner ...

    Indian Academy of Sciences (India)

    This paper is concerned with the existence of travelling wave solutions to a singularly perturbed generalized Gardner equation with nonlinear terms of any order. By using ... X Q YANG1. Nonlinear Scientific Research Center, Faculty of Science, Jiangsu University, Zhenjiang, Jiangsu, 212013, People's Republic of China ...

  13. On the ill-posedness of the Gardner equation

    DEFF Research Database (Denmark)

    Alejo Plana, Miguel Angel

    2012-01-01

    We present ill-posedness results for the initial value problem (IVP) for the Gardner equation. We measure the regularity of the Cauchy problem in the classical Sobolev spaces Hs, and show the critical Sobolev index under which the local well-posedness of the problem is not present, in the sense...

  14. Obituary: David Stanley Evans, 1916-2004

    Science.gov (United States)

    Bash, Frank N.

    2005-12-01

    David Stanley Evans died on 14 November 2004 in Austin, Texas. He was a noted observational astronomer whose career was divided between South Africa and Texas. He also used the extensive historical collections at the University of Texas to write several books on the history of astronomy. He was born in Cardiff, Wales on 28 January 1916. David received his BA degree in mathematics in 1937 from Kings College, Cambridge. He became a PhD student at Cambridge Observatory in 1937, and was one of Sir Arthur Eddington's last surviving students. He received his PhD degree in 1941 with a dissertation entitled, "The Formation of the Balmer Series of Hydrogen in Stellar Atmospheres." He was a conscientious objector to war and, thus, spent the war years at Oxford working with physicist Kurt Mendelssohn on medical problems, involving cadavers, relating to the war. During these years, David was scientific editor of "Discovery", and he was editor of "The Observatory". David left England in 1946 in order to take up the position of Second Assistant at the Radcliffe Observatory, Pretoria, South Africa. He and H. Knox Shaw were the entire staff after R. O. Redman left, and they aluminized and installed the mirrors in the 74-inch telescope. His notable scientific contribution was to use lunar occultations to measure stellar angular diameters during the 1950s. He succeeded in determining the angular diameter of Antares and determined that Arcturus was not circular but had an elliptical shape. The elliptical shape was later shown to be an instrumental artifact, but the utility of using lunar occultations to measure stellar diameters and stellar multiplicity was conclusively demonstrated. T. Gold presented David's paper on lunar occultation angular diameters at the January 1953 meeting of the Royal Astronomical Society. For the rest of his life, David resented Gold's remarks, because he felt that he had been ridiculed. By 1953, David Evans was Chief Assistant at the Royal Observatory

  15. Learners Test Performance and Gardner`s Multiple Inteligence Theory: Intercorrelation in a Bilingual Context

    Directory of Open Access Journals (Sweden)

    Bagher Azarmi

    2015-03-01

    Full Text Available Although decisions and inferences made based on test scores depend both on the characteristics of test takers and testing environment, the former seems to have the most overridingimportance. The present study which was conducted in a bilingual environment is in line with this assumption and is aimed at investigating intelligence as one of the test taker characteristics. First, it aimed at finding the possible correlation between any of the eight types of intelligences in Gardner`s MI theory and EAP test performance. Second, it intended to survey the intercorrelationamong the eight types of intelligences themselves. To that end, 122 male bilingual EFL learners who were all sophomore university students were chosen as the participants of the study. They satfor the final EAP exam and filled the questionnaire on multiple intelligence. The test takers' scores on EAP exam were correlated with their multiple intelligences. The result did not demonstrate anystatistically significant go-togetherness between EAP test performance and any types of intelligence; however, a significantly positive correlation was observed among the eight types of intelligences themselves showing that all types of intelligences are equally important and ought to be equally dealt with in EFL context.

  16. Stanley Park, Literary Ecology, and the Making of Sustainability

    OpenAIRE

    Drennig, Georg

    2015-01-01

    1. Introduction The study of urban systems and the role of cities in debates about sustainability is a fashionable topic in numerous fields in academia, with the need for interdisciplinary research being a much-voiced aspect of such academic interest. Yet the contributions of the humanities and the study of culture to these debates stay within the respective disciplines of studying literature and popular culture. In the following reading of Timothy Taylor’s 2001 novel Stanley Park, I intend t...

  17. A Virtual Reprise of the Stanley Milgram Obedience Experiments

    OpenAIRE

    Mel Slater; Angus Antley; Adam Davison; David Swapp; Christoph Guger; Chris Barker; Nancy Pistrang; Sanchez-Vives, Maria V.

    2006-01-01

    Background. Stanley Milgram's 1960s experimental findings that people would administer apparently lethal electric shocks to a stranger at the behest of an authority figure remain critical for understanding obedience. Yet, due to the ethical controversy that his experiments ignited, it is nowadays impossible to carry out direct experimental studies in this area. In the study reported in this paper, we have used a similar paradigm to the one used by Milgram within an immersive virtual environme...

  18. Combinatorial Reductions for the Stanley Depth of I and S/I

    Energy Technology Data Exchange (ETDEWEB)

    Keller, Mitchel T.; Young, Stephen J.

    2017-09-07

    We develop combinatorial tools to study the realtionship between the Stanley depth of a monomial ideal I and the Stanley depth of its compliment S/I. Using these results we prove that if S is a polynomial ring with at most 5 indeterminates and I is a square-free monomial ideal, then the Stanley depth of I is strictly larger than the Stanley depth of S/I. Using a computer search, we extend the strict inequality to the case of polynomial rings with at most 7 indeterminates. This partially answers questinos asked by Proescu and Qureshi as well as Herzog.

  19. The ERL-based Design of Electron-Hadron Collider eRHIC

    Energy Technology Data Exchange (ETDEWEB)

    Ptitsyn, Vadim [et al.

    2016-06-01

    Recent developments of the ERL-based design of future high-luminosity electron-hadron collider eRHIC focused on balancing technological risks present in the design versus the design cost. As a result a lower risk design has been adopted at moderate cost increase. The modifications include a change of the main linac RF frequency, reduced number of SRF cavity types and modified electron spin transport using a spin rotator. A luminosity-staged approach is being explored with a Nominal design ($L \\sim 10^{33} {\\rm cm}^2 {\\rm s}^{-1}$) that employs reduced electron current and could possibly be based on classical electron cooling, and then with the Ultimate design ($L \\gt 10^{34} {\\rm cm}^{-2} {\\rm s}^{-1}$) that uses higher electron current and an innovative cooling technique (CeC). The paper describes the recent design modifications, and presents the full status of the eRHIC ERL-based design.

  20. An FFAG-ERL at Cornell University for eRHIC prototyping and bright-beam applications

    Energy Technology Data Exchange (ETDEWEB)

    Hoffstaetter, Georg [Cornell University, Ithaca, NY (United States)

    2016-07-01

    Cornell University has prototyped technology essential for any high-brightness electron ERL. This includes a DC gun and an SRF injector Linac with world-record current and normalized brightness in a bunch train, a high-current CW cryomodule for 70 MeV energy gain, a high-power beam stop, and several diagnostics tools for high-current and high-brightness beams, e.g. slid measurements for 6-D phase-space densities, a fast wire scanner for beam profiles, and beam loos diagnostics. All these are now available to equip a one-cryomodule ERL, and laboratory space has been cleared out and is radiation shielded to install this ERL at Cornell. BNL has designed a multi-turn ERL for eRHIC, where beam is transported more than 20 times around the RHIC tunnel. The number of transport lines is minimized by using two non-scaling (NS) FFAG arcs. A collaboration between BNL and Cornell has been formed to investigate the new NS-FFAG optics and the multi-turn eRHIC ERL design by building a 4-turn, one-cryomodule ERL at Cornell. It has a NS-FFAG return loop built with permanent magnets and is meant to accelerate 40 mA beam to 250 MeV.

  1. [Ectopic craniopharyngioma and Gardner's syndrome: Case report and literature review].

    Science.gov (United States)

    Álvarez Salgado, Juan Antonio; González-Llanos Fernández de Mesa, Francisco; Villaseñor Ledezma, Jorge Javier; Cañizares Méndez, Maria de Los Angeles; Paredes Sansinenea, Igor; Rodríguez de Lope-Llorca, Angel; Mollejo Villanueva, Manuela

    Craniopharyngioma accounts for around 3% of all primary tumours of the central nervous system. It is usually located in the suprasellar region, although it may also have an ectopic location. The case is presented on 29 year-old male who underwent surgery for a jaw osteoma when he was 19 years old and was subsequently diagnosed with Gardner's syndrome. He was admitted in our Hospital with right facial paresis and diplopia of one day onset. The examination showed mild right VII and VI cranial nerves paresis. Magnetic resonance imaging of the brain demonstrated a rounded solid and cystic lesion with well-defined contours of about 2cm in diameter filling the fourth ventricle. The patient underwent a posterior fossa craniotomy using a telovelar approach with complete removal of the tumour implanted at roof level of the fourth ventricle. The final histology of the tumour was reported as adamantinomatous craniopharyngioma. Craniopharyngioma may appear in another location other than the suprasellar region. Its atypical location may be related to Gardner syndrome by still unknown pathogenic mechanisms. Copyright © 2016 Sociedad Española de Neurocirugía. Publicado por Elsevier España, S.L.U. All rights reserved.

  2. Howard Gardner: Knowledge, Learning and Development in Drama and Arts Education.

    Science.gov (United States)

    Roper, Bill; Davis, David

    2000-01-01

    Notes that Howard Gardner's theory of Multiple Intelligences (MI) has afforded support to educators and parents who want to see their children as equals no matter in what area of ability they develop competence. Explains the usefulness of Gardner's approach, based on Kantian notions of the power of mind to give order to the world. Discusses the…

  3. Simplifying Gardner's Labyrinth: The Role of Interpersonal Relationships in Pablo Picasso's Artistic Development

    Science.gov (United States)

    Gupta, Anoop

    2012-01-01

    An attempt is made to demonstrate if not the dispensability of Gardner's (1983) theory of multiple intelligences, at least that it is not foundational, to understanding what motivated Picasso's creative development. Gardner used the theory of multiple intelligences to account for the extraordinariness of various figures, including Picasso, who is…

  4. Stanley Fish, Chi ha paura di Wolfgang Iser?

    Directory of Open Access Journals (Sweden)

    Laura Massari

    2011-12-01

    Full Text Available Presentiamo qui la traduzione del saggio di Stanley Fish, Why no one’safraid of Wolfgang Iser, pubblicato nel numero di Marzo 1981 della rivista Diacritics. L’articolo fu scritto in risposta all’intervista a Wolfgang Iser, pubblicata nel numero precedente della stessa rivista, ma prende spunto per lo più da una delle massime opere di Iser, ovvero L’atto di lettura. Una teoria della risposta estetica (Il Mulino, Bologna, 1987. In esso l’autore valuta, critica e confuta molti dei capisaldi della teoria letteraria iseriana, a partire dalla natura ontologica degli agenti coinvolti nell’atto di lettura, fino all’esame fenomenologico  dell’interpretazione, che Fish applica sia al testo letterario che alla percezione del mondo reale.

  5. Reply to J M Stanley: fiddling and clarity.

    Science.gov (United States)

    Gillett, Grant

    1987-03-01

    The author responds to John M. Stanley's criticism ("More fiddling with the definition of death?" Journal of Medical Ethics 1987 Mar; 13(1): 21-22) and clarifies the arguments in his own previous article ("Why let people die?" Journal of Medical Ethics 1986 Jun; 12(2): 83-86). Gillett contends that we must decide what ethical stance we should adopt toward the living but nonsentient, devoid of personhood, human bodies that are distinguishable from human persons and from human cadavers. He argues that once human beings no longer participate in the world of persons, have no intentional interests, sentience, or a degree of sapience, their legal interests are void also. He reiterates that a human organism irrevocably stripped of personal being is no longer "in an ethically interesting sense, alive" but that the former person's body is alive and has a definite but distinct ethical status.

  6. Archetypal Anxieties in Stanley Kubrick’s The Shining

    Directory of Open Access Journals (Sweden)

    Ya-huei Wang

    2011-01-01

    Full Text Available The study intends to study the archetypal anxieties in Stanley Kubrick’s (1980 The Shining, which can be interpreted as Danny’s journey for the completion of his individualization process. In his individualization process, Danny has to go through the anxieties often seen in fairytales, such as separation anxieties, authoritarian anxieties, Oedipal rivalry anxieties, and sexual anxieties, in order to acquire his autonomy. The Overlook Hotel becomes symbolic of collective human evil, being charged with evil spirits. Only those who refused to identify themselves as victims would escape from the evil history of the hotel and would not be transformed into a homicidal maniac, pouring their anger to their families.

  7. Carl Gustav Jung and Granville Stanley Hall on Religious Experience.

    Science.gov (United States)

    Kim, Chae Young

    2016-08-01

    Granville Stanley Hall (1844-1924) with William James (1842-1910) is the key founder of psychology of religion movement and the first American experimental or genetic psychologist, and Carl Gustav Jung (1875-1961) is the founder of the analytical psychology concerned sympathetically about the religious dimension rooted in the human subject. Their fundamental works are mutually connected. Among other things, both Hall and Jung were deeply interested in how the study of religious experience is indispensable for the depth understanding of human subject. Nevertheless, except for the slight indication, this common interest between them has not yet been examined in academic research paper. So this paper aims to articulate preliminary evidence of affinities focusing on the locus and its function of the inner deep psychic dimension as the religious in the work of Hall and Jung.

  8. [Gardner syndrome--parent alienation syndrome (PAS). Diagnosis or family reality?].

    Science.gov (United States)

    Namysłowska, Irena; Heitzman, Janusz; Siewierska, Anna

    2009-01-01

    The authors present characteristics of Parental Alienation Syndrome (PAS) proposed by Gardner as well as data, which may help to differentiate that syndrome with real psychological, physical and sexual abuse. The consequences of Gardner Syndrome for legal decisions in the court cases of child custody and the critique of this syndrome in forensic and psychiatric literature are also discussed, and several questions posed. Authors propose to treat Gardner Syndrome not as as a child disorder but as a specific, dynamic family situation, which occurs sometimes, during divorce and fight about child custody.

  9. Design of the SRF Driver ERL for the Jefferson Lab UV FEL

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, David R; Benson, Stephen; Biallas, George; Blackburn, Keith; Boyce, James; Bullard, Donald; Coleman, James; Dickover, Cody; Ellingsworth, Forrest; Evtushenko, Pavel; Gould, Christopher; Gubeli, Joseph; Hannon, Fay; Hardy, David; Hernandez-Garcia, Carlos; Jordan, Kevin; Klopf, Michael; Kortze, James; Marchlik, Matthew; Moore, Steven; Neil, George; Powers, Thomas; Sexton, Daniel; Shinn, Michelle D; Tennant, Christopher; Walker, Richard; Wilson, Frederick; Zhang, Shukui

    2011-03-01

    We describe the design of the SRF Energy-Recovering Linac (ERL) providing the CW electron drive beam at the Jefferson Lab UV FEL. Based on the same 135 MeV linear accelerator as and sharing portions of the recirculator with the Jefferson Lab 10 kW IR Upgrade FEL, the UV driver ERL uses a novel bypass geometry to provide transverse phase space control, bunch length compression, and nonlinear aberration compensation (including correction of RF curvature effects) without the use of magnetic chicanes or harmonic RF. Stringent phase space requirements at the wiggler, low beam energy, high beam current, and use of a pre-existing facility and legacy hardware subject the design to numerous constraints. These are imposed not only by the need for both transverse and longitudinal phase space management, but also by the potential impact of collective phenomena (space charge, wakefields, beam break-up (BBU), and coherent synchrotron radiation (CSR)), and by interactions between the FEL and the accelerator RF system. This report addresses these issues and presents the accelerator design solution that is now in operation.

  10. Aperture Test for Internal Target Operation in the JLAB High-current ERL

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Shukui

    2013-06-01

    A high current beam transmission test has been successfully completed at the JLAB FEL Facility, culminating in very low-loss transmission of a high current CW beam through a small aperture. The purpose of this test was to determine if an ERL is capable of meeting the stringent requirements imposed by the use of a 1018/cm3 internal gas target proposed for the DarkLight experiment*. Minimal beamline modifications were made to create a machine configuration that is substantially different from those used in routine UV or IR FEL operation. A sustained (8 hour) high power beam run was performed, with clean transmission through a 2 mm transverse aperture of 127 mm length simulating the target configuration. A beam size of 50 um (rms) was measured near the center of the aperture. Experimental data from a week-long test run consistently exhibited beam loss of only a few ppm on the aperture while running 4.5 mA current at 100 MeV -- or nearly 0.5 MW beam power. This surpassed the users? expectation and demonstrated a unique capability of an ERL for this type of experiments. This report presents a summary of the experiment, a brief overview of our activities, and outlines future plans.

  11. Gardner syndrome associated with multiple osteomas, intestinal polyposis, and epidermoid cysts

    Energy Technology Data Exchange (ETDEWEB)

    Koh, Kwang Joon; Park, Ha Na; Kim, Kyoung A [Dept. of Oral and Maxillofacial Radiology, School of Dentistry and Institute of Oral Bioscience, Chonbuk National University, Jeonju (Korea, Republic of)

    2016-12-15

    Gardner syndrome is known as a variant of familial adenomatous polyposis. This syndrome is characterized by multiple intestinal polyposes, osteomas, and epidermoid cysts. In addition, dental abnormalities include an increased frequency of multiple odontomas, as well as supernumerary and impacted teeth. The authors report the case of a 7-year-old male patient with Gardner syndrome. Radiographic findings revealed multiple osteomas in both sides of the maxilla, multiple diffuse enostoses in both jaws, and a complex odontoma in the left mandibular body. Two years later, multiple epidermoid cysts on the scalp were found. Since this patient was suspected to have Gardner syndrome, the authors recommended gastrointestinal endoscopy to check for intestinal polyposis. Gastrointestinal endoscopic examination revealed multiple polyposes in the upper gastrointestinal tract and fundus of the stomach. As a result, the final diagnosis was Gardner syndrome.

  12. CRED REA Fish Team Belt Transect Surveys at Gardner Pinnacle 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Belt transects along 3 consecutively-placed, 25m transect lines were surveyed as part of Rapid Ecological Assessments conducted at 3 sites at Gardner Pinnacle in...

  13. CRED REA Coral Population Parameters at Gardner Pinnacles, Northwestern Hawaiiian Islands, 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Belt transects along 2 consecutively-placed, 25m transect lines were surveyed as part of Rapid Ecological Assessments conducted at 3 sites at Gardner Pinnacles in...

  14. Correspondence of the Gardner and van Genuchten/Mualem relativepermeability function parameters

    Energy Technology Data Exchange (ETDEWEB)

    Ghezzehei, Teamrat A.; Kneafsey, Timothy J.; Su, Grace W.

    2007-01-03

    The Gardner and van Genuchten models of relativepermeability are widely used in analytical and numerical solutions toflow problems. However, the applicab ility of the Gardner model to realproblems is usually limited, because empirical relative permeability datato calibrate the model are not routinely available. In contrast, vanGenuchten parameters can be estimated using more routinely availablematric potential and saturation data. However, the van Genuchten model isnot amenable to analytical solutions. In this paper, we introducegeneralized conversion formulae that reconcile these two models. Ingeneral, we find that the Gardner parameter alpha G is related to the vanGenuchten parameters alpha vG and n by alpha G=alpha vG ~; 1:3 n. Thisconversion rule will allow direct recasting of Gardner-based analyticalsolutions in the van Genuchten parameter space. The validity of theproposed formulae was tested by comparing the predicted relativepermeability of various porous media with measured values.

  15. CRED REA Algal Assessments, Gardner Pinnacles, Northwestern Hawaiian Islands 2003 (NODC Accession 0010352)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Twelve quadrats were sampled along 2 consecutively-placed, 25m transect lines as part of Rapid Ecological Assessments conducted at 3 sites at Gardner Pinnacles in...

  16. CRED REA Algal Assessments, Gardner Pinnacles, Northwestern Hawaiian Islands 2004 (NODC Accession 0010352)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Twelve quadrats were sampled along 2 consecutively-placed, 25m transect lines as part of Rapid Ecological Assessments conducted at 3 sites at Gardner Pinnacles in...

  17. CRED REA Coral Health and Disease Assessment at Gardner Pinnacles, Northwestern Hawaiian Islands, 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — One, 25-m line transect was surveyed at 50-cm intervals as part of the Rapid Ecological Assessment conducted at 3 sites at Gardner Pinnacles in the Northwestern...

  18. CRED 20 m Gridded bathymetry of Gardner Pinnacles, Northwestern Hawaiian Islands, USA (NetCDF format)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry (20m) of the shelf and slope environments of Gardner Pinnacles, Northwestern Hawaiian Islands, Hawaii, USA. This netCDF includes multibeam...

  19. A Study of Adler's Personality Theory in Chris Gardner's Character in the Pursuit of Happyness Movie

    OpenAIRE

    APRIYANSYAH, VEGI

    2013-01-01

    Keywords: inferiority, superiority, Adler's personality theory It can not be denied that within every individual there is feeling that can not be avoided. This feeling can lead us to be successful person or even be people who are desperate and sinking. That feeling is called inferiority by Adler. Referring to this, the writer undertook a study of Adler's personality theory in Chris Gardner character in The Pursuit of Happyness movie. This film is based on true story of Chris Gardner who succe...

  20. G. Stanley Hall, Child Study, and the American Public.

    Science.gov (United States)

    Young, Jacy L

    2016-01-01

    In the final decades of the 19th century psychologist Granville Stanley Hall was among the most prominent pedagogical experts in the nation. The author explores Hall's carefully crafted persona as an educational expert, and his engagements with the American public, from 1880 to 1900, arguably the height of his influence. Drawing from accounts of Hall's lecture circuit in the popular press, a map of his talks across the nation is constructed to assess the geographic scope of his influence. These talks to educators on the psychology underlying childhood and pedagogy, and his views and research on child life more generally, were regularly discussed in newspapers and popular periodicals. The venues in which Hall's ideas were disseminated, discussed, and in some cases, dismissed are described. His efforts to mobilize popular support for, and assistance with, his research endeavors in child study are also discussed. Such efforts were controversial both within the burgeoning field of psychology and among the public. Through his various involvements in pedagogy, and concerted efforts to engage with the American public, Hall helped establish psychology's relevance to parenting and educational practices.

  1. PEMIKIRAN HOWARD GARDNER DALAM PENDIDIKAN ANAK USIA DINI

    Directory of Open Access Journals (Sweden)

    Muhibuddin Fadhli

    2016-12-01

    Full Text Available Promises independence Indonesia has spoken by the agents of history, one promise is the co-educating the nation, of course, those promises have not been fully met, that generation has passed, but not with the spoken promise, that promise will remain imprinted in the minds of the generations thereafter , we have to participate repay the appointment, although mouth did not give yet a calling of souls who move the hearts and minds to intervene to guide the realization of this promise. By nature children are born with millions of uniqueness, even children are not always visible twins are similar in all respects, be aware that the duty to educate children inherent in every human being, to educate is to lead children and all human beings are born to be a leader. Educating is not the work, especially of that educating should be higher than just earn money, educate should be fair, be understandable, and brought the child to the noble human decency. This article will discuss educating children in terms of various aspects of the philosophical and theoretical thinking by Howard Gardner

  2. FERRITE-LINED HOM ABSORBER FOR THE E-COOL ERL

    Energy Technology Data Exchange (ETDEWEB)

    HAHN,H.

    2007-06-25

    An R&D Energy Recovery Linac (ERL) intended as step towards electron-cooling of RHIC-II is being constructed at this laboratory. The center piece of the project is the experimental 5-cell 703.75 MHz superconducting ECX cavity. Successful operation will depend on effective NOM suppression, and it is planned to achieve NOM damping exclusively with room temperature ferrite absorbers. A ferrite-lined pillbox test model with dimensions reflecting the operational unit was assembled and attached to the 5-cell copper cavity. The cavity resonances of the lowest dipole and monopole modes and their damping due to the ferrite were determined. The effective ferrite properties in a form portable to other structures were obtained from network analyzer measurements of the ferrite absorber models and their interpretation with the simulation code Microwave Studio.

  3. Design of ERL Spoke Cavity For Non-Destructive Assay Research

    Science.gov (United States)

    Sawamura, M.; Nagai, R.; Nishimori, N.; Hajima, R.

    2015-10-01

    We are proposing non-destructive assay system of nuclear materials with laser Compton scattering combined with an energy-recovery linac (ERL) and a laser. Since constructing accelerator system for nuclear safe guard and security requires small cavities, spoke cavities have many advantages such as shortening the distance between cavities, small frequency detune due to micro-phonics and easy adjustment of field distribution for strong cell coupling. Calculations of optimized cavity shape and HOM coupler shape have been performed and rf properties with aluminum spoke cavity model have been also measured. Considering refrigerator system required for superconducting accelerator, we are planning to develop 325MHz spoke cavity which can be practically operated with 4K liquid helium. We have started to fabricate the niobium one-spoke cavity.

  4. Tratamento cirúrgico da siringomielia pela Técnica de Gardner Syringomyelia: its surgical treatment by Gardner's method. Report of four cases

    Directory of Open Access Journals (Sweden)

    Gilberto M. Almeida

    1973-12-01

    Full Text Available O tratamento cirúrgico da siringomielia é, em geral, considerado decepcionante. Vários tipos de drenagem da cavidade siringomiélica não têm fornecido resultados satisfatórios. Gardner, em magnífica série de trabalhos, mostrou que a siringomielia e as várias malformações associadas à hidrocefalia têm fisiopatogenia única. Baseado em sua teoria, Gardner propôs, em 1958, o bloqueio da comunicação entre o IV ventrículo e o canal central da medula, para o tratamento da siringomielia. Esta técnica não tem sido realizada com muita freqüência. Empregamos o método proposto por Gardner em 4 pacientes, os quais melhoraram após a intervenção cirúrgica.The surgical treatment of syringomyelic patients is usually considered as deceptional. The drainage methods employed have resulted insatisfactory. Gardner, in a classical series of papers, developed the "hydromyelic theory" to explain syringomyelia and others nervous system malformatins. Founded on his own theory he proposed the blockadge of the communication between the fourth ventricle and the central canal. We have employed this method on 4 patients, with satisfactory results.

  5. A virtual reprise of the Stanley Milgram obedience experiments.

    Directory of Open Access Journals (Sweden)

    Mel Slater

    2006-12-01

    Full Text Available Stanley Milgram's 1960s experimental findings that people would administer apparently lethal electric shocks to a stranger at the behest of an authority figure remain critical for understanding obedience. Yet, due to the ethical controversy that his experiments ignited, it is nowadays impossible to carry out direct experimental studies in this area. In the study reported in this paper, we have used a similar paradigm to the one used by Milgram within an immersive virtual environment. Our objective has not been the study of obedience in itself, but of the extent to which participants would respond to such an extreme social situation as if it were real in spite of their knowledge that no real events were taking place.Following the style of the original experiments, the participants were invited to administer a series of word association memory tests to the (female virtual human representing the stranger. When she gave an incorrect answer, the participants were instructed to administer an 'electric shock' to her, increasing the voltage each time. She responded with increasing discomfort and protests, eventually demanding termination of the experiment. Of the 34 participants, 23 saw and heard the virtual human, and 11 communicated with her only through a text interface.Our results show that in spite of the fact that all participants knew for sure that neither the stranger nor the shocks were real, the participants who saw and heard her tended to respond to the situation at the subjective, behavioural and physiological levels as if it were real. This result reopens the door to direct empirical studies of obedience and related extreme social situations, an area of research that is otherwise not open to experimental study for ethical reasons, through the employment of virtual environments.

  6. A virtual reprise of the Stanley Milgram obedience experiments.

    Science.gov (United States)

    Slater, Mel; Antley, Angus; Davison, Adam; Swapp, David; Guger, Christoph; Barker, Chris; Pistrang, Nancy; Sanchez-Vives, Maria V

    2006-12-20

    Stanley Milgram's 1960s experimental findings that people would administer apparently lethal electric shocks to a stranger at the behest of an authority figure remain critical for understanding obedience. Yet, due to the ethical controversy that his experiments ignited, it is nowadays impossible to carry out direct experimental studies in this area. In the study reported in this paper, we have used a similar paradigm to the one used by Milgram within an immersive virtual environment. Our objective has not been the study of obedience in itself, but of the extent to which participants would respond to such an extreme social situation as if it were real in spite of their knowledge that no real events were taking place. Following the style of the original experiments, the participants were invited to administer a series of word association memory tests to the (female) virtual human representing the stranger. When she gave an incorrect answer, the participants were instructed to administer an 'electric shock' to her, increasing the voltage each time. She responded with increasing discomfort and protests, eventually demanding termination of the experiment. Of the 34 participants, 23 saw and heard the virtual human, and 11 communicated with her only through a text interface. Our results show that in spite of the fact that all participants knew for sure that neither the stranger nor the shocks were real, the participants who saw and heard her tended to respond to the situation at the subjective, behavioural and physiological levels as if it were real. This result reopens the door to direct empirical studies of obedience and related extreme social situations, an area of research that is otherwise not open to experimental study for ethical reasons, through the employment of virtual environments.

  7. Assessment of the Geothermal System Near Stanley, Idaho

    Energy Technology Data Exchange (ETDEWEB)

    Trent Armstrong; John Welhan; Mike McCurry

    2012-06-01

    The City of Stanley, Idaho (population 63) is situated in the Salmon River valley of the central Idaho highlands. Due to its location and elevation (6270 feet amsl) it is one of the coldest locales in the continental U.S., on average experiencing frost 290 days of the year as well as 60 days of below zero (oF) temperatures. Because of high snowfall (76 inches on average) and the fact that it is at the terminus of its rural grid, the city also frequently endures extended power outages during the winter. To evaluate its options for reducing heating costs and possible local power generation, the city obtained a rural development grant from the USDA and commissioned a feasibility study through author Roy Mink to determine whether a comprehensive site characterization and/or test drilling program was warranted. Geoscience students and faculty at Idaho State University (ISU), together with scientists from the Idaho Geological Survey (IGS) and Idaho National Laboratory (INL) conducted three field data collection campaigns between June, 2011 and November, 2012 with the assistance of author Beckwith who arranged for food, lodging and local property access throughout the field campaigns. Some of the information collected by ISU and the IGS were compiled by author Mink and Boise State University in a series of progress reports (Makovsky et al., 2011a, b, c, d). This communication summarizes all of the data collected by ISU including data that were compiled as part of the IGS’s effort for the National Geothermal Data System’s (NGDS) data compilation project funded by the Department of Energy and coordinated by the Arizona Geological Survey.

  8. Tratamento cirúrgico da siringomielia pela Técnica de Gardner

    Directory of Open Access Journals (Sweden)

    Gilberto M. Almeida

    1973-12-01

    Full Text Available O tratamento cirúrgico da siringomielia é, em geral, considerado decepcionante. Vários tipos de drenagem da cavidade siringomiélica não têm fornecido resultados satisfatórios. Gardner, em magnífica série de trabalhos, mostrou que a siringomielia e as várias malformações associadas à hidrocefalia têm fisiopatogenia única. Baseado em sua teoria, Gardner propôs, em 1958, o bloqueio da comunicação entre o IV ventrículo e o canal central da medula, para o tratamento da siringomielia. Esta técnica não tem sido realizada com muita freqüência. Empregamos o método proposto por Gardner em 4 pacientes, os quais melhoraram após a intervenção cirúrgica.

  9. 75 FR 30064 - Stanley Furniture Company, Inc., Including On-Site Leased Workers From Ameristaff Employment and...

    Science.gov (United States)

    2010-05-28

    ... Employment and Training Administration Stanley Furniture Company, Inc., Including On-Site Leased Workers From... related to the production of household furniture and furnishings. Workers of the subject firm were... applicable to the TA-W-72,861 is hereby issued as follows: All workers of Stanley Furniture Company, Inc...

  10. Unilateral chest wall anomaly in a patient with Gardner' s syndrome: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Song, Eun Hee; Lee, So Yeon; Park, Hee Jin; Kwon, Heon Ju; Kim, Mi Sung; Park, Hae Won; Kwang, Hyon Joo [Dept. of Radiology, Kangbuk Samsung Hospital, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Kim, Hye Jin [Dept. of Radiology, Eulji General Hospital, Eulji University School of Medicine, Seoul (Korea, Republic of)

    2014-05-15

    Gardner syndrome is a familial disease consisting of colonic polyposis, osteomas, and soft tissue tumors. We describe unilateral chest wall anomaly in a 32-year-old man with Gardner syndrome. A chest radiograph showed asymmetric hypertrophy of the right seventh to tenth ribs. CT images showed increased size of the medullary portions of these lesions, but relatively normal thickness of the cortex. Intercostal muscles along the right seventh to tenth ribs were hypertrophied as compared with the contralateral ribs. Both lungs were clear but the volume of right lung showed slightly smaller than left one.

  11. Conceptual design of a high real-estate gradient cavity for a SRF ERL

    Science.gov (United States)

    Xu, Chen; Ben-Zvi, Ilan; Hao, Yue; Xin, Tianmu; Wang, Haipeng

    2017-10-01

    The term ;real-estate gradient; is used to describe the energy gain provided by an accelerating structure per actual length it takes in the accelerator. given that the length of the tunnel available for the accelerator is constrained, the real-estate gradient is an important measure of the efficiency of a given accelerator structure. When designing an accelerating cavity to be efficient in this sense, the unwanted Higher Order Mode (HOM) fields should be reduced by suitable HOM dampers. This is a particularly important consideration for high current operation. The additional RF components might take longitude space and reduce the total accelerating efficiency. We describe a new high efficiency 5-cell cavity with the dampers included. The total length of the cavity is reduced by 13% as compared to a more conventional design without compromising the cavity fundamental-mode performance. In addition, the HOM impedance is reduced for a higher Beam-Break-Up (BBU) threshold of operating current. In this paper, we consider an example, a possible application at the eRHIC Energy Recovery Linac (ERL).

  12. State-of-the-Art Electron Guns and Injector Designs for Energy Recovery Linacs (ERL)

    CERN Document Server

    Todd, Alan; Ben-Zvi, Ilan; Benson, Stephen V; Blüm, Hans; Burrill, Andrew; Calaga, Rama; Cameron, Peter; Campisi, Isidoro E; Chang, Xiangyun; Christina, Vincent; Cole, Michael; Colestock, Patrick L; Daly, Edward; Douglas, David; Dylla, Fred H; Falletta, Michael; Hahn, Harald; Hernandez-Garcia, Carlos; Hogan, John; Holmes, Douglas; Janssen, Dietmar; Kayran, Dmitry; Kelley, John P; Kewisch, Jorg; Kneisel, Peter; Kurennoy, Sergey; Lewellen, John W; Litvinenko, Vladimir N; Mammosser, John; McIntyre, Gary; Neil, George R; Nguyen, Dinh C; Nicoletti, Tony; Peterson, Ed; Phillips, Larry; Preble, Joseph P; Rank, Jim; Rao, Triveni; Rathke, John; Reass, William; Rees, Daniel; Rimmer, Robert; Rode, Claus; Russell, Steven; Scaduto, Joseph; Schrage, Dale L; Schultheiss, Tom; Sekutowicz, Jacek; Siggins, Tim; Warren Funk, L; Whitlach, Timothy; Wiseman, Mark; Wong, Robert; Wood, Richard L; Wu, Kuo-Chen; Young, Lloyd M; Zaltsman, Alex; Zhao, Yongxiang

    2005-01-01

    A key technology issue of ERL devices for high-power free-electron laser (FEL) and 4th generation light sources is the demonstration of reliable, high-brightness, high-power injector operation. Ongoing programs that target up to 1 Ampere injector performance at emittance values consistent with the requirements of these applications are described. We consider that there are three possible approaches that could deliver the required performance. The first is a DC photocathode gun and superconducting RF (SRF) booster cryomodule. Such a 750 MHz device is being integrated and will be tested up to 100 mA at the Thomas Jefferson National Accelerator Facility beginning in 2007. The second approach is a high-current normal-conducting RF photoinjector. A 700 MHz gun will undergo thermal test in 2006 at the Los Alamos National Laboratory, which, if successful, when equipped with a suitable cathode, would be capable of 1 Ampere operation. The last option is an SRF gun. A half-cell 703 MHz SRF gun capable of delivering 1.0...

  13. STATE-OF-THE-ART ELECTRON GUNS AND INJECTOR DESIGNS FOR ENERGY RECOVERY LINACS (ERL)

    Energy Technology Data Exchange (ETDEWEB)

    TODD, A.M.M.; AMBROSIO, A.; BLUEM, H.; CHRISTINA, V.; COLE, M.D.; FALLETTA, M.; HOLMES, D.; PETERSON, E.; RATHKE, J.; SCHULTHEISS, T.; WONG, R.; BENSON, S.; DALY, E.; DOUGLAS,D.; DYLLA, F.; FUNK, W.; HERNANDEZ-GARCIA, C.; HOGAN, J.; KNEISEL, P.; MAMMOSSER, J.; NEIL, G.R.; PHILLIPS, L.; PREBLE, J.; RIMMER, R.; RODE, C.; SIGGINS, T.; WHITLACH, T.; WISEMAN, M.; BEN-ZVI, I.; BURRILL, A.; CALAGA, R.; CAMERON,P.; CHANG, X.; HAHN, H.; KAYRAN, D.; KEW...

    2005-05-16

    A key technology issue of energy recovery linac (ERL) devices for high-power free-electron laser (FEL) and fourth generation light sources is the demonstration of reliable, high-brightness, high-power injector operation. Three ongoing programs that target up to 0.5 Ampere photocathode injector performance with required EFU brightness, are described. The first is a DC gun and superconducting RF (SRF) booster cryomodule. Such a 748.5 MHz device is being assembled and will be tested up to 100 mA at the Thomas Jefferson National Accelerator Facility (JLAB) beginning in 2006. The second approach is a high-current normal-conducting RF (NCRF) injector. A 700 MHz gun will undergo thermal test in late 2005 at the Los Alamos National Laboratory (LANL), which when equipped with a suitable cathode, would be capable of exceeding 0.5 Ampere operation. Finally, a half-cell 703.75 MHz SRF gun with a diamond amplifier and other cathodes, will be tested to 0.5 Ampere at the Brookhaven National Laboratory (BNL) in 2007. The status and projected performance for each of these injector projects is presented.

  14. Steven Spielberg peab oma uut filmi koostööks Stanley Kubrickuga

    Index Scriptorium Estoniae

    2001-01-01

    30. juunil üheaegselt Jaapanis ja USAs esilinastub Steven Spielbergi "Tehisintellekt" ("A.I. Artificial Intelligence"), mille kohta režissöör Tokyos pressikonverentsil väitis, et see on õieti Stanley Kubricku film, kuna põhineb temast järelejäänud 90-leheküljelisel ideeprojektil

  15. 76 FR 53888 - Application to Export Electric Energy; Morgan Stanley Capital Group Inc.

    Science.gov (United States)

    2011-08-30

    ...-year term. The electric energy that MSCG proposes to export to Mexico would be surplus energy purchased... date listed above. Comments on the MSCG application to export electric energy to Mexico should be... Application to Export Electric Energy; Morgan Stanley Capital Group Inc. AGENCY: Office of Electricity...

  16. The guiding influence of Stanley Mandelstam, from S-matrix theory to string theory

    Science.gov (United States)

    Goddard, Peter

    2017-04-01

    The guiding influence of some of Stanley Mandelstam’s key contributions to the development of theoretical high energy physics is discussed, from the motivation for the study of the analytic properties of the scattering matrix through to dual resonance models and their evolution into string theory.

  17. An overview of recent findings of the Stanley Foundation Bipolar Network (Part I)

    NARCIS (Netherlands)

    Post, RM; Leverich, GS; Altshuler, LL; Frye, MA; Suppes, TM; Keck, PE; McElroy, SL; Kupka, R; Nolen, WA; Grunze, H; Walden, J

    2003-01-01

    Aim and Methods: Selected recent findings of the Stanley Foundation Bipolar Network are briefly reviewed and their clinical implications discussed. Results: Daily prospective ratings on the NIMH-LCM indicate a high degree of residual depressive morbidity (three times that of hypomania or mania)

  18. Six Degrees of Information Seeking: Stanley Milgram and the Small World of the Library

    Science.gov (United States)

    James, Kathryn

    2006-01-01

    Stanley Milgram's 1967 "small world" social connectivity study is used to analyze information connectivity, or patron information-seeking behavior. The "small world" study, upon examination, offers a clear example of the failure of social connectivity. This failure is used to highlight the importance of the subjectivities of patron experience of…

  19. Dust-ion-acoustic Gardner double layers in a dusty plasma with two ...

    Indian Academy of Sciences (India)

    physics pp. 137–144. Dust-ion-acoustic Gardner double layers in a dusty plasma with two-temperature electrons. M M MASUD1, I TASNIM2,∗ and A A MAMUN3. 1Department of Physics, Bangladesh University of Engineering & Technology, Dhaka, Bangladesh. 2Department of Physics, Begum Rokeya University, Rangpur, ...

  20. Síndrome de Gardner-Diamond.: Presentación de un caso

    National Research Council Canada - National Science Library

    Wainshtok Tomas, Daisy; Alfonso Alfonso, Eduardo; Carnot Pereira, Jorge; Orozco Niebla, Jorge; Regalado Soto, Eric; Valdés Izquierdo, Libertad

    2009-01-01

    ... un Síndrome de Gardner-Diamond. Esta entidad debe ser considerada en el diagnóstico diferencial de un síndrome purpúrico de etiología no bien precisada, fundamentalmente en pacientes con problemas psiquiátricos.

  1. Project Probes Digital Media's Effect on Ethics: Howard Gardner Leads Team Studying Youths' Web Norms

    Science.gov (United States)

    Viadero, Debra

    2008-01-01

    Noted Harvard psychologist Howard Gardner is leading a team studying the social and ethical norms of young people on the Web. Known as the "GoodPlay Project," the study is being financed with a grant from the Chicago-based Catherine T. MacArthur Foundation. What researchers hope to do through the project is fill a gap in the burgeoning research…

  2. Gardner's Two Children Problems and Variations: Puzzles with Conditional Probability and Sample Spaces

    Science.gov (United States)

    Taylor, Wendy; Stacey, Kaye

    2014-01-01

    This article presents "The Two Children Problem," published by Martin Gardner, who wrote a famous and widely-read math puzzle column in the magazine "Scientific American," and a problem presented by puzzler Gary Foshee. This paper explains the paradox of Problems 2 and 3 and many other variations of the theme. Then the authors…

  3. Maximizing Multiple Intelligences through Multimedia: A Real Application of Gardner's Theories.

    Science.gov (United States)

    Martin, Graham P.; Burnette, Carter

    2000-01-01

    Discusses Howard Gardner's theory of Multiple Intelligences that addresses how students assimilate information and suggests the use of electronic portfolios to allow a broader array of learning styles and increase the effectiveness of activities by addressing more Multiple Intelligences. Explains the use of hypertext and multimedia on a CD-ROM.…

  4. Structure, Content, and Process in Teacher Training: The Relevance of Copernicus, Gardner, and Dewey.

    Science.gov (United States)

    Soares, Louise M.

    1998-01-01

    Argues that a unique combination of (1) the Copernican Plan for block scheduling; (2) the application of Howard Gardner's theory of multiple intelligences; and (3) John Dewey's basic ideas about process create a teacher training program in which mastery is an achievable goal. Describes each component and illustrates how each has worked in one…

  5. CRED Gridded Bathymetry of North Gardner Pinnacles (100-014) in the Northwestern Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File 100-014b is a 60-m ASCII grid of depth data collected near N Gardner Pinnacles in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced...

  6. CRED Gridded Bathymetry of Southwest Gardner Pinnacles (100-012) in the Northwestern Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File 100-012b is a 60-m ASCII grid of depth data collected near SW Gardner Pinnacles in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced...

  7. CRED Gridded Bathymetry of East Gardner Pinnacles (100-016) in the Northwestern Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File 100-016b is a 60-m ASCII grid of depth data collected near E Gardner Pinnacles in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced...

  8. CRED Gridded Bathymetry of Northeast Gardner Pinnacles (100-013) in the Northwestern Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File 100-013b is a 60-m ASCII grid of depth data collected near NE Gardner Pinnacles in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced...

  9. CRED Gridded Bathymetry of South Gardner Pinnacles (100-015) in the Northwestern Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File 100-015b is a 60-m ASCII grid of depth data collected near S Gardner Pinnacles in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced...

  10. The botanist George Gardner and his impressions of slave culture in Brazil: Rio de Janeiro, 1810-1850.

    Science.gov (United States)

    Barreiro, José Carlos

    2017-01-01

    This article analyzes the English botanist George Gardner's trip to Brazil during the 1830s. After graduating from the University of Glasgow Gardner was influenced by his teacher and by readings of contemporary naturalists and set off for Brazil in March of 1836, arriving two months later in Rio de Janeiro. The article presents Gardner's impressions of slavery in Brazil, in an attempt to unveil the symbolic universe of a play he witnessed and described, which took place on a farm in Rio de Janeiro on Christmas night. By describing black slavery in its routes across the Atlantic, we compare this event with other similar happenings in Brazil and in Trinidad and Tobago.

  11. Der Tod im Leben. Einige Grundgedanken zu und aus Franz Rosenzweigs der Stern der Erlösung

    Directory of Open Access Journals (Sweden)

    Brasser Martin

    2012-01-01

    Full Text Available Franz Rosenzweig gilt als Existenzphilosoph, weil er das Thema des Todes ins Zentrum der Argumentation in seinem philosophisch-theologischen Hauptwerk Der Stern der Erlösung gestellt hat. Die Religion wird dort als der Ort verstanden, an dem der Tod nicht mehr wie im a-religiösen Leben aus dem Leben herausgedrängt werden muss. Wenn Religion Liebe ist, dann ist der Tod so Teil des Lebens wie er Teil der Liebe zwischen zwei Liebenden ist: als bejahter Bestandteil ihres gemeinsamen Lebens. Der Aufsatz versucht diese Argumentation nachzuzeichnen und zu plausibilisieren.

  12. Characterization of Isolates of Salmonella enterica Serovar Stanley, a Serovar Endemic to Asia and Associated with Travel

    DEFF Research Database (Denmark)

    Hendriksen, Rene S.; Le Hello, Simon; Bortolaia, Valeria

    2012-01-01

    Salmonella enterica serovar Stanley (S. Stanley) is a common serovar in Southeast Asia and was the second most common serovar implicated in human salmonellosis in Thailand in the years 2002 to 2007. In contrast, this serovar is relatively uncommon in Europe. The objective of this study...... isolates. We found some of the S. Stanley isolates isolated from patients in Europe were acquired during travel to Southeast Asia, including Thailand. The presence of multiple plasmid lineages carrying the extended-spectrum cephalosporinase-encoding blaCMY-2 gene in S. Stanley isolates from the central...... part of Thailand was confirmed. Our results emphasize that Thai authorities, as well as authorities in other countries lacking prudent use of antimicrobials, should improve the ongoing efforts to regulate antimicrobial use in agriculture and in clinical settings to limit the spread of multidrug...

  13. Stanley Milgram’s Obedience to Authority “Relationship” Condition: Some Methodological and Theoretical Implications

    OpenAIRE

    Nestar Russell

    2014-01-01

    In May 1962, social psychologist, Stanley Milgram, ran what was arguably the most controversial variation of his Obedience to Authority (OTA) experiments: the Relationship Condition (RC). In the RC, participants were required to bring a friend, with one becoming the teacher and the other the learner. The learners were covertly informed that the experiment was actually exploring whether their friend would obey an experimenter’s orders to hurt them. Learners were quickly trained in how to react...

  14. The resistance experiments: Morality, authority and obedience in Stanley Milgram's account

    OpenAIRE

    Kaposi, Dávid

    2017-01-01

    The paper seeks to re‐conceptualize Stanley Milgram's (in)famous experiments on willing obedience by drawing solely on Milgram's own contemporary account. It identifies a substantial incongruence between the findings Milgram presented (i.e., his description of the experiments) and the meaning he imputed to them (i.e., his interpretation of the exper iments). It argues that instead of operationalizing the concepts he claimed to operationalize – legitimate authority, embodied morality and willi...

  15. Stanley Milgram and Siegfried Lenz : an analysis of "Deutschstunde" in the framework of social psychology

    OpenAIRE

    Tumanov, Vladimir

    2007-01-01

    Siegfried Lenz's novel "Deutschstunde" is analyzed on the basis of work conducted by two American psychologists: Stanley Milgram and Lawrence Kohlberg. The concept of duty and obedience to authority are considered as social phenomena that go beyond personal disposition. The article uses Milgram's famous obedience experiment in order to consider the literary depiction of psychological processes underlying compliance with orders to commit reprehensible acts. A comparison is made between Jens Je...

  16. PENERAPAN TEORI MULTIPLE INTELLIGENCES HOWARD GARDNER DALAM PEMBELAJARAN PENDIDIKAN AGAMA ISLAM

    Directory of Open Access Journals (Sweden)

    Mushollin -

    2009-07-01

    Full Text Available This article is to describe the concept and the theory of Multiple Intelligences developd by Howard Gardner. Furthermore, it tries to explain how they are applied in the classroom in the Islamic education learning. The theory is the development of doubled-intelligences theory stating that human have different intelligences. Gardner argues that human are endowed eight intelligences---linguistic, natural, logic-mathematic, interpersonal, intrapersonal, spatial, musical, and natural. In educational context, Gardner’s theory effects the learning practice in school as well as the parents treatment to the children in the house. In practice, learning is demanded to develop each intelligence and use any kinds of intelligences to measure the students’ intelligence.

  17. As Teorias de Gardner e de Sternberg na Educação de Superdotados

    OpenAIRE

    Maria Clara Sodré Salgado Gama

    2014-01-01

    The aim of this paper is to offer a theoretical basis for the education of gifted and talented students. The work emphasizes the existence of specialists who, starting from different points of view, offer different conceptions of intelligence, to reach the views of Howard Gardner and Robert Sternberg. According to Gardner’s theory of Multiple Intelligences, there are eight different intelligences (linguistic, logical-mathematical, musical, spatial, naturalistic, kinesthetic, interpersonal and...

  18. Astronauts Gardner and Allen during loading of Palapa B-2 in payload bay

    Science.gov (United States)

    1984-01-01

    Astronaut Joseph P. Allen, in this frame, is the sole anchor for the top portion (and most of) the captured Palapa B-2 satellite. Astronaut Dale A. Gardner is on the other end as they load it into the payload bay. Note the difference between the two stinger devices stowed on the Challenger's port side (right side of frame). The one nearer the spacecraft's vertical stabilizer is spent. The one nearer the camera is still awaiting use.

  19. Management of a posterior mediastinal Gardner fibroma causing critical airway stenosis in a resource limited setting

    Directory of Open Access Journals (Sweden)

    Katie Clouthier, DO

    2017-05-01

    Full Text Available In developed countries, surgeons and anesthesiologists approach the mediastinal mass causing airway compression with prudence and trepidation. Resource-limited settings provide unique challenges in the diagnosis and management of patients with critical airway compression. We report the successful treatment of a patient in Port-au-Prince, Haiti with a posterior mediastinal mass that filled the left chest cavity and caused critical airway stenosis. The pathology revealed a Gardner Fibroma, which is rarely associated with mediastinal airway obstruction.

  20. As Teorias de Gardner e de Sternberg na Educação de Superdotados

    Directory of Open Access Journals (Sweden)

    Maria Clara Sodré Salgado Gama

    2014-09-01

    Full Text Available http://dx.doi.org/10.5902/1984686X14320O objetivo deste trabalho é propor duas conceituações de inteligência – diferentes porém compatíveis – na fundamentação teórica do trabalho com alunos superdotados. O texto enfatiza a existência de diferentes teóricos que, a partir de pressupostos variados, chegam a concepções diversas sobre inteligência; parte da constatação de grande variedade de conceitos, para chegar às conceituações contemporâneas de Howard Gardner e Robert Sternberg.  Segundo Gardner, em sua Teoria das Inteligências Múltiplas, existem pelo menos oito inteligências (linguística, logicomatemática, cinestésica, espacial, musical, interpessoal, intrapessoal e naturalista, que correspondem a diferentes sistemas simbólicos; e segundo Sternberg, em sua Teoria Triárquica de Inteligência, existem três diferentes formas de inteligência (analítica, criativa e prática.  Na concepção de Gardner, as inteligências referem-se a diferentes conteúdos da cognição, enquanto que na de Sternberg, o comportamento inteligente se dá através de diferentes processos.  Os diferentes processos definidos por Sternberg podem ser aplicados a cada uma das inteligências de Gardner, não só na identificação de alunos superdotados, como também no desenvolvimento de currículos especiais que de fato levem alunos superdotados ao maior desenvolvimento possível de seus potenciais.

  1. JAERI 10kW High Power ERL-FEL and Its Applications in Nuclear Energy Industries

    CERN Document Server

    Minehara, E J; Iijima, H; Kikuzawa, N; Nagai, R; Nishimori, N; Nishitani, T; Sawamura, M; Yamauchi, T

    2005-01-01

    The JAERI high power ERL-FEL has been extended to the more powerful and efficient free-electron laser (FEL) than 10kW for nuclear energy industries, and other heavy industries like defense, shipbuilding, chemical industries, environmental sciences, space-debris, and power beaming and so on. In order to realize such a tunable, highly-efficient, high average power, high peak power and ultra-short pulse FEL, we need the efficient and powerful FEL driven by the JAERI compact, stand-alone and zero boil-off super-conducting RF linac with an energy-recovery geometry. Our discussions on the ERL-FEL will cover the current status of the 10kW upgrading and its applications of non-thermal peeling, cutting, and drilling to decommission the nuclear power plants, and to demonstrate successfully the proof of principle prevention of cold-worked stress-corrosion cracking failures in nuclear power reactors under routine operation using small cubic low-Carbon stainless steel samples.

  2. Ion-acoustic Gardner solitons in a four-component nonextensive multi-ion plasma

    Energy Technology Data Exchange (ETDEWEB)

    Jannat, N., E-mail: nilimajannat74@gmail.com; Ferdousi, M.; Mamun, A. A. [Jahangirnagar University, Department of Physics (Bangladesh)

    2016-07-15

    The nonlinear propagation of ion-acoustic (IA) solitary waves (SWs) in a four-component non-extensive multi-ion plasma system containing inertial positively charged light ions, negatively charged heavy ions, as well as noninertial nonextensive electrons and positrons has been theoretically investigated. The reductive perturbation method has been employed to derive the nonlinear equations, namely, Korteweg−deVries (KdV), modified KdV (mKdV), and Gardner equations. The basic features (viz. polarity, amplitude, width, etc.) of Gardner solitons are found to exist beyond the KdV limit and these IA Gardner solitons are qualitatively different from the KdV and mKdV solitons. It is observed that the basic features of IA SWs are modified by various plasma parameters (viz. electron and positron nonextensivity, electron number density to ion number density, and electron temperature to positron temperature, etc.) of the considered plasma system. The results obtained from this theoretical investigation may be useful in understanding the basic features of IA SWs propagating in both space and laboratory plasmas.

  3. The Disciplined Mind. Howard Gardner. New York, NY: Simon and Schuster Inc., 1999.

    Directory of Open Access Journals (Sweden)

    Ted McKelgan

    1999-01-01

    Full Text Available What is true, beautiful, and good? Using the theory of evolution, the musical genius of Mozart, and the horrors of the Holocaust, Howard Gardner, in The Disciplined Mind successfully assists students' and teachers' cultural understanding of their educational process as it relates to truth, beauty, and goodness. He does this by emphasizing that we should teach less but in more depth. By probing important issues in depth, we will be teaching much more. In pursuit of truth, Gardner links Darwin's development of systematic classification of living organisms to the understanding of topics that effect human beings today. In doing so, he manages to fmd common ground between the scientific and religious communities, despite the controversies surrounding the theory of evolution. He uses the power of music to depict the human condition in Mozart's work, "The Marriage of Figaro," in search of beauty as it appears in music and human relations. And, in pursuit of the good (and the ugly, Gardner uses the Holocaust and the atrocities associated with it, as a way to understand, not only the Holocaust, but also the human motivation behind such a horrific and elaborate endeavour

  4. Stanley Cavell, Classical Hollywood and the Constitution of the Ordinary (With Notes on Billy Wilder

    Directory of Open Access Journals (Sweden)

    Tatjana Jukić

    2016-04-01

    Full Text Available When in his Tanner lectures Stanley Cavell sets out to define Ordinary Language Philosophy or – rather – to explain how it demarcates philosophy as such, he takes up psychoanalytic literary criticism in order to articulate the terms of this task. Yet the constitution of the ordinary, in Cavell, is never quite accessed from within psychoanalysis-cum-literature alone; instead, it takes another relation, that of psychoanalysis and literature to classical Hollywood, for Cavell to address the ordinary in terms of its constitution. I propose to discuss this complex using two films by Billy Wilder as a passageway to Cavell’s analytic procedure.

  5. The 1953 Stanley L. Miller Experiment: Fifty Years of Prebiotic Organic Chemistry

    Science.gov (United States)

    Lazcano, Antonio; Bada, Jeffrey L.

    2003-01-01

    The field of prebiotic chemistry effectively began with a publication in Science 50 years ago by Stanley L. Miller on the spark discharge synthesis of amino acids and other compounds using a mixture of reduced gases that were thought to represent the components of the atmosphere on the primitive Earth. On the anniversary of this landmark publication, we provide here an accounting of the events leading to the publication of the paper. We also discuss the historical aspects that lead up to the landmark Miller experiment.

  6. Clockwork Ultraviolence : anthropologische Aspekte der Struktur und Funktion von Gewalt in Stanley Kubricks "A Clockwork Orange"

    OpenAIRE

    Schäfer, Jerome Philipp

    2009-01-01

    Stanley Kubricks „A Clockwork Orange“ wird häufig als Paradebeispiel für einen Umgang mit der Filmtechnik herangezogen, bei dem eine unkonventionelle Ästhetik, gepaart mit sublimen Stilbrüchen wie dem Achsensprung, den Zuschauer dank vermittlungsbezogener Suggestivität moralisch entwaffnet. Eine solche Einstellung gegenüber dem Film setzt das Empfinden der dort gezeigten Gewalt als „sinnlos“ und „unmotiviert“ voraus – sonst wäre kaum von einer fehlenden „Moral“ die Rede. Der vorliegende Aufsa...

  7. Recurrent pancreatitis in Gardner variant familial polyposis: etiology, diagnostic approach, and interventional results.

    Science.gov (United States)

    Wright, B E; Kozarek, R A; Traverso, L W; Wechter, D; Thirlby, R; Raltz, S L

    1999-03-01

    Pancreatitis arising from an obstructing ampullary neoplasm in patients with Gardner variant familial polyposis is an infrequently described clinical entity. We reviewed all patients with Gardner variant polyposis presenting with pancreatitis during a 12-year period in our institution, hoping to better define etiology and the appropriate diagnostic and interventional approach. A retrospective record review (1986-1998) defined patient demographics, presenting features, initial and subsequent endoscopic retrograde cholangiopancreatography (ERCP) findings, subsequent treatments, and both immediate and long-term outcomes. Particular consideration was given to initial post-ERCP diagnosis and to endoscopic interventions undertaken at that time. We also looked at those patients who eventually required surgical intervention after long-term failure of medical and endoscopic therapy, the indications for surgery, final pathological characteristics, and follow-up results. Eight patients (6 women and 2 men), with a mean age of 42 years at initial presentation, were found. Each patient was known to have Gardner variant familial polyposis at the time of the initial bout of pancreatitis. All had undergone prior colectomy and 4 of 8 had undergone prior cholecystectomy. None were known to be taking medications or ingesting pancreatoxic substances. Five of 8 patients had obstructing focal or diffuse adenomatous disease involving the ampulla. Two of 8 patients had pancreatitis attributed to other causes (divisum, stones) and a single patient had no clear etiology. Three of 5 patients with ampullary adenomatous disease underwent pancreaticoduodenectomy for recurrent adenomatous encroachment and ampullary stenosis, despite repetitive snare resection and papillotomy. All of these patients had ampullary and other duodenal adenomas, and none had malignant disease. Patients presenting with pancreatitis in the setting of Gardner variant familial polyposis will frequently have an obstructing

  8. Creative idleness and multiple intelligences: dimensions by Domenico De Masi and Howard Gardner on contemporay work

    OpenAIRE

    Loureiro, Roberto de Oliveira

    2009-01-01

    Esta tese analisa os estudos de Domenico De Masi e Howard Gardner, que tratam, respectivamente, do Ócio Criativo e das Inteligências Múltiplas, conceitos estes ainda pouco considerados no cenário empresarial e constituem um novo modelo organizacional, de forma a transformar as relações do trabalhador com outros indivíduos e com o resultado de sua própria obra, mais humanizadas, sem perder de vista a competitividade e o crescimento sustentável, os quais são os objetivos das organizações que de...

  9. Giant desmoid tumor of the abdominal wall in a patient with Gardner Syndrome

    OpenAIRE

    Santana, Daniel Paulino; Figueiredo, Juliano Alves; Meyer, Matheus Matta Machado Mafra Duque Estrada; Ferreira, Paula Mendonça Pimenta; Valente, Guilherme Sousa Sarmento; Reis, Marcos Wanderley Campos

    2012-01-01

    Gardner syndrome (GS) is a rare entity characterized by a triad of familial colonic polyposis, multiple osteomas and soft tissue tumors, including desmoid tumor (DT). This is a case report of a 30 year-old patient with GS who developed giant DT in the abdominal wall after undergoing several laparotomies. The patient has taken a long time to search for medical care, and at first he saw another team that refused to operate him by judging the lesion unresectable. The surgery in our department wa...

  10. Design, planning and construction of a third recirculation with ERL-mode for the S-DALINAC; Auslegung, Planung und Aufbau einer dritten Rezirkulation mit ERL-Modus fuer den S-DALINAC

    Energy Technology Data Exchange (ETDEWEB)

    Arnold, Michaela

    2017-07-01

    This thesis focuses on the design, planning and construction of a third recirculation with an additional option of an energy-recovery-linac (ERL)-operation. The project goals are an increase of the final energy in cw-operation by using the main linac an additional time as well as completing the first ERL in Germany. Designing the separation dipole magnet was the biggest challenge of this project. It had to fulfill strict boundary conditions to the magnetic field distribution and challenging spatial constraints. After a demanding design process, the final version of the separation dipole was constructed. During the design, various simulations ensured the demanded quality. Particle tracking simulations of all energies through this dipole magnet showed that all beams have been bent precisely into their corresponding beamlines. Calculating the transverse homogeneity in the middle of the yoke showed very good results. All values stayed below the specified limit of 10{sup -3}. Regarding the longitudinal homogeneity, nearly all results have been below 5.10{sup -3}. Only the exit side of beam three showed deviations of up to 1.10{sup -2}. During the simulations, a strong dependency of the edge angles with respect to the vertical position was discovered, especially the exit edge angle. Ensuring a reliable beam dynamics simulation, this dependency has been checked with XBEAM. The result showed that these effects are controllable in a simple manner. Integrating higher multipole components along the different orbits led to smaller results than the recommended 10{sup -3}. All simulations showed very good results for such a complex dipole magnet. After manufacturing, the separation as well as the recombination dipole magnet have been measured and investigated with respect to all important parameters. The results for the transverse homogeneity of the magnetic field showed similar values in comparison to the theory. Nearly all beams stayed below 10{sup -3} except for the second

  11. Outbreak of Salmonella serovar Stanley infections in Switzerland linked to locally produced soft cheese, September 2006 - February 2007.

    Science.gov (United States)

    Pastore, R; Schmid, H; Altpeter, E; Baumgartner, A; Hächler, H; Imhof, R; Sudre, P; Boubaker, K

    2008-09-11

    Salmonella serovar Stanley is rare in Europe. In Switzerland, the number of reported isolates has increased from 2 in 2000 to 25 in 2005. A nationwide outbreak of gastrointestinal illness due to S. Stanley occurred from September 2006 through February 2007. Eighty-two cases were documented. Males were 56%; mean age of the cases was 45.7 years (range 0-92). Forty-seven cases (57%) occurred in three western cantons: Vaud, Bern, and Geneva. Twenty-three cases (28%) were hospitalised. In the case-control study conducted to find the source of the outbreak, cases were more likely than controls to have eaten local soft cheese (OR 11.4, p=0.008). One clone of S. Stanley strain was isolated from soft cheese and from 77 cases (94%) who reported no history of having travelled abroad. The outbreak ended after the withdrawal of the cheese from the market. This is the first S. Stanley outbreak in Switzerland and the first in Europe unrelated to imported products, suggesting an increased local circulation of this previously rare serotype.

  12. G. Stanley Hall and an American Social Darwinist Pedagogy: His Progressive Educational Ideas on Gender and Race

    Science.gov (United States)

    Goodchild, Lester F.

    2012-01-01

    This article explores the influence of evolutionary ideas, especially Social Darwinism, on G. Stanley Hall's (1844-1924) educational ideas and major writings on gender and race. Hall formed these progressive ideas as he developed an American Social Darwinist pedagogy, embedded in his efforts to create the discipline of psychology, the science of…

  13. G. Stanley Hall and Edward Thorndike on the Education of Women: Theory and Policy in the Progressive Era.

    Science.gov (United States)

    Seller, Maxine S.

    During the Progressive Era (late 19th and early 20th Centuries), the theories of educational psychologists G. Stanley Hall and Edward L. Thorndike provided a basis for educational policy formation. It is hypothesized that their educational policies led to separate and unequal educational programs for women. Review of their writing indicates that…

  14. A Problematic Alliance: Colonial Anthropology, Recapitulation Theory, and G. Stanley Hall's Program for the Liberation of America's Youth

    Science.gov (United States)

    Garrison, Joshua

    2008-01-01

    Recent studies of G. Stanley Hall's opus, "Adolescence: Its Psychology and Its Relations to Physiology, Anthropology, Sociology, Sex, Crime, Religion and Education" (1904), have highlighted one of the book's most problematic implications: if young people were thought to be the developmental analogues of "primitive" or "savage," then the treatment…

  15. "Erlösung ist, wenn man schulfrei hat!". Erste Ergebnisse einer qualitativ-empirischen Studie zur Erfassung und didaktischen Bearbeitung von Erlösungsvorstellungen 10- bis 14-jähriger SchülerInnen der Sekundarstufe I in Österreich.

    Directory of Open Access Journals (Sweden)

    Thomas Weiß

    2014-07-01

    Full Text Available ENGLISH: The teaching of redemption of mankind through God in Jesus Christ is fundamental to the Christian religion. This article expands on this central topic and presents the first results of a research carried out in schools as part of a current qualitative study about what ideas of redemption ten- to fourteen-year-old students have. The aim of this basic empirical research is to generate views and perspectives on ‚redemption‘ in children and adolescents. A further objective is to develop and integrate didactic tasks for Religious Education as a subject, in order to work on the topic of ‚redemption‘. By doing so, theological reflection should be applied and an alignment within the spheres of life of young people should be provided in lessons at School. DEUTSCH: Die Rede von der Erlösung des Menschen durch Gott in Jesus Christus ist für die christliche Religion fundamental. Der Beitrag widmet sich diesem zentralen Thema und präsentiert die ersten Forschungsergebnisse, die im Rahmen einer aktuellen qualitativen Studie zu Erlösungsvorstellungen von 10- bis 14-jährigen SchülerInnen in Schulen erhoben wurde. Diese grundlagenorientierte empirische Forschungsarbeit hat zum Ziel, kindliche / jugendliche Denk- und Sichtweisen zu ‚Erlösung’ zu generieren und didaktische Aufgaben im Religionsunterricht zu entwickeln und zu implementieren, um das Thema ‚Erlösung’ lebensweltlich orientiert und theologisch reflektiert im schulischen Unterricht bearbeiten zu können.

  16. The Validation of the Hillside Assessment of Perceived Intelligences (HAPI): A Measure of Howard Gardner's Theory of Multiple Intelligences.

    Science.gov (United States)

    Shearer, C. Branton; Jones, James A.

    Howard Gardner's multiple intelligence (MI) theory is an alternative to the unitary concept of general intelligence, but it lacks a practical, reliable, and valid method of assessment. The Hillside Assessment of Perceived Intelligences (HAPI) is an attempt to measure the seven constructs of MI theory with an objective, psychometrically sound…

  17. Gardner's Multiple Intelligence Theory: An Evaluation of Relevant Research Literature and a Consideration of its Application to Gifted Education.

    Science.gov (United States)

    Matthews, Dona

    1988-01-01

    Howard Gardner's Multiple Intelligence construct is considered from the perspective of its viability in gifted education, especially in comparison with the more traditional Intelligence Quotient-based construct of intelligence. Empirical and theoretical support and contradictory findings are discussed from the literature in cognitive science and…

  18. Oranges Aren't the Only Fruit. Ask a Gardner: Some Implications of the National Literacy and Numeracy Stategies

    Science.gov (United States)

    Byard, Kevin

    2004-01-01

    The introduction of the National Literacy and Numeracy strategies in U.K. schools is discussed in the light of Howard Gardner's theory of multiple intelligences. Although the core curriculum is evidently important, it is argued that the introduction of the national strategies has created a possible over-emphasis in these subjects at the expense of…

  19. Characterization of Isolates of Salmonella enterica Serovar Stanley, a Serovar Endemic to Asia and Associated with Travel

    Science.gov (United States)

    Le Hello, Simon; Bortolaia, Valeria; Pulsrikarn, Chaiwat; Nielsen, Eva Møller; Pornruangmong, Srirat; Chaichana, Phattharaporn; Svendsen, Christina Aaby; Weill, François-Xavier; Aarestrup, Frank M.

    2012-01-01

    Salmonella enterica serovar Stanley (S. Stanley) is a common serovar in Southeast Asia and was the second most common serovar implicated in human salmonellosis in Thailand in the years 2002 to 2007. In contrast, this serovar is relatively uncommon in Europe. The objective of this study was to characterize a collection of S. Stanley strains isolated from Thai (n = 62), Danish (n = 39), and French (n = 24) patients to gain a broader understanding of the genetic diversity, population dynamics, and susceptibility to antimicrobials. All isolates were characterized by pulsed-field gel electrophoresis and antimicrobial susceptibility testing. The molecular mechanisms of resistance to extended-spectrum cephalosporins and plasmid-mediated resistance to quinolones were characterized by PCR and sequencing. Plasmid profiling, replicon typing, and microarray analysis were used to characterize the genetic mechanisms of antimicrobial resistance in 10 extended-spectrum cephalosporinase-producing isolates. Considerable genetic diversity was observed among the isolates characterized with 91 unique XbaI pulsed-field gel electrophoresis (PFGE) patterns, including 17 distinct clusters consisting of two to seven indistinguishable isolates. We found some of the S. Stanley isolates isolated from patients in Europe were acquired during travel to Southeast Asia, including Thailand. The presence of multiple plasmid lineages carrying the extended-spectrum cephalosporinase-encoding blaCMY-2 gene in S. Stanley isolates from the central part of Thailand was confirmed. Our results emphasize that Thai authorities, as well as authorities in other countries lacking prudent use of antimicrobials, should improve the ongoing efforts to regulate antimicrobial use in agriculture and in clinical settings to limit the spread of multidrug-resistant Salmonella isolates and plasmids among humans and pigs in Thailand and abroad. PMID:22205822

  20. La fuerza expresiva del deseo en Lan Yu de Stanley Kwan .

    Directory of Open Access Journals (Sweden)

    David L. Eng

    2007-12-01

    Full Text Available Stanley Kwan's Lan Yu configures the emergence of homosexuality in contemporary China far beyond its validation in recognizably Western identitarian terms: the affirmation of an existing but misrecognized minority population; the defense of sexual "perversion"; the positing of sexual freedom, legal recognition, and political rights; the justification of a bourgeois consumer lifestyle, or even the expression of a universalizing and bindingtove bringing togethertwo abstract individuáis. Instead, in Kwan's film, homosexuality and its expressive desire mark the emergence of a new humanism in (postsocialist China under the shadows of global capitalism and neoliberal development. Gays and lesbians, that is, are harbingers of a new modernity, helping to situate China in its proper place within a cosmopolitan globalized world. From this perspective, homosexuality functions as a critical tool for organizing and evaluating the historical continuities and ruptures among China's (semicolonial past, its revolutionary aspirations for a socialist modernity, and its present investments in a neoliberal capitalist world order.

  1. "Is there a text in this class?" - Comentário ao texto de Stanley Fish

    Directory of Open Access Journals (Sweden)

    Rafael Eugenio Hoyos-Andrade

    2001-02-01

    Full Text Available

    Apresenta-se aqui um comentário ao texto de Stanley Fish, cuja tradução aparece nestemesmo número da revista Ma. Utilizando elementos de outros capítulos do mesmo livro, mostra-seque o Autor defende uma doutrina bem menos radical que aquela difundida em nosso meio por algunsintérpretes do famoso crítico literário. Acrescentam-se, porém, algumas considerações e distinçõesque, na opinião do comentarista, tornariam a teoria de Fish menos sujeita a interpretações radicais.

  2. Desire and Crisis: The Operation of Cinematic Masks in Stanley Kubrick's Eyes Wide shut

    Directory of Open Access Journals (Sweden)

    Stephanie Marriott

    2005-01-01

    Full Text Available El análisis del texto fílmico Eye Wide Shut, Stanley Kubrick se convierte en el punto de partida de una reflexión en torno a la mascarada de la vida posmoderna, pero también en torno al espejismo de la mirada que ayuda a consolidar las máscaras. El deseo se convierte en el generador del proceso y la película de Kubrick no es más que su metáfora metateórica. El cine, la publicidad y en general los discursos de los mass media que recorren la cultura popular de nuestros días conocen estos juegos y el espectador queda atrapado en su práctica.

  3. Encuentros y desencuentros entre videojuegos y literatura. Jugabilidad y narrativa en The Stanley Parable

    Directory of Open Access Journals (Sweden)

    Alejandro Lozano

    2017-05-01

    Full Text Available This paper focuses on the narrative of video games paying attention to resources and strategies borrowed from literature. I will approach a particular issue regarding the possibilities of video games as a suitable media to tell stories. This topic is related to the bonds, compatibilities, and incompatibilities between storytelling and gameplay. Such relationship is responsible for the debates that have centered the methods and approaches to video game studies since the late 90s. Video game creators are exploring this relationship to push the creative boundaries of this medium. This research focuses on the use of omniscient narrator within a series of recent games and further analyze the case of The Stanley Parable (Galactic Cafe, 2013 to study this phenomenon.

  4. "Shocking" masculinity: Stanley Milgram, "obedience to authority," and the "crisis of manhood" in Cold War America.

    Science.gov (United States)

    Nicholson, Ian

    2011-06-01

    Stanley Milgram's study of "obedience to authority" is one of the best-known psychological experiments of the twentieth century. This essay examines the study's special charisma through a detailed consideration of the intellectual, cultural, and gender contexts of Cold War America. It suggests that Milgram presented not a "timeless" experiment on "human nature" but, rather, a historically contingent, scientifically sanctioned "performance" of American masculinity at a time of heightened male anxiety. The essay argues that this gendered context invested the obedience experiments with an extraordinary plausibility, immediacy, and relevance. Immersed in a discourse of masculinity besieged, many Americans read the obedience experiments not as a fanciful study of laboratory brutality but as confirmation of their worst fears. Milgram's extraordinary success thus lay not in his "discovery" of the fragility of individual conscience but in his theatrical flair for staging culturally relevant masculine performances.

  5. Ernest Becker and Stanley Milgram: Twentieth-century students of evil.

    Science.gov (United States)

    Martin, Jack

    2016-02-01

    Both Stanley Milgram and Ernest Becker studied and theorized human evil and offered explanations for evil acts, such as those constituting the Holocaust. Yet the explanations offered by Becker and Milgram are strikingly different. In this essay, brief biographical records of their lives are provided. Differences in their research methods and theories are then examined and traced to relevant differences in their lives, education, and careers. Especially important in this regard were their personal experiences of evil and the scholarly practices and traditions of social scientific and humanities scholarship that characterized their graduate education and scholarly work. The final parts of the essay are devoted to a comparative and integrative analysis of their respective approaches to the question of evil, especially as manifest during the Holocaust, and a brief exegesis of their disciplinary commitments. (c) 2016 APA, all rights reserved).

  6. Vulnerabilität. Erläuterungen zu einem Schlüsselbegriff im Denken Judith Butlers

    Directory of Open Access Journals (Sweden)

    Pistrol Florian

    2016-07-01

    Full Text Available Im neueren Denken Judith Butlers nimmt der Begriff der Vulnerabilität eine Schlüsselrolle ein. Kaum eines der vielen Themen, denen sich die US-amerikanische Autorin seit der Jahrtausendwende widmet, kann ohne Kenntnis ihrer Überlegungen zu diesem Terminus angemessen verstanden werden. Der Versuch einer Rekonstruktion ihrer Konzeption von Vulnerabilität steht allerdings vor der Schwierigkeit, dass Butlers Gedanken hierzu über zahlreiche Texte hinweg verstreut sind, wobei bisweilen unterschiedliche Aspekte betont und verschiedene Schwerpunktsetzungen vorgenommen werden. Im vorliegenden Beitrag werden Butlers vulnerabilitätstheoretische Ausführungen in gebündelter Weise dargestellt und interpretiert. Dabei wird (1 die Bedeutsamkeit von Butlers Überlegungen zur Vulnerabilität für ihre Vorstellung von Körperlichkeit aufgewiesen, (2 der Zusammenhang von Vulnerabilität und Anerkennung erläutert und (3 gezeigt, welche ethischen Erwägungen Butler ausgehend von ihrer Anerkennungskonzeption und ihrem Denken der Vulnerabilität anstellt und inwiefern Vulnerabilität und politische Handlungsfähigkeit einander nicht ausschließen. Abschließend wird (4 Butlers Vulnerabilitätsverständnis mit einigen kritischen Rückfragen konfrontiert.

  7. Initial-value problem for the Gardner equation applied to nonlinear internal waves

    Science.gov (United States)

    Rouvinskaya, Ekaterina; Kurkina, Oxana; Kurkin, Andrey; Talipova, Tatiana; Pelinovsky, Efim

    2017-04-01

    The Gardner equation is a fundamental mathematical model for the description of weakly nonlinear weakly dispersive internal waves, when cubic nonlinearity cannot be neglected. Within this model coefficients of quadratic and cubic nonlinearity can both be positive as well as negative, depending on background conditions of the medium, where waves propagate (sea water density stratification, shear flow profile) [Rouvinskaya et al., 2014, Kurkina et al., 2011, 2015]. For the investigation of weakly dispersive behavior in the framework of nondimensional Gardner equation with fixed (positive) sign of quadratic nonlinearity and positive or negative cubic nonlinearity {eq1} partial η/partial t+6η( {1± η} )partial η/partial x+partial ^3η/partial x^3=0, } the series of numerical experiments of initial-value problem was carried out for evolution of a bell-shaped impulse of negative polarity (opposite to the sign of quadratic nonlinear coefficient): {eq2} η(x,t=0)=-asech2 ( {x/x0 } ), for which amplitude a and width x0 was varied. Similar initial-value problem was considered in the paper [Trillo et al., 2016] for the Korteweg - de Vries equation. For the Gardner equation with different signs of cubic nonlinearity the initial-value problem for piece-wise constant initial condition was considered in detail in [Grimshaw et al., 2002, 2010]. It is widely known, for example, [Pelinovsky et al., 2007], that the Gardner equation (1) with negative cubic nonlinearity has a family of classic solitary wave solutions with only positive polarity,and with limiting amplitude equal to 1. Therefore evolution of impulses (2) of negative polarity (whose amplitudes a were varied from 0.1 to 3, and widths at the level of a/2 were equal to triple width of solitons with the same amplitude for a 1) was going on a universal scenario with the generation of nonlinear Airy wave. For the Gardner equation (1) with the positive cubic nonlinearity coefficient there exist two one-parametric families of

  8. Dendrochronology and radiocarbon dating of conifer trees and buried logs from the Stanley River, Tasmania

    Energy Technology Data Exchange (ETDEWEB)

    Cook, E. [Columbia Univ., Palisades, NY (United States). Tree-Ring Lab; Barbetti, M.; Taylor, G.; Yu, Z.; Thompson, B.; Weeks, L. [Sydney Univ., Sydney, NSW (Australia). The NWG Macintosh Centre for Quaternary Dating; Buckley, B. [Tasmania Univ., Sandy Bay, TAS (Australia). Inst of Antarctic and Southern Ocean Studies

    1997-12-31

    Full text: Dendrochronological studies are being carried out on two endemic conifer species in the Stanley River area of western Tasmania. Living trees are growing along the river banks, adjacent floodplain areas, and occasionally on the lower hill-slopes. Many ancient logs are exposed in the bed and banks of the river, and several major excavations have been carried out in floodplain sediments up to a hundred metres distant from the present river channel. A tree-ring chronology for Huon pine (Lagarostrobos franklinii) now extends from the present back to 571 BC. This chronology has been constructed using cores from living trees (up to 1400 years old), sections from trees felled during logging operations in the early 1980s, and sections from subfossil logs in the river banks and floodplain sediments. Living celery-top pine (Phyllocladus aspleniifolius) trees are up to 500 years old, and a short chronology is being developed for this species as well. Large excavations have been carried out over several years in floodplain sediments, and sections have now been taken from a total of 350 subfossil logs. Both Huon and celery-top pine are represented in the collection. They range in age from >38 ka to modern, with good coverage for the periods 9-3.5 ka and from 2.5 ka to the present. A floating tree-ring chronology for Huon pine has been established for the period ca. 7200-3500 cal BP, and is gradually being augmented. In the collection of about 350 ancient conifer logs from the Stanley River, about 150 currently have known ages while the remaining 200 have yet to be studied. Most of them have ages less than 9000 cal BP, but about 10% of them are older. Four of them are more than 30,000 years old, and may be Last Interglacial in age. Nine of them are known to be between 18,000 and 10,000 years old, and six are between 10,000 and 9,000 years old. Our augmented collection has become an increasingly important archive for further tree-ring and carbon isotope studies. Paper

  9. Giant desmoid tumor of the abdominal wall in a patient with Gardner Syndrome

    Directory of Open Access Journals (Sweden)

    Daniel Paulino Santana

    2012-09-01

    Full Text Available Gardner syndrome (GS is a rare entity characterized by a triad of familial colonic polyposis, multiple osteomas and soft tissue tumors, including desmoid tumor (DT. This is a case report of a 30 year-old patient with GS who developed giant DT in the abdominal wall after undergoing several laparotomies. The patient has taken a long time to search for medical care, and at first he saw another team that refused to operate him by judging the lesion unresectable. The surgery in our department was performed in three steps. Initially, we resected the lesion with macroscopic margins, and as there were small bowel adhesions in the tumor, we performed enterectomy and closed using the "Bogotá" technique, with skin closure on the bag. On the fourth postoperative day (POD, we reoperated the abdomen without identifying any signs of fistula. On the seventh POD there was another surgical intervention, this time to insert a double-sided mesh. The patient recovered well, and had no debilitating motor deficit, despite the extensive resection of the abdominal muscles. Curative treatment of DT is based on surgical resection and only sequential surveillance allows us an early diagnosis, when the lesion is still resectable.Tumor desmoide gigante de parede abdominal em paciente portador da Síndrome de Gardner. A Síndrome de Gardner (SG é uma entidade rara caracterizada pela tríade polipose colônica familial, múltiplos osteomas e tumores de tecidos moles, dentre eles o tumor desmoide (TD. Tratou-se de um relato de caso de um paciente de 30 anos, com SG que evoluiu com TD gigante em parede abdominal, após ser submetido a diversas laparotomias prévias. O paciente levou longo tempo para procurar o serviço de cirurgia, passando por outra equipe que se negou a abordá-lo por julgar a lesão irressecável. A cirurgia no nosso serviço se deu em três tempos. Inicialmente, foi feita a ressecção da lesão com margens macroscópicas e, por haver aderências de al

  10. Report of the breeding bird study and vegetation analysis on the Gardner Division of the Mark Twain National Wildlife Refuge Annada District

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — An ornithological study of the breeding birds of the islands that make up the Gardner Division and the Bear Creek Unit of Mark Twain NWR was initiated in 1992. A...

  11. Management Plan, Part 3 : Forestry Chapter : Annada District, Mark Twain National Wildlife Refuge : Clarence Cannon National Wildlife Refuge, Delair Division, Gardner Division

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Mark Twain NWR (Annada District) and Clarence Cannon NWR (Delair and Gardner Divisions) Forest Management Plan is a general plan which outlines the Refuge...

  12. Survey of breeding birds using point count methodologies on the Gardner Division of the Mark Twain National Wildlife Refuge in Illinois

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes a study done on the Gardner Division of Mark Twain NWR to compliment ongoing neotropical migrant bird studies along the Upper Mississippi...

  13. Pneumatology and discipleship: Trinity and church in the theology of Stanley Grenz

    Directory of Open Access Journals (Sweden)

    Roland Spjuth

    2014-06-01

    Full Text Available In today’s ecclesiology, the notion of the Spirit and the church has been heavily influenced by a recent and broad retrieval of Trinitarian theology. In this article, I discuss this in relationship to baptist and evangelical traditions as it is represented by Stanley Grenz. His “theology for the community of God” demonstrates the fruitfulness of the Trinitarian retrieval for such traditions. However, the main argument in the article is that it also implies certain risks. According to the Baptist tradition, the central message of the New Testament is the invitation to be a disciple of Jesus Christ. As Kathryn Tanner and Karen Kilby have argued elsewhere, when the biblical challenge to be like Jesus Christ is turned into a more general exhortation to become an image of the Trinity, it often results in abstract ethics and an ecclesiology that focuses mainly on general exhortations to love and to live in community. In contrast, this article claims that the biblical notion of discipleship has greater possibilities to allow for a more substantial and more holistic account of the Church, one that reunites ecclesiology, ethics and the Spirit’s transformative work within liturgy, charismatic service and mission.

  14. Stanley Milgram’s Obedience to Authority “Relationship” Condition: Some Methodological and Theoretical Implications

    Directory of Open Access Journals (Sweden)

    Nestar Russell

    2014-04-01

    Full Text Available In May 1962, social psychologist, Stanley Milgram, ran what was arguably the most controversial variation of his Obedience to Authority (OTA experiments: the Relationship Condition (RC. In the RC, participants were required to bring a friend, with one becoming the teacher and the other the learner. The learners were covertly informed that the experiment was actually exploring whether their friend would obey an experimenter’s orders to hurt them. Learners were quickly trained in how to react to the impending “shocks”. Only 15 percent of teachers completed the RC. In an article published in 1965, Milgram discussed most of the variations on his baseline experiment, but only named the RC in passing, promising a more detailed account in his forthcoming book. However, his 1974 book failed to mention the RC and it remained unpublished until François Rochat and Andre Modigliani discovered it in Milgram’s personal archive in 1997 at Yale University. Their overview of the RC’s procedure and results left a number of questions unanswered. For example, what were the etiological origins of the RC? Why did Milgram decide against publishing this experiment? And does the RC have any significant methodological or theoretical implications on the Obedience studies discourse? Based on documents obtained from Milgram’s personal archive, the aim of this article is to shed new light on these questions.

  15. F2-layer parameters long-term trends at the Argentine Islands and Port Stanley stations

    Directory of Open Access Journals (Sweden)

    A. D. Danilov

    2001-03-01

    Full Text Available The ionospheric sounding data at two southern hemisphere stations, the Argentine Islands and Port Stanley, are analyzed using a method previously developed by the authors. Negative trends of the critical frequency foF2 are found for both stations. The magnitudes of the trends are close to those at the corresponding (close geomagnetic latitude stations of the northern hemisphere, as considered previously by the authors. The values of the F2 layer height hmF2 absolute trends ΔhmF2 are considered. The effect of ΔhmF2 dependence on hmF2 found by Jarvis et al. (1998 is reproduced. A concept is considered that long-term changes of the geomagnetic activity may be an important (if not the only cause of all the trends of foF2 and hmF2 derived by several groups of authors. The dependence of both parameters on the geomagnetic index Ap corresponds to a smooth scheme of the ionospheric storm physics and morphology; thus, a principal cause of the foF2 and hmF2 geomagnetic trends is most probably a trend found in several publications in the number and intensity of ionospheric storms.Key words. Ionosphere (ionosphere-atmosphere interaction; ionospheric disturbances

  16. Landau damping of Gardner solitons in a dusty bi-ion plasma

    CERN Document Server

    Misra, A P

    2015-01-01

    The effects of linear Landau damping on the nonlinear propagation of dust-acoustic solitary waves (DASWs) are studied in a collisionless unmagnetized dusty plasma with two species of positive ions. The extremely massive, micron-seized, cold and negatively charged dust particles are described by fluid equations, whereas the two species of positive ions, namely the cold (heavy) and hot (light) ions are described by the kinetic Vlasov equations. Following Ott and Sudan [Phys. Fluids {\\bf 12}, 2388 (1969)], and by considering lower and higher-order perturbations, the evolution of DASWs with Landau damping is shown to be governed by Korteweg-de Vries (KdV), modified KdV (mKdV) or Gardner (KdV-mKdV)-like equations. The properties of the phase velocity and the Landau damping rate of DASWs are studied for different values of the ratios of the temperatures $(\\sigma)$ and the number densities $(\\mu)$ of hot and cold ions as well the cold to hot ion mass ratio $m$. The distinctive features of the decay rates of the ampl...

  17. Winning the Stanley Cup Final Series is related to incurring fewer penalties for violent behavior.

    Science.gov (United States)

    McCaw, S T; Walker, J D

    1999-04-01

    Catastrophic and disabling injuries are being reported more frequently in ice hockey. Within the science of injury prevention, all possible avenues are being explored to address this devastating problem, especially in the areas of protective equipment playing rules, teaching techniques, and awareness programs. Ice hockey injuries are in many cases caused by violent player behavior, which may be supported by coaches who believe that such behavior contributes to winning. To determine whether a relationship existed between violent player behavior and game outcome, 1462 recorded penalties from all 18 Stanley Cup Final Series from 1980 through 1997 were analyzed with a 2 x 2 chi-square analysis. A statistically significant association (chi-square = 7.111, P = .008) was found between violent player behavior and series outcome, with the team drawing fewer violent penalty minutes being the winner of 13 of the 18 series. A period-by-period analysis of violent penalties incurred by the losing teams revealed a statistically significant difference between the first and third periods, with losing teams demonstrating more violent player behavior in the first period than in the third period. The results suggest that violent player behavior may be counterproductive to a favorable game outcome. Coaches at the highest level of competition may wish to adjust their team policies and recruiting practices to benefit from the plausible strategic advantage of reducing violent player behavior. This research was presented at the 1998 Ice Hockey World Championship International Symposium on Medicine and Science in Ice Hockey in Zurich, Switzerland, on Saturday, May 9, 1998, and published in the symposium's supplement, "Safety in Ice Hockey IIHF 1998."

  18. Environmental change and fire in the Owen Stanley Ranges, Papua New Guinea

    Science.gov (United States)

    Hope, Geoffrey

    2009-11-01

    Kosipe, an upland valley at 2000 m altitude in the Owen Stanley Ranges of southeastern New Guinea, is known for the discovery of large stone waisted blades dated to 31 400 cal a BP. The purpose of these tools and the nature of occupation are unknown. The altitude is too high for most food crops today and may have stood close to the treeline during the last glaciation. Three pollen and charcoal diagrams from a large swamp in the Kosipe Valley provide a record of swamp and dryland changes for more than 50 000 years. There have been considerable fluctuations in vegetation on the slopes and on the swamp which reflect both environmental change and anthropogenic influences. A gymnosperm-rich forest at the base is replaced by mountain forest dominated by Nothofagus about 42 000 years ago. Fire first becomes apparent across the swamp around 40 000 years ago but is not common during the time when subalpine herbs reach their best representation. Tree fern-rich grasslands form a mosaic with montane forest in a near-treeline environment. The Pleistocene-Holocene boundary is marked by a decline in Nothofagus and increase in lower montane mixed forest taxa. Charcoal increases before this time and the swamp vegetation becomes more grass-rich. Charcoal is at its maximum through the last 3000 years possibly reflecting climate variability as well as sedentary occupation and agriculture on the swamp margin. Supplementary pollen diagrams from two higher altitude sites support the evidence from the Kosipe Swamp cores. Charcoal, local catchment erosion and increases in disturbance taxa become more widespread in the last 5000 years at these sites, suggesting that local settlement at Kosipe may have lagged behind general landscape use by populations from lower altitudes.

  19. "Back-fire to lust": G. Stanley Hall, sex-segregated schooling, and the engine of sublimation.

    Science.gov (United States)

    Graebner, William

    2006-08-01

    G. Stanley Hall was an advocate of sex-segregated schooling long after most Americans had accepted coeducation. His position was based in part on personal experience: observations of his father and mother, a repressed and guilt-ridden boyhood sexuality, and his conviction that his own career success was a product of sublimated sexual desire, of erotic energy converted into mental energy. Hall theorized that coeducation put sublimation at risk, and that sex-segregated schools, by contributing to proper gendered development and by prolonging and sublimating the sexual tensions of adolescence, would produce social progress.

  20. Additional Detection of Multiple Osteomas in a Patient with Gardner's Syndrome by Bone SPECT/CT

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Woo Hyoung; Kim, Daeweung; Kim, Chang Guhn; Kim, Myoung Hyoun [Wonkwang Univ. School of Medicine, Iksan (Korea, Republic of)

    2013-12-15

    Familial adenomatous polyposis (FAP) is an autosomal dominant disorder which generally develops numerous polyps in the colon and rectum during the second decade of life. Gardner's syndrome is a variant of FAP which has multiple osteomas, dental abnormalities, and fibromas, with incidence ranging between 1 in 4,000 and 1 in 40,000, depending on the region. We present the case of a 35-year-old man referred to our department for bone scintigraphy who was shown to have multiple colon polyps and nuchal type fibroma. In this patient, planar image showed intensely increased uptakes of bone agent in the maxilla and mandible, which are typical findings of Gardner's syndrome. Single photon emission computed tomography/computed tomography (SPECT/CT) was acquired to accurately identify and locate abnormal uptakes detected on planar images. SPECT/CT showed numerous osteomas in the maxilla and mandible where intense uptakes of bone agent were seen. Mildly asymmetrical, focally increased uptake in the superomedial aspect of the left orbit on anterior planar image was shown to be a fontal sinus osteoma on SPECT/CT. Enhanced sensitivity of detecting lesions of SPECT/CT superior to planar scintigraphy has been reported in previous studies. In this report, additional osteomas of sphenoidal and ethmoidal sinuses, which were not seen on planar scintigraphy, were detected by SPECT/CT. This case emphasizes that nuclear physicians should be aware of the typical findings of bone scintigraphy for Gardner's syndrome and also that SPECT/CT could be helpful to diagnose additional lesions not seen on planar images.

  1. WILLIAM STANLEY JEVONS: EL USO DE LAS PROBABILIDADES Y EL CÁLCULO

    Directory of Open Access Journals (Sweden)

    Jhon James Mora

    2000-01-01

    Full Text Available En el capítulo tercero de la TPE, Jevons recurre al uso de las probabilidades como un método alternativo para analizar el intercambio de las mercancías. Jevons, decide no continuar con el uso de las probabilidades en los capítulos siguientes; su teoría se bifurca imperando el uso del cálculo diferencial. La explicación de esta bifurcación radica en la existencia de dos métodos alternativos para explicar el análisis del intercambio: La teoría de las probabilidades y el cálculo diferencial. Usar el cálculo diferencial no significaba que fuese el método más eficiente, pues no sólo existieron errores al maximizar como muestra Westergaard (1874, sino también problemas metodológicos, como muestran Stigler (1956 y Blaug (1985. Por otro lado, el método de las probabilidades habría significado para el análisis del intercambio, un problema de valores esperados y un camino totalmente diferente para la revolución marginalista. WILLIAM STANLEY JEVONS: EL USO DE LAS PROBABILIDADES Y EL CÁLCULO JOHN JAMES MORA R.1 Economista Universidad del Valle. Maestría en Economía Ambiental Universidad Autónoma de Madrid. Jefe del Departamento de Economía de la Universidad Icesi e-mail:jjmora@icesi.edu.co 1. Este ensayo comenzó a escribirse hace casi cinco años, cuando era asistente de investigación del profesor Boris Salazar en la Universidad del Valle. Muchos eventos impidieron culminar esta “deuda intelectual” que tenía con Boris, quien nunca ha reparado en brindarme su desinteresada crítica y, de quien siempre estaré en deuda.

  2. Effect of ion beam on the characteristics of ion acoustic Gardner solitons and double layers in a multicomponent superthermal plasma

    Science.gov (United States)

    Kaur, Nimardeep; Singh, Kuldeep; Saini, N. S.

    2017-09-01

    The nonlinear propagation of ion acoustic solitary waves (IASWs) is investigated in an unmagnetized plasma composed of a positive warm ion fluid, two temperature electrons obeying kappa type distribution and penetrated by a positive ion beam. The reductive perturbation method is used to derive the nonlinear equations, namely, Korteweg-de Vries (KdV), modified KdV (mKdV), and Gardner equations. The characteristic features of both compressive and rarefactive nonlinear excitations from the solution of these equations are studied and compared in the context with the observation of the He+ beam in the polar cap region near solar maximum by the Dynamics Explorer 1 satellite. It is observed that the superthermality and density of cold electrons, number density, and temperature of the positive ion beam crucially modify the basic properties of compressive and rarefactive IASWs in the KdV and mKdV regimes. It is further analyzed that the amplitude and width of Gardner solitons are appreciably affected by different plasma parameters. The characteristics of double layers are also studied in detail below the critical density of cold electrons. The theoretical results may be useful for the observation of nonlinear excitations in laboratory and ion beam driven plasmas in the polar cap region near solar maximum and polar ionosphere as well in Saturn's magnetosphere, solar wind, pulsar magnetosphere, etc., where the population of two temperature superthermal electrons is present.

  3. Multidisciplinary investigation of a multicountry outbreak of Salmonella Stanley infections associated with turkey meat in the European Union, August 2011 to January 2013.

    Science.gov (United States)

    Kinross, P; van Alphen, L; Martinez Urtaza, J; Struelens, M; Takkinen, J; Coulombier, D; Makela, P; Bertrand, S; Mattheus, W; Schmid, D; Kanitz, E; Rucker, V; Krisztalovics, K; Paszti, J; Szogyenyi, Z; Lancz, Z; Rabsch, W; Pfefferkorn, B; Hiller, P; Mooijman, K; Gossner, C

    2014-05-15

    Between August 2011 and January 2013, an outbreak of Salmonella enterica serovar Stanley (S. Stanley) infections affected 10 European Union (EU) countries, with a total of 710 cases recorded. Following an urgent inquiry in the Epidemic Intelligence Information System for food- and waterborne diseases (EPIS-FWD) on 29 June 2012, an international investigation was initiated including EU and national agencies for public health, veterinary health and food safety. Two of three local outbreak investigations undertaken by affected countries in 2012 identified turkey meat as a vehicle of infection. Furthermore, routine EU monitoring of animal sources showed that over 95% (n=298) of the 311 S. Stanley isolates reported from animal sampling in 2011 originated from the turkey food production chain. In 2004–10, none had this origin. Pulsed-field gel electrophoresis (PFGE) profile analysis of outbreak isolates and historical S. Stanley human isolates revealed that the outbreak isolates had a novel PFGE profile that emerged in Europe in 2011. An indistinguishable PFGE profile was identified in 346 of 464 human, food, feed, environmental and animal isolates from 16 EU countries: 102 of 112 non-human isolates tested were from the turkey production chain. On the basis of epidemiological and microbiological evidence, turkey meat was considered the primary source of human infection, following contamination early in the animal production chain.

  4. Teaching Technology: From Knowing to Feeling Enhancing Emotional and Content Acquisition Performance through Gardner's Multiple Intelligences Theory in Technology and Design Lessons

    Science.gov (United States)

    Sanchez-Martin, Jesus; Alvarez-Gragera, Garcia J.; Davila-Acedo, Maria Antonia; Mellado, Vicente

    2017-01-01

    Gardner's Multiple Intelligences Theory (MIT) can be a cognitive and emotional improvement if is taken into account in the standard development of the Technology lessons. This work presents a preliminary evaluation of the performance enhancement in two concomitant aspects: contents acquisition and emotional yield. The study was made on up to 150…

  5. The Howard Gardner School: A Portrait of a Small Progressive, Independent and Alternative High School for Bright, Creative Non-Traditional Learners

    Science.gov (United States)

    Drakeford, Jocelyn G.

    2010-01-01

    Howard Gardner's theory of multiple intelligences has impacted the educational community since its inception in 1983. The theory became the framework for Gifted and Talented Education, in that it broaden the scope of giftedness to be defined in the context of students being identified with nontraditional gifts and talents as well as combinations…

  6. Howard Gardner: Aportes de la investigación psicológica a la educación actual : Parte III

    OpenAIRE

    Gómez, María Florencia

    2016-01-01

    Como afirmamos en las publicaciones previas del tema de este mes, Howard Gardner es hoy un especialista citado en distintos posts, comentarios, presentaciones e infografías sobre el uso de recursos tecnológicos en educación. En esta parte presentaremos su estudio sobre la App Generation.

  7. Stanley Milgram e a interpretação sectária nos textos de Qumran

    OpenAIRE

    Sidney Matos da Silva

    2013-01-01

    Este trabalho de pesquisa visa a verificar quais fatores psicossociais presentes em determinado ambiente favorecem ou determinam a fixação de uma nova interpretação de um texto ou situação. Tomou-se como base o experimento de Stanley Milgram realizado para determinação dos fatores que impõem um determinado comportamento. A pesquisa comprova a hipótese de que os fatores que impõem comportamentos também estão presentes na imposição de uma determinada interpretação. Para tanto, no primeiro capít...

  8. O acervo de Stanley Browne: leprologista e médico-missionário (1907-86

    Directory of Open Access Journals (Sweden)

    Robertson Jo

    2003-01-01

    Full Text Available Esse texto trata de significativa aquisição de documentos que complementam o acervo da Wellcome Library for the History and Understanding of Medicine de Londres no que diz respeito à vida e obra de Stanley George Browne, especificamente suas atividades internacionais como consultor e seu trabalho no Congo Belga (de 1936 a 1959, em Uzuakoli, na Nigéria (1959 a 1966, e ainda em Londres, com o Leprosy Study Centre (1966-1980. O artigo também se refere a um acervo de documentos, fotos e correspondência, que corre o risco de se perder, e que se encontra em um pequeno museu do Sanatório de Culion, nas Filipinas. Essa pesquisa é parte das atividades do Leprosy Association Global Project on the History of Leprosy (Projeto Global da História da Lepra da Leprosy Association. Seus resultados podem ser conferidos no site http://www.leprosyhistory.org.

  9. Characterizing the subsurface geology in and around the U.S. Army Camp Stanley Storage Activity, south-central Texas

    Science.gov (United States)

    Blome, Charles D.; Clark, Allan K.

    2018-02-15

    Several U.S. Geological Survey projects, supported by the National Cooperative Geologic Mapping Program, have used multi-disciplinary approaches over a 14-year period to reveal the surface and subsurface geologic frameworks of the Edwards and Trinity aquifers of central Texas and the Arbuckle-Simpson aquifer of south-central Oklahoma. Some of the project achievements include advancements in hydrostratigraphic mapping, three-dimensional subsurface framework modeling, and airborne geophysical surveys as well as new methodologies that link geologic and groundwater flow models. One area where some of these milestones were achieved was in and around the U.S. Army Camp Stanley Storage Activity, located in north­western Bexar County, Texas, about 19 miles north­west of downtown San Antonio.

  10. Analytical solutions of time-fractional models for homogeneous Gardner equation and non-homogeneous differential equations

    Directory of Open Access Journals (Sweden)

    Olaniyi Samuel Iyiola

    2014-09-01

    Full Text Available In this paper, we obtain analytical solutions of homogeneous time-fractional Gardner equation and non-homogeneous time-fractional models (including Buck-master equation using q-Homotopy Analysis Method (q-HAM. Our work displays the elegant nature of the application of q-HAM not only to solve homogeneous non-linear fractional differential equations but also to solve the non-homogeneous fractional differential equations. The presence of the auxiliary parameter h helps in an effective way to obtain better approximation comparable to exact solutions. The fraction-factor in this method gives it an edge over other existing analytical methods for non-linear differential equations. Comparisons are made upon the existence of exact solutions to these models. The analysis shows that our analytical solutions converge very rapidly to the exact solutions.

  11. F 18 FDG PET/CT Findings of Spontaneous Mesenteric Fibromatosis in a Patient with Gardner's Syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, Myung Hee; Jeong, Young Jin; Lim, Seok Tae; Kim, Dong Wook; Jeong, Hwan Jeong; Yim, Chang Yeol [Chonbuk National Univ. Medical School and Hospital, Jeonju (Korea, Republic of)

    2011-06-15

    Gardner's syndrome (GS), a variant of familial adenomatous polyposis, is an autosomal dominant disease. Originally, Gardner described a syndrome consisting of hereditary intestinal polyposis With osteomas and multiple cutaneous and subcutaneous lesions. The syndrome was later modified by the addition of other features, such as dental abnormalities, abdominal fibromatosis, and a number of malignant tumors. the principal cutaneous lesions that have been described in GS are epidermoid cysts. Other cutaneous lesions include fibromas, lipomas, leiomyomas, neurofibromas, and pigmented skin lesions. Fibromatoses are histologically benign, but locally aggressive fibrous tumors consisting of mature fibroblasts within an extensive collagen matrix. Most cases are sporadic, but there is a clear association with familial adenomatous polyposis and GS, suggesting a link with a mutation of the APC gene on chromosome 5q22. Fibromatosis occurs in 3.5%-29% of patients with GS, and is more likely to be multiple and to involve the mesentery and abdominal wall rather than being an isolated form. Clinically, fibromatosis presents as a painless firm soft tissue mass. Most cases of fibromatosis are believed to be precipitated by surgical trauma, however, a few cases of spontaneous occurrence have been reported. In our patient, no history of abdominal surgery or trauma was present. In addition, an abdominal CT obtained 2 years ago revealed no abnormality. Although the radiological features of fibromatosis on CT or MR have been described in the literature, F 18 FDG PET or PET/CT findings are rarely reported. The F 18 FDG uptake in patients with fibromatosis ranged from low to moderate grade and was generally heterogenous with a few tiny foci of relatively intense uptake or relatively homogenous. The areas of higher FDG metabolism are likely to represent more cellular and mitotically active areas. Mesenteric fibromatosis has similar findings to extra abdominal lesions.

  12. Howard Gardner: Aportes de la investigación psicológica a la educación actual : Parte II

    OpenAIRE

    Gómez, María Florencia

    2016-01-01

    Como comentamos en la publicación anterior, Howard Gardner es hoy un especialista citado en distintos posts, comentarios, presentaciones e infografías sobre el uso de recursos tecnológicos en educación y el modelo uno a uno. En esta parte nos centraremos en sus aportes actuales a la psicología cognitiva y a la educación.

  13. Four new species of coccidia (Apicomplexa: Eimeriidae) from Owen Stanley Skinks, Papuascincus stanleyanus (Sauria: Scincidae), from Papua New Guinea.

    Science.gov (United States)

    McAllister, Chris T; Duszynski, Donald W; Fisher, Robert N; Austin, Christopher C

    2014-06-01

    Between September and November 1991, 12 Owen Stanley skinks, Papuascincus stanleyanus (Booulenger) were collected from various localities on Papua New Guinea and examined for coccidians. Six (50%) were found to harbour four eimerians that we describe here as new. Oocysts of Eimeria burseyi sp. n. were elongate to ellipsoidal with a bilayered wall and measured (length x width, L x W) 36.0 x 24.0 microm, with a L/W ratio of 1.5. Both micropyle and oocyst residuum were absent, but a polar granule was present. Oocysts of Eimeria goldbergi sp. n. were ellipsoidal, with a bilayered wall, and measured 21.4 x 16.1 microm; L/W ratio was 1.3. Both micropyle and oocyst residuum were absent, but a single or fragmented polar granule was present. Oocysts of Eimeria boulengeri sp. n. were spheroidal to slightly subspheroidal, with a thin, single-layered wall that readily collapses, and measured 16.0 microm, L/W ratio was 1.0. Both micropyle and oocyst residuum were absent, but usually one (sometimes two) polar granule(s) were present. Oocysts of Eimeria niuginiensis sp. n. were oblong to tapered with a bilayered wall, and measured 20.0 x 13.1 microm; L/W ratio was 1.5. A micropyle, oocyst residuum and polar granule were absent. To our knowledge, these represent the only coccidians ever described from P. stanleyanus.

  14. Interaural Difference of Wave V Predicting Postoperative Hearing in Gardner-Robertson Class II Acoustic Neuroma Patients.

    Science.gov (United States)

    Aihara, Noritaka; Murakami, Shingo; Takemura, Keiji; Yamada, Kazuo

    2013-10-01

    Patients with acoustic neuroma classified in Gardner and Robertson (GR) Class II should be considered to have useful hearing, and patients classified in Class III should be considered to have not-useful hearing. Therefore, it is important for acoustic neuroma surgery to distinguish between postoperative GR Class II and Class III patients by brainstem auditory evoked potentials (BAEPs). We evaluate which BAEP parameter is the best for predicting postoperative GR Class II or III in 36 preoperative GR Class II patients with unilateral acoustic neuroma. Delay in wave V latency, reduction ratio in wave V amplitude, and interaural difference of wave V (IT5) are evaluated by a receiver-operating characteristic (ROC) curve in this study. IT5 is the best distinguishing parameter between postoperative Class II and Class III. IT5 below 1.12 millisecond (msec) should be a good marker to preserve postoperative useful hearing. Thus, comparing the latency of wave V on both sides is important, and surgeons would be able to make more informed decisions during surgery by checking IT5 on BAEPs.

  15. Becoming good in Africa: A critical appraisal of Stanley Hauerwas� ecclesial ethic in the sub-Saharan context

    Directory of Open Access Journals (Sweden)

    Charles K. Bafinamene

    2017-01-01

    Full Text Available The present article examines the appropriateness of Stanley Hauerwas� ecclesial ethic for the sub-Saharan African churches. Thus, it consists in a Christian ethical assessment of the metaethical foundational categories of his ecclesial ethic. In brief, his proposal is eclectic and pluri-disciplinarily applicable to the churches of various denominations. It reflects the marks of the Aristotelian ethical tradition endorsed by Thomas Aquinas and recovered by several communitarian philosophers. It also includes some discernible ecclesio-centric and postliberal theological accents. The promising insights of this proposal include: (1 the necessity to ordain the church�s worship, polity and its entire way of life to the spiritual and moral formation of church members; (2 the stress on Christian virtuous life, identity formation, witness and non-conformism in social ethics. However, essentially designed against the background of a Western, liberal, autonomous and individualist self, Hauerwas� ecclesial ethic is not a definitive answer for the holistic, normative and communalist moral self, characteristic of the traditional African ethos and influencing a large majority in Africa. Moreover, it stresses the purity of the church in a way that restricts cooperation between Christians and nonChristians for socio-economic justice and the common good.Intradisciplinary and/or interdisciplinary implications: Therefore, Hauerwas� virtue, narrative, community and social ethics provide some valuable insights for moral formation in African churches as it explores the interplay between ecclesiology, Christian ethics, practical theology and philosophical ethics. For sure, other relevant resources should come from African spirituality, developmental psychology and sociology of religion.

  16. Howard Gardner: Aportes de la investigación psicológica a la educación actual : Parte I

    OpenAIRE

    Gómez, María Florencia

    2016-01-01

    Howard Gardner es hoy un especialista citado en distintos posts, comentarios, presentaciones e infografías sobre el uso de recursos tecnológicos en educación y el modelo uno a uno. Por ello, conoceremos un poco más del autor tanto en las investigaciones psicológicas por las que suele ser reconocido por los educadores como en las siguientes publicaciones del tema de este mes que tratan sobre sus últimos desarrollos de las mentes del futuro y la generación App.

  17. Stanley Milgram's "Obedience" Studies.

    Science.gov (United States)

    Eckman, Bruce K.

    1977-01-01

    Describes Milgram's experiments in which individuals (assigned the role of "teacher") obeyed instructions to administer what they thought were severe electric shocks to "learners," and reports criticisms of the findings. Concludes that the experiments were sound and that they demonstrate that morality is situation-related…

  18. Influence of G. Stanley Hall on Yuzero Motora, the first psychology professor in Japan: how the kymograph powered Motora's career in psychology.

    Science.gov (United States)

    Sato, Tatsuya; Nakatsuma, Takuya; Matsubara, Norika

    2012-01-01

    Yuzero Motora was the founder of psychology in Japan, acting as an organizer, executive, and administrator of psychological science and practice and as a vocal link between psychology and the larger philosophical and pedagogical community. He studied under Professor G. Stanley Hall and earned his PhD at Johns Hopkins University. An article coauthored by Hall and Motora was published in the first issue of The American Journal of Psychology. Findings presented herein are based partially on the biographical records, articles, and books written by Motora and partially on Motora's personal documents and course curriculum from Johns Hopkins University. We focus on Motora's life and work with Hall at Johns Hopkins, the research described in the article coauthored with Hall and the impact that it had, and the influence of Hall on Motora's career after he returned to Japan.

  19. Developmental norms for the Gardner Steadiness Test and the Purdue Pegboard: a study with children of a metropolitan school in Brazil

    Directory of Open Access Journals (Sweden)

    G.N.O. Brito

    2002-08-01

    Full Text Available Norms for the Gardner Steadiness Test and the Purdue Pegboard were developed for the neuropsychological assessment of children in the metropolitan area of Rio de Janeiro. A computer-generated unbiased sample of 346 children with a mean age of 9.4 years (SD = 2.76, who were attending a large normal public school in this urban area, was the subject of this study. Two boys were removed from the study, one for refusing to participate and the other due to severe strabismus. Therefore, the final sample contained 344 children (173 boys and 171 girls. Sex and age of the child and hand preferred for writing, but not ethnic membership or social class, had significant effects on performance in the Gardner Steadiness Test and the Purdue Pegboard. Girls outperformed boys. Older children performed better than younger children. However, the predictive relationship between age of the child and neuropsychological performance included linear and curvilinear components. Comparison of the present results to data gathered in the United States revealed that the performance of this group of Brazilian children is equivalent to that of US children after Bonferroni's correction of the alpha level of significance. It is concluded that sex and age of the child and hand preferred for writing should be taken into account when using the normative data for the two instruments evaluated in the present study. Furthermore, the relevance of neurobehavioral antidotes for the obliteration of some of the probable neuropsychological effects of cultural deprivation in Brazilian public school children is hypothesized.

  20. Adolescentes e suas más companhias: lunáticos, criminosos, e pervertidos sexuais [sobre a obra Adolescence de Stanley Hall

    Directory of Open Access Journals (Sweden)

    Mirian Jorge Warde

    2015-12-01

    Full Text Available http://dx.doi.org/10.5007/2175-795X.2015v33n2p739 Nas duas últimas décadas do século XIX verifica-se nos Estados Unidos atenções se concentrando sobre a criança, tanto nos estudos sobre a infância – que desembocaram na institucionalização de um novo campo de investigação, o “child study” – quanto nas práticas de socialização – que incluíram o chamado “kindergarten movement”. Na virada do século XX, começam a ser publicados trabalhos sobre o adolescente e a adolescência, seminais quer em relação ao tema quer em relação às disciplinas que emergiam ou caminhavam para a consolidação no campo acadêmico, tais como: Sociologia e Antropologia, no primeiro caso, e Psicologia, no segundo. Esse fenômeno é especialmente visível nos Estados Unidos, onde são flagrantes as associações entre adolescência e criminalidade, assim como o são as referências à obra de G. Stanley Hall, Adolescence: its psychology and its relations to physiology, anthropology, sociology, sex, crime, religion and education, publicada pela primeira vez em 1904, considerada matriz das futuras pesquisas no âmbito dos estudos sociais e psicológicos. Ainda que tenham contribuído para borrar o mito da criança imaculada, os experimentos com crianças de Hall não chegaram a perfilá-las com os endiabrados; no entanto, o adolescente de Hall veio a lume acompanhado dos “primitivos” e “selvagens”, assim como dos criminosos, loucos, e sexualmente desajustados, ou seja, a adolescência como conceito psicossocial nasceu referida aos grupos mais baixos na escala evolutiva. Hall explica toda a adolescência com base na teoria da recapitulação, tanto o seu desenvolvimento fisiológico como o seu crescimento intelectual e social.  Adolescents and their bad companies: lunatics, criminals, and sexual perverts [on Stanley Hall’s adolescence] Abstract In the last two decades of the 19th century, in the United States, attentions are focused

  1. Electric Substations, Electric substation locations provided to us from Kansas City Power and Light and City of Gardner only at this time. AIMS is working on getting other providers in area. Data is limited to CUE (Collaborative Utility Exchange) Participants and subcontracto, Published in 2004, Johnson County Government.

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Electric Substations dataset current as of 2004. Electric substation locations provided to us from Kansas City Power and Light and City of Gardner only at this time....

  2. ENSINO ORIENTADO PELO RESPEITO ÀS INTELIGÊNCIAS MÚLTIPLAS: AS CONTRIBUIÇÕES DE HOWARD GARDNER PARA O EXERCÍCIO DA DOCÊNCIA

    Directory of Open Access Journals (Sweden)

    Kelly Roman Pavan

    2014-09-01

    Full Text Available A obra de Howard Gardner intitulada Inteligências múltiplas – A teoria na prática foi publicada no Brasil há quase vinte anos. Embora não se trate de obra recente, vale a pena revisitá-la com um olhar crítico e destacar suas importantes contribuições para o exercício da docência.

  3. Cuestiones ético-metodológicas frente a la réplica del experimento de Stanley Milgram, 45 años después Ethical and methodological issues involved in the replica of Stanley Milgram's experiment - 45 years later

    OpenAIRE

    Gabriela Z. Salomone; Juan Jorge Michel Fariña

    2009-01-01

    En 2009 se publicaron los resultados de la investigación de Jerry Burger, una réplica parcial del célebre estudio de Stanley Milgram sobre obediencia a la autoridad. A 45 años del experimento original, se reabrieron así discusiones éticas y metodológicas insoslayables. Tales cuestiones éticas se organizan en tres niveles diferentes: (1) Las premisas éticas para la utilización de consignas engañosas en la investigación científica: ¿cuáles son estas premisas? ¿por qué ha sido objetado el experi...

  4. Anne Scott Sørensen, Ole Martin Høystad, Erling Bjurström and Halvard Vike Nye kulturstudier - En innføring, Oslo: Spartacus Forlag AS/Scandinavian Academic Press, 2008

    Directory of Open Access Journals (Sweden)

    Gösta Arvastson

    2009-10-01

    Full Text Available Nye kulturstudier [New Cultural Studies] is the first introduction to cultural studies in Scandinavia and an impressive presentation of the subject. The book aims to explain how cultural studies emerged as an interdisciplinary field in humanities and social sciences. Other introductions to cultural research in eth-nology and anthropology have been produced - but this one is different, since it is more comprehensive and am-bitious. Nye kulturstudier is the result of in-terdisciplinary collaboration between four colleagues from Norway, Sweden and Denmark. Senior lecturer Anne Scott Sørensen and Professor Ole Martin Høystad are affiliated to the Institute for Literature, Media and Cultural Studies at the University of Southern Denmark in Odense. Professor Erling Bjurström belongs to Tema Q at Linköping Uni-versity, and Professor Halvard Vike works at the Institute for Social Anthro-pology at Oslo University. The authors comment that they are oriented towards different subjects and educational pro-grammes at their respective universities. The book begins with a background to the theories and scientific traditions. This is followed by Cultural Analysis and Methodology, a chapter on Identity, Globalisation and Multiculturalism, one on Taste, Lifestyle and Consumption and, finally, by Nature, Body and Ex-perience Landscapes.

  5. Prebiotic Synthesis of Methionine and Other Sulfur-Containing Organic Compounds on the Primitive Earth: A Contemporary Reassessment Based on an Unpublished 1958 Stanley Miller Experiment

    Science.gov (United States)

    Parker, Eric T.; Cleaves, H. James; Callahan, Michael P.; Dworkin, Jason P.; Glavin, Daniel P.; Lazcano, Antonio

    2010-01-01

    Original extracts from an unpublished 1958 experiment conducted by the late Stanley L. Miller were recently found and analyzed using modern state-of-the-art analytical methods. The extracts were produced by the action of an electric discharge on a mixture of methane (CH4), hydrogen sulfide (H2S), ammonia (NH3), and carbon dioxide (CO2). Racemic methionine was farmed in significant yields, together with other sulfur-bearing organic compounds. The formation of methionine and other compounds from a model prebiotic atmosphere that contained H2S suggests that this type of synthesis is robust under reducing conditions, which may have existed either in the global primitive atmosphere or in localized volcanic environments on the early Earth. The presence of a wide array of sulfur-containing organic compounds produced by the decomposition of methionine and cysteine indicates that in addition to abiotic synthetic processes, degradation of organic compounds on the primordial Earth could have been important in diversifying the inventory of molecules of biochemical significance not readily formed from other abiotic reactions, or derived from extraterrestrial delivery.

  6. Prebiotic Synthesis of Methionine and Other Sulfur-Containing Organic Compounds on the Primitive Earth: A Contemporary Reassessment Based on an Unpublished 1958 Stanley Miller Experiment

    Science.gov (United States)

    Parker, Eric T.; Cleaves, H. James; Callahan, Michael P.; Dworkin, Jason P.; Glavin, Daniel P.; Lazcano, Antonio; Bada, Jeffrey L.

    2011-06-01

    Original extracts from an unpublished 1958 experiment conducted by the late Stanley L. Miller were recently found and analyzed using modern state-of-the-art analytical methods. The extracts were produced by the action of an electric discharge on a mixture of methane (CH4), hydrogen sulfide (H2S), ammonia (NH3), and carbon dioxide (CO2). Racemic methionine was formed in significant yields, together with other sulfur-bearing organic compounds. The formation of methionine and other compounds from a model prebiotic atmosphere that contained H2S suggests that this type of synthesis is robust under reducing conditions, which may have existed either in the global primitive atmosphere or in localized volcanic environments on the early Earth. The presence of a wide array of sulfur-containing organic compounds produced by the decomposition of methionine and cysteine indicates that in addition to abiotic synthetic processes, degradation of organic compounds on the primordial Earth could have been important in diversifying the inventory of molecules of biochemical significance not readily formed from other abiotic reactions, or derived from extraterrestrial delivery.

  7. MELHORAMENTO DO TOMATEIRO: II. PROCEDIMENTO DE GARDNER E EBERHART NA ANÁLISE HETERÓTICA DE CARACTERÍSTICAS MORFOAGRONÔMICAS E DA QUALIDADE DOS FRUTOS

    Directory of Open Access Journals (Sweden)

    AMARAL JÚNIOR ANTÔNIO TEIXEIRA DO

    1997-01-01

    Full Text Available Cinco cultivares de tomateiro (Lycopersicon esculentum Mill. - Ângela I.5100, Floradade, IPA-05, Jumbo AG-592 e Santa Clara - e seus p (p - 1/2 cruzamentos foram avaliados quanto a dez características morfoagronômicas e cinco relacionadas à qualidade dos frutos, pelo método de Gardner e Eberhart. Os resultados evidenciaram suficiente variabilidade entre os parentais para a maioria das características, indicando uma situação favorável à aplicação do melhoramento genético. A potencialização das características `teor de carotenóides totais' e `conteúdo de beta-caroteno' nos frutos poderá ser alcançada por meio dos intercruzamentos envolvendo os cultivares Ângela I.5100, Floradade e Jumbo AG-592, enquanto apenas a combinação Jumbo AG-592 x Ângela I.5100 revelou possibilidade de incrementos nos teores de vitamina C. Considerando-se conjuntamente as características morfoagronômicas e as relacionadas à qualidade dos frutos, conclui-se que os cultivares Ângela I.5100, Floradade e Santa Clara são os de maior potencial para compor intercruzamentos.

  8. Three-dimensional model of the hydrostratigraphy and structure of the area in and around the U.S. Army-Camp Stanley Storage Activity Area, northern Bexar County, Texas

    Science.gov (United States)

    Pantea, Michael P.; Blome, Charles D.; Clark, Allan K.

    2014-01-01

    A three-dimensional model of the Camp Stanley Storage Activity area defines and illustrates the surface and subsurface hydrostratigraphic architecture of the military base and adjacent areas to the south and west using EarthVision software. The Camp Stanley model contains 11 hydrostratigraphic units in descending order: 1 model layer representing the Edwards aquifer; 1 model layer representing the upper Trinity aquifer; 6 model layers representing the informal hydrostratigraphic units that make up the upper part of the middle Trinity aquifer; and 3 model layers representing each, the Bexar, Cow Creek, and the top of the Hammett of the lower part of the middle Trinity aquifer. The Camp Stanley three-dimensional model includes 14 fault structures that generally trend northeast/southwest. The top of Hammett hydrostratigraphic unit was used to propagate and validate all fault structures and to confirm most of the drill-hole data. Differences between modeled and previously mapped surface geology reflect interpretation of fault relations at depth, fault relations to hydrostratigraphic contacts, and surface digital elevation model simplification to fit the scale of the model. In addition, changes based on recently obtained drill-hole data and field reconnaissance done during the construction of the model. The three-dimensional modeling process revealed previously undetected horst and graben structures in the northeastern and southern parts of the study area. This is atypical, as most faults in the area are en echelon that step down southeasterly to the Gulf Coast. The graben structures may increase the potential for controlling or altering local groundwater flow.

  9. Caracterização morfo-anatômica dos órgãos vegetativos de Cattleya walkeriana Gardner (Orchidaceae - DOI: 10.4025/actascibiolsci.v26i1.1664 Morpho-anatomic characterization of vegetative organs of Cattleya walkeriana Gardner (Orchidaceae - DOI: 10.4025/actascibiolsci.v26i1.1664

    Directory of Open Access Journals (Sweden)

    Cláudia Inês da Silva

    2004-04-01

    Full Text Available As espécies de orquídeas epífitas possuem adaptações morfo-anatômicas singulares e que as tornam aptas a ocuparem ambientes onde a escassez de água e de nutrientes é freqüente, como os ramos e troncos das árvores. Nelas são comuns os tecidos especializados para a reserva de água, tanto nas folhas quanto nas raízes e nos pseudobulbos, tendo este estudo o objetivo de caracterizar morfo-anatomicamente os órgãos vegetativos de Cattleya walkeriana Gardner. As folhas são coriáceo-carnosas, revestidas com espessa cutícula, hipostomáticas e com mesofilo tendendo para a dorsi-ventralidade. Nos pseudobulbos, a cutícula e algumas camadas de células subjacentes impermeabilizam o parênquima fundamental, formado por grandes células que reservam água e carboidratos na forma de grãos de amido. Os feixes vasculares são colaterais, tendo os maiores, calotas de fibras em ambos os polos de tecidos condutores. Nas raízes o velame e o tecido cortical estão formados por várias camadas de células, embora tanto a exoderme quanto a endoderme mostrem-se pouco espessadasThe epiphytic orchids species have singular morpho-anatomic adaptations, which enable them to stay in places where water and nutrients scarcity are frequent, such as trees branch and trunk. The tissues specialized in water reservation are common in these species, as much as in leaves, roots and pseudobulbs. This study aimed to distinguish morpho-anatomically the vegetative organs of ,em>Cattleya walkeriana Gardner. Their leaves are coriaceous-fleshy in texture, covered by thick cuticle, hypostomatic and their mesophyll tends to the dorsal-ventral. In the pseudobulbs, the cuticle and some underlying cell layers waterproof the fundamental parenchyma, formed by big cells that reserve water and grains of starch. The vascular bundles are collateral, and the longest ones have sclerenchyma cap in both conductor tissue poles. In the roots, the velamen and the cortical tissue are formed

  10. A reavaliação da Guerra do Vietnã apresentada no romance The short timer (197(), de Gustav Hasford, e em sua adaptação fílmica Fullmetal JAcket (1987), de Stanley Kubrick

    OpenAIRE

    Paula, Rodrigo Martini [UNESP

    2010-01-01

    Este projeto examina as maneiras pelas quais a obra The Short-Timers (1979), de Gustav Hasford, e o filme Full Metal Jacket (1987), de Stanley Kubrick, revisitam a Guerra do Vietnã, dessacralizando a História oficial. Em seu romance The Short Timers (1979), o veterano Gustav Hasford narra a trajetória de um soldado e de seus companheiros durante o treinamento militar e o posterior combate no Vietnã. Tomando a perspectiva desse soldado, o narrador focaliza esse episódio da história dos Estados...

  11. Poliposis familiar hereditaria y síndrome de Gardner: Aportación de la exploración odontoestomatológica a su diagnóstico y descripción de un caso

    OpenAIRE

    Chimenos Küstner, Eduardo; Pascual Cruz, Montserrat; Blanco Guillermo, Ignacio; Finestres Zubeldia, Fernando

    2005-01-01

    La poliposis adenomatosa familiar (PAF) y su variante fenotípica, el síndrome de Gardner, constituyen una infrecuente patología hereditaria autosómica dominante. Se caracterizan por el desarrollo, generalmente durante la segunda y tercera década de la vida, de múltiples pólipos adenomatosos en el colon y en el recto. Estos pólipos tienen un riesgo elevado de transformación maligna subsiguiente, cosa que suele ocurrir en las décadas tercera y cuarta de la vida. Las manifestaciones fenotípicas ...

  12. Poliposis familiar hereditaria y síndrome de Gardner: aportación de la exploración odontoestomatológica a su diagnóstico y descripción de un caso

    OpenAIRE

    Chimenos Küstner, Eduardo; Pacual, Montserrat; Blanco, Ignacio; Finestres, Fernando

    2005-01-01

    La poliposis adenomatosa familiar (PAF) y su variante fenotípica, el síndrome de Gardner, constituyen una infrecuente patología hereditaria autosómica dominante. Se caracterizan por el desarrollo, generalmente durante la segunda y tercera década de la vida, de múltiples pólipos adenomatosos en el colon y en el recto. Estos pólipos tienen un riesgo elevado de transformación maligna subsiguiente, cosa que suele ocurrir en las décadas tercera y cuarta de la vida. Las manifes...

  13. Stanley Kubrick Directs. Expanded Edition.

    Science.gov (United States)

    Walker, Alexander

    After reviewing Kubrick's career from his start as a photojournalist on "Look" the book presents a detailed analysis of all Kubrick's films, from "Killer's Kiss" to "A Clockwork Orange," looking at them from both technical and thematic aspects. The book is copiously illustrated with stills from the productions. (JK)

  14. Euroopa ratsaliitude juhtide konverents Poolas / ERL

    Index Scriptorium Estoniae

    2012-01-01

    19.-20. jaanuarini Poolas Varssavis toimunud konverentsist "Best Practice in Horse Industry", millest võtsid osa enamuse Euroopa ratsaliitude ja suuremate hobusekasvatusorganisatsioonide esindajad, teiste hulgas ka Eesti Ratsaspordi Liit

  15. ERL Option for LHeC

    CERN Document Server

    Hao, Y; Litvinenko, VN; Ptitsyn, V; Trbojevic, D; Tsoupas, N

    2010-01-01

    We present a self-consistent system for a 3-pass 60-GeV energy recovery linac, including arc optics design, linac cryomodule, splitters and combiners, overall layout, compensation schemes for synchrotron-radiation energy losses either using a higher-harmonic RF system or optimizing the beam phases in the main linacs, coherent energy loss from resistive wall and coherent synchrotron radiation, and simulations of beam break up as a function of HOM frequency spread.

  16. Cuestiones ético-metodológicas frente a la réplica del experimento de Stanley Milgram, 45 años después Ethical and methodological issues involved in the replica of Stanley Milgram's experiment - 45 years later

    Directory of Open Access Journals (Sweden)

    Gabriela Z. Salomone

    2009-12-01

    Full Text Available En 2009 se publicaron los resultados de la investigación de Jerry Burger, una réplica parcial del célebre estudio de Stanley Milgram sobre obediencia a la autoridad. A 45 años del experimento original, se reabrieron así discusiones éticas y metodológicas insoslayables. Tales cuestiones éticas se organizan en tres niveles diferentes: (1 Las premisas éticas para la utilización de consignas engañosas en la investigación científica: ¿cuáles son estas premisas? ¿por qué ha sido objetado el experimento de Milgram? ¿Es posible una réplica del experimento que salve tales objeciones?; (2 El contexto de aplicación de la investigación: ¿es posible utilizar sus resultados para explicar la obediencia a órdenes aberrantes en casos tan diversos como el nazismo, My Lai, la dictadura militar de Argentina 1976-83, Guantánamo o Abu Ghraib?; (3 Las condiciones para la transmisión de un experimento metodológica y conceptualmente controvertido: ¿cuáles son los principios éticos actualmente vigentes en materia de "objetividad en la enseñanza"? ¿qué supone, en el caso concreto de Milgram, ofrecer a estudiantes e investigadores una perspectiva ética sobre el problema? Como una contribución a este último punto, el presente artículo discute los parámetros actualmente vigentes en materia de Engaño en la investigación y Consentimiento Informado, analizando las implicancias ético-metodológicas de la "solución de los 150 voltios" propuesta por Burger en su réplica del experimento.The results of Jerry Burger's investigation, a partial replica of Stanley Milgram's famous study on obedience to authority, were published in 2009. 45 years after the original experiment was conducted, the ethical and methodological issues surrounding this study inevitably resurfaced. Said ethical issues can be organized into three different levels: (1 The ethical premises which outline the practice of deception in research. What are these premises? Why have

  17. Meediahiiglane või meediasegadus? / Stanley Reed

    Index Scriptorium Estoniae

    Reed, Stanley

    2008-01-01

    Thomas H. Glocer kavatseb tulevikku muuta 157aastase uudisteagentuuri ja finantsandmegigandi Reutersi ning ajalehekirjastajana alustanud 78aastase äriteabeimpeeriumi Thomson abil. Glocer müüs Reutersi 15,6 miljardi dollari eest Thomsonile ning asus ise Thomson Reutersi juhi kohale. Vt. samas: Teabehiid

  18. Hey, James Stanley (1909-90)

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    English radioastronomy pioneer, made three fundamental discoveries in radio astronomy. Working on radar during the second World War, he discovered radio interference from solar storms (at first thought to be enemy `jamming' of radar). It is surprising that he should have found this emission serendipitously, since solar radio emission had been sought without success by several scientists since ...

  19. Publishing for conservation and development? | Gardner ...

    African Journals Online (AJOL)

    http://dx.doi.org/10.4314/mcd.v9i1.1 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers ...

  20. Calibration of the ERL cavity FPC and PU couplers

    Energy Technology Data Exchange (ETDEWEB)

    Hahn, H.; Johnson, E.; Kayran, D.

    2010-04-05

    The performance parameters of a superconducting cavity, notably accelerating field and quality factor, are first obtained in a cryogenic vertical test Dewar, and again after the final assembly in its cryostat. The tests involve Network Analyzer (NA) measurements in which the cavity is excited through an input coupler and the properties are obtained from the reflected signal at the input and the transmitted signal from the output coupler. The interpretation of the scattering coefficients in terms of field strength requires the knowledge of the Fundamental Power Coupler (FPC) and Pick-Up (PU) coupler strength, as expressed by their 'external' and Q{sub FPC} Q{sub PU}. The coupler strength is independent of the field level or cavity losses and thus can be determined at low levels with the scattering coefficients S{sub 11} and S{sub 21}, assuming standard 50 {Omega} terminations in the network analyzer. Also needed is the intrinsic cavity parameter, R{sub a} /Q{sub 0} {triple_bond} {l_brace}R/Q{r_brace}, a quantity independent of field or losses which must be obtained from simulation programs, such as the Microwave Studio.

  1. Margus Laanet - erakust mässaja / Erle Selling

    Index Scriptorium Estoniae

    Selling, Erle

    2001-01-01

    Eesti päritolu kunstnikust Margus Laanetist (s. 16. juulil 1965 Väike-Maarjas), kes peab oma kodumaaks Hondurast, elab peamiselt Guatemalas, korraldab näitusi ka teistes Ladina-Ameerika maades. Tema üheksast isiknäitusest (1989-2000), retseptsioonist. Mehhiko kunstiteadlase Karen Reiman Cordero, argentiina kunstiteadlase Laura Malosetti-Costa ja M. Laaneti kommentaarid.

  2. First beam commissioning at BNL ERL SRF Gun

    Energy Technology Data Exchange (ETDEWEB)

    Xu, W. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Altinbas, Z. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Belomestnykh, S. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Stony Brook Univ., NY (United States). Dept. of Physics and Astronomy; Ben-Zvi, I. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Stony Brook Univ., NY (United States). Dept. of Physics and Astronomy; Deonarine, S. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; DeSanto, L. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Gassner, D. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Gupta, R. C. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Hahn, H. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Hammons, L. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Ho, C. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Jamilkoski, J. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kankiya, P. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kayran, D. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Kellerman, R. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Laloudakis, N. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Lambiase, R. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Liaw, C. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Litvinenko, V. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Stony Brook Univ., NY (United States). Dept. of Physics and Astronomy; Mahler, G. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Masi, L. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; McIntyre, G. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Miller, T. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Philips, D. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Ptitsyn, V. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Seda, T. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Sheehy, B. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Smith, K. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Rao, T. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Steszyn, A. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Tallerico, T. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Than, R. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Tuozollo, J. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Wang, E. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Weiss, D. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Wiliniski, M. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.; Zaltsman, A. [Brookhaven National Lab. (BNL), Upton, NY (United States). Collider-Accelerator Dept.

    2015-05-03

    The 704 MHz SRF gun successfully generated the first photoemission beam in November of 2014. The configurations of the test and the sub-systems are described.The latest results of SRF commissioning, including the cavity performance, cathode QE measurements, beam current/energy measurements, are presented in the paper.

  3. (Stanley, 2006; Brown, 2003; Shannon, 1997; etc) have established ...

    African Journals Online (AJOL)

    Andrew

    Similar problem has been envisaged around the globe ... global trend which addresses issues concerning environ- mental impacts. .... Generation of 1 kWh of electricity with biogas/diesel mixture. 700. Source: Brown (2003). Figure 9. Modified gas stove and pressure lamp attached to biogas storage container. Source: Forst ...

  4. Järjekord liival / Stanley Reed, Emily Thornton, Eamon Javers

    Index Scriptorium Estoniae

    Reed, Stanley

    2007-01-01

    USA ärimeeste visiitidest Lähis-Ida naftariikidesse, mille eesmärkideks on võita kohalike juhtide soosing ning sõlmida endale võimalikult suuri ja kasulikke tehinguid. Diagramm: Lähis-Ida tehingute maht. Lisa: Külaliste nimekiri

  5. North Stanley Polymer Demonstration Project, second annual report

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, J.P.; Cunningham, J.W.; DuBois, B.M.

    1977-10-01

    This project is a cooperative test of the economics of polymer enhanced waterflooding and is a field scale test involving 1,010 productive acres containing 72 million barrels of pore volume, 19 injection wells, and 28 producers. The primary activity during the second year was successful injection of the polymer slug. Polymer injection was completed June 22, 1977, after injecting 1,194,770 pounds of Dow Pusher 700 and 11,962,918 barrels of water over a period of 372 days. The average polymer concentration was 285 ppM. Nine of the injection wells were given Channelblock (TM) treatments. One well, Pappin 12, did not respond to the Channelblock treatment; it was the closest well to the injection plant, and the pressure was too high for the soft gel to hold. The rate on Pappin 12 was then restricted by use of a flow regulator coil; the polymer (250 ppM) underwent 12% shear degradation passing through the regulator coil. Movement of the slug through the reservoir was monitored by analysis of produced water samples. The producing wells were sampled every two weeks from Feb. through June and once a month thereafter. The water samples were analyzed for salinity and polymer. The primary producing problem was a change in the producing well fluid levels resulting from the changes in injection distribution, and it was necessary to either change out the pump or lower the present pump which resulted in less efficiency. The oil production started responding in Sept. 1976 by increasing 15 BPD to 581 BPD. It increased to 586 BPD in Oct., 590 BPD in Nov., and 592 BPD in Dec. In Jan., production jumped to 660 BPD. It fell back to 641 in Feb. but slowly increased to 658 BPD by May. June's production fell back to 645 BPD, partially as a result of lower injection rates experienced when polymer injection was terminated. (DLC)

  6. Postmodernismi aabits / Stanley J. Grenz ; tõlk. Andrus Norak

    Index Scriptorium Estoniae

    Grenz, Stanley J.

    2001-01-01

    Lühendatult raamatust "A Primer on Postmodernism" (1996). Jrg. nr. 2, lk. 28-31 ; nr. 3, lk. 27-29 ; nr. 4, lk. 31-32 ; nr. 5, lk. 30-31 ; nr. 6, lk. 30-31 ; nr. 7, lk. 32-33 ; nr. 8, lk. 32-33 ; (2002) nr. 1, lk. 31-33 ; nr. 2, lk. 31-33 ; nr. 3, lk. 33 ; nr. 4, lk. 30-32 ; nr. 5, lk. 32-33 ; nr. 6, lk. 30-33

  7. Small mammals of the Eastern Arc Mountains, Tanzania | Stanley ...

    African Journals Online (AJOL)

    Because of the staggering degree of biodiversity, how little we know about the biota of the EAM and the rapid degradation of the remaining montane forests of these mountains, we are studying the natural history and biogeography of the small mammals (shrews and rodents) of this archipelago. We are also interested in ...

  8. Small mammals of the Eastern Arc Mountains, Tanzania | Stanley ...

    African Journals Online (AJOL)

    The Eastern Arc Mountains (EAM) contain some of the most biologically diverse and endemic-rich montane ecosystems in all of Africa. Because of the staggering degree of biodiversity, how little we know about the biota of the EAM and the rapid degradation of the remaining montane forests of these mountains, we are ...

  9. Müüdid ja tegelikkus / Stanley Davis Phillips

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2007-01-01

    USA suursaadik Eestis väidab, et kliimamuutustega seonduv on üks enim valesti mõistetud USA poliitika valdkond. Suursaadik kummutab müüdid, nagu teeks Euroopa rohkem kui USA, et vähendada oma tegevuse mõju kliimale, ning nagu ei teeks USA teiste riikidega koostööd kliimamuutuste alal. Lisa: Saksamaa ettepanek

  10. Codismantlability and projective dimension of the Stanley-Reisner ...

    Indian Academy of Sciences (India)

    61

    J. Herzog; T. Hibi; X. Zheng, Dirac's theorem on chordal graphs and Alexander duality. European J. Combin. 25 (2004), no. 7, 949–960. 10. K. Kimura, Kimura, Kyouko. Non-vanishingness of Betti numbers of edge ideals. Harmony of Gröbner bases and the modern industrial society, 153–168, World Sci. Publ., Hackensack,.

  11. The immobilised body: Stanley Kubrick’s A clockwork orange

    National Research Council Canada - National Science Library

    Macris, Anthony

    2013-01-01

    Draws on theories of French philosopher Gilles Deleuze to analyse the passage in “A clockwork orange” where the protagonist is bound and forced to watch violent images on a movie screen as therapy...

  12. Stanley Corrsin Award Talk: Fluid Mechanics of Fungi and Slime

    Science.gov (United States)

    Brenner, Michael

    2013-11-01

    There are interesting fluid mechanics problems everywhere, even in the most lowly and hidden corners of forest floors. Here I discuss some questions we have been working on in recent years involving fungi and slime. A critical issue for the ecology of fungi and slime is nutrient availability: nutrient sources are highly heterogeneous, and strategies are necessary to find food when it runs out. In the fungal phylum Ascomycota, spore dispersal is the primary mechanism for finding new food sources. The defining feature of this phylum is the ascus, a fluid filled sac from which spores are ejected, through a build up in osmotic pressure. We outline the (largely fluid mechanical) design constraints on this ejection strategy, and demonstrate how it provides strong constraints for the diverse morphologies of spores and asci found in nature. The core of the argument revisits a classical problem in elastohydrodynamic lubrication from a different perspective. A completely different strategy for finding new nutrient is found by slime molds and fungi that stretch out - as a single organism- over enormous areas (up to hectares) over forest floors. As a model problem we study the slime mold Physarum polycephalum, which forages with a large network of connected tubes on the forest floors. Localized regions in the network find nutrient sources and then pump the nutrients throughout the entire organism. We discuss fluid mechanical mechanisms for coordinating this transport, which generalize peristalsis to pumping in a heterogeneous network. We give a preliminary discussion to how physarum can detect a nutrient source and pump the nutrient throughout the organism.

  13. A virtual reprise of the Stanley Milgram obedience experiments

    National Research Council Canada - National Science Library

    Slater, Mel; Antley, Angus; Davison, Adam; Swapp, David; Guger, Christoph; Barker, Chris; Pistrang, Nancy; Sanchez-Vives, Maria V

    2006-01-01

    .... Our objective has not been the study of obedience in itself, but of the extent to which participants would respond to such an extreme social situation as if it were real in spite of their knowledge...

  14. The Rhetoric of the Challenger: George Stanley McGovern.

    Science.gov (United States)

    Trent, Judith S.; Trent, Jimmie D.

    Reasons for George McGovern's presidential election failure are summarized in the context of McGovern's rhetoric as a challenger. Taking the point of view that McGovern abandoned the traditional rhetorical advantages of the challenger, the authors conclude that this abandonment along with the problems of financing, the impression of alignment with…

  15. Intelligence Assessment: Gardner Multiple Intelligence Theory as an Alternative

    Science.gov (United States)

    Almeida, Leandro S.; Prieto, Maria Dolores; Ferreira, Aristides I.; Bermejo, Maria Rosario; Ferrando, Mercedes; Ferrandiz, Carmen

    2010-01-01

    In the multiple intelligence framework, newer and more contextualized cognitive tasks are suggested as alternative to more traditional psychometric tests. The purpose of this article is to examine whether or not these two types of instruments converge into a general factor of cognitive performance. Thus, the Battery of General and Differential…

  16. Gender issues among south African anaesthetists | Gardner | South ...

    African Journals Online (AJOL)

    The largest group of males was over 50 years old whereas most females were under 50 years. Most respondents chose anaesthesia because of academic appeal or career opportunities. More females reported experiencing sexual harassment and felt discriminated against in terms of job selection during the training period ...

  17. Ethical issues in public health promotion | Gardner | South African ...

    African Journals Online (AJOL)

    Health promotion is a key element of public health practice. Among strategies aiming to deal with public health problems, health promotion purports to help people achieve better health. Health promotion can significantly alter people's lifestyles, and three main ethical issues relate to it: (i) what are the ultimate goals for ...

  18. Narrative report Mark Twain National Wildlife Refuge Gardner Division 1966

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great River National Wildlife Refuge outlines Refuge accomplishments during the 1966 calendar year. The report begins by summarizing...

  19. Mani, Augustine and the vision of God | Gardner | HTS Teologiese ...

    African Journals Online (AJOL)

    If one accepts that Augustine as a Manichaean catechumen would have partaken in this most basic of the community's religious duties then one must consider what effect this could have had on the development of his own striking and influential teachings about the vision of God. The article discusses evident allusions to ...

  20. The Importance of Early Diagnosis of Gardner's syndrome in Dental ...

    African Journals Online (AJOL)

    2018-02-07

    4 days ago ... routine panoramic radiographic examination [Figure 1], multiple radiopaque masses with relatively well- circumscribed margins were detected incidentally involving the both maxilla and mandible. In particular, large lobulated masses at the bilateral angle of the mandible and diffuse sclerosis throughout the ...

  1. A white paper: The Cornell-BNL FFAG-ERL Test Accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Ben-Zvi, I. [Brookhaven National Lab. (BNL), Upton, NY (United States); Berg, S. [Brookhaven National Lab. (BNL), Upton, NY (United States); Blaskiewicz, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Brooks, S. [Brookhaven National Lab. (BNL), Upton, NY (United States); Brown, K. [Brookhaven National Lab. (BNL), Upton, NY (United States); Fischer, W. [Brookhaven National Lab. (BNL), Upton, NY (United States); Hao, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States); Meng, W. [Brookhaven National Lab. (BNL), Upton, NY (United States); Meot, F. [Brookhaven National Lab. (BNL), Upton, NY (United States); Minty, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Peggs, S. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ptitsin, V. [Brookhaven National Lab. (BNL), Upton, NY (United States); Roser, T. [Brookhaven National Lab. (BNL), Upton, NY (United States); Thieberger, P. [Brookhaven National Lab. (BNL), Upton, NY (United States); Trbojevic, D. [Brookhaven National Lab. (BNL), Upton, NY (United States); Tsoupas, N. [Brookhaven National Lab. (BNL), Upton, NY (United States); Bazarov, I. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Dobbins, J. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Dunham, B. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Hoffstaetter, G. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Mayes, C. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Patterson, R. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States); Sagan, D. [Cornell Lab. for Accelerator-Based Sciences and Education, Ithaca, NY (United States)

    2014-12-16

    This white paper describes a project that promises to propel high-power, high-brightness electron beam science and applications to an exciting new level. The collaborative effort between Brookhaven and Cornell will be a model for future projects between universities and national lab, taking advantage of the expertise and resources of both to investigate new topics in a timely and cost-effective manner.

  2. Space Charge Effects for the ERL Prototype Injector Line at Daresbury Laboratory

    CERN Document Server

    Muratori, Bruno; Owen, Hywel; de Loos, Marieke; van der Geer, Bas

    2005-01-01

    Daresbury Laboratory is currently building an Energy Recovery Linac Prototype (ERLP) that will operate at a beam energy of 35 MeV. In this paper we examine the space charge effects on the beam dynamics in the ERLP injector line. A Gaussian particle distribution is tracked with GPT (General Particle Tracer) through the injection line to the main linac to calculate the effect of 3Dspace charge in the dipoles. The nominal beam energy in the injection line is 8.3 MeV and the bunch charge 80 pC. The effects of space charge on the transverse and longitudinal emittance are studied for various electron beam parameter settings.

  3. Lõimklastrid : sissejuhatus / Gerli Nimmerfeldt, Erle Rikmann, Jüri Kruusvall ... [jt.

    Index Scriptorium Estoniae

    2013-01-01

    Ülevaade lõimumisvaldkonna riikliku arengukava sihtrühmadest, kaasates vaatlusaluste sotsiaalsete gruppidena ka lõimklastrid, mille moodustavad klasteranalüüsi meetodil enne taasiseseisvumist Eestisse sisserännanute ja nende järeltulijate alamrühmad

  4. Uuringu kokkuvõte / Gerli Nimmerfeldt, Erle Rikmann, Jüri Kruusvall ... [jt.

    Index Scriptorium Estoniae

    2013-01-01

    Uuringu eesmärgiks oli analüüsida Eesti lõimumispoliitika siht- ja sidusrühmade kogemusi, vajadusi, ootusi ja võimalusi lõimumisprotsessis. Venekeelse elanikkonna uurimisel lähtuti lõimklastritest, mis on klasteranalüüsi meetodil moodustatud alarühmad vastavalt lõimitusele kolmel dimensioonil: kodanikuidentiteet, sotsiaalne-poliitiline osalus ning keeleoskus ja -kasutus

  5. Abort - valik või paratamatus / Naatan Haamer ; interv. Erle Iher

    Index Scriptorium Estoniae

    Haamer, Naatan, 1965-

    2001-01-01

    Intervjuu Tartu naistekliiniku ja vaimse tervise hooldekeskuse hingehoidja ning Haiglahingehoiu Keskuse juhatajaga. Lisa : Eesti Kirikute Nõukogu põõrdumine Eesti rahva poole "Kaitsta iga inimese loomupärast õigust elule"

  6. Villu Reiljan : me pole võimuhullude partei / Villu Reiljan ; interv. Kalle Muuli

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2002-01-01

    ERL-i esimees Villu Reiljan vastab küsimustele ERL-i presidendi parteiks nimetamise, ERL-i populaarsuse, valimislubaduste, ERL-i rahastamise kohta. Lisa: Rahvaliidu valimislubadustest. Autor: ERL. Parlamendisaadik

  7. Ministeerium nõudis ELF-i ja ERL-i projektide rahata jätmist / Sander Silm

    Index Scriptorium Estoniae

    Silm, Sander, 1970-

    2004-01-01

    Keskkonnainvesteeringute Keskuse nõukogus ei leidnud keskkonnaministeeriumi programmide ekspertgrupi ettepanekul toetust üheksa Eestimaa Looduse Fondi ja Eesti Rohelise Liikumise projekti. Kommenteerib keskkonnaminister Villu Reiljan

  8. Post-zerebrale Utopien: Im Grenzbereich zwischen künstlicher Intelligenz und technikzentrierter Erlösungsfantasien.

    OpenAIRE

    Seyringer, Simone

    2014-01-01

    Warum könnten Gehirn-Utopien aus den 1990ern heute interessant sein? Blockbuster wie "Transcendence" mit Johnny Depp, dessen Gehirn auf ein Computersystem geladen wird, oder populäre Hollywood-Produktionen wie "Her", die Serie "Real Humans" rekurrieren auf Utopien, um die es nach den 1990ern sehr leise geworden ist. Der Diskurs um "Mind-Upoloading", Neu- bzw. Selbstbestimmung von Identiät durch Cyborgisierung, oder digitale Unsterblichkeit ist mit den derzeit anlaufenden Big Science Projekten...

  9. A broadening debate : is the Estonian society ready for civic initiative? / Rein Ruutsoo, Erle Rikmann, Mikko Lagerspetz

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2004-01-01

    Valitsusväliste organisatsioonide koostöö võimalustest riiklike institutsioonidega, osalemisest poliitiliste otsuste tegemises, ühiskonna suhtumisest kodanikualgatusse. 22. juunist 4. detsembrini 2000. a. läbiviidud küsitlusuuringu tulemustest

  10. Kohe näha, et valimiste aeg on käes / Villu Reiljan

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2001-01-01

    ERL esimees kinnitab, et ERL toetab Arnold Rüütli kandidatuuri lõpuni ja teeb kõik selleks, et valijameeste kogu valiks presidendi juba septembris. ERL ja Keskerakonna presidendikandidaatide toetusest. Autor: ERL: Parlamendisaadik

  11. Die Frage der Menschenrechte in Estland, Lettland und Litauen / V. Stanley Vardys

    Index Scriptorium Estoniae

    Vardys, Vytas Stanley, 1924-1993

    1983-01-01

    Lisa: Der baltische Appell von 1979 (Balti apell - Eest, Läti ja Leedu kodanike märgukiri, mis sisaldas nõuet avalikustada Molotovi-Ribbentropi pakt koos oma salaprotokollidega, kuulutada pakt kehtetuks selle allakirjutamise momendist peale ja taastada Balti riikide iseseisvus, avalikustati 23. aug. 1979) ; Offener Brief aus der Estnischen SSR (Avalik kiri Eest NSV-st, nn. 40 kiri, 28. okt. 1980)

  12. William Stanley Jevons: Precursor del pensamiento económico neoconservador

    Directory of Open Access Journals (Sweden)

    Emmanuel Borgucci

    2006-01-01

    Full Text Available El siguiente ensayo tiene el objetivo de demostrar que el pensamiento económico neoconservador (neoliberal no nació con las ideas que en materia económica porponían los teóricos de la oferta, las expectativas racionales, los monetaristas o los seguidores de la nueva hacienda pública conservadora. La economía neoconservadora tuvo en W.S. Jevons a uno de sus precursores más importantes. Esta afirmación se sustenta en tres razones: Su método de estudio, sus aportaciones en el campo de su teoría del intercambio, los precios relativos y su teoría del trabajo. Se concluye, que el discurso económico propuesto por W.S. Jevons contribuyó de manera decisiva al desarrollo y consolidación de un tipo de pensamiento económico que privilegia el uso del análisis formal y que se adapta a la forma moderna de hacer negocios en el mundo capitalista.

  13. Stanley Reef Extension, Density, and Calcification Data for 1912 to 1985

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Extension, Density, and Calcification data from 35 Porites coral cores covering the entire length of the Great Barrier Reef, Australia. Data set contains 35...

  14. Kes kardab Lähis-Ida raha? / Emily Thornton, Stanley Reed

    Index Scriptorium Estoniae

    Thornton, Emily

    2008-01-01

    Lähis-Ida riikide investeerimisfondide tegevusest. Mehed, kes haldavad selle piirkonna riiklikke investeerimisfonde, muudavad Pärsia lahe naftamiljarditega maailma rahanduse palet. Lisa: Hea on olla emiir. Kuuele Lähis-Ida emiraadile kuulub umbes pool kogu maailma riiklike investeerimisfondide varadest

  15. 78 FR 16540 - AIP Series Trust and Morgan Stanley AIP GP LP; Notice of Application

    Science.gov (United States)

    2013-03-15

    ... outstanding voting stock to be owned by investment companies generally. 2. Section 12(d)(1)(J) of the Act... section 12(d)(1)(J) of the Investment Company Act of 1940 (the ``Act'') for an exemption from sections 12...-end management investment companies that operate as ``funds of funds'' to acquire shares of certain...

  16. Conductismo y aprendizaje en la filmografía de Stanley Kubrick

    OpenAIRE

    Marcos Pascual, Luis Javier

    2014-01-01

    En este Trabajo de Fin de Grado se abordará una de las teorías del aprendizaje que más influencia ha tenido dentro del ámbito educativo: el conductismo. Se partirá de un marco teórico que siente las bases de los principios e ideas que dieron lugar a esta teoría, así como su aplicación en el mundo educativo y lo que esto conlleva. Se analizarán también los cambios que de forma progresiva se han ido introduciendo en el currículo de Primaria que tratan de dejar atrás los métodos de enseñ...

  17. Human rights issues in Estonia, Latvia and Lithuania / V. Stanley Vardys

    Index Scriptorium Estoniae

    Vardys, Vytas Stanley, 1924-1993

    1981-01-01

    Lisatud: The Baltic appeal of 1979 (Balti apell - Eest, Läti ja Leedu kodanike märgukiri, mis sisaldas nõuet avalikustada Molotovi-Ribbentropi pakt koos oma salaprotokollidega, kuulutada pakt kehtetuks selle allakirjutamise momendist peale ja taastada Balti riikide iseseisvus, avalikustati 23. aug. 1979) ; Open letter from the Estonian SSR (Avalik kiri Eest NSV-st, nn. 40 kiri, 28. okt. 1980)

  18. U.S. hegemony and the transatlantic alliance / Stanley R. Sloan

    Index Scriptorium Estoniae

    Sloan, Stanley R.

    2004-01-01

    Autor vaatleb Euroopa riikide ja Ameerika Ühendriikide poliitiliste, julgeolekupoliitiliste ja majanduslike suhete arengut alates 1945. aastast käeoleva ajani ning järeldab, et USA ülemvõim on suurendanud Euroopa riikide vahelist koostööd

  19. Cosmopolitanism in Relation to the Self and the Other: From Michel Foucault to Stanley Cavell

    Science.gov (United States)

    Smeyers, Paul; Waghid, Yusef

    2010-01-01

    Educators, not to mention philosophers of education, find themselves in a difficult position nowadays. They are confronted with problems such as which kind of values one would want citizens to embrace, or to what extent social practices of a particular group may differ from what is generally held. In this essay, Paul Smeyers and Yusef Waghid focus…

  20. Stanley Corrsin Award Lecture: Lagrangian Measurements in Turbulence: From Fundamentals to Applications

    Science.gov (United States)

    Bodenschatz, Eberhard

    2014-11-01

    In my talk I shall present results from particle tracking experiments in turbulence. After a short review of the history of the field, I shall summarize the most recent technological advances that range form low and high-density particle tracking to direct measurements of the Lagrangian evolution of vorticity. I shall embark on a journey that describes the discoveries made possible by this new technology in the last 15 years. I present results that challenge our understanding of turbulence and show how Lagrangian particle tracking can help us ask questions on turbulent flows that so far were hidden. I shall show how Lagrangian particle tracking may provide important insights into the reversibility of turbulent flows, on vorticity generation, the energy cascade and turbulent mixing. I shall describe the consequences of inertial particle transport on rain formation and end with an outlook on how Lagrangian particle tracking experiments on non-stationary flows in real-world situations may provide high quality data that can support real world engineering problems. I am very thankful for the support by Cornell University, the National Science Foundation, the Research Corporation, the Alfred P. Sloan Foundation, the Kavli Institute for Theoretical Physics, the German Research Foundation, the European Union and the Max Planck Society. I very gratefully acknowledge the excellent partnership with many colleagues in the field of fluid mechanics and turbulence.

  1. 75 FR 38557 - Application Nos. and Proposed Exemptions; D-11489, Morgan Stanley & Co., Incorporated; L-11609...

    Science.gov (United States)

    2010-07-02

    ... diversified group of clients and customers, including corporations, governments, financial institutions, and..., Philadelphia, PA. The Facility is comprised mainly of classrooms and indoor work areas, and it is used by... in additional funds to finance an expansion of the Facility by adding two new classrooms.\\10...

  2. Afganistan väärib meie abi / Stanley Davis Phillips

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2008-01-01

    Lääne toetus aitab Afganistani elanikel luua stabiilset, demokraatlikku ja majanduslikult elujõulist tulevikku. Kuigi töö Afganistanis on väga riskantne, on Eesti abiks sealsetel elanikel turvalise keskkonna loomisel

  3. In the labyrinth of time and eternity: on Stanley Kubrick’s The Shining

    Directory of Open Access Journals (Sweden)

    Kamil Kościelski

    2014-01-01

    Full Text Available In the interview which appeared after the premiere of The Shining, Kubrick said that the fantastic qualities of reality in his movies are “treated in a very […] ordinary way”. He indicated that uncanny events are also depicted in this way in Jorge Luis Borges’ writings. The comparison made by Kubrick should not be disregarded since the labyrinth motif, which does not appear in Stephen King’s book that has been adapted for the screen, is an important theme in Borges’ works as well as in The Shining. The Garden of Forking Paths, which was also written by this Argentinian writer, not only explores the above-mentioned motif, but also describes the conception of time which can be found in The Shining and in the last scene of Kubrick’s 2001: A Space Odyssey. Borges’ literary works might be helpful in comprehending Kubrick’s notion of the fourth dimension. The coexistence of different times in The Shining, in turn, refers to the theological idea of eternity. This conception corresponds to the main character’s nature – especially his desires, aspirations and anxieties. The established perspective provides an opportunity to exemplify what Kubrick meant by showing the fantastic qualities of reality “in a simple, non-baroque style”.

  4. Die Frage der Menschenrechte in Estland, Lettland und Litauen / V. Stanley Vardys

    Index Scriptorium Estoniae

    Vardys, Vytas Stanley, 1924-1993

    1984-01-01

    Varem avaldatud: Acta Baltica : liber annalis Instituti Baltici. Vol. 22. - Königstein im Taunus, 1982, lk. 181-209, korrigeeritud ja täiendatud lk. 162-164. - Lisa: Der baltische Appell von 1979 (Balti apell - Eest, Läti ja Leedu kodanike märgukiri, mis sisaldas nõuet avalikustada Molotovi-Ribbentropi pakt koos oma salaprotokollidega, kuulutada pakt kehtetuks selle allakirjutamise momendist peale ja taastada Balti riikide iseseisvus, avalikustati 23. aug. 1979) ; Offener Brief aus der Estnischen SSR (Avalik kiri Eest NSV-st, nn. 40 kiri, 28. okt. 1980)

  5. 77 FR 15125 - United States v. Morgan Stanley; Public Comments and Response on Proposed Final Judgment

    Science.gov (United States)

    2012-03-14

    ... that takes into account the losses suffered by retail electricity consumers. As this Court recognized... relief in consent judgment that contained recitals in which defendants asserted their innocence...

  6. Can Academic Freedom Be Justified? Reflections on the Arguments of Robert Post and Stanley Fish

    Science.gov (United States)

    Hammersley, Martyn

    2016-01-01

    It is widely recognised that academic freedom is currently under threat. But there is also considerable dispute about the meaning of the term. In this paper I examine two recent and important accounts of the nature of academic freedom that seek to distinguish it clearly from free speech. Such a distinction is, in my view, essential. The aim of the…

  7. Implementing Gardner's Theory of Multiple Intelligences at the College Level of Learning

    Science.gov (United States)

    Leckron, Lynn L.

    2013-01-01

    Today, more than ever, increasing numbers of adult learners are reentering the college arena. Teaching adult learners can be an overwhelming responsibility for educators, especially if they are unprepared to meet the diverse needs of these learners. The adult learner, no matter their age, still desires to be successful. By learning to identify and…

  8. Effect of superthermal electrons on dust-acoustic Gardner solitons in ...

    Indian Academy of Sciences (India)

    Author Affiliations. Deb Kumar Ghosh1 Yday Narayan Ghosh1 Prasanta Chatterjee1 C S Wong2. Department of Mathematics, Siksha Bhavana, Visva Bharati University, Santiniketan 731 235, India; Department of Physics, Plasma Research Laboratory, University of Malaya, 50603 Kuala Lumpur, Malaysia ...

  9. ESI-HI90 Gardner Pinnacles, NWHI, Hawaii 2001 (Environmental Sensitivity Index Map)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Environmental Sensitivity Index (ESI) maps are an integral component in oil-spill contingency planning and assessment. They serve as a source of information in the...

  10. 1987-88 Trapping Information and Regulations : The Gardner Division of Mark Twain National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document covers the general plan for trapping information and regulations. Trapping operations, methods of take, and special permit conditions are covered.

  11. Dust-ion-acoustic Gardner double layers in a dusty plasma with two ...

    Indian Academy of Sciences (India)

    Author Affiliations. M M Masud1 I Tasnim2 A A Mamun3. Department of Physics, Bangladesh University of Engineering & Technology, Dhaka, Bangladesh; Department of Physics, Begum Rokeya University, Rangpur, Bangladesh; Department of Physics, Jahangirnagar University, Savar, Dhaka-1342, Bangladesh ...

  12. In vitro growth and leaf anatomy of Cattleya walkeriana (Gardner, 1839 grown in natural ventilation system

    Directory of Open Access Journals (Sweden)

    Adriano Bortolotti da Silva

    2014-12-01

    Full Text Available Natural ventilation system facilitates gaseous exchanges in in vitro plants promoting changes in the leaf tissue, which can be evaluated through the leaf anatomy, and it allows a cultivation closer to the photoautrophic micropropagation. The objective of this work was to evaluate the effects on in vitro growth and on the leaf anatomy of Cattleya walkeriana grown in natural and conventional ventilation system with different concentrations of sucrose (0; 15; 30 and 45 L-1 combined with different cultivation systems (conventional micropropagation and natural ventilation system. The culture medium was composed of MS salts, solidified with 7 g L-1 of agar and pH adjusted to 5.8. Forty milliliters of culture medium were distributed in 250 mL flasks, autoclaved at 120 ºC for 20 minutes. The greater plant growth, as well as the greater thickness of the mesophyll was observed with the use of 20 g L-1 sucrose in natural ventilation system. Plants grown in natural ventilation system showed a thicker leaf mesophyll, which is directly related to photoautotrophic crops. The natural ventilation system induced more elliptical stomata and probably more functional formats.

  13. Mark Twain National Wildlife Refuge Gardner Unit Narrative report: September, October, November, December, 1958

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This narrative report for Great River National Wildlife Refuge outlines Refuge accomplishments from September through December of 1958. The report begins by...

  14. CRED REA Invertebrate Quantitative Assessments at Gardner Pinnacles, NW Hawaiian Islands, in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support a long-term NOAA Coral Reef Conservation Program (CRCP) for sustainable management and conservation of coral reef ecosystems, from 12 July - 17 August...

  15. Effect of superthermal electrons on dust-acoustic Gardner solitons in ...

    Indian Academy of Sciences (India)

    The properties of nonplanar (cylindrical and spherical) dust-acoustic solitary waves. (DASWs) in an unmagnetized ... negatively charged cold dust fluid, superthermal/non-Maxwellian electrons (represented by kappa distribution) and ... are long range, and the gravitational interaction is much weaker than the electromagnetic.

  16. Are I.Q. Tests Valid Measures of Intelligence? An Interview with Howard Gardner.

    Science.gov (United States)

    School Administrator, 1986

    1986-01-01

    Discuss seven basic intellectual competencies possessed by all human beings: linguistic, logical-mathematical, musical, spatial, bodily-kinesthetic, interpersonal, and intrapersonal. Because I.Q. tests can measure only the first two qualities, this interview suggests evaluating schools by quality of educational experiences and students by project…

  17. The First Seven...and the Eighth: A Conversation with Howard Gardner.

    Science.gov (United States)

    Checkley, Kathy

    1997-01-01

    Reviews seven multiple-intelligence forms (linguistic, logical-mathematical, spatial, bodily kinesthetic, musical, interpersonal, intrapersonal) and adds naturalist intelligence, the ability to discriminate among living things. Considers a ninth form (existential intelligence), challenges the IQ concept and common testing practices, and urges…

  18. Gardner; re BWV: Victorian Supreme Court makes landmark Australian ruling on tube feeding.

    Science.gov (United States)

    Ashby, Michael A; Mendelson, Danuta

    2004-10-18

    The Victorian Supreme Court has decided that artificial nutrition and hydration provided through a percutaneous gastrostomy tube to a woman in a persistent vegetative state may be withdrawn. The judge ruled, in line with a substantial body of international medical, ethical and legal opinion, that any form of artificial nutrition and hydration is a medical procedure, not part of palliative care, and that it is a procedure to sustain life, not to manage the dying process. Thus, the law does not impose a rigid obligation to administer artificial nutrition or hydration to people who are dying, without due regard to their clinical condition. The definition of key terms such as "medical treatment", "palliative care", and "reasonable provision of food and water" in this case will serve as guidance for end-of-life decisions in other states and territories. The case also reiterates the right of patients, and, when incompetent, their validly appointed agents or guardians, to refuse medical treatment. Where an incompetent patient has not executed a binding advance directive and no agent or guardian has been appointed, physicians, in consultation with the family, may decide to withdraw medical treatment, including artificial nutrition or hydration, on the basis that continuation of treatment is inappropriate and not in the patient's best interests. However, Victoria and other jurisdictions would benefit from clarification of this area of the law.

  19. CRED Towed-Diver Benthic Characterization Surveys at Gardner Pinnacles, NW Hawaiian Islands in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support NOAA Coral Reef Conservation Program (CRCP) long-term goals for sustainable management and conservation of coral reef ecosystems, towed-diver surveys...

  20. CRED Gridded Bathymetry of Northwest Gardner Pinnacles (100-011) in the Northwestern Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File 100-011b is a 60-m ASCII grid of depth data collected near Kure Atoll in the Northwestern Hawaiian Islands as of May 2003. This grid has been produced as part...

  1. CRED REA Invertebrate Quantitative Assessments at Gardner Pinnacles, NW Hawaiian Islands, in 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support a long-term NOAA Coral Reef Conservation Program (CRCP) for sustainable management and conservation of coral reef ecosystems, from 13 September - 17...

  2. Teaching Information Literacy through Learning Styles: The Application of Gardner's Multiple Intelligences

    Science.gov (United States)

    Mokhtar, Intan Azura; Majid, Shaheen; Foo, Schubert

    2008-01-01

    The key for students of today to become independent learners and knowledge workers of tomorrow lies in being information literate. However, existing information literacy (IL) teaching approaches have not always been successful in equipping students with these crucial skills to ensure deep erudition and long-lasting retention. Hence, sound…

  3. CRED REA Invertebrate Quantitative Assessments at Gardner Pinnacles, NW Hawaiian Islands, in 2000

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To support a long-term NOAA Coral Reef Conservation Program (CRCP) for sustainable management and conservation of coral reef ecosystems, from 08 September - 06...

  4. CRED Towed-Diver Fish Biomass Surveys at Gardner Pinnacles, NW Hawaiian Islands in 2003

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Towed-diver surveys (aka. Towboard surveys) are conducted by the Coral Reef Ecosystem Division (CRED) of the NOAA Pacific Islands Fisheries Science Center (PIFSC) as...

  5. 77 FR 25155 - Atlantic Power Energy Services (US) LLC; White Eagle Trading, LLC; Morgan Stanley Capital Group...

    Science.gov (United States)

    2012-04-27

    ... AGENCY: Office of Fossil Energy, Department of Energy (DOE). ACTION: Notice of orders. SUMMARY: The Office of Fossil Energy (FE) of the Department of Energy gives notice that during March 2012, it issued... summarized in the attached appendix and may be found on the FE Web site at http://www.fossil.energy.gov...

  6. International Conference in Memory of Stanley Milgram “Obedience to Authority: Experimental Obedience-Paradigm Yesterday, Today, Tomorrow”

    Directory of Open Access Journals (Sweden)

    A Y Voronov

    2015-12-01

    Full Text Available The article provides the information about the international conference “Obedience to Authority: Experimental Obedience-Paradigm yesterday, today, tomorrow”, held in Moscow State Regional Institute of Humanities and Social Studies, the main directions of its work and the subject of scientific reports.

  7. Factors associated with suicide attempts in 648 patients with bipolar disorder in the Stanley Foundation Bipolar Network

    NARCIS (Netherlands)

    Leverich, GS; Altshuler, LL; Frye, MA; Suppes, T; Keck, PE; McElroy, SL; Denicoff, KD; Obrocea, G; Nolen, WA; Kupka, R; Walden, J; Grunze, H; Perez, S; Luckenbaugh, DA; Post, RM

    Background: Clinical factors related to suicide and suicide attempts have been studied much more extensively in unipolar depression compared with bipolar disorder. We investigated demographic and course-of-illness variables to better understand the incidence and potential clinical correlates of

  8. G. Stanley Hall and Edward Thorndike on the Education of Women Theory and Policy in the Progressive Era.

    Science.gov (United States)

    Seller, Maxine

    1981-01-01

    Explores theories of educational psychologists Hall and Thorndike in relation to the education of women and examines the relationship of these theories to educational policy and the social context of the Progressive Era. The restrictive ideas of these psychologists were a response to anxieties about the increasing number of women entering the work…

  9. Frontiers in Fluid Mechanics: A Collection of Research Papers Written in Commemoration of the 65th Birthday of Stanley Corrsin.

    Science.gov (United States)

    1985-04-30

    1979), pp. 6. 51. S. Byggstoyl and W. Kollmann, Int. J. Heat Mass Transfer 24 (1981), pp. 1811. .’ 52. J. Jimenez, M. Cogollos, and L. P. Bernal , Fourth...Proc. Univ. of Md. 1961 Sympos., ed. J. B. Diaz and S.1. Pai5), pp. 105-24, New York: Gordon & Breach. 56. Corrsin, S. 1962. Theories of Turbulent

  10. USA suursaadik : Eesti peaks meedia tähelepanu ära kasutama / Stanley Davis Phillips ; interv. Holger Roonemaa

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2007-01-01

    USA suursaadik räägib Tõnismäe pronkssõdurist, viisavabaduse võimalikkusest Eesti ja USA vahel, suursaadiku plaanidest Eestis, president Toomas Hendrik Ilvese eelseisvast kohtumisest USA presidendi George W. Bushiga, USA ja Venemaa suhetest, Iraagi sõjast ning kommenteerib ühe USA presidendikandidaadi Pat Buchanani väidet, et USA jaoks oleks absurdne astuda sõtta näiteks Venemaaga, et kaitsta Eestit. Suursaadik soovitab Eestil aktiivselt ära kasutada Venemaa-poolsete küberrünnakutega kaasnenud meediakajastust. Ilmunud ka: Vaba Eesti Sõna 7. juuni 2007, lk. 10; ingl. k. Eesti Elu 8. juuni 2007, lk. 8-9, pealk.: U.S Ambassador: Estonia should take advantage of media attention

  11. A Union Voice for Racial Equality: Miles Stanley and Civil Rights in West Virginia, 1957-68

    Science.gov (United States)

    Fones-Wolf, Colin T.

    2004-01-01

    On October 15, 1959, union delegates from across West Virginia converged upon the Daniel Boone Hotel in the capital city of Charleston to participate in the West Virginia Labor Federation, AFL-CIO's second statewide constitutional convention. Charleston, at this time, remained a segregated city. So when G. William Dunn, an African-American…

  12. Miscellaneous notes on Loranthaceae 9—15. (Nrs. 1—8 in Recueil Trav. Bot. Néerl. 31, p. 223—223 and 751—760, 1937)

    NARCIS (Netherlands)

    Danser, B.H.

    1936-01-01

    Ramulus c. 2 mm crassus, apice paulum incrassatus, ad 5 mm dilatatus, 2 folia et 2 inflorescentias ferens, superficie tenuiter ferrugineo furfuraceus. Folia opposita; petiolus ut costae pars basalis ferrugineo furfuraceus, c. 8 mm longus, basi tereti c. 1.5 mm crassus, laminam versus supra

  13. Post-zerebrale Utopien: Im Grenzbereich zwischen künstlicher Intelligenz und technikzentrierter Erlösungsfantasien der 1990er

    OpenAIRE

    Seyringer, Simone

    2014-01-01

    Warum könnten Gehirn-Utopien aus den 1990ern heute interessant sein? Blockbuster wie "Transcendence" mit Johnny Depp, dessen Gehirn auf ein Computersystem geladen wird, oder populäre Hollywood-Produktionen wie "Her", die Serie "Real Humans" rekurrieren auf Utopien, um die es nach den 1990ern sehr leise geworden ist. Der Diskurs um "Mind-Upoloading", Neu- bzw. Selbstbestimmung von Identiät durch Cyborgisierung, oder digitale Unsterblichkeit ist mit den derzeit anlaufenden Big Science Projekten...

  14. Erläuterungen zum nestor-Siegel für vertrauenswürdige digitale Langzeitarchive. Version 2.0

    NARCIS (Netherlands)

    Bähr, Thomas; Gerdes, Thomas; Harmsen, J.H.; Keitel, Christian; Schmidt, Christoph; Schoger, Astrid; Schrimpf, Sabine; Schumann, Natascha; Schwab, Franziska; Stürzlinger, Martin; Wolf, Stefan

    2016-01-01

    Das von nestor entwickelte und angebotene Verfahren der erweiterten Selbstevaluierung für digitale Langzeitarchive auf der Grundlage der DIN-Norm 31644 bietet digitalen Langzeitarchiven eine abgestimmte und praxisgerechte Möglichkeit zu prüfen, ob sie gemäß der „Kriterien für vertrauenswürdige

  15. Trichomes and chemical composition of the volatile oil of Trichogonia cinerea (Gardner) R. M. King & H. Rob. (Eupatorieae, Asteraceae).

    Science.gov (United States)

    Fernandes, Yanne S; Trindade, Luma M P; Rezende, Maria Helena; Paula, José R; Gonçalves, Letícia A

    2016-03-01

    Trichogonia cinerea is endemic to Brazil and occurs in areas of cerrado and campo rupestre. In this study, we characterized the glandular and non-glandular trichomes on the aerial parts of this species, determined the principal events in the development of the former, and identified the main constituents of the volatile oil produced in its aerial organs. Fully expanded leaves, internodes, florets, involucral bracts, and stem apices were used for the characterization of trichomes. Leaves, internodes, florets, and involucral bracts were examined by light microscopy and scanning electron microscopy, whereas stem apices were examined only by light microscopy. Branches in the reproductive phase were used for the extraction and determination of the composition of the volatile oil. The species has three types of glandular trichomes, biseriate vesicular, biseriate pedunculate, and multicellular uniseriate, which secrete volatile oils and phenolic compounds. The major components identified in the volatile oil were 3,5-muuroladiene (39.56%) and butylated hydroxytoluene (13.07%).

  16. A Response to Gardner and Harrison: the Reasons for, and Implications of, Brexit from an Anthropological Standpoint

    Directory of Open Access Journals (Sweden)

    Megan Arnot

    2017-12-01

    Full Text Available This is a response to the Brexit, Archaeology and Heritage workshop held in May 2017 at the Institute of Archaeology, UCL. On the 23rd of June 2016, the majority of the United Kingdom (UK electorate voted in favour of leaving the European Union (EU, despite the implications of such a decision being unclear. Now, a year on, and with Article 50 signed, it is still no clearer what the terms of ‘Brexit’ are, or how the UK will fare culturally, socially, and economically as a result. This discussion article presents aspects of the author’s research relating to the link between voting decisions and 'life history theory' conducted as part of her Master’s research.

  17. Manual for ERLE (Energy-Related Laboratory Equipment). Instructions and information for institutions of higher learning concerning used energy-related laboratory equipment grants; Manual para ERLE [Equipo de Laboratorio Relacionado con la Energia]. Instrucciones e informacion para instituciones de educacion superior sobre subvenciones de equipo de laboratorio usado relacionado con la energia

    Energy Technology Data Exchange (ETDEWEB)

    1994-10-01

    This is a listing of energy related equipment available through the Energy-Related Laboratory Equipment Grant Program which grants used equipment to institutions of higher education for energy-related research. Information included is an overview of the program, how to apply for a grant of equipment, eligibility requirements, types of equipment available, and the costs for the institution.

  18. Valitsuskriisist valitsuskoalitsioonini / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2002-01-01

    Ilmunud ka: Hiiu Leht 8. veebr. lk. 2, ERL Teataja veebr. nr. 2 lk. 4, Valgamaalane 23. veebr. lk. 2, ERL Teataja märts lk. 2 (ka venekeelne). Valitsuskriisi parim lahendustee olnuks Riigikogu ennetähtaegsed valimised. ERL konstruktiivses opositsioonis. Autor: ERL. Parlamendisaadik

  19. Archeological Test Excavations at Eight Sites in the Lake Sharpe Project Area of Hughes, Lyman, and Stanley Counties, South Dakota 1987 Main Report

    Science.gov (United States)

    1990-04-01

    exotic gastropod artifact from 39LM146 was identified. The nonfossilized snail is tentatively classified to the family level as Neritidae (?) (A. M...members of the gastropod family Neritidae . This finding provides minimal support to suggest a temporal/cultural linkage between the aforementioned... Neritidae [?], cf. Anculosa/Leptoxis sp.), which is thought to have come from some source in the southeastern United States. This specimen presents us with

  20. Cultural Resources Reconnaissance Along the Cheyenne River Arm of Lake Oahe in Dewey, Haakon, Stanley, and Ziebach Counties, South Dakota. Volume 1. Main Report

    Science.gov (United States)

    1988-03-01

    19. Frison, George C., Michael Wilson, and Diane J. Wilson 1976 Fossil Bison and Artifacts from an Early Altithermal Period Arroyo Trap in Wyoming...Resource Surveys at Pass Creek, Nelson Butte, Babby Butte, Squaw-Humper Creek and Cuny Table in Jackson (Washabaugh) and Shannon Counties, South

  1. Archeological Test Excavations at Eight Sites in the Lake Sharpe Project Area of Hughes, Lyman, and Stanley Counties, South Dakota 1987. Appendixes A-O

    Science.gov (United States)

    1990-04-01

    showy clusters of small pinkish flowers. Two species of beebaim (Monarde fistulosa and Monarda oectinata) are presently found in the region (Johnson...21 Buckwheat or Dock (Polvoonum or Rumex) .................................................................. 21 Beebalm ( Monarda ...Botanical Sample) Cat. 0 Identification Common Name Part Whole Fragment 39HU83 804 Monarda Beebalm seed 2 Polvoonum or Rumex Buckwheat or Dock seed 3 Vitis

  2. PIMS(trademark): Remediation of Soil and Groundwater Contaminated With Metals. PIMS Remediation of Soil Contaminated with Lead at Camp Stanley Storage Activity, TX

    Science.gov (United States)

    2003-08-01

    Chemostratigraphy of Conodonts Across the Cambrian-Ordovician Boundary: Western U.S. and SE China.” In Conodonts : Investigative Tech. and Appl., Ed., R. L...Austin. Ellis Horwood, Ltd., London, pp. 259-286. Wright, Judith (1990) “ Conodont Apatite: Structure and Geochemistry,” In Biomineralization

  3. Biological investigations of Indian phaeophyceae 16. Antibacterial acitivity of phenolic substances, extracted from Sargassum johnstonii Setchell et Gardner collected from Okha, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, P.P.S.

    Free and hydrolysed phenolic substances were extracted from a dry sample of Sargassum johnstonii using 80% methanol and tested for their antibacterial activity by agar diffusion method. The growth of two gram-positive bacteria tested were inhibited...

  4. Biological investigations of Indian phaeophyceae: 17. Seasonal variation of antibacterial activity of total sterols obtained from frozen samples of Sargassum johnstonii Setchell et Gardner

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, P.P.S.

    From lipid fraction of frozen samples of Sargassum johnstonii unsaponifiable part was extracted with diethyl ether to isolate total sterols. The extracted sterols were obtained for a period of nine months and tested against test bacteria...

  5. CRED Shallow CTD Profiles; Gardner Pinnacle, Northwestern Hawaiian Islands (Papahanaumokuakea Marine National Monument); Cruise: HI0401, Data Date Range: 20040920-20040920 (NODC Accession 0039382).

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CRED shallow Conductivity-Temperature-Depth (CTD) casts are vertical profiles (max 30 meter depth, downcast only) of temperature, conductivity and pressure. Data are...

  6. CRED Shallow CTD Profiles; Gardner Pinnacle, Northwestern Hawaiian Islands (Papahanaumokuakea Marine National Monument); Cruise: OES0306, Data Date Range: 20030719-20030720 (NODC Accession 0039382).

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CRED shallow Conductivity-Temperature-Depth (CTD) casts are vertical profiles (max 30 meter depth, downcast only) of temperature, conductivity and pressure. Data are...

  7. Producción y propiedades de alginato de Sargassum sinicola (Setchell y gardner) y su aplicación en inmovilización celular

    OpenAIRE

    Yabur Pacheco, Ricardo

    2005-01-01

    Se llevó a cabo la producción de alginato de sodio del alga café S. sinicola como material para la inmovilización de la microalga Chlorella sorokiniana y co-inmovilización con la bacteria promotora de crecimiento de plantas, Azospirillum brasilense, para el tratamiento de aguas residuales. El alginato también se empleó para la formulación de microesferas de A. brasilense, para la inoculación de semillas de tomate, como promotores de crecimiento de plantas. Durante la producción se analizaron ...

  8. Eesti rahva tulevikule mõeldes / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2002-01-01

    Ilmunud ka: ERL : Vestnik nr. 5 lk. 2, Hiiu Leht 17. detsember lk. 2. Autor süüdistab keskvõimu sõnamurdlikkuses: 1990-ndate aastate maksureformi kogumispensionisüsteemi kriitika. Autor: ERL. Parlamendisaadik

  9. Rahvaliit nõuab enne euro kasutuselevõttu rahareferendumit / Mart Helme ; interv. Andrus Karnau

    Index Scriptorium Estoniae

    Helme, Mart, 1949-

    2004-01-01

    ERL-i kandidaat Euroopa Parlamendi valimistel vastab küsimustele, mis puudutavad ERL-i vastuseisu euro kasutuselevõtu suhtes, euroskeptikute kandideerimist europarlamenti, Eesti saadikute positsiooni EL-i Vene-poliitika kujundamisel. Lisa: Rahvaliidu nimekiri

  10. Iga kingsepp jäägu oma liistude juurde / Meida Vaarik

    Index Scriptorium Estoniae

    Vaarik, Meida

    2002-01-01

    Kui valitsus koosneks vaid asjatundjatest, kes ei hoolitse ainult oma isikliku heaolu eest, oleks Eestis paljud asjad hoopis teisiti, leiab ERL-i Pärnu linna osakonna esinaine Meida Vaarik. Autor: ERL

  11. Indekseerimine pole imerohi / Mai Treial

    Index Scriptorium Estoniae

    Treial, Mai, 1952-

    2001-01-01

    Vt. samas: ERL Teataja, nr. 5, mai 2001, lk. 4. TTÜ Eesti Majanduse Instituudi teadlased uurisid pensionikindlustusreformi majanduslikke ja sotsiaalseid aspekte. Uuringu tulemustest. Pensioni suurus 1999. aastal, kui pensionide indekseerimine oleks toimunud aastatel 1993-99. Autor: ERL. Parlamendisaadik

  12. Vaese valla edukuse tagab projektipõhine lisaraha / Maie Nisu

    Index Scriptorium Estoniae

    Nisu, Maie

    2007-01-01

    Riigikokku kandideeriv Alatskivi vallavanem vaatleb, kui palju on Tartumaa ja Jõgevamaa saanud projektide kaudu raha, ning kummutab väite, nagu eraldaks ERL raha ainult neile omavalitsustele, mille juhid kuuluvad ERL-i

  13. Tshestnost - zalog bolshoi pobedõ / Villu Reiljan

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2001-01-01

    Ilmunud ka: ERL Teataja, nr. 10, okt. 2001, lk. 3. Arnold Rüütli valimine presidendiks on selle tõenduseks, et demokraatia areng Eestis on õigel teel. Arnold Rüütli valimiskampaaniast. Autor: ERL. Parlamendisaadik

  14. Madalam või kõrgem tulumaksumäär? / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2002-01-01

    Reformierakonna ettepanekust alandada üksikisiku tulumaksu määra 26%-lt 20%-le. ERL-i üksikisiku maksukoormuse vähendamise ideest. Eesti talunike juhi Kaul Nurme maksuideoloogiast. Autor: ERL. Parlamendisaadik

  15. Kazhdõi sam za sebja

    Index Scriptorium Estoniae

    2004-01-01

    ERL-i juhatus arutas erakonna platvormi Euroopa Parlamendi valimistel. ERL-i esimehe Villu Reiljani sõnul ei saa eelseisvate europarlamendi valimistega seoses rääkida ühistest huvidest koalitsioonis

  16. Praegust majandusedu peab Reiljan seisakuks / Villu Reiljan ; interv. Kaarel Tarand

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2003-01-01

    ERL-i esimees Villu Reiljan vastab küsimustele, mis puudutavad ERL-i sõnumit maal ja linnas, sisemigratsiooni, toetuste katteallikaid, kohalike omavalitsuste ja riigi suhete muutumist, haldusterritoriaalset reformi, suhtumist EL-i, suhteid Venemaaga

  17. Eesti muutus monopolide paradiisiks / Elmar Truu

    Index Scriptorium Estoniae

    Truu, Elmar-Johannes, 1942-

    2001-01-01

    Ilmunud ka: ERL Teataja, nov. 2001, nr. 11, lk. 5. Riigikogu liikme Elmar Truu peaministrile esitatud arupärimisest, mis käsitles maksukoormuse ja hindade tõusu ning toimetulekutoetust. Peaminister Mart Laari vastusest. Autor: ERL. Parlamendisaadik

  18. Pengembangan Alat Permainan My Costume untuk Menstimulasi Kecerdasan Visual-Spasial pada Anak Usia Dini Autis

    Directory of Open Access Journals (Sweden)

    Dhiarti Tejaningrum

    2014-12-01

    Full Text Available Game is one of learning tools in early education for any children. My Costume is a game to stimule visual-spacial intellegence of children with autism. This tool is constructed from Research and Development (R&D study which utilizes the theories of M. Alessi Stephen R. Stanley Trollip (development theory and Howard Gardner (early education curricullum for children with autism. The stages of the research as follows: analysis, design and development. The development is conducted after obtaining validation from material/content expert, media specialist and limited experimental research. The research shows that the product of My Costume in general is appropriate to stimulate visual-spacial intellegence of children with autism in early education context. This is based on the of alpha tests from content expert is 4,6 (very good, alpha test from media specialist is 4,2 (good whereas beta test obtains 4,27 (very good and the final result is 4,06 (good. Pre-test visual-spacial intellegence assesment score is 2,18 (poor and post-test is 3,45 (good. Nevertheless, we can conclude that the product of My Costume is very appopriate to be a visual-spacial learning tool for children with autism.

  19. Rapla debatil räägiti tervishoiust / Kristiina Viiron

    Index Scriptorium Estoniae

    Viiron, Kristiina, 1971-

    2003-01-01

    Raplas toimunud valimiseelne erakondade debatt, kus võtsid sõna: Toomas Vilosius - Reformierakond, Tiit Toomsalu - ESDTP, Taavi Veskimägi - Res Publica, Arvo Sirendi - ERL, Kalle Talviste - Keskerakond, Ülo Vooglaid - Res Publica, Viive Rosenberg - Keskerakond, Jaak Herodes - Rahvaerakond Mõõdukad, Tõnis Blank - ERL, Andres Tarand - Rahvaerakond Mõõdukad, Tunne Kelam - Isamaaliit, Kaul Nurm - ERL

  20. Molodõje narodniki blesnuli umom ha jarmarke Intellektika / Olav Hoop

    Index Scriptorium Estoniae

    Hoop, Olav, 1984-

    2005-01-01

    ERL-i Tartu organisatsiooni juhatuse liikme hinnangul suhtlesid ERL-i noored poliitikud Tartus toimunud haridusmessi Intellektika külastajatega teiste erakondade noortest palju aktiivsemalt ning ta meenutab president Arnold Rüütli ja tema abikaasa Ingrid Rüütli külaskäiku ERL-i näituseboksi

  1. Valitsemise ilu ja valu / Tiit Tammsaar

    Index Scriptorium Estoniae

    Tammsaar, Tiit, 1951-

    2002-01-01

    Ilmunud ka: Harjumaa 22. jaan. lk. 2. ERL on arvamusel, et rahvalt tuleb küsida, mis suunas tahab kodanik Eesti riigi arengut tulevikus näha. Miks ERL otsustas jääda konstruktiivsesse opositsiooni. Autor: ERL. Parlamendisaadik

  2. Valijate tahe Tallinnas on taastatud / Marika Tuus

    Index Scriptorium Estoniae

    Tuus, Marika, 1951-

    2005-01-01

    Kuigi ERL esitas oma kongressil vasakerakondade ühinemise idee, pole senini sõnadest tegudeni jõutud. Kommenteerides Jaak Alliku esinemist telesaates "Terevisioon" 16. märtsil, ütleb autor, et ERL-il polnud koalitsioonivahetusel Tallinnas midagi kaotada, kuna rahvas ERL-ile Tallinna volikokku mandaati ei andnud

  3. Põllumees hammasrataste vahel / Toivo Palm

    Index Scriptorium Estoniae

    Palm, Toivo

    2002-01-01

    Ilmunud ka: ERL Teataja oktoober nr. 10 lk. 3. Riigikogu ERL-i fraktsiooni nõuniku Toivo Palmi sõnul panevad erakonnad, kes maaelu kujundamisel lähtuvad ainult minevikust, oma rahva vastu sisuliselt toime kuriteo. Autor: ERL

  4. Sõnade asemel ootame tegusid / Raili Lepik

    Index Scriptorium Estoniae

    Lepik, Raili

    2002-01-01

    ERL-i Järva maakonna esinaine Raili Lepik nimetab ERL-i seaduseelnõusid, mille arutelu Riigikogu esimesel töönädalal taas katkestati. Tulumaksuseaduse muutmise eelnõust, selle hääletamisest. Autor: ERL

  5. Regulation of floral patterning and organ identity by Arabidopsis ERECTA-family receptor kinase genes.

    Science.gov (United States)

    Bemis, Shannon M; Lee, Jin Suk; Shpak, Elena D; Torii, Keiko U

    2013-12-01

    Due to the lack of cell migration, plant organogenesis relies on coordinated cell proliferation, cell growth, and differentiation. A flower possesses a complex structure, with sepals and petals constituting the perianth, and stamens and pistils where male and female gametophytes differentiate. While advances have been made in our understanding of gene regulatory networks controlling flower development, relatively little is known of how cell-cell coordination influences floral organ specification. The Arabidopsis ERECTA (ER)-family receptor kinases, ER, ER-LIKE1 (ERL1), and ERL2, regulate inflorescence architecture, organ shape, and epidermal stomatal patterning. Here it is reported that ER-family genes together regulate floral meristem organization and floral organ identity. The stem cell marker CLAVATA3 exhibits misplaced expression in the floral meristems of the er erl1 erl2 mutant. Strikingly, homeotic conversion of sepals to carpels was observed in er erl1 erl2 flowers. Consistently, ectopic expression of AGAMOUS, which determines carpel identity, was detected in er erl1 erl2 flower primordia. Among the known downstream components of ER-family receptor kinases in stomatal patterning, YODA (YDA) is also required for proper floral patterning. YDA and the ER-family show complex, synergistic genetic interactions: er erl1 erl2 yda quadruple mutant plants become extremely small, callus-like masses. While a constitutively active YDA fully rescues stomatal clustering in er erl1 erl2, it only partially rescues er erl1 erl2 flower defects. The study suggests that ER-family signalling is crucial for ensuring proper expression domains of floral meristem and floral organ identity determinants, and further implies the existence of a non-canonical downstream pathway.

  6. Voices in American Education: Conversations with Patricia Biehl, Derek Bok, Daniel Callahan, Robert Coles, Edwin Dorn, Georgie Anne Geyer, Henry Giroux, Ralph Ketcham, Christopher Lasch, Elizabeth Minnich, Frank Newman, Robert Payton, Douglas Sloan, and Manfred Stanley.

    Science.gov (United States)

    Murchland, Bernard

    Interviews expressing a variety of viewpoints on the present and future status of education on a national and global scale are offered by 14 major educators and public figures. The theme of educational reform frames each interview. Patricia Biehl reflects on the diminishing effectiveness of secondary education. Derek Bok favors the teaching of…

  7. PUBLICATION BANS IN A FACEBOOK AGE: HOW INTERNET VIGILANTES HAVE CHALLENGED THE YOUTH CRIMINAL JUSTICE ACT’S “SECRECY LAWS” FOLLOWING THE 2011 VANCOUVER STANLEY CUP RIOT

    Directory of Open Access Journals (Sweden)

    Tania Arvanitidis

    2016-08-01

    Full Text Available On June 15th, 2011, a hockey riot occurred in Vancouver, British Columbia. This event is prominent in Canada’s history for, among other reasons, the unprecedented extent to which it was documented via photographs and video footage. The days that followed the riot saw much of this media documentation uploaded to social media platforms on the Internet, where Internet users worked together to identify and collectively “name and shame” those believed to have been involved in the disturbance. Several individuals targeted by these “Internet vigilantes” were young offenders whose identities are legally protected from publication under the Youth Criminal Justice Act (YCJA. This article examines the phenomenon of “Internet vigilantism”, and raises the issue of whether those provisions within the YCJA that prohibit the identification of youth remain relevant today, given the current difficulties in enforcing these provisions. Following an overview of these “secrecy provisions”, the phenomenon of Internet vigilantism is defined, and challenges posed by acts of Internet vigilantism are discussed. A “naming and shaming” Facebook group created for the purpose of identifying participants in the 2011 Vancouver riot is then looked to as a case study of Internet vigilantism in action. This article concludes with recommendations for how justice officials and social media outlets may modify current practices to better protect the safety and security of young offenders, and to minimize harmful instances of Internet vigilantism.

  8. Editorial Commentary: Helping Those Who Seek the Company of "Lord Stanley": Hockey Players and Hip Injuries Highlight the Current State and Future Challenges in Understanding, Treating, and Preventing Nonarthritic Hip Disease.

    Science.gov (United States)

    Christoforetti, John

    2016-09-01

    The state of the art in caring for athletic hip injuries requires comprehensive understanding of dynamic sport-specific biomechanical demands, accurate musculoskeletal diagnosis, and a mindset towards matching hip structure with functional demand at all levels of play. The sport of hockey presents a unique opportunity to review these fundamentals of modern management and illuminates the way towards future understanding of the cause of common nonarthritic hip conditions. Copyright © 2016 Arthroscopy Association of North America. Published by Elsevier Inc. All rights reserved.

  9. PUBLICATION BANS IN A FACEBOOK AGE: HOW INTERNET VIGILANTES HAVE CHALLENGED THE YOUTH CRIMINAL JUSTICE ACT’S “SECRECY LAWS” FOLLOWING THE 2011 VANCOUVER STANLEY CUP RIOT

    OpenAIRE

    Tania Arvanitidis

    2016-01-01

    On June 15th, 2011, a hockey riot occurred in Vancouver, British Columbia. This event is prominent in Canada’s history for, among other reasons, the unprecedented extent to which it was documented via photographs and video footage. The days that followed the riot saw much of this media documentation uploaded to social media platforms on the Internet, where Internet users worked together to identify and collectively “name and shame” those believed to have been involved in the disturbance. Seve...

  10. Review of "Handbook of Human Factors in Medical Device Design", edited by Matthew B. Weinger, Michael E. Wiklund and Daryle J. Gardner-Bonneau, Assistant Editor Loir M. Kelly

    Directory of Open Access Journals (Sweden)

    Gaev Jonathan A

    2011-06-01

    Full Text Available Abstract Human factors is the study of the relationship between people and devices or systems. The goal of considering human factors in the design of medical devices is to create devices that take into consideration the way people use technology and process information to create a man-machine interface that leads to the best possible performance. This text describes the significant aspects of human factors issues related to medical device design. It is well written and is useful for medical device designers and for others who use or evaluate medical equipment.

  11. Biological investigations of Indian phaeophyceae. 15, effect of antibacterial substance extracted from Sargassum johnstionii Setchell et Gardner collected from Okha, west coast of India on the growth of bacteria

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, P.P.S.

    Cruide either extract and two fractions from the lipid namely fraction A (unsaponifiable) and fraction B (saponifiable) were obtained from a dry sample of Sargassum johnstionii. From these extracts different concentrations viz., 150 mu g, 200 mu g...

  12. Efeito de combinações diferentes de reguladores de crescimento a partir da indução de botões de plântulas de Cattleya walkeriana Gardner (Orchidaceae - DOI: 10.4025/actascibiolsci.v25i1.2106 Effects of different combinations of growth regulators for bud induction from seedlings of Cattleya walkeriana Gardner (Orchidaceae - DOI: 10.4025/actascibiolsci.v25i1.2106

    Directory of Open Access Journals (Sweden)

    Priscila Vanessa Krapiec

    2003-04-01

    Full Text Available No presente estudo, foram investigadas diferentes combinações e concentrações de auxinas e citocininas para ativar o desenvolvimento de brotos e multiplicar plântulas de Cattleya walkeriana (Orchidaceae, sem estágio intermediário de calos. As plântulas de C. walkeriana foram cultivadas em meio B5, contendo 2% de sacarose, 0,65% de agar e combinações fatoriais das auxinas ácido naftalenoacético (NAA e ácido 3-indolbutírico (IBA, e das citocininas 6-benzilaminopurina (BA e cinetina (KIN, nas concentrações de 0,0; 0,5; 1,0 e 1,5mg/L. O maior número de brotos com folhas desenvolvidas foi formado nas plântulas cultivadas em meio contendo IBA e BA, enquanto o menor número de brotos foi observado na combinação NAA e KIN. Houve maior indução de brotos em meio contendo somente IBA (na ausência de citocininas nas três concentrações. A maior freqüência de indução de brotos usando as combinações de BA e IBA indicaram que essa combinação foi mais efetiva para a multiplicação in vitro de C. walkeriana, usando plântulas como explantesThe present study reports a research with different concentrations and combinations of auxins and cytokinins to activate bud development and to obtain multiplication of Cattleya walkeriana (Orchidaceae without an intermediate callus stage. Seedlings of C. walkeriana were cultured on B5 medium containing 2% sucrose and solidified with 0.65% agar, with factorial combinations of the auxins 1-naphthaleneacetic acid (NAA, 3-indolbutyric acid (IBA, and cytokinins 6-benzylaminopurine (BA and N-(2-furanyl-methyl-1-purine-6 amine (Kinetin at concentrations of 0.0, 0.5, 1.0, and 1.5 mg/L. The highest number of buds with elongated leaves occurred by cultivating seedlings on medium containing different concentrations of IBA and BA, while the lowest number was observed in NAA and KIN combination. IBA alone yielded better results at the three tested concentrations, when compared to the total absence of growth regulators. The higher frequency of bud induction using BA and IBA combination indicated that this combinations were more effective for C. walkeriana in vitro multiplication using seedlings as explants

  13. Antes y después de las inteligencias múltiples

    Directory of Open Access Journals (Sweden)

    Ana Sofía Vargas-Hernández

    2004-12-01

    Full Text Available In this article, a contrast between the traditional concept of intelligence and Gardner`s concept of multiple intelligences is discussed. The most significant details about the traditional educational system and the new one are also contrasted. After this, Gardner`s multiple intelligences are presented together with a proposal about how to implement this theory in the classroom for the benefit of the national educational community.

  14. Disease: H01267 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available /2) ... AUTHORS ... Suchi M, MacMullen CM, Thornton PS, Adzick NS, Ganguly A, Ruchelli ED, Stanley...in Invest 108:457-65 (2001) DOI:10.1172/JCI11294 ... PMID:9571255 (HHF6) ... AUTHORS ... Stanley CA, Lieu YK, Hsu B...auss L, Ganguly A, Katz LE, Stanley CA ... TITLE ... Familial leucine-sensitive hypoglycemia of infancy due to

  15. Ravnopravnõi Peeter / Vello Tafenau ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Tafenau, Vello, 1952-

    2007-01-01

    Riigikogu rahanduskomisjoni aseesimees vastab küsimustele, kuidas ERL viib oma valimisprogrammi potentsiaalsete valijateni, kas Eesti on lõpuks teel sotsiaalse riigi poole, kuidas ERL-il õnnestus säilitada aastatel 2003-2005 koalitsioonis olles oma nägu, kuidas muuta ERL-i ideed profülaktilisest suunast meditsiinis tegelikkuseks, kuidas praegustes tingimustes parandada majandussuhteid Venemaaga, kas Erakonna Eestimaa Rohelised tulek ei meenuta Res Publica tulekut

  16. Rahvaliit contra kolmikliit / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Järgneb: ERL Teataja, nr. 6, juuni 2001, lk. 3; nr. 7-8, juuli/aug. 2001, lk. 7; nr. 9, sept. 2001, lk. 3-4; nr. 10, okt. 2001, lk. 4; nr. 11, nov. 2001, lk. 2; nr. 12, dets. 2001, lk. 2. Ilmunud ka: ERL Teataja, nr. 5, mai 2001, lk. 2-3 (vene k.). Autor võrdleb Eestimaa Rahvaliidu eesmärke ja põhimõtteid kolmikliidu omadega. Autor: ERL. Parlamendisaadik

  17. Bodily-Kinesthetic Intelligence and Dance Education: Critique, Revision, and Potentials for the Democratic Ideal

    Science.gov (United States)

    Blumenfeld-Jones, Donald

    2009-01-01

    This paper offers a way of rethinking Howard Gardner's theory of Multiple Intelligences. The bodily-kinesthetic intelligence is used as the point of critique. The author provides a detailed discussion of the act of dancing as counterpoint to Gardner's understanding of the intelligence. The author critiques Gardner's exemplar and evolutionary…

  18. Peretoetuste mõõdukast kidumisest Mõõdukate toel / Mai Treial

    Index Scriptorium Estoniae

    Treial, Mai, 1952-

    2002-01-01

    Ilmunud ka: Meie Maa 12. veebr. lk. 2, Vooremaa 12. veebr. lk. 2,Virumaa Teataja 8. veebr. lk. 7, Põhjarannik, Severnoje Poberzhje 16. veebr. lk. 2, ERL Teataja veebr. nr. 2, lk. 3, Valgamaalane 19. veebr. lk. 2, venek. ERL Teataja märts lk. 3. ERL on korduvalt teinud ettepanekuid lastetoetusi suurendada, kuid viimati võimul olnud kolmikliit on need pidevalt kõrvale lükanud. Lastetoetusemäära suurendamise otsuse eelnõust ja riiklike peretoetuste seaduse muutmise eelnõust. Autor: ERL. Parlamendisaadik

  19. Isamaaliit ja Mõõdukad on eelnõu vastu, Rahvaliit poolt

    Index Scriptorium Estoniae

    2002-01-01

    Mart Laar, Tõnu Kõiv ja Toomas Paur kohalike valimiste erakonnastamisest. Autor: Isamaaliit. Autor: Rahvaerakond Mõõdukad. Autor: Isamaaliit. Autor: Rahvaerakond Mõõdukad. Autor: ERL. Parlamendisaadik

  20. Padar ja Ansip rahustasid nii USAst kui Venemaalt tulevate halbade uudiste kartjaid

    Index Scriptorium Estoniae

    2008-01-01

    Parlamendiliikmete Marek Strandbergi (EER), Tarmo Männi (ERL), Lembit Kaljuvee (Keskerakond) ja Olga Sõtniku (Keskerakond) küsimustele vastavad rahandusminister Ivari Padar ja peaminister Andrus Ansip

  1. Ot tshego i radi tsehgo pridjotsja otkazatsja zhiteljam Estonii posle prihoda Vashei partii k vlasti?

    Index Scriptorium Estoniae

    2003-01-01

    Valimiseelne debatt - vastavad Kristiina Ojuland - Reformierakond, Tiit Toomsalu - ESDTP, Mart Meri - Rahvaerakond Mõõdukad, Mihhail Stalnuhhin - Keskerakond, Stanislav Tsherepanov, Anatoli Jegorov - EÜVRP, Merike Metstak - ERL

  2. Kuidas kergendaksite Pärnumaa rannakalurite olukorda? / interv. Kaupo Meiel, Kalev Vilgats

    Index Scriptorium Estoniae

    2007-01-01

    Küsimusele vastavad Diana Beltadze (Reformierakond), Riho Erismaa (ERL), Hillar Talvik (Keskerakond), Tarmo Kõuts (Erakond Eestimaa Rohelised), Marianne Mikko (SDE), Urmas Aava (IRL) ja Enn Veesalu (EKD)

  3. Dicty_cDB: SSB559 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available knqllmdqliicqlkdvnylrksmqttvqklnkn*iqkk*t Frame C: kkkrkkenkenlifkkknaknyxshmlnxiigiyflwrtnferkmlhetr*l*kde...IADGSINHMPAQGRQLFEEIYANNCPKA**klnskein Frame B: qkkkkkrkqrkpnf*kkkckklfxsya*fxhwylflmenklraqnvt*dsmivkr*erle

  4. Zum Vorkommen von Wildbienen und Wespen (Hymenoptera, Aculeata) : auf Magerrasenflächen, Wald- und Wegrändern, verschiedenen Grünlandbereichen der (Nethe-) Flussaue sowie im Siedlungsbereich bei den Ortschaften Ottbergen, Bruchhausen und Amelunxen (Nordrhein-Westfalen, Landkreis Höxter) ; eine erläuterte Liste der nachgewiesenen Wildbienen und Wespen

    OpenAIRE

    Reidt, Jörg von der

    2006-01-01

    Die Bestimmung der gefangenen und präparierten Belegindividuen erfolgte mit einem Stereomikroskop (Binokular) bei ca. 30 bis 60 Vergrößerung. Für die Determination der Bienen und Wespen, insbesondere für einzelne Gattungen der Familie Apidae, ist eine Vielzahl von spezieller Bestimmungsliteratur erforderlich. Zur besseren Übersicht ist die, für die Determination als auch die zur Klärung systematischer und nomenklatorischer Fragen, benutzte Literatur in der nachfolgenden Tabelle aufgeführt....

  5. Reiljan : paremjõudude liit oleks Eestile raske / Villu Reiljan ; interv. Tuuli Koch

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2005-01-01

    ERL-i esimees vastab küsimustele, kui ohtlik oleks praegu ainult paremjõudude valitsus, kas president võib talle teha pakkumise hakata valitsust moodustama, milline on ERL-i võimalus võimule tulla, kui palju võtavad erakonnad oma otsustes praegu arvesse seda, et järgmisel aastal toimuvad presidendivalimised

  6. Vastavad jääjad ja lahkuja

    Index Scriptorium Estoniae

    2003-01-01

    Pärnumaalt Riigikokku valitud (Koit Pikaro - Keskerakond, Väino Linde - Reformierakond, Tiit Sinissaar - Isamaaliit, Jaanus Männik - ERL, Toomas Vilosius - Reformierakond, Trivimi Velliste - Isamaaliit, Andres Varik - ERL) räägivad nelja aasta jooksul Riigikogus ja Pärnumaal ning Pärnumaa heaks tehtust

  7. Rahvaliit otsib siseministrile järglast? / Kristjan Roos

    Index Scriptorium Estoniae

    Roos, Kristjan, 1978-

    2005-01-01

    SL Õhtulehe andmetel otsivad ERL juhid infarktist paraneva siseministri Margus Leivo asemele uut siseministrit, väidetavalt võib uueks siseministriks saada Mario Sootna. ERL-i aseesimehe Jüri Saare sõnul on sel teemal kohatu arutleda, kuni Leivo endaga pole sellest räägitud

  8. Milleks meile valitsus? / Rainer Kattel

    Index Scriptorium Estoniae

    Kattel, Rainer, 1974-

    2003-01-01

    Ilmunud ka: Estonija 2. dets. lk. 11. TTÜ professor Rainer Kattel analüüsib ERL-i ja Reformierakonna maksualaseid seisukohti. Tema hinnangul ei suurenda ei ERL-i ega Reformierakonna maksukavad kaugemas perspektiivis Eesti inimeste jõukust. Negatiivsete trendide muutmiseks on vaja alustada Eesti tööstuse moderniseerimisest

  9. Issledovanije podtverdilo neobhodimost studentsheskoi zarplatõ

    Index Scriptorium Estoniae

    2007-01-01

    Eesti Üliõpilaskondade Liidu tellimusel ja koostöös Euroopa Sotsiaalfondiga valminud küsitlusuuring näitas vajadust seada sisse tudengipalk. Tudengipalga idee on esitanud ERL-i noorteühendus. ERL-i aseesimees Karel Rüütli uuringu tulemustest

  10. Kto otpravit pensionerov na Lunu? / Rodion Denissov

    Index Scriptorium Estoniae

    Denissov, Rodion

    2005-01-01

    Ilmunud ka: Za Narod! veebr. nr. 1 lk. 6. ERL-i vene pensionäride klubi koordinaatori sõnul näevad paljud vene pensionärid ERL-is seda jõudu, mis aitab neid mitte ainult valimiste eel, vaid ka pärast valimisi

  11. Saaremaa rahvaliitlased on liitumise osas ettevaatlikud / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    Keskerakonna poolt Rahvaliidule tehtud ühinemisettepanekut arutanud ERL Saaremaa maakonnaühendus ei poolda liitumist seni väljapakutud tingimustel. SDE juhatus moodustas töörühma, kes hakkab pidama konsultatsioone ERL-i ja EER-iga võimaliku liitumise üle

  12. Parts asus koalitsiooni päästma / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2003-01-01

    Opositsioon ja ERL hääletasid Riigikogus tulumaksuseaduse eelnõusse Mõõdukate ettepaneku, mis jätaks 2004. aastal ära lubatud maksulanguse. Peaminister Juhan Parts alustas kõnelusi ERL-i esimehe Villu Reiljaniga

  13. Reiljan pöörab Partsile ja Kallasele lõplikult selja / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2003-01-01

    ERL-i esimehe Villu Reiljani sõnul ei lepi ERL pideva maksubaasi alandamise, ühishuvide ning sotsiaalsete vajaduste eiramise ja koalitsioonileppe valikulise täitmisega. Jätkuvad Isamaaliidu esimehe Tunne Kelami ja peaminister Juhan Partsi konsultatsioonid

  14. Rahvaliit nõuab neljarealist Tallinna-Tartu maanteed / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2006-01-01

    ERL-i esimehe Villu Reiljani sõnul võib Tallinna-Tartu maantee tarbeks vabalt kasutada mitte ainult Euroopa vahendeid, vaid ka Eesti oma raha ja laenuraha. ERL-i volikogu otsustas, et riigil tuleb Eesti Raudtee aktsiad õiglase hinnaga tagasi osta

  15. Tshetvero v lodke / Maksim Rogalski

    Index Scriptorium Estoniae

    Rogalski, Maksim

    2003-01-01

    ERL-i esimehe Villu Reiljani sõnul ei ole ERL vaimustuses Isamaaliidu kutsumisest koalitsiooniläbirääkimistele, kuid on valmis istuma läbirääkimiste laua taha ka siis, kui neist võtab osa Isamaaliit

  16. Tšernobõli järelkajad / Mai Treial

    Index Scriptorium Estoniae

    Treial, Mai, 1952-

    2001-01-01

    Siiani ei ole õiguslikku alust, kuidas Tšhernobõli aatomielekrijaama avarii tagajärgede likvideerimisel osalenute meditsiinilisi uuringuid korraldatakse. Sotsiaalminister Eiki Nestori vastusest Mai Treiali arupärimisele 18. aprillil. Autor: ERL. Parlamendisaadik. Ilmunud ka: ERL Teataja, mai, nr. 5, lk. 7

  17. Pensionid sotside silmakirjalikkuse võrgus / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2006-01-01

    Riigikogu liige kritiseerib pensionireformi ja sotsiaaldemokraatide propageeritavat uut pensioniindeksit. Tema sõnul on kolme viimase aasta jooksul ERL-i eestvõttel tehtud nii mõndagi selle reformi vigade parandamiseks ning alati, kui ERL kannab valitsusvastutust, tõstetakse pensione palgast kiiremini

  18. Edasi tänaste pensionäride kukil! / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Riigikogu ja ERL liige Janno Reiljan leiab, et kolmikliidu pensionipoliitika kohaselt hoitakse tulevaste pensionäride jaoks tänaste arvel kokku. Tabel ja diagrammid: SKP võrrelduna keskmise netopalgaga 1999-2008; Rahvaliidu ja kolmikliidu pensionipoliitika võrdlus. Autor: ERL. Parlamendisaadik

  19. U nas mnogo obshtshihh del / Villu Reiljan ; interv. Nikolai Bojartshuk

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2006-01-01

    ERL-i esimees vastab küsimustele, mis puudutavad Eestis elava vene elanikkonna võimalust rakendada oma potentsiaali Eesti riigi ülesehituseks, Ida-Virumaad, eestlaste ja venelaste vaheliste suhete praegust seisu, Rahvaliidu vene osakonna liikmete võimalust esindada, kaitsta venelaste huve, ERL-i positsioone Lõuna-Eestis

  20. Environmental Risk Limits for Nine Trace Elements

    NARCIS (Netherlands)

    Vlaardingen PLA van; Posthumus R; Posthuma-Doodeman CJAM; SEC

    2005-01-01

    In this report, we present an update of environmental risk limits (ERLs), based on the literature, for nine trace elements, namely, beryllium (Be), vanadium (V), cobalt (Co), selenium (Se), molybdenum (Mo), tin (Sn), antimony (Sb), barium (Ba) and thallium (Tl). The updated ERLs, established for

  1. Lead Detection and Mapping with Reference to Relationships Between Scale, Sensor Characteristics, Surface Conditions and Atmospheric Properties

    Science.gov (United States)

    1993-10-01

    2.40. The wideband (350-695 nm) pyrheliometer data were collected at the NOAA Climate Monitoring and Diagnostics Laboratory’s Barrow Observatory ( CMDL ...Analysis of meteorological conditions during AGASP-IV: March 30-April 23, 1992. I NOAA Tech. Memo. ERL CMDL -5, NOAA/ERL/Climate Monitoring and

  2. ICFA Beam Dynamics Newsletter

    Energy Technology Data Exchange (ETDEWEB)

    Ben-Zvi I.; Kuczewski A.; Altinbas, Z.; Beavis, D.; Belomestnykh,; Dai, J. et al

    2012-07-01

    The Collider-Accelerator Department at Brookhaven National Laboratory is building a high-brightness 500 mA capable Energy Recovery Linac (ERL) as one of its main R&D thrusts towards eRHIC, the polarized electron - hadron collider as an upgrade of the operating RHIC facility. The ERL is in final assembly stages, with injection commisioning starting in October 2012. The objective of this ERL is to serve as a platform for R&D into high current ERL, in particular issues of halo generation and control, Higher-Order Mode (HOM) issues, coherent emissions for the beam and high-brightness, high-power beam generation and preservation. The R&D ERL features a superconducting laser-photocathode RF gun with a high quantum efficiency photoccathode served with a load-lock cathode delivery system, a highly damped 5-cell accelerating cavity, a highly flexible single-pass loop and a comprehensive system of beam instrumentation. In this ICFA Beam Dynamics Newsletter article we will describe the ERL in a degree of detail that is not usually found in regular publications. We will discuss the various systems of the ERL, following the electrons from the photocathode to the beam dump, cover the control system, machine protection etc and summarize with the status of the ERL systems.

  3. Uddannelsesvidenskab og pædagogik

    DEFF Research Database (Denmark)

    Kirkegaard, Preben Olund

    2014-01-01

    Pædagogikkens grundproblemler bliver behandlet ud fra den afdøde norske didaktik og pædagogik professor Erling Lars Dales forfatterskab.......Pædagogikkens grundproblemler bliver behandlet ud fra den afdøde norske didaktik og pædagogik professor Erling Lars Dales forfatterskab....

  4. Effects of a Positive Feedback Loop upon the Stability of Bi-Connected Elementary Biochemical Reaction Cycles

    Science.gov (United States)

    Kang, Jiyoung; Tateno, Masaru

    2017-07-01

    We explored the stability transitions of a biochemical reaction network that were induced by a positive feedback loop (PFL) through kinetics-based mathematical modeling, and identified a novel role of the PFL. First, we proposed the elementary reaction loop (ERL) as a building block of biochemical networks. Then, we analyzed the effects of a PFL upon the responses of a bi-connected ERL (bc-ERL) by exploring the stability of the steady-state equations of the bc-ERL and bc-ERL/PFL in the parameter space. Although previously, the bc-ERL was theoretically predicted to be bistable even in the absence of a PFL, we identified all types of conceivable stability transitions induced by the PFL herein. Thus, this is the first report of the transition from bistability (bc-ERL) to monostability (bc-ERL/PFL) (i.e., the b → m transition), for which the origin was the significantly lower Michaelis-Menten constant in the PFL. The biological roles of the b → m transition are discussed.

  5. Rahvaliit rassib sügislõikuse nimel / Villu Reiljan ; interv. Riina Kuru

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2002-01-01

    ERL esimees Villu Reiljan sõidab mööda Eestimaad, et jõuda isiklikult võimalikult paljude tulevast häälekandjateni. Valimiste teemal kommenteerivad Ken-Marti Vaher ja Tõnu Kõiv. Autor: ERL. Parlamendisaadik

  6. Concept of economic readiness levels assessment

    Science.gov (United States)

    Yuniaristanto, Sutopo, W.; Widiyanto, A.; Putri, A. S.

    2017-11-01

    This research aims to build a concept of Economic Readiness Level (ERL) assessment for incubation center. ERL concept is arranged by considering both market and business aspects. Every aspect is divided into four phases and each of them consists of some indicators. Analytic Hierarchy Process (AHP) is used to develop the ERL in calculating the weight of every single aspect and indicator. Interval scale between 0 and 4 is also applied in indicator assessment. In order to calculate ERL, score in every indicator and the weight of both the aspect and indicator are considered. ERL value is able to show in detail the innovative product readiness level from economic sight, market and business aspect. There are four levels in Economic Readiness Level scheme which are investigation, feasibility, planning and introduction.

  7. High Current Energy Recovery Linac at BNL

    Energy Technology Data Exchange (ETDEWEB)

    Vladimir N. Litvinenko; Donald Barton; D. Beavis; Ilan Ben-Zvi; Michael Blaskiewicz; J.M. Brennan; A. Burrill; R. Calaga; P. Cameron; X. Chang; Roger Connolly; D. Gassner; H. Hahn; A. Hershcovitch; H.C. Hseuh; P. Johnson; D. Kayran; J. Kewisch; R. Lambiase; G. McIntyre; W. Meng; T. C. Nehring; A. Nicoletti; D. Pate; J. Rank; T. Roser; T. Russo; J. Scaduto; K. Smith; T. Srinivasan-Rao; N. Williams; K.-C. Wu; Vitaly Yakimenko; K. Yip; A. Zaltsman; Y. Zhao; H. Bluem; A. Burger; Mike Cole; A. Favale; D. Holmes; John Rathke; Tom Schultheiss; A. Todd; J. Delayen; W. Funk; L. Phillips; Joe Preble

    2004-08-01

    We present the design, the parameters of a small test Energy Recovery Linac (ERL) facility, which is under construction at Collider-Accelerator Department, BNL. This R&D facility has goals to demonstrate CW operation of ERL with average beam current in the range of 0.1 - 1 ampere, combined with very high efficiency of energy recovery. A possibility for future up-grade to a two-pass ERL is considered. The heart of the facility is a 5-cell 700 MHz super-conducting RF linac with HOM damping. Flexible lattice of ERL provides a test-bed for testing issues of transverse and longitudinal instabilities and diagnostics of intense CW e-beam. ERL is also perfectly suited for a far-IR FEL. We present the status and our plans for construction and commissioning of this facility.

  8. Surrender - A Soldier’s Legal, Ethical, and Moral Obligations; with Philippine Case Study.

    Science.gov (United States)

    1989-06-02

    of Combat in the American Civil War. (New York, NY: The Free Press, 1987), p. 35. 2 Stanley Milgram , Obedience to Authority ; An Experimental View...American Civil War. New York, NY: The Free Press, 1987. Milgram , Stanley . Obedience to Authority . New York, NY: Harper and Row, 1974. Millett, Allan R...indispensable element if discipline is to be maintained. Behavioral scientist Stanley Milgram called obedience "the dispositional cement that binds men

  9. Inter- og intrapersonlig kompetence som 'to intelligenser'?

    DEFF Research Database (Denmark)

    Jensen, Bente; Jensen, Jørgen Aage

    2001-01-01

    Within Howard Gardners' theory of multiple intelligences, the two intelligences of intra- and interpersonal intelligence are discussed. The issue is relevant firstly because the concept of intelligence is intensively discussed in order to viewe human competence from a personal, social......, and instrimumental point of view, and secondly because Gardner's theory has attarcted wide attention in the world of pedagogy. The intention of the article is thus to examine if and how Gardner argues the existence of the 'personal intelligences'....

  10. Sajandi õudseimad horror-filmid / Mari Rebane

    Index Scriptorium Estoniae

    Rebane, Mari

    2004-01-01

    Meelelahutusajakirja "Entertainment Weekly" valis läheneva halloweeni puhuks välja parimad ja õudsemad õudusfilmid. Kõrgeima kunstilise tasemega õudusfilmiks tunnistati Stanley Kubricku "The Shining" (1980)

  11. 77 FR 34067 - Notice Pursuant to the National Cooperative Research and Production Act of 1993-National Warheads...

    Science.gov (United States)

    2012-06-08

    ...., Rockville, MD; John Hopkins University Applied Physics Laboratory LLC, Laurel, MD; Lumimove, Inc., (dba....), Spooner, WI; Stanley Associates, Inc., Huntsville, AL; Surface Optics Corporation, San Diego, CA; The...

  12. Gingival tissue healing following Er:YAG laser ablation compared to electrosurgery in rats.

    Science.gov (United States)

    Sawabe, Masanori; Aoki, Akira; Komaki, Motohiro; Iwasaki, Kengo; Ogita, Mayumi; Izumi, Yuichi

    2015-02-01

    The erbium-doped yttrium aluminum garnet (Er:YAG) laser is currently used for periodontal soft tissue management with favorable outcomes. However, the process of wound healing after Er:YAG laser (ErL) treatment has not been fully elucidated yet. The aim of this study was to investigate the gingival tissue healing after ErL ablation in comparison with that after electrosurgery (ElS). Gingival defects were created in 28 rats by ablation with ErL irradiation or ElS. The chronological changes in wound healing were evaluated using histological, histometrical, and immunohistochemical analyses. The ErL-ablated gingival tissue revealed much less thermal damage, compared to the ElS. In the ElS sites, the postoperative tissue destruction continued due to thermal damage, while in the ErL sites, tissue degradation was limited and the defects were re-epithelialized early. Heat shock protein (Hsp) 72/73 expression was detected abundantly remote from the wound in the ElS, whereas it was slightly observed in close proximity to the wound in the ErL sites. Hsp47 expression was observed in the entire connective tissue early in the wound healing and was found limited in the wound area later. This phenomenon proceeded faster in the ErL sites than in the ElS sites. Expression of proliferating cell nuclear antigen (PCNA) persisted in the epithelial tissue for a longer period in the ElS than that in the ErL. The ErL results in faster and more favorable gingival wound healing compared to the ElS, suggesting that the ErL is a safe and suitable tool for periodontal soft tissue management.

  13. Kogumispensionide seadusega on probleeme / Mai Treial

    Index Scriptorium Estoniae

    Treial, Mai, 1952-

    2001-01-01

    Ilmunud ka: Virumaa Teataja, 14. sept. 2001, lk. 7; Hiiumaa, 15. sept. 2001, lk. 2; Koit, 15. sept. 2001, lk. 6; Meie Maa, 14. sept. 2001, lk. 2; Lääne Elu, 18. sept. 2001, lk. 4; Nädaline, 20. sept. 2001, lk. 4; Vooremaa, 22. sept. 2001, lk. 4; Valgamaalane, 25. sept. 2001, lk. 4; Järva Teataja, 28. sept. 2001, lk. 2; ERL Teataja, nov., nr. 11, 2001, lk. 5. Riigikogu ümarlaud teemal "Kogumispensionid - kes võidab, kes kaotab" 10. sept. 12. sept. võeti kogumispensionide seadus vastu, kuigi seda ei pooldanud ERL, Koonderakonna, Keskerakonna ja EÜRP fraktsioonid. Autor: ERL. Parlamendisaadik

  14. A FIRST LOOK AT BEAM DIAGNOSTICS FOR THE RHIC ELECTRON COOLING PROJECT.

    Energy Technology Data Exchange (ETDEWEB)

    CAMERON, P.; BEN-ZVI, I.; KEWISCH, J.; LITVINENKO, V.

    2005-06-06

    High energy electron cooling [1] is essential to meet the luminosity specification for RHIC II [2]. In preparation for electron cooling, an Energy Recovery Linac (ERL) test facility [3] is under construction at BNL. A preliminary description of Diagnostics for the ERL was presented at an earlier workshop [4]. A significant portion of the eCooling Diagnostics will be a simple extension of those developed for the ERL test facility. In this paper we present a preliminary report on eCooling Diagnostics. We summarize the planned conventional Diagnostics, and follow with more detailed descriptions of Diagnostics specialized to the requirements of high-energy magnetized cooling.

  15. Potshemu ne goditsja nõheshnjaja sistema nalogooblazhenija?

    Index Scriptorium Estoniae

    2003-01-01

    Oma arvamuse Eesti maksusüsteemi kohta ütlevad: Siim Kallas - Reformierakond, Tõnis Palts - Res Publica, Nikolai Maspanov - VEE, Eiki Nestor - Rahvaerakond Mõõdukad, Tiit Toomsalu - ESDTP, Küllo Arjakas - Keskerakond, Mart Opmann - ERL

  16. Pilk Toompealt kaugemale / Elmar Truu ; interv. Imbi Jeletsky

    Index Scriptorium Estoniae

    Truu, Elmar-Johannes, 1942-

    2001-01-01

    Koonderakonna opositsioonipoliitik Elmar Truu peab tähtsaks valijate arvamust ja sotsiaalküsimuste lahendamist ning selgitab millised on Riigikogus opositsioonipoliitiku võimalused. Autor: ERL. Parlamendisaadik

  17. Human impact on a small barrier reef meadow of Posidonia oceanica (L.) Delile on the north Tyrrhenian coast (Italy).

    Science.gov (United States)

    Mauro, Lenzi; Paola, Gennaro; Margherita, Volterrani; Rugiada, Roffilli; Francesca, Birardi; Primo, Micarelli; Duccio, Solari; Enrica, Franchi

    2013-12-15

    The health status of an emerging Posidonia oceanica meadow, subject to high human impact, was studied. Biometric variables, heavy metals, PAHs and C, N, P contents were determined in sediment and seagrass samples. The meadow was found to grow under oligotrophic conditions and an increase in nutrient content was only recorded in autumn. In sediment, Hg exceeded its ERL (effects range low) and sometimes also its ERM (effects range medium), and Cu was close to its ERL. In leaves, Hg and Cu were relatively high but below their respective ERLs. Sediments close to the meadow were heavily contaminated with pyrolytic PAHs, some of which exceeded their ERLs. P. oceanica did not show major accumulation of PAHs, lighter molecules predominating. Despite 40 years of intense human activity, meadow growth dynamics and contaminant accumulation did not suggest that the meadow was regressing. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. High Current Energy Recovery Linac at BNL

    CERN Document Server

    Litvinenko, Vladimir N; Ben-Zvi, Ilan; Blaskiewicz, Michael; Bluem, Hans; Brennan, Joseph M; Burger, Al; Burrill, Andrew; Calaga, Rama; Cameron, Peter; Chang, Xiangyun; Cole, Michael; Connolly, Roger; Delayen, Jean R; Favale, Anthony; Gassner, David M; Hahn, Harald; Hershcovitch, Ady; Holmes, Douglas; Hseuh Hsiao Chaun; Johnson, Peter; Kayran, Dmitry; Kewisch, Jorg; Lambiase, Robert; Mahler, George; McIntyre, Gary; Meng, Wuzheng; Nehring, Thomas; Nicoletti, Tony; Oerter, Brian; Pate, David; Phillips, Larry; Preble, Joseph P; Rank, Jim; Rao, Triveni; Rathke, John; Roser, Thomas; Russo, Thomas; Scaduto, Joseph; Schultheiss, Tom; Smith, Kevin T; Todd, Alan M M; Warren Funk, L; Williams, Neville; Wu, Kuo-Chen; Yakimenko, Vitaly; Yip, Kin; Zaltsman, Alex; Zhao, Yongxiang

    2004-01-01

    We present the design and the parameters of a small Energy Recovery Linac (ERL) facility, which is under construction at BNL. This R&D facility has goals to demonstrate CW operation of ERL with average beam current in the range of 0.1 - 1 ampere, combined with very high efficiency of energy recovery. The possibility for future up-grade to a two-pass ERL is being considered. The heart of the facility is a 5-cell 703.75 MHz super-conducting RF linac with HOM damping. Flexible lattice of ERL provides a test-bed for testing issues of transverse and longitudinal instabilities and diagnostics of intense CW e-beam. We present the status and plans for this facility.

  19. 21. X avati Kaunase kunstibiennaal "Textile 2005"

    Index Scriptorium Estoniae

    2005-01-01

    Eestist osalevad Mare Kelpmann, Marika Kööbi, Aet Ollisaar, Kadi Pajupuu, Ludmilla Svarzhevska, Hanna Tiidus, Helen Kauksi, Krista Leesi, Aune Taamal, Erika Tammpere, Milvi Thalheim ja Erle Võsa-Tangsoo

  20. Bitcoins, Blockchain und Distributed Ledgers: Funktionsweise, Marktentwicklungen und Zukunftsperspektiven

    National Research Council Canada - National Science Library

    Brühl, Volker

    2017-01-01

    .... Sie funktionieren auf Basis der Blockchain- bzw. Distributed-Ledger-Technologie. Volker Brühl erläutert ihre Funktionsweise und zeigt auf, dass diese Technologien nicht nur den Finanzsektor revolutionieren...

  1. Valimised 2002 : Tartu linnapeakandidaadid prioriteetidest linna arengus : kolm esimest ülesannet

    Index Scriptorium Estoniae

    2002-01-01

    Artiklite autorid: Andrus Ansip Reformierakonnast, Tõnu Kauba Keskerakonnast, Jüri Kumar ERL-ist, Ivar Tallo Mõõdukatest, Tõnis Lukas Isamaaliidust, Teet Jagomägi Res Publicast. Parlamendisaadik

  2. Dicty_cDB: VSI379 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available erl*slkihtmhs*snytvs*pveptpsstrls*rdyyklkpi dhqfqsqelpi**rteravrllfvlvpllmmkdy*ta... C: ntqwpsinpkds*erpverl*slkihtmhs*snytvs*pveptpsstrls*rdyyklkpi dhqfqsqelpi**rteravrllfvlvpllmmkdy*taqnslfv...h*dslkllvqessklvv khylsinsl*ldqevttls*SKVLPKLEKSTNISVELQVYQVPMLVLMSVQKVLNSKDQR PEIHKGKKKIKSPIKNKKK--- ---qfqsqelpi

  3. Wutz Handbuch Vakuumtechnik

    CERN Document Server

    2012-01-01

    Dieses Standardwerk gibt dem Leser umfassend Auskunft über Theorie und Praxis der Vakuumtechnik. Eine große Anzahl von numerischen Beispielen sowie aussagekräftigen Abbildungen erläutert und visualisiert die theoretischen Sachverhalte.

  4. SESAME/Environmental Research Laboratories

    Science.gov (United States)

    1977-01-01

    The Environmental Research Laboratories (ERL) have been designated as the basic research group of the National Oceanic and Atmospheric Administration (NOAA). ERL performs an integrated program of research and research services directed toward understanding the geophysical environment, protecting the environment, and improving the forecasting ability of NOAA. Twenty-four laboratories located throughout the United States comprise ERL. The Project SESAME (Severe Environmental Storms and Mesoscale Experiment) Planning Office is a project office within ERL. SESAME is conceived as a joint effort involving NOAA, NASA, NSF, and the atmospheric science community to lay the foundation for improved prediction of severe convective storms. The scientific plan for SESAME includes a phased buildup of analysis, modeling, instrumentation development and procurement, and limited-scale observational activities.

  5. From a dream to a resounding reality: the inception of a doctors ...

    African Journals Online (AJOL)

    raoul

    2012-01-25

    Jan 25, 2012 ... From a dream to a resounding reality: the inception of a doctors union in Kenya. Aruyaru Stanley Mwenda1,&. 1Consolata Hospital, Nyeri, Kenya. &Corresponding author: Aruyaru Stanley Mwenda, Consolata Hospital, P.o Box 25 - 10100, Nyeri, Kenya. Key words: Doctor, union, strike, health workforce, ...

  6. Truchet Tilings and their Generalisations

    Indian Academy of Sciences (India)

    Cyril Stanley Smith was acutely sensitive to this in every aspect of his work. In a diversion he rediscovered the. Truchet tilings of 1704 and added to their richness and variety. 1. Introduction. The range and depth of Cyril Stanley Smith's erudition was astonishing. Apart from being one of the most creative metallur- gists of the ...

  7. 75 FR 70232 - Combined Notice of Filings #1

    Science.gov (United States)

    2010-11-17

    ..., DEERE & CO, John Deere Renewables, LLC, Cassia Gulch Wind Park, Cow Branch Wind Power, LLC, CR Clearing... Stanley Capitol Group Inc., TAQA Gen X LLC, MS TGX, LLC. Description: Joint Application for Authorization... Treatment of TAQA Gen X LLC, Morgan Stanley Capital Group Inc. and MS TGX, LLC. Filed Date: 11/04/2010...

  8. 76 FR 10492 - Credit Reforms in Organized Wholesale Electric Markets

    Science.gov (United States)

    2011-02-25

    ... Operator, Inc. (NYISO), Morgan Stanley Capital Group Inc. (Morgan Stanley), Financial Marketers,\\7\\ the... New York Transmission Owners filed an answer.\\11\\ \\7\\ Financial Marketers are comprised of Energy... Cities, Six Cities, and Financial Marketers seek rehearing on the Commission's determination that each...

  9. USA suursaadikuga Tallinna lahel / Katrin Kruss

    Index Scriptorium Estoniae

    Kruss, Katrin

    2007-01-01

    USA suursaadik Stanley Davis Phillips oma haridusteest, perekonnast, armastusest mere vastu, panusest isa Earl Phillipsi mööbliäri laiendamisse, golfiharrastusest, suursaadikute ettevalmistusest USA-s, suursaadiku residentsist Pirital ning uue saatkonnahoone otsingutest Tallinnas. Lisa: Stanley Davis Phillips

  10. Cooperative Search with Autonomous Vehicles in a 3D Aquatic Testbed

    Science.gov (United States)

    2012-01-01

    pp. 37–49, January 2009. [10] G. M. Viswanathan, V. Afanasyev, S. V. Buldyrev, S. Havlin, M. da Luz , E. Raposo, and H. E. Stanley, “Lévy flights in...Phillips, N. W. Watkins, M. P. Freeman, E. J. Murphy, V. Afanasyev, S. V. Buldyrev, M. da Luz , E. Raposo, H. E. Stanley, and G. M. Viswanathan

  11. Becoming a teacher at teacher training colleges in Kenya

    DEFF Research Database (Denmark)

    Dahl, Kari

    Paper presented at International Conference "Health Education and Teacher Training in Kenya" at Sarova Stanley Hotel 8. December 2010, Nairobi, Kenya.......Paper presented at International Conference "Health Education and Teacher Training in Kenya" at Sarova Stanley Hotel 8. December 2010, Nairobi, Kenya....

  12. Paradoxical health education

    DEFF Research Database (Denmark)

    Dahl, Kari

    Key note presentation from International konference "Health Education and Teacher Training in Kenya", 8. December 2010, Stanley Sarova Hotel, Nairobi, Kenya.......Key note presentation from International konference "Health Education and Teacher Training in Kenya", 8. December 2010, Stanley Sarova Hotel, Nairobi, Kenya....

  13. RESEñA DEL LIBRO “LA GENERACIóN App. CóMO LOS JóVENES GESTIONAN SU IDENTIDAD, SU PRIVACIDAD y SU IMAGINACIóN EN EL MUNDO DIGITAL” HOWARD GARDNER y kATIE DAVIS (2014. BARCELONA, PAIDóS, 238 PáGS.

    Directory of Open Access Journals (Sweden)

    Carlos Bolívar Bonilla Baquero

    2015-11-01

    Full Text Available os autores logran una crítica equilibrada al sustentar, cualitativa y estadísticamente, las bondades y riesgos de las nuevas tecnologías de la comunicación para la construcción subjetiva de los jóvenes de la "Generación app" (aplicaciones o programas informáticos en los dispositivos móviles. De manera prudente no les asignan a las tecnologías un carácter de causalidad determinante en los actuales comportamientos juveniles, pero admiten que se trata de un poderoso fenómeno tanto imparable como coadyuvante en las concepciones dominantes del mundo y las prácticas de interacción social, fenómeno que debe estudiarse en conexión con múltiples factores familiares, educativos, culturales, económicos y políticos del desarrollo histórico social que vivimos.

  14. Transmission Lines or Poles, Electric, Electric transmission lines locations provided to us from Kansas City Power and Light and City of Gardner only at this time. AIMS is working on getting other providers in area. Data is limited to CUE (Collaborative Utility Exchange) Participants and subc, Published in 2004, Johnson County Government.

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Transmission Lines or Poles, Electric dataset current as of 2004. Electric transmission lines locations provided to us from Kansas City Power and Light and City of...

  15. Generation of Department of Defense Architecture Framework (DODAF) Models Using the Monterey Phoenix Behavior Modeling Approach

    Science.gov (United States)

    2015-09-01

    notes the following in the forward to Thomas Erl’s SOA Design Patterns book: The entire history for software engineering can be characterized as...Washington, D.C.: Department of Defense Chief Information Officer. Erl, Thomas. 2009. SOA Design Patterns . Boston, MA: SOA Systems. Erl, Thomas...author and do not reflect the official policy or position of the Department of Defense or the U.S. Government . IRB Protocol number ____N/A____. 12a

  16. A Message Exchange Protocol in Command and Control Systems Integration, using the JC3IEDM

    Science.gov (United States)

    2014-06-01

    Foster City, CA, USA (1998). Erl, T. SOA Design Patterns , Prentice Hall Service-Oriented Computing Series (2009). Hohpe, G. and Woolf, B...Control, Communications, and Computer Systems, Joint Chiefs of Staf. USA, 1st October 1996 edition. • Erl, T., 2009. SOA Design Patterns , Prentice...19 June, 2014 in Alexandria, VA. U.S. Government or Federal Rights License 14. ABSTRACT A Joint Operation scenario can be described as a

  17. Mida poliitikud lubavad teha, et sünniks rohkem lapsi / Kristiina Viiron

    Index Scriptorium Estoniae

    Viiron, Kristiina, 1971-

    2003-01-01

    Ajalehe Nädaline korraldatud erakondade poliitiline debatt, kus võtsid sõna: Agu Laius - Isamaaliit, Liina Tõnisson - Keskerakond, Henn Pärn - Res Publica, Tiit Hiiemaa - ERL, Harri Õunapuu - Keskerakond, Taavi Veskimägi - Res Publica, Andres Tarand - Rahvaerakond Mõõdukad, Kaul Nurm - Isamaaliit, Jaana Padrik - Isamaaliit, Tiit Tammsaar - ERL, Anne Vahemäe - Rahvaerakond Mõõdukad, Viive Rosenberg - Keskerakond

  18. Kes räägib tõtt, kes ebatõtt? / Elmar Truu

    Index Scriptorium Estoniae

    Truu, Elmar-Johannes, 1942-

    2001-01-01

    Ilmunud ka: Sakala, 27. nov. 2001, lk. 2; Meie Maa, 28. nov. 2001, lk. 2; Valgamaalane, 27. nov, 2001, lk. 2; Virumaa Teataja, 28. nov. 2001, lk. 7; Nädaline, 29. nov. 2001, lk. 4; ERL Teataja, dets. 2001, nr. 12, lk. 4. Riigikogu 14. nov. infotunnis pöördumisest sotsiaalministri Eiki Nestori poole küsimustega ravimite hinna järjekindlast tõstmisest. Autor: ERL. Parlamendisaadik

  19. Electron linac for medical isotope production with improved energy efficiency and isotope recovery

    Science.gov (United States)

    Noonan, John; Walters, Dean; Virgo, Matt; Lewellen, John

    2015-09-08

    A method and isotope linac system are provided for producing radio-isotopes and for recovering isotopes. The isotope linac is an energy recovery linac (ERL) with an electron beam being transmitted through an isotope-producing target. The electron beam energy is recollected and re-injected into an accelerating structure. The ERL provides improved efficiency with reduced power requirements and provides improved thermal management of an isotope target and an electron-to-x-ray converter.

  20. Tõde on Rahvaliidule valus / Rainis Ruusamäe

    Index Scriptorium Estoniae

    Ruusamäe, Rainis, 1965-

    2002-01-01

    Ilmunud ka: Põhjarannik, Severnoje Poberezhje 5. dets. lk. 2,2, Vooremaa 7. detsember lk. 2, Meie Maa 6. detsember lk. 2, Hiiu Leht 6. detsember lk. 2, Koit 5. detsember lk. 6, Pärnu Postimees 6. detsember lk. 15, Valgamaalane 10. detsember lk. 2. Autori sõnul ei taha ERL tunnistada, et maa erastamise õiguse andmine firmadele oli viga. ERL-i ja Reformierakonna poliitilisest kokkuleppest. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik

  1. Den europæiske katastrofe

    DEFF Research Database (Denmark)

    Rüdiger, Mogens

    2005-01-01

    Anmeldelse af Erling Bjøl: Da verden gik amok. Politik og Kulturhistorie 1914-45; og Nils Arne Sørensen: Den store krig. Europæernes første verdenskrig.......Anmeldelse af Erling Bjøl: Da verden gik amok. Politik og Kulturhistorie 1914-45; og Nils Arne Sørensen: Den store krig. Europæernes første verdenskrig....

  2. Efficacy in Teaching through "Multiple Intelligence" Instructional Strategies

    Science.gov (United States)

    Tamilselvi, B.; Geetha, D.

    2015-01-01

    Multiple intelligence is the theory that "people are smart in more ways than one has immense implication for educators". Howard Gardner proposed a new view of intelligence that is rapidly being incorporated in school curricula. In his theory of Multiple Intelligences, Gardner expanded the concept of intelligence with such areas as music,…

  3. An Holistic Approach for Counsellors: Embracing Multiple Intelligences

    Science.gov (United States)

    Booth, Rosslyn; O'Brien, Patrick John

    2008-01-01

    This paper explores a range of therapeutic modalities used by counsellors of children and positions those modalities within Gardner's theory of multiple intelligences. Research by O'Brien ("Gardner's theory of multiple intelligence and its implications for the counselling of children." Unpublished doctoral dissertation, Queensland University of…

  4. Exploring the Application of Multiple Intelligences Theory to Career Counseling

    Science.gov (United States)

    Shearer, C. Branton; Luzzo, Darrell Anthony

    2009-01-01

    This article demonstrates the practical value of applying H. Gardner's (1993) theory of multiple intelligences (MI) to the practice of career counseling. An overview of H. Gardner's MI theory is presented, and the ways in which educational and vocational planning can be augmented by the integration of MI theory in career counseling contexts are…

  5. Applying Multiple Intelligences

    Science.gov (United States)

    Christodoulou, Joanna A.

    2009-01-01

    The ideas of multiple intelligences introduced by Howard Gardner of Harvard University more than 25 years ago have taken form in many ways, both in schools and in other sometimes-surprising settings. The silver anniversary of Gardner's learning theory provides an opportunity to reflect on the ways multiple intelligences theory has taken form and…

  6. Playing with the Multiple Intelligences: How Play Helps Them Grow

    Science.gov (United States)

    Eberle, Scott G.

    2011-01-01

    Howard Gardner first posited a list of "multiple intelligences" as a liberating alternative to the assumptions underlying traditional IQ testing in his widely read study "Frames of Mind" (1983). Play has appeared only in passing in Gardner's thinking about intelligence, however, even though play instructs and trains the verbal, interpersonal,…

  7. Familial Adenomatous Polyposis (FAP):Genotype Correlation to FAP Phenotype With Osteomas and Sebaceous Cysts

    DEFF Research Database (Denmark)

    Bisgaard, Marie Luise; Bülow, Steffen

    2006-01-01

    Gardner syndrome is characterized by the triad of colorectal adenomas, soft and hard tissue tumors. This disorder was regarded as a separate disease until the identification of the APC gene when it was recognized that mutations in the APC gene were the underlying cause of both Gardner syndrome an...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Martin Gardner. Articles written in Resonance – Journal of Science Education. Volume 18 Issue 1 January 2013 pp 97-106 Classics. Quantum Theory and Quack Theory · Martin Gardner John Archibald Wheeler · More Details Fulltext PDF ...

  9. Opportunities provided in language textbooks to develop learners ...

    African Journals Online (AJOL)

    This article is a report on a study that investigated the opportunities provided in language textbooks to develop learners\\' full potential. Howard Gardner\\'s theory of multiple intelligences, which is used as a theoretical framework, claims that learners have different combinations of intelligences and that the various ...

  10. Creativity and Dance: Implications for Pedagogy and Policy.

    Science.gov (United States)

    Schwartz, Peggy

    1993-01-01

    Examines the theories of Howard Gardner and Rudolf Laban as frameworks for exploring issues of creativity and dance education. Asserts that Gardner's theory of multiple intelligences and Laban's language for movement description provide a language for discussing creativity in dance. (CFR)

  11. Theories of Intelligence, Learning, and Motivation as a Basis for Praxis

    Science.gov (United States)

    Nderu-Boddington, Eulalee

    2008-01-01

    This paper examines how Piaget, Werner, and Gardner differ regarding the roles of cognition, intelligence, and learning in the developmental process. Piaget believes in the predominance of genetic factors. Werner stresses the influence of biological factors, while Gardner proposes that the environment plays a greater influence in how intelligence…

  12. Conceptions of Intelligence and Giftedness.

    Science.gov (United States)

    Bireley, Marlene

    This paper presents a review of the major ideas on the nature of intelligence and giftedness. Especially noted are theories of Howard Gardner, Robert Sternberg, and J.P. Das. Gardner expanded traditional notions of intelligence to include such talents as spatial ability, musical intelligence, bodily-kinesthetic intelligence, and interpersonal and…

  13. If the Shoe Fits...How To Develop Multiple Intelligences in the Classroom.

    Science.gov (United States)

    Chapman, Carolyn

    This guide provides a rationale and approach for translating Howard Gardner's theory of multiple intelligences into classroom practice. Chapter 1 explains Gardner's theory and gives the definitions of the seven intelligences he identifies: verbal/linguistic, musical/rhythmic, logical/mathematical, visual/spatial, bodily/kinesthetic, intrapersonal,…

  14. Multiple Intelligence and the Child with Dyslexia.

    Science.gov (United States)

    Green, Beryl

    1998-01-01

    Howard Gardner's multiple intelligences theory has exciting implications for planning new curricula, especially for children with dyslexia. These children have been "educated" in a system that has failed them. Gardner's theory allows an open-ended approach to assessing dyslexic children's intelligence. Understanding the eight…

  15. Reframing the Mind

    Science.gov (United States)

    Willingham, Daniel T.

    2004-01-01

    This article discusses Howard Gardner and his theory of multiple intelligences. Gardner became a hero among educators simply by redefining talents as "intelligences" in a theory first proposed in 1983. Since then, his theory has undergone incremental but not fundamental change, including the addition of one intelligence (bringing the total to…

  16. Multiple Intelligences: A Collection.

    Science.gov (United States)

    Fogarty, Robin, Ed.; Bellanca, James, Ed.

    As a concise resource for Howard Gardner's theory of multiple intelligences and its implications for schooling around the world, this collection is designed for educators, parents, and others interested in education. The first section discusses Gardner and his background, and the second section expounds his theory. The third section explores the…

  17. Curriculum Integration: The Use of Technology to Support Learning

    Science.gov (United States)

    Jackson, Allen; Gaudet, Laura; McDaniel, Larry; Brammer, Dawn

    2009-01-01

    Our understanding of how people learn is continually changing. Howard Gardner's Theory of Multiple Intelligences revolutionized the field education, because it accounts for a broader range of human potential in children and adults and suggests that individuals learn in a multitude of ways. Gardner's theory suggests there are a variety of…

  18. You're Smarter Than You Think: A Kid's Guide to Multiple Intelligences.

    Science.gov (United States)

    Armstrong, Thomas

    This book is intended to show children how to put Howard Gardner's theory of multiple intelligences (MI) into practice in their own lives. An introductory chapter discusses the nature of intelligence and introduces Gardner's theory and eight types of intelligences. Then a chapter is given to each of the eight intelligences: (1) "Word…

  19. Multiple Intelligences: Its Tensions and Possibilities

    Science.gov (United States)

    Eisner, Elliot W.

    2004-01-01

    This article explores the tensions between Howard Gardner's theory of multiple intelligences and current educational policies emphasizing standardized and predictable outcomes. The article situates Gardner's theory within the historical interests among psychometricians in identifying those core processes that constitute human intelligence.…

  20. Seven Kinds of Smart.

    Science.gov (United States)

    Collins, James

    1998-01-01

    Describes the application of Howard Gardner's theory of Multiple Intelligences (MI) in classroom instruction. Notes lack of research supporting effectiveness of MI; includes Gardner's responses to criticisms. Notes that the most common misapplication is to present a topic from seven directions to incorporate the intelligences, rather than present…

  1. Die intrapersoonlike leerder se ervaring van koöperatiewe leer en ...

    African Journals Online (AJOL)

    Erna Kinsey

    We expand on Howard Gardner's theory of multiple intelligences. Obser- vation of group work in ... be used with care and an understanding of differences in learning styles by teachers and lecturers. Inleiding ...... The Unschooled Mind: How children think and how schools should teach. New. York: Basic Books. Gardner H ...

  2. Sex Differences in Parents' Estimations of Their Own and Their Children's Intelligence

    Science.gov (United States)

    Furnham, Adrian; Bunclark, Katherine

    2006-01-01

    In this study 141 British parents estimated their own, and one of their children's IQ on their overall intelligence as well as on Gardner's (1983) [Gardner, H. (1983). "Frames of the mind: The theory of multiple intelligences." New York: Basic Books.] seven multiple ''intelligences''. Replicating previous studies, fathers gave higher…

  3. Enhancing Multiple Intelligences in Children Who Are Blind: A Guide to Improving Curricular Activities

    Science.gov (United States)

    Al-Balushi, Sulaiman Mohammed

    2006-01-01

    Howard Gardner's Theory of Multiple Intelligences has provided educators with a new view of intelligence. It emphasizes that science, math and language are not the only ways to exhibit intelligence. People exhibit intelligence in many different ways. Each type of intelligence is as valuable as the others. Gardner classifies these intelligences…

  4. Student Management and Human Intelligence Skills Enhanced through Community Service

    Science.gov (United States)

    Wilson, Stefanie Denise

    2012-01-01

    Based on years of human intelligence research conducted by Howard Gardner and results from a quantitative research study supporting Gardner's research collected from a sample of 205 faculty within the United States, the researcher examined students that are actively engaged in community service experiences and their approaches to reframing their…

  5. Meeteth Thy Match: Sensory Activities to Support Brain-Based Learning

    Science.gov (United States)

    Brown, Nancy

    2005-01-01

    A great deal of research has been done on the different ways students learn. Over twenty years ago, Gardner (1983) introduced the theory of multiple intelligences. According to Gardner, each individual possesses at least eight different intelligences, each with varied abilities. The eight intelligences are identified as linguistic,…

  6. Understanding the Theory of Multiple Intelligences. Staff Workshop Handout

    Science.gov (United States)

    Early Childhood Today, 2005

    2005-01-01

    In his "Theory of Multiple Intelligences," Dr. Howard Gardner expands the concept of intelligence to include such areas as music, spatial relations, and interpersonal knowledge in addition to the traditional view of two intelligences--mathematical and linguistic. Using biological as well as cultural research, Gardner formulated a list of seven…

  7. Beyond "g": Putting Multiple Intelligences Theory to the Test

    Science.gov (United States)

    Visser, Beth A.; Ashton, Michael C.; Vernon, Philip A.

    2006-01-01

    We investigated Gardner's "Theory of Multiple Intelligences" in a sample of 200 adults. For each of the hypothesized eight "intelligence" domains--Linguistic, Logical/Mathematical, Spatial, Interpersonal, Intrapersonal, Musical, Bodily-Kinesthetic, Naturalistic--we selected two tests based on Gardner's description of its content. Factor analysis…

  8. Learner Outcomes in Science in South Africa: Role of the Nature of Learner Difficulties with the Language for Learning and Teaching Science

    Science.gov (United States)

    Oyoo, Samuel Ouma

    2017-01-01

    Paul Leslie Gardner pioneered the study of student difficulties with everyday words presented in the science context (Gardner 1971); several similarly designed studies (e.g. Cassels and Johnstone 1985; Tao in "Research in Science Education," 24, 322-330, 1994; Farell and Ventura in "Language and Education," 12(4), 243-254,…

  9. An application of the theory of multiple intelligences in mathematics classrooms in the context of origami

    Science.gov (United States)

    Wares, Arsalan

    2013-01-01

    The purpose of this paper is to illustrate how Howard Gardner's theory of Multiple Intelligences may be applied in mathematics classrooms in the context of an origami project. The paper discusses an origami project and the mathematics behind the project. The paper finally uses the origami project to discuss how Howard Gardner's theory of Multiple Intelligences and idea of entry points can be applied in mathematics classrooms to help students understand and appreciate mathematics [H. Gardner, Multiple Intelligences: New Horizons, Basic Books, New York, 2006].

  10. Research Today Volume 3, Issue 2 April 2017 Newsletter

    Science.gov (United States)

    2017-05-05

    Technology’s overall ability to advance the mission of the 59th Medical Wing." Maj Gardner’s project titled, "Standardized Capture and Display of...hope to have a better data collection and information display process in place by the end of May." Maj Gardner said. The project established a common...Medical Wing and the AFMS," Lt Col Killian said. In addition to Lt Col Killian and Maj Gardner, other ST graduates of the Gateway Academy include, Dr

  11. ER@CEBAF: A test of 5-pass energy recovery at CEBAF

    Energy Technology Data Exchange (ETDEWEB)

    Bogacz, S. A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Douglas, D. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Dubbe, C. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hutton, A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Michalski, T. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Pilat, F. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Roblin, Y. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Satogata, T. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Spata, M. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Tennant, C. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Tiefenback, M. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Ben-Zvi, I. [Brookhaven National Lab. (BNL), Upton, NY (United States); Hao, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States); Korysko, P. [Brookhaven National Lab. (BNL), Upton, NY (United States); Liu, C. [Brookhaven National Lab. (BNL), Upton, NY (United States); Meot, F. [Brookhaven National Lab. (BNL), Upton, NY (United States); Minty, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ptitsyn, V. [Brookhaven National Lab. (BNL), Upton, NY (United States); Robert-Demolaize, G. [Brookhaven National Lab. (BNL), Upton, NY (United States); Roser, T. [Brookhaven National Lab. (BNL), Upton, NY (United States); Thieberger, P. [Brookhaven National Lab. (BNL), Upton, NY (United States); Tsoupas, N. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-06-06

    Jefferson Lab personnel have broad expertise in the design, commissioning, and operation of multiple energy recovery linacs (ERLs): the CEBAF Front-End Test (early 1990s), CEBAF-ER (2003), the IR Free Electron Laser (FEL) Demo, the IR FEL Upgrade, and the UV FEL Driver (1997-2014). Continued development of this core competency has led to this collaborative proposal to explore the forefronts of ERL technology at high energy in a unique expansion of CEBAF capability to a 5-pass ERL with negligible switchover time and programmatic impact to the CEBAF physics program. Such a capability would enable world-class studies of open issues in high-energy ERL beam dynamics that are relevant to future facilities such as electron-ion colliders (EICs). This proposal requests support from the CEBAF Program Advisory Committee to seek funding for hardware installation, and a prospective 12 days of beam time circa Fall 2018 for commissioning this high-energy multi-pass ERL experiment in CEBAF.

  12. The effect of pectin on swelling and permeability characteristics of free films containing Eudragit RL and/or RS as a coating formulation aimed for colonic drug delivery

    Directory of Open Access Journals (Sweden)

    A Akhgari

    2010-06-01

    Full Text Available "n  "n Background and the purpose of the study:The potential of pectin as a bacterially degradable polysaccharide for colon drug delivery has been demonstrated. Due to the high solubility and swelling properties of pectin in aqueous media, it is frequently used in combination with water insoluble polymers for targeting drugs to the colon. The aim of this study was to evaluate free films containing pectin as a bacterially-degradable polysaccharide in combination with Eudragit RL (ERL and/or RS (ERS as a coating formulation for colonic drug delivery. "nMethods:Isolated free films comprising 20% pectin and 80% ERL or ERS and their combination in 1:1 ratio were prepared by casting method. Then, free films were evaluated by water vapor transmission (WVT, swelling and permeability experiments for theophylline and indomethacin in different media. "nResults:Formulations containing ERL exhibited higher WVT, swelling and permeability compared with formulations containing ERS. The permeability of theophylline through free films composed of pectin and eudragit polymers in simulated colonic media was not significantly different from those obtained in other media. However indomethacin free films containing pectin and ERL showed higher permeation in simulated colonic fluid (SCF compared to the other media. Major conclusion:Formulation containing pectin and ERL may be suitable as a coating formulation for colon targeted delivery of drugs of low solubility such as indomethacin.

  13. Läbi legendide William Shakespeare'i poole / Maris Peters

    Index Scriptorium Estoniae

    Peters, Maris

    2010-01-01

    Tutvustus: Wells, Stanley. Kas on tõsi, et Shakespeare ...? / tõlkinud Maris Peters. Tallinn : Argo, 2010. Raamat William Shakespeare kohta käivatest legendidest, kuuldustest ja teooriatest ning tema teoste autorsusest

  14. Mingo National Wildlife Refuge contaminants survey results

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Fishes and turtles were collected from Stanley and Linn Creeks, Ditches 1 and 2, and Mingo Ditch of Mingo National Wildlife Refuge (MNWR) near Puxico, Stoddard and...

  15. Digital compilation bedrock geologic map of the Warren quadrangle, Vermont

    Data.gov (United States)

    Vermont Center for Geographic Information — Digital Data from VG95-4A Walsh, GJ, Haydock, S, Prewitt, J, Kraus, J, Lapp, E, O'Loughlin, S, and Stanley, RS, 1995, Digital compilation bedrock geologic map of the...

  16. 21ST CENTURY INNOVATION SYSTEMS FOR JAPAN AND THE UNITED STATES: Lessons from a Decade of Change : Report of a Symposium

    National Research Council Canada - National Science Library

    Nagaoka, Sadao

    2009-01-01

    ... Role in Supporting Corporate R&D in the United States: Theory, Practice, and Results in the Advanced Technology Program Stephanie Shipp, National Institute of Standards and Technology Marc Stanley, ...

  17. Tegelikult on postmodernism / Urve Eslas

    Index Scriptorium Estoniae

    Eslas, Urve

    2005-01-01

    Rets. rmt.: Kraavi, Janek. Postmodernismi teooria ja postmodernistlik kultuur : ülevaade 20. sajandi teise poole kultuuri ja mõtlemise arengust. Viljandi, 2005 ; Grenz, Stanley J. Postmodernismi aabits. Tallinn, 2003

  18. Narva - front borbõ s "piratskoi" produktsiei / Aleksander Mauser

    Index Scriptorium Estoniae

    Mauser, Aleksander

    2008-01-01

    Narvas toimus seminar, millest võtsid osa Eesti, Soome tollitöötajad, USA suursaadik Eestis Stanley Davis Phillips ja patendinõustaja Michel Smith. Artikkel sisaldab ka lühiinterv. Michel Smithiga

  19. Uued videod ja DVD-d / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2007-01-01

    Hiina võitluskunstide film "Seitse mõõka" (režii Tsui Hark), USA õudusfilm "100 laiba maja" (Rob Zombie), Suurbritannia - Prantsusmaa komöödiafilm "Olla Stanley Kubrick" (Alan Conway, peaosas John Malkovich)

  20. John Malkovich ikka oskab / Kätlin Kaldmaa

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2006-01-01

    Edinburghi filmifestivalil esilinastus "Colour Me Kubrick" (stsenarist Anthony Frewin, režissöör Brian Cook, peaosas John Malkovich) mehest, kes režissööri eluajal 1996.a. esines Stanley Kubrick'una

  1. A Clockwork Orange (1971): suffers Alex DeLarge antisocial personality disorder?

    National Research Council Canada - National Science Library

    Laura María GARCÍA LORENZO

    2016-01-01

    .... A clockwork orange (1971) by Stanley Kubrick is one of those. This paper aims to identify in the behavior of his main character, Alex DeLarge, the characteristic features of an antisocial personality disorder...

  2. Afganistani vägede juht usub jätkuvalt edu võimalikkusse / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2009-01-01

    NATO ja USA vägesid Afganistanis juhtiv kindral Stanley McChrystali arvates on olukord piirkonnas tõsine, kuid edu on saavutatav. Vt. samas: Kaheksa kuuga on ületatud mullune ohvrite arv. Tabel: Hukkunute arv

  3. Digital compilation bedrock geologic map of the Milton quadrangle, Vermont

    Data.gov (United States)

    Vermont Center for Geographic Information — Digital Data from VG95-8A Dorsey, R, Doolan, B, Agnew, PC, Carter, CM, Rosencrantz, EJ, and Stanley, RS, 1995, Digital compilation bedrock geologic map of the Milton...

  4. [Intra-Agency Agreement Documents : Rocky Mountain Arsenal & Wyoming Cooperative Fish & Wildlife Unit : 1994-1996

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — In June 1994 a Committee consisting of Dr. Stanley Anderson, Chair, Wyoming Cooperative Fish and Wildlife Research Unit, Dr. David Bowden, Statistician, Colorado...

  5. Libraries in Oregon: MedlinePlus

    Science.gov (United States)

    ... this page: https://medlineplus.gov/libraries/oregon.html Libraries in Oregon To use the sharing features on ... Albany Samaritan Albany General Hospital Stanley K. Davis Library 1046 6th Ave. SW Albany, OR 97321 541- ...

  6. Seks ei ole häbiasi / Aksel Kala

    Index Scriptorium Estoniae

    Kala, Aksel

    1999-01-01

    Režissöör Stanley Kubrick' filmis "Silmad pärani kinni" "Eyes Wide Shut" on shokeerivaid seksistseene, mille lavastamiseks kasutasid näitlejad Cruise ja Kidman seksiterapeudi abi : Ameerika Ühendriigid 1999

  7. Kuldkaru elutöö eest / Endel Link

    Index Scriptorium Estoniae

    Link, Endel

    2001-01-01

    Ameerika näitleja Kirk Douglas (1916), kellele seekordsel Berlinalel antakse elutöö eest Kuldkaru. Austamisõhtul näidatakse teda Stanley Kubricku kaua keelu all olnud filmis "Tee kuulsusele " ("Paths of Glory") : 1957

  8. A Tale of Wootz Steel

    Indian Academy of Sciences (India)

    /fulltext/reso/011/06/0067-0077. Keywords. Wootz steel; Damascus swords; Cyril Stanley Smith. Author Affiliations. S Ranganathan1 Sharada Srinivasan1. School of Humanities National Institute of Advanced Studies Bangalore 560 012, India ...

  9. Coming Home: A Prospective Study of Family Reintegration Following Deployment to a War Zone

    Science.gov (United States)

    2015-01-01

    stress, both in military couples (Allen, Rhoades , Stanley, & Mark- man, 2011) and other trauma-exposed populations (Brewin, An- drews, & Valentine, 2000...S., Rhoades , G. K., Stanley, S. M., & Markman, H. J. (2011). On the home front: Stress for recently deployed Army couples. Family Process, 50, 235...S., Rhoades , G., & Markman, H. (2011). Relationships between soldiers’ PTSD symptoms and spousal communication during deployment. Journal of

  10. Directional Communication in Evolved Multiagent Teams

    Science.gov (United States)

    2013-06-10

    networks. Artificial Life, 15(2):185– 212, 2009. [23] K. O. Stanley and R. Miikkulainen. Evolving neural networks through augmenting topologies ...paper. 2.2 Neuroevolution of Augmenting Topologies The HyperNEAT approach is itself an extension of the original NEAT (Neu- roevolution of Augmenting ...Gauci and K. O. Stanley. Autonomous evolution of topographic regu- larities in artificial neural networks. Neural Computation, 22(7):1860–1898, 2010

  11. The Trend Toward Rationalization and the Military Profession

    Science.gov (United States)

    1987-04-27

    from the field theory perspective of Leon Festinger who defined cohesion as "the total field of forces which act on a member to remain in a group.Ŝ...Effectiveness: Cohesion, Stress, and the Volunteer Military. (Beverly Hills, CA: Sage Publications, INC. ,1980), p. 21. 8 Leon Festinger , Stanley Schacter, and...Perspective to Savage and Gabriel," Armed Forces and Society 3,3 (May, 1977), pp. 457-462. Festinger , Leon , Stanley Schacter and Kurt W. Back. Social

  12. Impact of Single-sex Instruction on Student Motivation to Learn Spanish

    National Research Council Canada - National Science Library

    Scott Kissau; Lan Quach; Chuang Wang

    2009-01-01

    .... Using Gardner's model of second language motivation (1985), 57 high-school students studying Spanish in either single-sex or coeducational classes completed a pre and post questionnaire to gauge their motivation to learn the language...

  13. History making: The historian as consultant

    National Research Council Canada - National Science Library

    Kalela, Jorma

    2013-01-01

    ... 2.0, including Flickr, Facebook, YouTube, Twitter, blogs and Wikis. The new kinds of expectations from and challenges to the historian created by the online world have been discussed by James Gardner in Public History Review...

  14. Model-based remote sensing algorithms for particulate organic ...

    Indian Academy of Sciences (India)

    based remote sensing algorithms for particulate organic carbon (POC) in the Northeastern Gulf of Mexico. Young Baek Son Wilford D Gardner Alexey V Mishonov Mary Jo Richardson. Volume 118 Issue 1 February 2009 pp 1-10 ...

  15. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    POC) in the Northeastern Gulf of Mexico · Young Baek Son Wilford D Gardner Alexey V Mishonov Mary Jo Richardson · More Details Abstract Fulltext PDF. Hydrographic data, including particulate organic carbon (POC) from the Northeastern ...

  16. That's Using Your Brain!

    Science.gov (United States)

    Visser, Dana R.

    1996-01-01

    Discusses new adult learning theories, including those of Roger Sperry (left brain/right brain), Paul McLean (triune brain), and Howard Gardner (multiple intelligences). Relates adult learning theory to training. (JOW)

  17. Exploring Vietnam: A Multiple Intelligence Portfolio of Learning.

    Science.gov (United States)

    Hoover, Linda A.; Taylor, Randall

    1998-01-01

    Provides guidelines for implementing portfolios in the social studies classroom that focus on the Vietnam era and incorporate Howard Gardner's multiple intelligences. Outlines the portfolio project, lists eleven portfolio components, and addresses the intelligence of each. (CMK)

  18. Coloring Outside the Lines: Applying the Theory of Multiple Intelligences to the Community College Setting.

    Science.gov (United States)

    Diaz-Lefebvre, Rene; Finnegan, Patricia

    1997-01-01

    Explores the application of Howard Gardner's theory of Multiple Intelligences (MI) in developing a community college curriculum that enhances an educator's ability to teach students based upon their dominant intelligences, such as verbal/linguistic or musical/rhythmic. (VWC)

  19. 78 FR 13156 - Notice of Rail Energy Transportation Advisory Committee Meeting

    Science.gov (United States)

    2013-02-26

    ... headquarters at 395 E Street SW., Washington, DC 20423. FOR FURTHER INFORMATION CONTACT: Scott M. Zimmerman... Board, Rachel D. Campbell, Director, Office of Proceedings. Derrick A. Gardner, Clearance Clerk. BILLING...

  20. 78 FR 49721 - Petition for Rulemaking To Adopt Revised Competitive Switching Rules

    Science.gov (United States)

    2013-08-15

    ... Switching Rules AGENCY: Surface Transportation Board, DOT. ACTION: Notice of public hearing. SUMMARY: The... submitted by NITL to modify the Board's standards for mandatory competitive switching. Under its proposal.... Derrick A. Gardner, Clearance Clerk. BILLING CODE 4915-01-P ...

  1. 78 FR 25755 - Announcement of Funding Awards; Energy Innovation Fund-Multifamily Pilot Program Fiscal Year 2010

    Science.gov (United States)

    2013-05-02

    ... demonstrate ``proof of concept'' of specific models; and (3) conduct applied research to document and..., New Jersey. Avenue, New York, NY 10176. New Ecology, Inc., 15 Court Square, Eric Gardner 617-557-1700...

  2. Acute Pancreatitis and Pregnancy

    Science.gov (United States)

    ... Pancreatitis Acute Pancreatitis and Pregnancy Acute Pancreatitis and Pregnancy Timothy Gardner, MD Acute pancreatitis is defined as ... pancreatitis in pregnancy. Reasons for Acute Pancreatitis and Pregnancy While acute pancreatitis is responsible for almost 1 ...

  3. ISSN 2073-9990 East Cent. Afr. J. surg

    African Journals Online (AJOL)

    Hp 630 Dual Core

    FAP, Gardner syndrome) and the harmatomatous polyposis syndromes (Putze Jeghers syndrome, Juvenile polyposis, and Cowdenss disease)2. The adenomatous polyposis syndromes are characterized by numerous adenomatous polyps ...

  4. The Oxford book of modern science writing

    National Research Council Canada - National Science Library

    Dawkins, Richard

    2008-01-01

    ..." to "the terror and vastness of the universe." Edited by renowned scientist Richard Dawkins, this collection brings together pieces by a who's who of scientists and science writers, including Stephen Pinker, Stephen Jay Gould, Martin Gardner...

  5. Dancing through Post-Youth Cultures

    Directory of Open Access Journals (Sweden)

    Tara Brabazon

    2013-08-01

    Full Text Available A review of Ros Jennings and Abigail Gardner (eds, ‘Rock on’: Women, Ageing and Popular Music (Ashgate, 2012 and Andy Bennett and Paul Hodkinson (eds, Ageing and Youth Cultures: Music, Style and Identity (Berg, 2012.

  6. A Psychological View of Spirituality and Leadership.

    Science.gov (United States)

    Solomon, Jeffrey; Hunter, Jeremy

    2002-01-01

    Using Howard Gardner's concept of existential intelligence along with others such as Jerome Bruner, explores the psychology of spirituality and leadership. Describes how famous film director uses meditation in his work. Draws implications for educational leadership. (PKP)

  7. Revised Fish Management Recommendations for Clarence Cannon National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Fish management objectives for Clarence Cannon NWR listed in this report include: (1) manage the fish habitats/populations of the Gardner Division for optimum sport...

  8. Attitudes and Motivation toward Learning the English Language among Students from Islamic Education System Background: Exploring the Views of Teachers

    National Research Council Canada - National Science Library

    Ismail Sheikh Ahmad; Hazlina Abdullah; Muhammad Faizal A Ghani

    2014-01-01

    ... Gardner and Wallace Lambert [1]. However, in Malaysia, there has been only a meagre number of research that investigates teachers' perceptions on attitudes and motivation of students from religious school background...

  9. A wire scanner system for characterizing the BNL energy recovery LINAC beam position monitor system

    Energy Technology Data Exchange (ETDEWEB)

    Michnoff R.; Biscardi, C.; Cerniglia, P.; Degen, C.; Gassner, D.; Hoff, L.; Hulsart, R.

    2012-04-15

    A stepper motor controlled wire scanner system has recently been modified to support testing of the Brookhaven National Laboratory (BNL) Collider-Accelerator department's Energy Recovery Linac (ERL) beam position monitor (BPM) system. The ERL BPM consists of four 9.33 mm diameter buttons mounted at 90 degree spacing in a cube with 1.875 inch inside diameter. The buttons were designed by BNL and fabricated by Times Microwave Systems. Libera brilliance single pass BPM electronic modules with 700 MHz bandpass filter, manufactured by Instrumentation Technologies, will be used to measure the transverse beam positions at 14 locations around the ERL. The wire scanner assembly provides the ability to measure the BPM button response to a pulsed wire, and evaluate and calibrate the Libera position measurement electronics. A description of the wire scanner system and test result data will be presented.

  10. Advance in MEIC cooling studies

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yuhong [JLAB, Newport News, VA (United States); Derbenev, Ya. [JLAB, Newport News, VA (United States); Douglas, D. [JLAB, Newport News, VA (United States); Hutton, A. [JLAB, Newport News, VA (United States); Kimber, A. [JLAB, Newport News, VA (United States); Li, R. [JLAB, Newport News, VA (United States); Nissen, E. [JLAB, Newport News, VA (United States); Tennant, [JLAB, Newport News, VA (United States); Zhang, H. [JLAB, Newport News, VA (United States)

    2013-06-01

    Cooling of ion beams is essential for achieving a high luminosity for MEIC at Jefferson Lab. In this paper, we present the design concept of the electron cooling system for MEIC. In the design, two facilities are required for supporting a multi-staged cooling scheme; one is a 2 MeV DC cooler in the ion pre-booster; the other is a high electron energy (up to 55 MeV) ERL-circulator cooler in the collider ring. The simulation studies of beam dynamics in an ERL-circulator cooler are summarized and followed by a report on technology development for this cooler. We also discuss two proposed experiments for demonstrating high energy cooling with a bunched electron beam and the ERL-circulator cooler.

  11. Beam Line Design and Beam Physics Study of Energy Recovery Linac Free Electron Laser at Peking University

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Guimei [Peking Univ., Beijing (China)

    2011-12-31

    Energy recovering linac (ERL) offers an attractive alternative for generating intense beams of charged particles by approaching the operational efficiency of a storage ring while maintaining the superior beam quality typical of a linear accelerator. In ERLs, the decelerated beam cancels the beam loading effects of the accelerated beam with high repetition rate. Therefore, ERLs can, in principle, accelerate very high average currents with only modest amounts of RF power. So the efficiency of RF power to beam is much higher. Furthermore, the energy of beam to dump is lower, so it will reduce dump radiation. With the successful experiments in large maximum-to-injection energy ratio up to 51:1 and high power FEL up to 14kW, the use of ERL, especially combining with superconducting RF technology, provides a potentially powerful new paradigm for generation of the charged particle beams used in MW FEL, synchrotron radiation sources, high-energy electron cooling devices and so on. The 3+1/2 DC-SC photo injector and two 9cell TESLA superconducting cavity for IR SASE FEL in PKU provides a good platform to achieve high average FEL with Energy Recovery. The work of this thesis is on Beam line design and Beam dynamics study of Energy Recovery Linac Free Electron Laser for Peking University. It is the upgrade of PKU facility, which is under construction. With ERL, this facility can work in CW mode, so it can operate high average beam current without RF power constraint in main linac and generate high average FEL power. Moreover, it provides a test facility to study the key technology in ERL. System parameters are optimized for PKU ERL-FEL. The oscillation FEL output power is studied with different bunch charge, transverse emittance, bunch length and energy spread. The theory of optimal RF power and Q{sub ext} with ERL and without ERL is analyzed and applied to PKU injector and linac including microphonic effect. pace charge effect in the injector and merger is studied for beam

  12. Status of the R&D Towards Electron Cooling of RHIC

    Energy Technology Data Exchange (ETDEWEB)

    A. Favale; D. Holmes; J.J. Sredniawski; Hans Bluem; M.D. Cole; J. Rathke; T. Schultheiss; A.M.M. Todd; V.V. Parkhomchuk; V.B. Reva; J. Alduino; D.S. Barton; Dana Richard Beavis; I. Ben-Zvi; Michael Blaskiewicz; J.M. Brennan; Andrew Burrill; Rama Calaga; P. Cameron; X. Chang; K.A. Drees; A.V. Fedotov; W. Fischer; G. Ganetis; D.M. Gassner; J.G. Grimes; Hartmut Hahn; L.R. Hammons; A. Hershcovitch; H.C. Hseuh; D. Kayran; J. Kewisch; R.F. Lambiase; D.L. Lederle; Vladimir Litvinenko; C. Longo; W.W. MacKay; G.J. Mahler; G.T. McIntyre; W. Meng; B. Oerter; C. Pai; George Parzen; D. Pate; D. Phillips; S.R. Plate; Eduard Pozdeyev; Triveni Rao; J. Reich; Thomas Roser; A.G. Ruggiero; T. Russo; C. Schultheiss; Z. Segalov; J. Smedley; K. Smith; T. Tallerico; S. Tepikian; R. Than; R.J. Todd; Dejan Trbojevic; J.E. Tuozzolo; P. Wanderer; G. WANG; D. Weiss; Q. Wu; Kin Yip; A. Zaltsman; A. Burov; S. Nagaitsev; L.R. Prost; A.O. Sidorin; A.V. Smirnov; Yaroslav Derbenev; Peter Kneisel; John Mammosser; H. Phillips; Joseph Preble; Charles Reece; Robert Rimmer; Jeffrey Saunders; Mircea Stirbet; Haipeng Wang; A.V. Aleksandrov; D.L. Douglas; Y.W. Kang; D.T. Abell; G.I. Bell; David L. Bruhwiler; R. Busby; John R. Cary; D.A. Dimitrov; P. Messmer; Vahid Houston Ranjbar; D.S. Smithe; A.V. Sobol; P. Stoltz

    2007-08-01

    The physics interest in a luminosity upgrade of RHIC requires the development of a cooling-frontier facility. Detailed cooling calculations have been made to determine the efficacy of electron cooling of the stored RHIC beams. This has been followed by beam dynamics simulations to establish the feasibility of creating the necessary electron beam. Electron cooling of RHIC at collisions requires electron beam energy up to about 54 MeV at an average current of between 50 to 100 mA and a particularly bright electron beam. The accelerator chosen to generate this electron beam is a superconducting Energy Recovery Linac (ERL) with a superconducting RF gun with a laser-photocathode. An intensive experimental R&D program engages the various elements of the accelerator: Photocathodes of novel design, superconducting RF electron gun of a particularly high current and low emittance, a very high-current ERL cavity and a demonstration ERL using these components.

  13. Naturalist Intelligence Among the Other Multiple Intelligences [In Bulgarian

    Directory of Open Access Journals (Sweden)

    R. Genkov

    2007-09-01

    Full Text Available The theory of multiple intelligences was presented by Gardner in 1983. The theory was revised later (1999 and among the other intelligences a naturalist intelligence was added. The criteria for distinguishing of the different types of intelligences are considered. While Gardner restricted the analysis of the naturalist intelligence with examples from the living nature only, the present paper considered this problem on wider background including objects and persons of the natural sciences.

  14. RESEARCH TODAY VOLUME 3, ISSUE 3 JULY 2017 NEWSLETTER

    Science.gov (United States)

    2017-07-27

    Extraordinary. When Col Morgan provided constructive cri ticism, she would always say " ... this is me caring."" --- Maj Gardner. Director of...over to Maj Cubby Gardner as Lt Col Killian assumed the role of Deputy Chief Scientist. PAGE 2 VOLU M E 3, IS S U E 3 PAGE 3 Col Kevin Steel...Medical Center (SAMMC). His toxicology research interest peaked when he began to work with Lt Col (Dr.) Vik Bebana and then Maj (Dr.) Joseph Maddry

  15. An exploration on young adults' experiences of childhood parental alienation syndrome / Orgelena Maryna Borstlap

    OpenAIRE

    Borstlap, Orgelena Maryna

    2014-01-01

    For over 20 years, the phenomenon of parental alienation and its related characteristics has been described in literature. Various clinicians independently researched and described the pathological alignment of a child within the context of divorce. In the 1980’s Richard Gardner coined this “Parental alienation syndrome” (PAS). According to Gardner PAS is characterised by a child’s profound preoccupation with criticism against a parent. This criticism is overstated and ungrounded, and it is c...

  16. Prospective Randomized Trial of the Military Anti-Shock Garment

    Science.gov (United States)

    1987-12-20

    since 1907. Aviators during World War II used antigravity suits ("G suits") to prevent blackout during negative acceleration (eyes in) situations...effects of medical anti-shock trousers (MAST garment). J Trauma 21:931, 1981. 51. Gardner WJ: The antigravity suit (G-Suit) in surgery. JAMA 162:274...1956. 52. Gardner WJ: Acute blood loss requiring 58 transfusions - use of antigravity suite as aid in postpartum intra-abdominal bleeding. JAMA 167

  17. THE ROLE OF WORKER'S MULTIPLE INTELLIGENCES ON THEIR PRODUCTIVITY IN CULTURAL INSTITUTIONS OF MOGHAN

    OpenAIRE

    Mir Hossein Seyyedi; Gholamreza Rahimi; Qader Vazifeh Damirchi

    2011-01-01

    The main focus of this study is Cultural Institutions of Moghan region in Iran. The theory of multiple intelligences was developed in 1983 by Howard Gardner. He suggests that the traditional notion of intelligence, based on I.Q. testing, is far too limited. Instead, Dr. Gardner proposes eight different intelligences to account for a broader range of human potential in children and adults. These intelligences are linguistic intelligence, logical intelligence, spatial intelligence, bodily intel...

  18. Evaluation of Peel Ply Surface Preparation of Composite Surfaces for Secondary Bonding

    Science.gov (United States)

    2013-09-01

    bonding, which include mechanical abrasion , chemical treatments, cleaning, and inspection. The success or failure of a peel ply to create a...Evaluation of Peel Ply Surface Preparation of Composite Surfaces for Secondary Bonding by Jared M. Gardner, James P. Wolbert, Larry R. Holmes...Evaluation of Peel Ply Surface Preparation of Composite Surfaces for Secondary Bonding Jared M. Gardner, James P. Wolbert, Larry R

  19. Defense Acquisition Research Journal. Volume 22, Number 4, Issue 75, October 2015

    Science.gov (United States)

    2015-10-01

    Nicholas J. Ross Online-only Article Balancing Incentives and Risks in Performance- Based Contracts Maj Christopher P. Gardner, USAF, Jeffrey A. Ogden, Lt...Defense Acquisition Research Journal. p. Balancing Incentives and Risks in Performance-Based Contracts Maj Christopher P. Gardner, USAF, Jeffrey A...journal. • Get promoted or rewarded. • Become part of a focus group sharing similar interests. • Become a nationally recognized expert in your field

  20. Erlotinib preserves renal function and prevents salt retention in doxorubicin treated nephrotic rats.

    Directory of Open Access Journals (Sweden)

    Raed N Bou Matar

    Full Text Available Nephrotic syndrome is associated with up-regulation of the heparin-binding epidermal growth factor (HB-EGF. Erlotinib blocks the activation of the epidermal growth factor receptor (EGFR in response to HB-EGF. This study investigates the effect of Erlotinib on the progression of proteinuria, renal dysfunction, and salt retention in doxorubicin treated nephrotic rats. Male rats were divided into 3 pair-fed groups (n = 13/group as follows: Control rats (Ctrl; rats receiving intravenous doxorubicin (Dox; and rats receiving intravenous doxorubicin followed by daily oral Erlotinib (Dox + Erl. Upon establishment of high grade proteinuria, urine sodium and creatinine clearance were measured. Kidney tissue was dissected and analyzed for γ-epithelial sodium channel (γENaC, sodium-potassium -chloride co-transporter 2 (NKCC2, sodium chloride co-transporter (NCC, aquaporin 2 (AQP2, and EGFR abundances using western blot. Creatinine clearance was preserved in the Dox + Erl rats as compared to the Dox group (in ml/min: Ctrl: 5.2±.5, Dox: 1.9±0.3, Dox + Erl: 3.6±0.5. Despite a minimal effect on the degree of proteinuria, Erlotinib prevented salt retention (Urinary Na in mEq/d: Ctrl: 2.2±0.2, Dox: 1.8±0.3, Dox + Erl: 2.2±0.2. The cleaved/uncleaved γENaC ratio was increased by 41±16% in the Dox group but unchanged in the Dox + Erl group when compared to Ctrl. The phosphorylated EGFR/total EGFR ratio was reduced by 74±7% in the Dox group and by 77±4% in the Dox + Erl group. In conclusion, Erlotinib preserved renal function and prevented salt retention in nephrotic rats. The observed effects do not appear to be mediated by direct blockade of EGFR.

  1. Ministeeriumist aktsiaseltsiks / Kajar Lember

    Index Scriptorium Estoniae

    Lember, Kajar, 1976-

    2007-01-01

    Ilmunud ka: Pärnu Postimees, 13. sept. 2007, lk. 15; Nädaline, 13. sept. 2007, lk. 4; Vooremaa, 13. sept. 2007, lk. 2; Võrumaa Teataja, 13. sept. 2007, lk. 2; Virumaa Teataja, 14. sept. 2007, lk. 11; Meie Maa, 17. sept. 2007, lk. 2; Koit, 18. sept. 2007, lk. 6; Lääne Elu, 22. sept. 2007, lk. 2. Rahvaliidu peasekretär kritiseerib reformierakonna uuenduslikke reforme, mis on läbi viidud nii keskkonnaministeeriumis kui Riigimetsa Majandamise Keskuses. Ilmunud ka:: ERL-i fraktsiooni esimees Karel Rüütli. ERL nõuab RMK nõukogu tagasikutsumist (Koit, 18. sept.)

  2. Kes võidab ja kes kaotab kogumispensioniga? / Mai Treial

    Index Scriptorium Estoniae

    Treial, Mai, 1952-

    2001-01-01

    Pensionireformi teise samba ehk kogumispensioni eelnõust. Autor: ERL. Parlamendisaadik. Ilmunud ka: Virumaa Teataja, 22. juuni 2001, lk. 11; Nädaline, 22. juuni 2001, lk. 4; Koit, 21. juuni 2001, lk. 6; Meie Maa, 21. juni 2001, lk. 2; Põhjarannik, 22. juuni 2001, lk. 2; Severnoje Poberezhje, 22. juuni 2001, lk. 2; Hiiu Leht, 26. juuni 2001, lk. 2; Valgamaalane, 26. juuni 2001, lk. 2; Pärnu Postimees, 27. juuni 2001, lk. 2; Vooremaa, 28. juuni 2001, lk. 3; Järva Teataja, 6. juuli 2001, lk. 2; Sakala, 25. juuli 2001, lk. 2; ERL Teataja, juuli/aug., nr. 7-8, 2001, lk. 9

  3. HOM damping properties of fundamental power couplers in the superconducting electron gun of the energy recovery LINAC at Brookhaven National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Hammons, L.; Hahn, H.

    2011-03-28

    Among the accelerator projects under construction at the Relativistic Heavy Ion Collider (RHIC) is an R and D energy recovery LINAC (ERL) test facility. The ERL includes both a five-cell superconducting cavity as well as a superconducting, photoinjector electron gun. Because of the high-charge and high-current demands, effective higher-order mode (HOM) damping is essential, and several strategies are being pursued. Among these is the use of the fundamental power couplers as a means for damping some HOMs. Simulation studies have shown that the power couplers can play a substantial role in damping certain HOMs, and this presentation discusses these studies along with measurements.

  4. Characterization of the C. elegans erlin homologue

    Directory of Open Access Journals (Sweden)

    Hoegg Maja B

    2012-01-01

    Full Text Available Abstract Background Erlins are highly conserved proteins associated with lipid rafts within the endoplasmic reticulum (ER. Biochemical studies in mammalian cell lines have shown that erlins are required for ER associated protein degradation (ERAD of activated inositol-1,4,5-trisphosphate receptors (IP3Rs, implying that erlin proteins might negatively regulate IP3R signalling. In humans, loss of erlin function appears to cause progressive intellectual disability, motor dysfunction and joint contractures. However, it is unknown if defects in IP3R ERAD are the underlying cause of this disease phenotype, whether ERAD of activated IP3Rs is the only function of erlin proteins, and what role ERAD plays in regulating IP3R-dependent processes in the context of an intact animal or embryo. In this study, we characterize the erlin homologue of the nematode Caenorhabditis elegans and examine erlin function in vivo. We specifically set out to test whether C. elegans erlin modulates IP3R-dependent processes, such as egg laying, embryonic development and defecation rates. We also explore the possibility that erlin might play a more general role in the ERAD pathway of C. elegans. Results We first show that the C. elegans erlin homologue, ERL-1, is highly similar to mammalian erlins with respect to amino acid sequence, domain structure, biochemical properties and subcellular location. ERL-1 is present throughout the C. elegans embryo; in adult worms, ERL-1 appears restricted to the germline. The expression pattern of ERL-1 thus only partially overlaps with that of ITR-1, eliminating the possibility of ERL-1 being a ubiquitous and necessary regulator of ITR-1. We show that loss of ERL-1 does not affect overall phenotype, or alter brood size, embryonic development or defecation cycle length in either wild type or sensitized itr-1 mutant animals. Moreover we show that ERL-1 deficient worms respond normally to ER stress conditions, suggesting that ERL-1 is not an

  5. A passive radon detector survey in a three-storey laboratory building

    Energy Technology Data Exchange (ETDEWEB)

    Abu-Jarad, F.; Islam, M.A. [King Fahd University of Petroleum and Minerals, Dhahran (Saudi Arabia). Energy Research Laboratory, Research Inst.

    1993-12-31

    A radon survey was performed by using passive radon dosimeters in each office and lab of the three floors Energy Research Laboratory (ERL) building. The ERL building is fully air conditioned and thus the windows are always closed. The average radon concentration in the building was found to be 31 {+-} 13 Bq.m{sup -3}. The average for the different floors varied between 21 and 34 Bq.m{sup -3}, while the average in KFUPM occupied and unoccupied houses was 14{+-} 1Bq.m{sup -3} and 29 {+-} 7 Bq.m{sup -3}, respectively. (author).

  6. HIGH-ENERGY ELECTRON COOLING BASED ON REALISTIC SIX-DIMENSIONAL DISTRIBUTION OF ELECTRONS

    Energy Technology Data Exchange (ETDEWEB)

    FEDOTOV,A.; BEN-ZVI, I.; ET AL.

    2007-06-25

    The high-energy electron cooling system for RHIC-II is unique compared to standard coolers. It requires bunched electron beam. Electron bunches are produced by an Energy Recovery Linac (ERL), and cooling is planned without longitudinal magnetic field. To address unique features of the RHIC cooler, a generalized treatment of cooling force was introduced in BETACOOE code which allows us to calculate friction force for an arbitrary distribution of electrons. Simulations for RHIC cooler based on electron distribution from ERL are presented.

  7. Wissensmanagement und Medienbildung

    Directory of Open Access Journals (Sweden)

    Gerhard Scheidl

    2012-09-01

    Full Text Available Die Querschnittsthematik "Medienbildung" stößt auf eine immer noch fachzentrierte Ausbildung und Schulpraxis. Mögliche Lösungen könnten Überlegungen aus dem Wissensmanagement bieten, wie Gerhard Scheidl in seinem Beitrag auf verschiedenen Ebenen erläutert.

  8. The Anthropocene Biosphere: Supporting 'Open Interdisciplinarity' through Blogging.

    Science.gov (United States)

    Trachtenberg, Zev M; Burns, Thomas J; de Beurs, Kirsten; Ellis, Stephen E; Gates, Kiza K; Hoagland, Bruce W; Kelly, Jeffrey F; Neeson, Thomas M; Randall, Asa R; Schlupp, Ingo; Soppelsa, Peter S; Soreghan, Gerilyn S; Zeigler, James J

    2017-01-01

    This paper describes a process of 'open' interdisciplinary scholarship. Researchers from across the University of Oklahoma blogged about a recent paper by ecologist Erle Ellis, and met in person to discuss posts. They then hosted Ellis for a seminar on questions that emerged, and for a public panel discussion. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Computerunterstütztes Modellieren mit Musiknetzen

    Science.gov (United States)

    Levens, Ulla

    In der folgenden Ausführung geht es um eine Anwendung von Petri-Netzen im Bereich Musik. Ausgehend von der Implementierung einer speziellen Anwendung, dem Programmsystem ScoreSynth, wird das zugrundeliegende Konzept erläutert und anschließend an einem kleinen Beispiel veranschaulicht. Dieser Beitrag ist ein Auszug aus [Lev95b].

  10. Ministrite umbusaldamise mõttekusest / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Poliitika peab muutuma ausamaks, selgemaks ja rahvast teenivaks. Umbusaldusavalduse mõte peitub probleemide avalikustamises ja arutamises kõrgeimal tasemel. Autor: ERL. Palramendisaadik. Ilmunud ka: Koit, 26. apr. 2001, lk. 6; Meie Maa, 26. apr. 2001, lk. 2; Molodjozh Estonii, 27. apr. 2001, lk. 2; Valgamaalane, 3. mai 2001, lk. 2; Nädaline, 10. mai 2001, lk. 4

  11. Teeme eurosuhted selgeks! / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    EL-iga liitumise positiivsed ja negatiivsed küljed. Referendumi korraldamise vajalikkus. Autor: ERL. Parlamendisaadik. Ilmunud ka: Võrumaa Teataja, 12. juuni 2001, lk. 2; Põhjarannik, 14. juuni 2001, lk. 2; Severnoje Poberezhje, 14. juuni 2001, lk. 2; Meie Maa, 22. juuni 2001, lk. 2; Järva Teataja, 26. juuni 2001, lk. 2

  12. Poliitika eitamise poliitikast / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Eitada poliitikat tähendab mitte mõelda oma elu probleemidele ja võimalikele lahendustele. Autor: ERL. Parlamendisaadik. Ilmunud ka: Koit, 24. mai 2001, lk. 6; Molodjozh Estonii, 23. mai 2001, lk. 3; Valgamaalane, 26. mai 2001, lk. 2; Virumaa Teataja, 30. mai 2001, lk. 7; Nädaline, 29. mai 2001, lk. 4

  13. Mart Laar tuleb peatada / Villu Reiljan

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2001-01-01

    Ilmunud ka: Vooremaa, 8. dets. 2001, lk. 2; Nädaline, 8. dets. 2001, lk. 4; Võrumaa Teataja, 11. dets. 2001, lk. 2; Järva Teataja, 13. dets. 2001, lk. 2. Kuigi ca 70% Eesti rahvast on elektrijaamade erastamise vastu, on Mart Laari valitsus ignoreerinud rahva tahet, talle on kogu aeg sekundeerinud Mihkel Pärnoja. Autor: ERL. Parlamendisaadik

  14. Tants riigieelarve ümber / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Ilmunud ka: Estonija, 18. dets. 2001, lk. 2; Koit, 18. dets. 2001, lk. 6; Vooremaa, 18. dets. 2001, lk. 2; Võrumaa Teataja, 18. dets. 2001, lk. 2; Virumaa Teataja, 19. dets. 2001, lk. 7; Molodjozh Estonii, 21. dets. 2001, lk. 6; Valgamaalane, 20. dets. 2001, lk. 2. Riigieelarve arutelu kriitika. Autor: ERL. Parlamendisaadik

  15. Kak zamutit problemu pensii / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Vanaduspension peab olema tulu väljatöötatud aastate eest. Autor: ERL. Parlamendisaadik. Ilmunud ka: Põhjarannik, 12. apr. 2001, lk. 2; Severnoje Poberezhje, 12. apr. 2001, lk. 2; Koit, 12. apr. 2001, lk. 6; Meie Maa, 12. apr. 2001, lk. 2; Valgamaalane, 17. apr. 2001, lk. 2

  16. Kummaline euroarutelu / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Liitumisel EL-iga on Eestis nii võitjaid kui kaotajaid. Eurointegratsioonis veel palju vastamata küsimusi. Autor: ERL. Parlamendisaadik. Ilmunud ka: Hiiu Leht, 2. veebr. 2001, lk. 2; Koit, 13. veebr. 2001, lk. 6; Põhjarannik, 16. veebr. 2001, lk. 2; Severnoje Poberezhje, 16. veebr. 2001, lk. 2; Valgamaalane, 10. märts 2001, lk. 2

  17. Kas ebavõrdsena Euroopa Liitu? / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Ebavõrdsetel tingimustel ühinemine EL-iga seab ohtu Eesti kui rahvusriigi. Autor: ERL. Parlamendisaadik. Ilmunud ka: Nädaline, 7. juuli 2001, lk. 4; Hiiu Leht, 10. juuli 2001, lk. 2; Põhjarannik, 10. juuli 2001, lk. 2; Severnoje Poberezhje, 10. juuli 2001, lk. 2; Koit, 10. juuli 2001, lk. 6; Valgamaalane, 12. juuli 2001, lk. 2

  18. Mida kõike inimene eluks vajab? / Arvo Sirendi

    Index Scriptorium Estoniae

    Sirendi, Arvo, 1939-

    2001-01-01

    Järgneb: Videvik, 12. juuli 2001, lk. 5; 19. juuli 2001, lk. 5; 9. aug. 2001, lk. 5; 13. sept. 2001, lk. 5; 20. sept. 2001, lk. 5; 27. sept. 2001, lk. 5; 22. nov. 2001, lk. 5. Inimese vajadustest toimetulekuks. Autor: ERL. Parlamendisaadik

  19. CORAL RESPONSES TO CLIMATE AND LAND USE CHANGES

    Science.gov (United States)

    Fisher, William S., Debbie L. Santavy, John E. Rogers and Richard G. Zepp. In press. Coral Responses to Climate and Land Use Changes (Abstract). To be presented at the SETAC Fourth World Congress, 14-18 November 2004, Portland, OR. 1 p. (ERL,GB R1019). Coral reefs have ex...

  20. Res Publica nõuab veel üht abilinnapea kohta / Urmas Seaver

    Index Scriptorium Estoniae

    Seaver, Urmas, 1973-

    2005-01-01

    Tallinna linnapea Tõnis Palts on seisukohal, et Reformierakond surus koalitsiooni moodustamisel Res Publicale peale ebaõiglase vastutusvaldkondade jaotuse. Res Publica peasekretär Ott Lumi ei välista võimuliidu loomist Keskerakonnaga, kui Reformierakond järeleandmisi ei tee. ERL tegi ettepaneku kokku kutsuda erakondade ümarlaud. Vt. samas intervjuud Ott Lumiga

  1. Idealism on pragmatismist kasulikum / Tõnis Lukas

    Index Scriptorium Estoniae

    Lukas, Tõnis, 1962-

    2006-01-01

    Ükski edasiviiv poliitika ei saa olla ideaalideta, aadete eest seismine on ka suurte erakondade kohustus. Kui ERL-is ja Keskerakonnas on vähegi aatelisi inimesi, peaksid nad protestima selle vastu, et nende erakondade juhtkonnad nimetavad sõjakuritegu vabastamiseks, ütleb autor

  2. TOP DOWN CONTROL OF THE MICROBIAL LOOP IN ESTUARINE PHYTOPLANKTON

    Science.gov (United States)

    Top Down Control of the Microbial Loop in Estuarine Plankton (Abstract). To be presented at the 16th Biennial Conference of the Estuarine Research Foundation, ERF 2001: An Estuarine Odyssey, 4-8 November 2001, St. Pete Beach, FL. 1 p. (ERL,GB R846).We examined the effects...

  3. Development of a Spoken Language System

    Science.gov (United States)

    1992-04-01

    system to detect the exact location and the class of the new words, it is also useful to simply detect that a new word has occurred). - " fal: fase alarm...Language first used in LUNAR . This is translated into ERL for database retrievals. ! 2) TRAINING DATA: For the February 1992 evaluation test, the

  4. Eksperiment - teeme kõige noorema Vanemuise näitleja vanaemaks

    Index Scriptorium Estoniae

    2010-01-01

    Vanemuise teatri noorim näitleja Liisa Pulk osaleb Anne-Ly Soo (grimmiala juht) ja Erle Vannuse (jumestuskunstnik) lavagrimmi eksperimendis. Artiklis teatrigrimeerija tööst lähemalt. Lisaks näitleja CV: "Liisa Pulk"

  5. Kõige eest siin elus tuleb maksta / Piret Hartman

    Index Scriptorium Estoniae

    Hartman, Piret

    2006-01-01

    ERL-i fraktsiooni nõunik käsitleb rahvastikuteadlase Kalev Katuse loengut Eesti rahvastikuarengust Euroopa kontekstis. Rahvastiku juurdekasv tuleb seada kõigis valdkondades esmatähtsaks, vaja on terviklikku toetussüsteemi kuni lapse täiskasvanuks saamiseni

  6. CBETA Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Hoffstaetter, G. [Brookhaven National Lab. (BNL), Upton, NY (United States); Trbojevic, D. [Brookhaven National Lab. (BNL), Upton, NY (United States); Mayes, C. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2017-06-08

    This Design Report describes the baseline design of the Cornell-BNL ERL Test Accelerator, as it exists on the date of its publication in June 2017. The Design Report will not change frequently in the future. In contrast, the parameter sheets that summarize the CBETA design will respond as quickly and as thoroughly as necessary to maintain configuration control.

  7. CBETA Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Hoffstaetter, G. [Brookhaven National Lab. (BNL), Upton, NY (United States); Trbojevic, D. [Brookhaven National Lab. (BNL), Upton, NY (United States); Mayes, C. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2017-06-08

    This Design Report describes the baseline design of the Cornell-BNL ERL Test Accelerator, as it exists on the date of its publication in June 2017. The Design Report will not change frequently in the future. In contrast, the parameter sheets that summarize the CBETA design will respond as quickly and as thoroughly as necessary to maintain con guration control.

  8. Subcellular localization of cadmium in the root cells of Allium cepa ...

    Indian Academy of Sciences (India)

    Unknown

    mulated by many cereals, potatoes, vegetables and fruits and that humans take up at least 70% of the Cd which originates from plant food (Wagner 1993). Studies ... which the samples were dehydrated in graded acetone and embedded in ERL epoxy resin (Spurr 1969). Ultrathin sections (80 nm thick) were cut on an ultra-.

  9. Eesti põllumajanduse ja maaelu hävitamise lugu / Villu Reiljan

    Index Scriptorium Estoniae

    Reiljan, Villu, 1953-

    2001-01-01

    Raamatust: Decollectivisation, destruction and disillusionment. A community study in Southern Estonia. Tallinn: Jyväskylä, 2001. Teos käsitleb Eesti põllumajanduse allakäiku viimase 10 a. jooksul. Uuring Kanepi valla näitel. Autor: ERL. Parlamendisaadik

  10. Presidendilossis pidutses ka üks Res Publica liige / Kadri Jakobson

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2006-01-01

    SL Õhtulehele presidendilossis toimunud noortepidudest rääkinud neiu on Res Publica liige, kuid tema sõnul pole tema parteiline kuuluvus pidudega seotud. Arvamust avaldavad Res Publica juhatuse liige Andreas Kaju, erakonna esimees Taavi Veskimägi, ERL-i pressiesindaja Agu Uudelepp jt.

  11. Clinical and histological healing pattern of peri-implantitis lesions following non-surgical treatment with an Er:YAG laser.

    NARCIS (Netherlands)

    Schwarz, F.; Bieling, K.; Nuesry, E.; Sculean, A.; Becker, J.M.

    2006-01-01

    BACKGROUND AND OBJECTIVES: The aim of the present study was to assess clinical and histo-pathological healing pattern of peri-implantitis lesions following non-surgical treatment with an Er:YAG laser (ERL). STUDY DESIGN/MATERIALS AND METHODS: Twelve patients suffering from peri-implantitis (n = 12

  12. Rom er kommet tættere på

    DEFF Research Database (Denmark)

    Lodberg, Peter

    2015-01-01

    Anmeldelse af: Czeslaw Kozon, Erling Tiedemann og Hanne Gregersen: Fra konflikt til fællesskab - Fælles luthersk-katolsk højtideligholdelse af reformationsjubilæet i 2017. Forord af Niels Henrik Arendt. 113 sider. Anis....

  13. Environmental Risk Limits for alcohols, glycols, and other relatively soluble and/or volatile compounds. 2. Integration of human and ecotoxicological risk limits

    NARCIS (Netherlands)

    Traas TP; Bontje D; UU/IRAS; SEC

    2005-01-01

    Environmental risk limits are concentrations of a substance in water, air, sediment and soil that are expected to be protective of the environment. In this report environmental risk limits (ERLs) are derived, based on a comparison of human and ecotoxicological risk limits. Ecotoxicological risk

  14. Browse Author Index

    African Journals Online (AJOL)

    Items 451 - 500 of 1479 ... Haupt, Theo Conrad · Hausler, Harry · Hayes, Nicole C · Høg, Erling · Hüsken, Saskia MC · Heald, Suzette · Hearst, Norman · Heck, Simon · Heerden, Alastair Van · Hemson, Crispin · Henda, Nomvo · Hess, Rosanna F · Heunis, Christo · Hewer, Raymond · Himmelgreen, David · Himmelgreen, David A

  15. Browse Author Index

    African Journals Online (AJOL)

    Items 1 - 50 of 52 ... Haupt, Theo Conrad · Hausler, Harry · Hayes, Nicole C · Høg, Erling · Hüsken, Saskia MC · Heald, Suzette · Hearst, Norman · Heck, Simon · Heerden, Alastair Van · Hemson, Crispin · Henda, Nomvo · Hess, Rosanna F · Heunis, Christo · Hewer, Raymond · Himmelgreen, David A · Himmelgreen, David

  16. Täna on ülim aeg Eestile öelda, et ta on armastamist väärt / Arnold Rüütel

    Index Scriptorium Estoniae

    Rüütel, Arnold

    2001-01-01

    Ilmunud ka Estonija (2001/Oct/10) lk. 2 (lüh.) ; ERL Teataja (2001/Oct) nr.10, lk. 2 ; Raamatus "President". -Tallinn, 2003, lk. 24-29, pealkiri: Eesti iseseisvuse tagatised on riigi ja rahvuslikus eneseväärikuses. President Arnold Rüütli kõne Riigikogus ametisse astumise tseremoonial

  17. Rünnak alatu tiibmanöövriga / Tiit Tammsaar

    Index Scriptorium Estoniae

    Tammsaar, Tiit

    2001-01-01

    President Arnold Rüütli ründamiseks on appi võetud alatud tiibmanöövrid. Rünnakud presidendi kantselei direktori Tarmo Männi vastu. Ilmunud T. Kümmeli art. EPL Oct/24 ja A. Langemetsa art. Maaleht Oct/4. Autor: ERL. Parlamendisaadik

  18. Rezension: Der Klang des Films. Dramaturgie und Geschichte des Filmtons von Peter Rabenalt

    Directory of Open Access Journals (Sweden)

    Valeska Ringhof

    2014-12-01

    Full Text Available Valeska Ringhof stellt einen bemerkenswerten Band vor, in dem Peter Rabenalt der Kinogeschichte von Auge und Ohr nachgeht, um deren Synästhesie eingehend zu erläutern. Dabei rekapituliert Rabenalt die Geschichte des Filmtons von seinen Anfängen an ...

  19. Agronoom presidenditooli ei ihka / Ants Käärma ; interv. Tiit Reinberg

    Index Scriptorium Estoniae

    Käärma, Ants, 1942-

    2001-01-01

    Riigikogu liige Ants Käärma ei hakka presidendiks pürgima, vaid loodab poliitiku ametist lahkudes jälle põllumehena leiba teenida. Ants Käärma eluloolisi andmeid. Kommenteerib Andres Taimla. Autor: ERL. Parlamendisaadik

  20. To be continued ...

    Directory of Open Access Journals (Sweden)

    Wilfried Swoboda

    2012-09-01

    Full Text Available Eine Münze reist quer durch Europa – begleitet von einer Handy-Kamera und Youtube! Wilfried Swoboda nimmt uns mit auf eine Reise in das Medienkompetenztraining an der Schule Holzhausergasse und erläutert eingehend seine diesbezüglichen Erfahrungen.