Ultrastructure of Sarcocystis bertrami sarcocysts from naturally infected donkey (Equus asinus) from Egypt

Science.gov (United States)

There is considerable confusion concerning Sarcocystis species in equids. Little is known of Sarcocystis infections in donkeys (Equus asinus). Here we describe the structure of Sarcocystis bertrami-like from the donkey by light and transmission electron microscopy (LM, TEM). Nineteen sarcocysts fro...

Phylogeny of horse chromosome 5q in the genus Equus and centromere repositioning.

Science.gov (United States)

Piras, F M; Nergadze, S G; Poletto, V; Cerutti, F; Ryder, O A; Leeb, T; Raimondi, E; Giulotto, E

2009-01-01

Horses, asses and zebras belong to the genus Equus and are the only extant species of the family Equidae in the order Perissodactyla. In a previous work we demonstrated that a key factor in the rapid karyotypic evolution of this genus was evolutionary centromere repositioning, that is, the shift of the centromeric function to a new position without alteration of the order of markers along the chromosome. In search of previously undiscovered evolutionarily new centromeres, we traced the phylogeny of horse chromosome 5, analyzing the order of BAC markers, derived from a horse genomic library, in 7 Equus species (E. caballus, E. hemionus onager, E. kiang, E. asinus, E. grevyi, E. burchelli and E. zebra hartmannae). This analysis showed that repositioned centromeres are present in E. asinus (domestic donkey, EAS) chromosome 16 and in E. burchelli (Burchell's zebra, EBU) chromosome 17, confirming that centromere repositioning is a strikingly frequent phenomenon in this genus. The observation that the neocentromeres in EAS16 and EBU17 are in the same chromosomal position suggests that they may derive from the same event and therefore, E. asinus and E. burchelli may be more closely related than previously proposed; alternatively, 2 centromere repositioning events, involving the same chromosomal region, may have occurred independently in different lineages, pointing to the possible existence of hot spots for neocentromere formation. Our comparative analysis also showed that, while E. caballus chromosome 5 seems to represent the ancestral configuration, centric fission followed by independent fusion events gave rise to 3 different submetacentric chromosomes in other Equus lineages. (c) 2009 S. Karger AG, Basel.

LESIONES CUTANEAS PARASITARIAS EN EL ASNO EQUUS ASINUS DE CHORONI, ESTADO ARAGUA, VENEZUELA

DEFF Research Database (Denmark)

Morales, Abelardo; Garcia, Francisco; Rossini, Mario

2010-01-01

Three donkeys (Equus asinus Linnaeus, 1758), two males and a female sex, between 5-8 years of old, in athletic shape, in Choroni, Aragua, Venezuela were examined. Clinical examination evidenced hirsute hair and moderate body condition. Nodular dermatitis like skin lesions showed crusted erythemat...

Mitochondrial genome sequence of the Tibetan wild ass (Equus kiang).

Science.gov (United States)

Luo, Yongjun; Chen, Yu; Liu, Fuyu; Jiang, Chunhua; Gao, Yuqi

2011-02-01

The Tibetan wild ass, or kiang (Equus kiang) is endemic to the cold and hypoxic (4000-7000 m above sea level) climates of the montane and alpine grasslands of the Tibetan Plateau. We report here the complete nucleotide sequence of the E. kiang mitochondrial genome. Our results show that E. kiang mitochondrial DNA is 16,634 bp long, and predicted to encode all the 37 genes that are typical for vertebrates.

Evolutionary constraints on equid domestication: Comparison of flight initiation distances of wild horses (Equus caballus ferus) and plains zebras (Equus quagga).

Science.gov (United States)

Brubaker, Alexali S; Coss, Richard G

2015-11-01

Habituation to humans was an essential component of horse (Equus caballus ferus) domestication, with the nondomestication of zebras (Equus quagga) possibly reflecting an adaptive constraint on habituation. We present the human hunting hypothesis, arguing that ancestral humans hunted African animals, including zebras, long enough to promote a persistent wariness of humans, whereas a briefer period of hunting horses in Central Asia influenced by glacial cycles was unlikely to produce an equally persistent wariness. An alternative habituation to humans hypothesis, prompted by field observations, posits that zebras can habituate well to nonthreatening humans given sufficient exposure. If so, other factors must account for zebra nondomestication. To examine these hypotheses, we compared the flight initiation distances (FIDs) of wild horses in the United States and plains zebras in Africa to a human approaching on foot (N = 87). We compared the flight behavior of both species at sites with low and high exposure to humans (mean humans/acre = .004 and .209, respectively). Analyses revealed a significant interaction (p = .0001) between equid species and level of human exposure. The mean FIDs of horses (146 m) and zebras (105 m) with low human exposure did not differ appreciably (p = .412), but these distances were substantially longer (p < .0001) than those of horses (17 m) and zebras (37 m) with high human exposure that did differ significantly (p < .0001). The finding that plains zebras habituate less completely to humans than horses do might reflect an adaptive response to historical hunting and partly explain their resistance to domestication. (c) 2015 APA, all rights reserved).

Genetic diversity of piroplasms in plains zebra (Equus quagga burchellii) and Cape mountain zebra (Equus zebra zebra) in South Africa.

Science.gov (United States)

Bhoora, Raksha; Buss, Peter; Guthrie, Alan J; Penzhorn, Barend L; Collins, Nicola E

2010-11-24

Seventy EDTA blood samples collected from plains zebra (Equus quagga burchellii) and Cape mountain zebra (Equus zebra zebra) were screened for the presence of piroplasm parasite DNA using quantitative T. equi-specific and B. caballi-specific TaqMan real-time PCR (qPCR) tests. T. equi parasite DNA was detected in 60 samples, 19 of which were also positive for B. caballi. Approximately 1480bp of the piroplasm 18S rRNA gene was amplified and sequenced from 17 samples, while the V4 hypervariable region of the 18S rRNA gene was amplified, cloned and sequenced from 31 samples. BLASTN analysis revealed that all of the sequences obtained were most similar to T. equi genotypes and not B. caballi genotypes. Although Babesia parasites were present in some of these samples, as indicated by qPCR, the parasitaemia may have been too low to allow detection by cloning of PCR products from a mixed infection. Sequence analyses of both the full-length and the V4 hypervariable region of the T. equi 18S rRNA gene revealed the existence of 13 new T. equi sequences from zebra, confirming the existence of sequence heterogeneity in the rRNA genes of the parasites that cause equine piroplasmosis, and further suggesting that there may be additional, as yet unidentified, T. equi and B. caballi 18S rRNA sequences present in the horse and zebra populations in South Africa. The occurrence of previously unrecognized sequence variation could pose a potential problem in the implementation of diagnostic tests targeting the 18S rRNA gene. Copyright © 2010 Elsevier B.V. All rights reserved.

Esteatosis en un burro (Equus asinus. Primer reporte en Colombia

Directory of Open Access Journals (Sweden)

José Cardona Á.

2011-12-01

Full Text Available Se describe un caso de esteatosis en un burro (Equus asinus, castrado, de 15 años de edad, procedente del municipio de San Antero (Córdoba, Colombia, al cual se le detectó ligamento nucal engrosado, duro y doloroso, dando la impresión de un doble cuello y edemas subcutáneos indurados en pared costal, abdominal y pectoral. Tambiénpresentó masas duras en la unión de músculos semimembranoso y semitendinoso. Por todo lo anterior, mostró dificultad para realizar movimientos coordinados del cuello, nuca y de traslado. Estos hallazgos obedecen principalmente a una deficiencia de selenio y vitamina E, sirviendo como parámetro diagnóstico para la identificación de esta enfermedad en equinos, por lo cual se determinó la actividad eritrocitica de la enzima glutatión peroxidada (GSH-Px, arrojando resultados muy bajos. Este cuadro es también conocido en equinos como enfermedad de la grasa amarilla o esteatitis, que produce degeneración del tejido adiposo, siendo reemplazado por tejido conectivo con depósitos de calcio. Puede estar asociada a miodegeneración nutricional o distrófica (enfermedad del músculo blanco. Es el primer reporte de esta enfermedad en burros(Equus asinus que se hace en Colombia.

Research on Donkey Populations (Equus Asinus in Banat

Directory of Open Access Journals (Sweden)

Marcel Matiuti

2011-05-01

Full Text Available Research has been made in what concerns the bodily development of donkeys (Equus asinus in Banat, on a number of 94 specimens. The results have shown a great variety in body measures, colours and hues. The Banat Donkey comes from different areas in Romania, Europe or Levant. In 2010 in Banat there were approx. 1000 donkey specimens, 98% of which pertained to shepherds. In the case of this species the mating occurs naturally, and a selection has never been made. Their meat and milk are only rarely consumed by some communities, even if their milk is highly appreciated in the European Union.

Recalibrating Equus evolution using the genome sequence of an early Middle Pleistocene horse.

Science.gov (United States)

Orlando, Ludovic; Ginolhac, Aurélien; Zhang, Guojie; Froese, Duane; Albrechtsen, Anders; Stiller, Mathias; Schubert, Mikkel; Cappellini, Enrico; Petersen, Bent; Moltke, Ida; Johnson, Philip L F; Fumagalli, Matteo; Vilstrup, Julia T; Raghavan, Maanasa; Korneliussen, Thorfinn; Malaspinas, Anna-Sapfo; Vogt, Josef; Szklarczyk, Damian; Kelstrup, Christian D; Vinther, Jakob; Dolocan, Andrei; Stenderup, Jesper; Velazquez, Amhed M V; Cahill, James; Rasmussen, Morten; Wang, Xiaoli; Min, Jiumeng; Zazula, Grant D; Seguin-Orlando, Andaine; Mortensen, Cecilie; Magnussen, Kim; Thompson, John F; Weinstock, Jacobo; Gregersen, Kristian; Røed, Knut H; Eisenmann, Véra; Rubin, Carl J; Miller, Donald C; Antczak, Douglas F; Bertelsen, Mads F; Brunak, Søren; Al-Rasheid, Khaled A S; Ryder, Oliver; Andersson, Leif; Mundy, John; Krogh, Anders; Gilbert, M Thomas P; Kjær, Kurt; Sicheritz-Ponten, Thomas; Jensen, Lars Juhl; Olsen, Jesper V; Hofreiter, Michael; Nielsen, Rasmus; Shapiro, Beth; Wang, Jun; Willerslev, Eske

2013-07-04

The rich fossil record of equids has made them a model for evolutionary processes. Here we present a 1.12-times coverage draft genome from a horse bone recovered from permafrost dated to approximately 560-780 thousand years before present (kyr BP). Our data represent the oldest full genome sequence determined so far by almost an order of magnitude. For comparison, we sequenced the genome of a Late Pleistocene horse (43 kyr BP), and modern genomes of five domestic horse breeds (Equus ferus caballus), a Przewalski's horse (E. f. przewalskii) and a donkey (E. asinus). Our analyses suggest that the Equus lineage giving rise to all contemporary horses, zebras and donkeys originated 4.0-4.5 million years before present (Myr BP), twice the conventionally accepted time to the most recent common ancestor of the genus Equus. We also find that horse population size fluctuated multiple times over the past 2 Myr, particularly during periods of severe climatic changes. We estimate that the Przewalski's and domestic horse populations diverged 38-72 kyr BP, and find no evidence of recent admixture between the domestic horse breeds and the Przewalski's horse investigated. This supports the contention that Przewalski's horses represent the last surviving wild horse population. We find similar levels of genetic variation among Przewalski's and domestic populations, indicating that the former are genetically viable and worthy of conservation efforts. We also find evidence for continuous selection on the immune system and olfaction throughout horse evolution. Finally, we identify 29 genomic regions among horse breeds that deviate from neutrality and show low levels of genetic variation compared to the Przewalski's horse. Such regions could correspond to loci selected early during domestication.

Short Communication Quick method for identifying horse (Equus caballus) and donkey (Equus asinus) hybrids.

Science.gov (United States)

Franco, M M; Santos, J B F; Mendonça, A S; Silva, T C F; Antunes, R C; Melo, E O

2016-09-23

The domestication of the Equus genus 5000-6000 years ago has influenced the history of human civilization. As soon as horse and donkey species had been domesticated, they were crossbred, producing humanity's first documented attempt at animal genome manipulation. Since then, the mule (male donkey x female horse) and the reciprocal cross (the hinny, male horse x female donkey) have been the most common equine hybrids in the world. Due to their hybrid vigor, mules and hinnies have been intensively used for carrying loads and people and for tilling the land. Despite their importance, visual distinction of mules and hinnies is difficult due to high phenotypic resemblance. However, the distinction between these two hybrids is of pivotal importance for equid breeders and ranchers. In this study, an easy, low-cost, effective, and fast multiplex-polymerase chain reaction method was developed to distinguish the maternal origin of mules and hinnies, targeting the hyper-variable mitochondrial DNA D-loop region. This methodology can help breeders, ranchers, animal science professionals, and researchers manage their equine herds with more confidence and precision.

Male harassment influences female movements and associations in Grevy's zebra (Equus grevyi)

OpenAIRE

Siva R. Sundaresan; Ilya R. Fischhoff; DI Rubenstein

2007-01-01

In traditional models for social organization, female movements and association patterns track resource distribution, whereas males track females. More recently, this model has been expanded to include feedback effects of male behavior, especially sexual harassment, on female decisions. In Grevy's zebra (Equus grevyi), males defend territories containing resources attractive to females, who form unstable groups. Past research has explained female behavior based on resource distribution and ne...

Restos de megafauna asociadas a artefactos en la Sabana de Bogotá Restos de megafauna asociadas a artefactos en la Sabana de Bogotá

Directory of Open Access Journals (Sweden)

Correal Urrego Gonzalo

1982-12-01

Full Text Available Luego de una amplia exploración que cubrió el Valle del río Cauca y la Sabana de Bogotá, excavaciones recientes dentro del plan de estudios "Medio ambiente pleistocénico y el hombre prehistórico en Colombia", permitieron el hallazgo por primera vez en nuestro territorio de evidencias culturales precerámicas asociadas a fauna pleistocénica.  Las investigaciones aquí resumidas se adelantaron por el Instituto de Ciencias Naturales - Museo de Historia Natural- Facultad de Ciencias de la Universidad Nacional de Colombia, con el apoyo financiero de la Fundación de Investigaciones Arqueológicas del Banco de la República.At the archaelogical site TIBITÓ 1, Sabana de Bogotá, there have been found for the first time in Colombia stone and bone artifacts associated with the remains of mastodon (Haplomastodon sp.; Cuvieronius hyodon, horse (Equus amerhippus sp. and deer (Odocoileus virginianus. Bone fragments dated by the C-14 process gave an age of 11.740 ± 110 y BO (Late Pleistocene.

Tanque Loma, a new late-Pleistocene megafaunal tar seep locality from southwest Ecuador

Science.gov (United States)

Lindsey, Emily L.; Lopez R., Eric X.

2015-01-01

Fossil deposits in the petroleum-rich sediments of the Santa Elena Peninsula in southwestern Ecuador contain some of the largest and best-preserved assemblages of Pleistocene megafaunal remains known from the neotropics, and thus represent an opportunity to greatly expand our knowledge of Pleistocene paleoecology and the extinction of Quaternary megafauna in this region. This paper reports data from excavations at Tanque Loma, a late-Pleistocene locality on the Santa Elena Peninsula that preserves a dense assemblage of megafaunal remains in hydrocarbon-saturated sediments along with microfaunal and paleobotanical material. The megafauna bones are concentrated in and just above a ˜0.5 m thick asphaltic layer, but occur sparsely and with poorer preservation up to 1 m above this deposit. Several meters of presumed-Holocene sediments overlying the megafauna-bearing strata are rich in bones of microvertebrates including birds, squamates, and rodents. These are interpreted as raptor assemblages. While over 1000 megafaunal bones have been identified from the Pleistocene strata at Tanque Loma, more than 85% of these remains pertain to a single species, the giant ground sloth Eremotherium laurillardi. Only five other megafauna taxa have been identified from this site, including Glossotherium cf. tropicorum, Holmesina occidentalis, cf. Notiomastodon platensis, Equus (Amerhippus) c.f. santaeelenae, and a cervid tentatively assigned to cf. Odocoileus salinae based on body size and geography. No carnivores have yet been identified from Tanque Loma, and microvertebrate remains are extremely rare in the Pleistocene deposits, although terrestrial snail shells and fragmented remains of marine invertebrates are occasionally encountered. Accelerator Mass Spectrometry radiocarbon dates on Eremotherium and cf. Notiomaston bones from within and just above the asphaltic layer yielded dates of ˜17,000 - 23,500 radiocarbon years BP. Taken together, the taxonomic composition, taphonomy

Karyotypic relationships among Equus grevyi, Equus burchelli and domestic horse defined using horse chromosome arm-specific probes.

Science.gov (United States)

Musilova, P; Kubickova, S; Zrnova, E; Horin, P; Vahala, J; Rubes, J

2007-01-01

Using laser microdissection we prepared a set of horse chromosome arm-specific probes. Most of the probes were generated from horse chromosomes, some of them were derived from Equus zebra hartmannae. The set of probes were hybridized onto E. grevyi chromosomes in order to establish a genome-wide chromosomal correspondence between this zebra and horse. The use of arm-specific probes provided us with more information on the mutual arrangement of the genomes than we could obtain by means of whole-chromosome paints generated by flow sorting, even if we used reciprocal painting with probe sets from both species. By comparison of our results and results of comparative mapping in E. burchelli, we also established the chromosomal correspondence between E. grevyi and E. burchelli, providing evidence for a very close karyotypic relationship between these two zebra species. Establishment of the comparative map for E. grevyi contributes to the knowledge of the karyotypic phylogeny in the Equidae family.

Status of groundwater levels and storage volume in the Equus Beds aquifer near Wichita, Kansas, January 2006 to January 2010

Science.gov (United States)

Hansen, Cristi V.; Aucott, Walter R.

2010-01-01

A part of the Equus Beds aquifer in southwestern Harvey County and northwestern Sedgwick County was developed to supply water to residents of Wichita and for irrigation in south-central Kansas. Groundwater pumping for city and agricultural use caused water levels to decline in a large part of the aquifer northwest of Wichita. In 1965, the city of Wichita began using water from Cheney Reservoir in addition to water from the Equus Beds aquifer to meet the city's increasing demand for water. Irrigation pumpage in the area increased substantially during the 1970s and 1980s and contributed to the water-level declines. Water-level declines reached their maximum to date in October 1992.

Environmental impact on faecal glucocorticoid metabolite concentrations in Grevy's Zebra (Equus grevyi)

OpenAIRE

Yarnell, K; Walker, SL

2017-01-01

The non-invasive nature of faecal glucocorticoid metabolite (FGM) assessment means that sample collection is on an opportunistic basis and samples cannot always be collected immediately upon defection during field studies. Faeces that have been exposed to heat and moisturemay not accurately reflect levels of FGM. Our study exposed male (n=3) and female (n=3) Grevy's zebra (Equus grevyi) faeces to six environmental conditions to simulate a range of weather and seasonal patterns (temperate clim...

Presumptive red maple (Acer rubrum) toxicosis in Grevy's zebra (Equus grevyi).

Science.gov (United States)

Weber, M; Miller, R E

1997-03-01

Two female Grevy's zebras (Equus grevyi), one juvenile and one adult, were treated for hemolytic anemia. The juvenile survived, but the adult animal, which also had methemoglobinemia, was euthanized after it failed to recover from anesthesia. Significant pathologic findings in the adult zebra included generalized icterus, hemoglobinuric nephrosis, and paracentral hepatic necrosis. Serum titers for known infectious causes of anemia were negative. Examination of the zebra holding areas revealed two hybrid red maple (Acer sp.) trees. There was no known exposure to other hemolytic agents. This is the first report of probable red maple-induced hemolysis in zebra.

Water quality of the Little Arkansas River and Equus Beds Aquifer before and concurrent with large-scale artificial recharge, south-central Kansas, 1995-2012

Science.gov (United States)

Tappa, Daniel J.; Lanning-Rush, Jennifer L.; Klager, Brian J.; Hansen, Cristi V.; Ziegler, Andrew C.

2015-01-01

The city of Wichita artificially recharged about 1 billion gallons of water into the Equus Beds aquifer during 2007–2012 as part of Phase I recharge of the Artificial Storage and Recovery project. This report, prepared in cooperation by the U.S. Geological Survey and the city of Wichita, Kansas, summarizes Little Arkansas River (source-water for artificial recharge) andEquus Beds aquifer water quality before (1995–2006) and during (2007–2012) Artificial Storage and Recovery Phase I recharge. Additionally, aquifer water-quality distribution maps are presented and water-quality changes associated with Phase I recharge timing are described.

A SEROLOGIC AND POLYMERASE CHAIN REACTION SURVEY OF EQUINE HERPESVIRUS IN BURCHELL'S ZEBRAS (EQUUS QUAGGA), HARTMANN'S MOUNTAIN ZEBRAS (EQUUS ZEBRA HARTMANNAE), AND THOMSON'S GAZELLES (EUDORCAS THOMSONII) IN A MIXED SPECIES SAVANNAH EXHIBIT.

Science.gov (United States)

Lopez, Karen M; Fleming, Gregory J; Mylniczenko, Natalie D

2016-12-01

Reports of equine herpesvirus (EHV) 1 and EHV-9 causing clinical disease in a wide range of species have been well documented in the literature. It is thought that zebras are the natural hosts of EHV-9 both in the wild and in captive collections. Concerns about potential interspecies transmission of EHV-1 and EHV-9 in a mixed species savannah exhibit prompted serologic and polymerase chain reaction surveys. Eighteen Burchell's zebras ( Equus quagga ), 11 Hartmann's mountain zebras ( Equus zebra hartmannae), and 14 Thomson's gazelles ( Eudorcas thomsonii ) cohabitating the same exhibit were examined for EHV-1 virus neutralization titers, and evidence of virus via EHV 1-5 polymerase chain reactions. None of the animals had previous exposure to vaccination with EHV-1 or EHV-4. All tested zebras had positive EHV-1 titers, ranging from 4 to 384. All zebras and Thomson's gazelles had negative polymerase chain reaction results for all targeted equine herpesviruses. EHV-9-specific assays are not available but EHV-1, EHV-4, and EHV-9 cross-react serologically. Positive serology results indicate a potential latent equine herpesvirus in the zebra population, which prompted initiation of an equine herpesvirus vaccine protocol, changes in pregnant zebra mare management, and equine herpesvirus polymerase chain reaction screening prior to shipment to or from the study site.

Prevalence of Theileria equi and Babesia caballi as well as the identification of associated ticks in sympatric Grevy's zebras (Equus grevyi) and donkeys (Equus africanus asinus) in northern Kenya.

Science.gov (United States)

Hawkins, Elaine; Kock, Richard; McKeever, Declan; Gakuya, Francis; Musyoki, Charles; Chege, Stephen M; Mutinda, Mathew; Kariuki, Edward; Davidson, Zeke; Low, Belinda; Skilton, Robert A; Njahira, Moses N; Wamalwa, Mark; Maina, Elsie

2015-01-01

The role of equine piroplasmosis as a factor in the population decline of the Grevy's zebra is not known. We determined the prevalence of Babesia caballi and Theileria equi in cograzing Grevy's zebras (Equus grevyi) and donkeys (Equus africanus asinus) in northern Kenya and identified the associated tick vectors. Blood samples were taken from 71 donkeys and 16 Grevy's zebras from March to May 2011. A nested PCR reaction using 18s ribosomal (r)RNA primers on 87 blood spots showed 72% (51/71; 95% confidence interval [CI] 60.4-81.0%) of donkeys and 100% (16/16; 95% CI, 77.3-100%) of Grevy's zebras were T. equi positive. No samples were positive for B. caballi. Sequence comparison using the National Center for Biotechnology Information's basic local alignment search tool identified homologous 18s rRNA sequences with a global geographic spread. The T. equi-derived sequences were evaluated using Bayesian approaches with independent Metropolis-coupled Markov chain Monte Carlo runs. The sequences clustered with those found in Sudan, Croatia, Mongolia, and the US, with statistical support greater than 80% for the two main clades. Hyalomma tick species were found on both donkeys and Grevy's zebras, whereas Rhipicephalus pulchellus was found exclusively on Grevy's zebras and Hyalomma marginatum rupfipes on donkeys. The prevalence of T. equi was 100% in Grevy's zebras and 72% in donkeys with common tick vectors identified. Our results suggest that donkeys and Grevy's zebras can be asymptomatic carriers and that piroplasmosis is endemic in the study area.

The systematic position of Equus hydruntinus, an extinct species of Pleistocene equid⋆

Science.gov (United States)

Burke, Ariane; Eisenmann, Vera; Ambler, Graeme K.

2003-05-01

Palaeolithic people commonly hunted Equus hydruntinus, an extinct species of equid whose cursorial body proportions suggest an adaptation to semi-arid conditions. Despite the frequency with which it is encountered in fossil deposits, only partial cranial remains have been reported until now. As a result, the systematic affiliation of the species remains a subject of controversy. Two nearly complete E. hydruntinus crania are presented here for the first time. These skulls show that E. hydruntinus is a distinct species, more closely related to the hemiones (Asiatic asses) than to any other equid. This suggests that the social organisation of E. hydruntinus followed one of two known equid sociotypes: resource defense territoriality.

Inoculação experimental de Equus asinus com Leishmania chagasi Cunha & Chagas, 1937 Experimental infection of Equus asinus with Leishmania chagasi Cunha & Chagas, 1937

Directory of Open Access Journals (Sweden)

Elúzio José Lima Cerqueira

2003-12-01

Full Text Available Quatro Equus asinus foram inoculados com promastigotas de Leishmania chagasi Cunha & Chagas, 1937 e acompanhados durante 12 meses através de: pesquisa de amastigotas em esfregaços e culturas de sangue periférico em fragmentos de tecido do lábio inferior, medula óssea, baço e fígado e de testes de ELISA e TRALd. Estes foram positivos nos 8º, 10º e 12º meses após a inoculação. O exame histopatológico pós necropsia, demonstrou discreto número de amastigotas no fígado de dois dos eqüídeos inoculados. Apesar de desafiados com elevado número de promastigotas, os animais não desenvolveram infecções patentes e não infectaram experimentalmente a vetora Lutzomya longipalpis. Os resultados induzem a acreditar que os eqüídeos são desprovidos de importância como reservatórios na cadeia de transmissão da leishmaniose visceral, embora sirvam como boa fonte de alimentação sangüínea e proliferação da vetora Lutzomyia longipalpis.Four Equus asinus were challenged with promastigotes of Leishmania chagasi Cunha & Chagas, 1937, and followed up for 12 months. They were observed by means of direct testing for promastigotes in smears and culture of peripheral blood, fragments from inferior lip, bone marrow, spleen and liver and the immunological assays ELISA and TRALd. The post-necropsy histological examination demonstrated a small number of amastigotes in the liver of two animals. ELISA and TRALd tests were positive at the 8th, 10th and 12th month after inoculation. The results suggest that the donkeys were able to overcome the experimental leishmanial infection and did not infect the vector Lutzomyia longipalpis in the laboratory. Consequently they can not be considered an important reservoir in the epidemiological chain of transmission of visceral leishmaniasis, although they represent an important blood source for the vector and its proliferation.

Zonadhesin D3-Polypeptides Vary among Species but Are Similar in Equus Species Capable of Interbreeding1

OpenAIRE

Tardif, Steve; Brady, Heidi A.; Breazeale, Kelly R.; Bi, Ming; Thompson, Leslie D.; Bruemmer, Jason E.; Bailey, Laura B.; Hardy, Daniel M.

2009-01-01

Zonadhesin is a rapidly evolving protein in the sperm acrosome that confers species specificity to sperm-zona pellucida adhesion. Though structural variation in zonadhesin likely contributes to its species-specific function, the protein has not previously been characterized in organisms capable of interbreeding. Here we compared properties of zonadhesin in several animals, including the horse (Equus caballus), donkey (E. asinus), and Grevy's zebra (E. grevyi) to determine if variation in zona...

Cardiac evaluation of anesthetized Grevy's zebras (Equus grevyi).

Science.gov (United States)

Adin, Darcy B; Maisenbacher, Herbert W; Ojeda, Nyurka; Fiorello, Christine V; Estrada, Amara H; Prosek, Robert; Citino, Scott B

2007-02-01

To determine ECG and echocardiographic measurements in healthy anesthetized Grevy's zebras (Equus grevyi). 20 healthy zebras. Auscultation, base-apex ECG, and echocardiography were performed on anesthetized zebras. Low-grade systolic murmurs were detected in the left basilar region in 4 of 20 zebras. Evaluation of ECGs from 19 zebras revealed sinus rhythm with a predominantly negative QRS complex and a mean +/- SD heart rate of 67 +/- 10 beats/min. Echocardiograms of sufficient image quality were obtained for 16 zebras. Interventricular septal thickness in diastole, left ventricular chamber in diastole and systole, left atrial diameter, and left ventricular mass were significantly and moderately correlated with estimated body weight (r values ranged from 0.650 to 0.884). Detectable swirling of blood in the right and sometimes the left ventricles was detected in 9 of 16 zebras, whereas physiologic regurgitation of blood was detected for the aortic valve in 3 zebras, pulmonary valve in 2 zebras, mitral valve in 2 zebras, and tricuspid valve in 1 zebra. Results of this study provide reference information for use in the cardiac evaluation of anesthetized Grevy's zebras.

Halicephalobus gingivalis (Nematoda) infection in a Grevy's zebra (Equus grevyi).

Science.gov (United States)

Isaza, R; Schiller, C A; Stover, J; Smith, P J; Greiner, E C

2000-03-01

A 6-yr-old female Grevy's zebra (Equus grevyi) with a disseminated rhabditiform nematode infection is described. Antemortem clinical signs were limited to blindness and abnormal behavior believed to be caused by a recurrent nematode-induced uveitis. Histologic examination of the kidneys, heart, eyes, uterus, and lymph nodes revealed granulomas containing multiple sections of rhabditiform nematodes. Most of the recovered nematodes were larval stages with only a few adult females noted. The adults measured 243-297 microm x 11-16 microm (x = 269 x 14 microm). The distinctive rhabditiform esophagi had corpus:isthmus:bulb proportions of 19:11:5. On the basis of adult morphology, the nematode was identified as Halicephalobus gingivalis. This is the first report of this parasite in a zebra and indicates that this parasitic granulomatous disease should be considered in zebras with neurologic disease.

Seroepidemiology of Sarcocystis neurona and Neospora hughesi infections in domestic donkeys (Equus asinus) in Durango, Mexico

OpenAIRE

Alvarado-Esquivel, Cosme; Howe, Daniel K.; Yeargan, Michelle R.; Alvarado-Esquivel, Domingo; Alfredo Zamarripa-Barboza, Jos?; Dubey, Jitender P.

2017-01-01

There is currently no information regarding Sarcocystis neurona and Neospora hughesi infections in donkeys in Mexico. Here, we determined the presence of antibodies against S. neurona and N. hughesi in donkeys in the northern Mexican state of Durango. Serum samples of 239 domestic donkeys (Equus asinus) were assayed for S. neurona and N. hughesi antibodies using home-made enzyme-linked immunoassays; six (2.5%) of the 239 donkeys tested seropositive for S. neurona. The seroprevalence of S. neu...

Toxoplasma gondii seroprevalence in donkeys (Equus asinus) from the U.S.A. and isolation of T. gondii from cats on donkey farms

Science.gov (United States)

Donkeys (Equus asinus) are used as companion animals, in leisure activities as working animals, for onotherapy, and their meat and milk is used for human consumption in certain countries. Here we report first serological survey for Toxoplasma gondii in donkeys in the U.S.A. Serum samples were collec...

Prevalence of Toxoplasma gondii antibodies in domestic donkeys (Equus asinus) in Durango, Mexico slaughtered for human consumption

OpenAIRE

Alvarado-Esquivel, Cosme; Alvarado-Esquivel, Domingo; Dubey, Jitender P

2015-01-01

Background Nothing is known about Toxoplasma gondii prevalence in donkeys in Mexico. Meat from donkey is consumed by humans in Mexico and also exported to other countries. We sought to determine the presence of antibodies against T. gondii in 239 domestic donkeys (Equus asinus) for slaughter in Durango, Mexico using the modified agglutination test (MAT). Donkeys were sampled in four premises (trade centers) where donkeys were gather for shipment to abattoirs in other Mexican states. Results A...

Estudio clínico e histopatológico del Sarcoide Fibroblastico en burros (Equus Asinus) en Colombia

OpenAIRE

Cardona Álvarez, José; Vargas Viloria, Marlene; Perdomo Ayola, Sandra

2013-01-01

El objetivo de este trabajo fue estudiar los aspectos clínicos e histopatológicos del sarcoide fibroblástico (SF) en burros (Equus asinus) del departamento de Córdoba, Colombia. Dicho estudio fue de tipo descriptivo, no probabilístico, en animales de conveniencia. Se utilizaron siete burros con SF diagnosticados clínica e histopatológicamente en diferentes explotaciones ganaderas del Departamento. Al describir las lesiones se observó apariencia exofítica fibrovascular, pa...

Revised shallow and deep water-level and storage-volume changes in the Equus Beds Aquifer near Wichita, Kansas, predevelopment to 1993

Science.gov (United States)

Hansen, Cristi V.; Lanning-Rush, Jennifer L.; Ziegler, Andrew C.

2013-01-01

Beginning in the 1940s, the Wichita well field was developed in the Equus Beds aquifer in southwestern Harvey County and northwestern Sedgwick County to supply water to the city of Wichita. The decline of water levels in the aquifer was noted soon after the development of the Wichita well field began. Development of irrigation wells began in the 1960s. City and agricultural withdrawals led to substantial water-level declines. Water-level declines enhanced movement of brines from past oil and gas activities near Burrton, Kansas and enhanced movement of natural saline water from the Arkansas River into the well field area. Large chloride concentrations may limit use or require the treatment of water from the well field for irrigation or public supply. In 1993, the city of Wichita adopted the Integrated Local Water Supply Program (ILWSP) to ensure an adequate water supply for the city through 2050 and as part of its effort to effectively manage the part of the Equus Beds aquifer it uses. ILWSP uses several strategies to do this including the Equus Beds Aquifer Storage and Recovery (ASR) project. The purpose of the ASR project is to store water in the aquifer for later recovery and to help protect the aquifer from encroachment of a known oilfield brine plume near Burrton and saline water from the Arkansas River. As part of Wichita’s ASR permits, Wichita is prohibited from artificially recharging water into the aquifer in a Basin Storage area (BSA) grid cell if water levels in that cell are above the January 1940 water levels or are less than 10 feet below land surface. The map previously used for this purpose did not provide an accurate representation of the shallow water table. The revised predevelopment water-level altitude map of the shallow part of the aquifer is presented in this report. The city of Wichita’s ASR permits specify that the January 1993 water-level altitudes will be used as a lower baseline for regulating the withdrawal of artificial rechage

Protocols for collection of streamflow, water-quality, streambed-sediment, periphyton, macroinvertebrate, fish, and habitat data to describe stream quality for the Hydrobiological Monitoring Program, Equus Beds Aquifer Storage and Recovery Program, city of Wichita, Kansas

Science.gov (United States)

Stone, Mandy L.; Rasmussen, Teresa J.; Bennett, Trudy J.; Poulton, Barry C.; Ziegler, Andrew C.

2012-01-01

The city of Wichita, Kansas uses the Equus Beds aquifer, one of two sources, for municipal water supply. To meet future water needs, plans for artificial recharge of the aquifer have been implemented in several phases. Phase I of the Equus Beds Aquifer Storage and Recovery (ASR) Program began with injection of water from the Little Arkansas River into the aquifer for storage and subsequent recovery in 2006. Construction of a river intake structure and surface-water treatment plant began as implementation of Phase II of the Equus Beds ASR Program in 2010. An important aspect of the ASR Program is the monitoring of water quality and the effects of recharge activities on stream conditions. Physical, chemical, and biological data provide the basis for an integrated assessment of stream quality. This report describes protocols for collecting streamflow, water-quality, streambed-sediment, periphyton, macroinvertebrate, fish, and habitat data as part of the city of Wichita's hydrobiological monitoring program (HBMP). Following consistent and reliable methods for data collection and processing is imperative for the long-term success of the monitoring program.

Electrocardiography of Grevy's zebras (Equus grevyi).

Science.gov (United States)

Myers, Debbie A; Citino, Scott; Mitchell, Mark A

2008-09-01

Electrocardiograms (ECGs) are a good baseline test for assessing cardiac rhythm. ECGs have not been reported in any zebra species and in very few Perissodactyla species. Standard limb, six-lead ECGs were recorded in 23 anesthetized Grevy's zebras (Equus grevyi). Heart rate, RR interval, P-wave duration, RR maximum/minimum, PR interval, QRS duration, QT interval, ST segment deviation, P-wave amplitude, QRS amplitude, and T-wave amplitude were measured and calculated from lead II ECGs from these Grevy's zebras. Several variables were tested, including gender, age (0-24, 24-48, 48-180, and >180 mo), weight (350 kg), pregnancy status, and anesthetic differences (standard dose or supplemented dose), to see if they affected ECG values in these animals. There were no significant differences in any of the ECG parameters between genders. RR and QT intervals were longer in older zebras; heart rates were faster in younger zebras. The RR and PR intervals, as well as the QRS duration, were greater in heavier zebras; heart rates were faster in lighter zebras. The RR interval was significantly longer in pregnant zebras. There were no significant differences in any of the ECG parameters for zebras anesthetized with a standardized dose of the drug combination etorphine-detomidine-acepromazine compared to those receiving additional supplements of these drugs and/or ketamine. All other parameters were not significantly different among groups, except where noted previously. The results of this research indicate that differences in ECG parameters in zebras may occur between animals of different ages, weights, and pregnancy status and that these factors should be considered when interpreting the respective ECGs of these zebras.

Cheek tooth morphology and ancient mitochondrial DNA of late Pleistocene horses from the western interior of North America: Implications for the taxonomy of North American Late Pleistocene Equus.

Directory of Open Access Journals (Sweden)

Christina I Barrón-Ortiz

Full Text Available Horses were a dominant component of North American Pleistocene land mammal communities and their remains are well represented in the fossil record. Despite the abundant material available for study, there is still considerable disagreement over the number of species of Equus that inhabited the different regions of the continent and on their taxonomic nomenclature. In this study, we investigated cheek tooth morphology and ancient mtDNA of late Pleistocene Equus specimens from the Western Interior of North America, with the objective of clarifying the species that lived in this region prior to the end-Pleistocene extinction. Based on the morphological and molecular data analyzed, a caballine (Equus ferus and a non-caballine (E. conversidens species were identified from different localities across most of the Western Interior. A second non-caballine species (E. cedralensis was recognized from southern localities based exclusively on the morphological analyses of the cheek teeth. Notably the separation into caballine and non-caballine species was observed in the Bayesian phylogenetic analysis of ancient mtDNA as well as in the geometric morphometric analyses of the upper and lower premolars. Teeth morphologically identified as E. conversidens that yielded ancient mtDNA fall within the New World stilt-legged clade recognized in previous studies and this is the name we apply to this group. Geographic variation in morphology in the caballine species is indicated by statistically different occlusal enamel patterns in the specimens from Bluefish Caves, Yukon Territory, relative to the specimens from the other geographic regions. Whether this represents ecomorphological variation and/or a certain degree of geographic and genetic isolation of these Arctic populations requires further study.

Identificación de Especímenes de Equus grevyi en el Parque Zoológico Nacional de Cuba

OpenAIRE

Irina Fermin-Morales; Alberto Martín-Mora

2014-01-01

La cebra de Grevy (Equus grevyi) se ha manejado a través de extracciones y reintroducciones de individuos desde su inclusión en la colección de animales del Parque Zoológico Nacional de Cuba. Para mejorar el manejo de esta especie es necesaria la identificación individual a través de caracteres morfológicos, por esto los que los investigadores se propusieron demostrar las diferencias en el patrón de rayado facial existente entre los individuos y entre ambos lados de un mismo individuo. El mét...

Trained Quantity Abilities in Horses (Equus caballus: A Preliminary Investigation

Directory of Open Access Journals (Sweden)

Maria Elena Miletto Petrazzini

2014-07-01

Full Text Available Once believed to be a human prerogative, the capacity to discriminate between quantities now has also been reported in several vertebrates. To date, only two studies investigated numerical abilities in horses (Equus caballus but reported contrasting data. To assess whether horses can be trained to discriminate between quantities, I have set up a new experimental protocol using operant conditioning. One adult female was trained to discriminate between 1 and 4 (Test 1 in three different conditions: non-controlled continuous variables (numerical and continuous quantities that co-vary with number are simultaneously available, 50% controlled continuous variables (intermediate condition, and 100% controlled continuous variables (only numerical information available. The subject learned the discrimination in all conditions, showing the capacity to process numerical information. When presented with a higher numerical ratio (2 vs. 4, Test 2, the subject still discriminated between the quantities but its performance was statistically significant only in the non-controlled condition, suggesting that the subject used multiple cues in presence of a more difficult discrimination. On the whole, the results here reported encourage the use of this experimental protocol as a valid tool to investigate the capacity to process numerical and continuous quantities in horses in future research.

Uneven distribution of enamel in the tooth crown of a Plains Zebra (Equus quagga

Directory of Open Access Journals (Sweden)

Daniela E. Winkler

2015-06-01

Full Text Available Unworn teeth of herbivorous mammals are not immediately functional. They have to be partially worn to expose enamel ridges which can then act as shear-cutting blades to break the food down. We use the Plains Zebra (Equus quagga as a hypsodont, herbivorous model organism to investigate how initial wear of the tooth crown is controlled by underlying structures. We find that the enamel proportion is smaller at the apical half of the tooth crown in all upper tooth positions and suggest that lower enamel content here could promote early wear. Besides this uneven enamel distribution, we note that the third molar has a higher overall enamel content than any other tooth position. The M3 is thus likely to have a slightly different functional trait in mastication, resisting highest bite forces along the tooth row and maintaining functionality when anterior teeth are already worn down.

Uneven distribution of enamel in the tooth crown of a Plains Zebra (Equus quagga).

Science.gov (United States)

Winkler, Daniela E; Kaiser, Thomas M

2015-01-01

Unworn teeth of herbivorous mammals are not immediately functional. They have to be partially worn to expose enamel ridges which can then act as shear-cutting blades to break the food down. We use the Plains Zebra (Equus quagga) as a hypsodont, herbivorous model organism to investigate how initial wear of the tooth crown is controlled by underlying structures. We find that the enamel proportion is smaller at the apical half of the tooth crown in all upper tooth positions and suggest that lower enamel content here could promote early wear. Besides this uneven enamel distribution, we note that the third molar has a higher overall enamel content than any other tooth position. The M3 is thus likely to have a slightly different functional trait in mastication, resisting highest bite forces along the tooth row and maintaining functionality when anterior teeth are already worn down.

Identification and the primary structure of equine alpha-lactalbumin B and C (Equus caballus, Perissodactyla).

Science.gov (United States)

Godovac-Zimmermann, J; Shaw, D; Conti, A; McKenzie, H

1987-04-01

The presence of two new alpha-lactalbumins has been demonstrated in the colostrum of a single mare (Equus caballus, Persian Arab). They have been designated equine alpha-lactalbumin B and C, and that isolated previously from the milk of Australian horses (English Thoroughbred) as alpha-lactalbumin A. The primary structures of B/C have been determined by automatic Edman degradation of enzymatic cleavage of the oxidized protein. Cyanogen bromide cleavage of S-carbamoyl-methylated protein provided necessary overlapping peptides. Comparison of the sequences of B and C with that of A indicates 3 and 4 amino-acid exchanges, respectively. The phylogenetic difference of equine alpha-lactalbumin B/C from bovine alpha-lactalbumin B is indicated by 39 and 40 amino-acid exchanges, respectively. The structure-function relationship, calcium binding sites and variants of alpha-lactalbumin are discussed.

Serological diagnosis of Besnoitia bennetti infection in donkeys (Equus asinus).

Science.gov (United States)

Ness, SallyAnne L; Schares, Gereon; Peters-Kennedy, Jeanine; Mittel, Linda D; Dubey, Jitender P; Bowman, Dwight D; Mohammed, Hussni O; Divers, Thomas J

2014-11-01

Besnoitiosis is an emerging infectious disease of donkeys (Equus asinus) in the United States for which there are currently no serologic methods of diagnosis. A study was performed to evaluate physical examination findings and 3 serologic assays for the detection of Besnoitia bennetti infection in donkeys. A prospective study of 416 donkeys from 6 privately owned herds across 5 U.S. states (New York, Pennsylvania, Vermont, Oregon, and Washington) was performed. Donkeys were examined for clinical lesions suggestive of besnoitiosis and evaluated for antibodies against B. bennetti using a fluorescent antibody test (FAT) and 2 immunoblot assays specific for bradyzoite and tachyzoite antigens, respectively. Donkeys were confirmed to be infected with B. bennetti by histology (cases; n = 32) and were compared to those with no clinical signs of besnoitiosis (controls; n = 384). Identifying clinical lesions in 2 or more locations correctly identified infected donkeys 83% of the time. Donkeys with besnoitiosis had significantly higher FAT titers (P donkeys. The sensitivity and specificity of the serologic assays for detecting besnoitiosis was 88% and 96% for FAT, 81% and 91% for bradyzoite immunoblot, and 91% and 92% for tachyzoite immunoblot, respectively. Fluorescent antibody and immunoblot assays are effective at identifying donkeys with besnoitiosis and provide a more efficient and less invasive diagnostic alternative to histology. © 2014 The Author(s).

Characterization of a novel variant of amino acid transport system asc in erythrocytes from Przewalski's horse (Equus przewalskii).

Science.gov (United States)

Fincham, D A; Ellory, J C; Young, J D

1992-08-01

In thoroughbred horses, red blood cell amino acid transport activity is Na(+)-independent and controlled by three codominant genetic alleles (h, l, s), coding for high-affinity system asc1 (L-alanine apparent Km for influx at 37 degrees C congruent to 0.35 mM), low-affinity system asc2 (L-alanine Km congruent to 14 mM), and transport deficiency, respectively. The present study investigated amino acid transport mechanisms in red cells from four wild species: Przewalski's horse (Equus przewalskii), Hartmann's zebra (Zebra hartmannae), Grevy's zebra (Zebra grevyi), and onager (Equus hemonius). Red blood cell samples from different Przewalski's horses exhibited uniformly high rates of L-alanine uptake, mediated by a high-affinity asc1-type transport system. Mean apparent Km and Vmax values (+/- SE) for L-alanine influx at 37 degrees C in red cells from 10 individual animals were 0.373 +/- 0.068 mM and 2.27 +/- 0.11 mmol (L cells.h), respectively. As in thoroughbreds, the Przewalski's horse transporter interacted with dibasic as well as neutral amino acids. However, the Przewalski asc1 isoform transported L-lysine with a substantially (6.4-fold) higher apparent affinity than its thoroughbred counterpart (Km for influx 1.4 mM at 37 degrees C) and was also less prone to trans-stimulation effects. The novel high apparent affinity of the Przewalski's horse transporter for L-lysine provides additional key evidence of functional and possible structural similarities between asc and the classical Na(+)-dependent system ASC and between these systems and the Na(+)-independent dibasic amino acid transport system y+. Unlike Przewalski's horse, zebra red cells were polymorphic with respect to L-alanine transport activity, showing high-affinity or low-affinity saturable mechanisms of L-alanine uptake. Onager red cells transported this amino acid with intermediate affinity (apparent Km for influx 3.0 mM at 37 degrees C). Radiation inactivation analysis was used to estimate the target

The presence of Giardia intestinalis in donkeys, Equus asinus, in China.

Science.gov (United States)

Zhang, Xiao-Xuan; Zhang, Fu-Kai; Li, Fa-Cai; Hou, Jun-Ling; Zheng, Wen-Bin; Du, Shuai-Zhi; Zhao, Quan; Zhu, Xing-Quan

2017-01-03

Giardia intestinalis is one of the most important zoonotic enteric parasites. As no information regarding prevalence and genotype of G. intestinalis in donkeys (Equus asinus) in China is available, 181 faecal samples from 48 donkeys from Jilin Province, from 104 from Shandong Province and from 29 from Liaoning Province were examined between May and December 2015. Twenty-eight (15.47%) out of 181 donkey samples were tested G. intestinalis-positive by nested amplification of the triosephosphate isomerase (tpi) gene. The prevalence in different regional groups varied from 10.42 to 18.27%. The prevalence in adult and young donkeys was 14.29 and 22.92%, respectively. Otherwise, the prevalence was 11.69% in summer and 18.27% in winter. However, no statistically significant differences were found in relation to region or age group. Sequence analysis of the tpi, glutamate dehydrogenase (gdh) and beta giardin (bg) loci identified 4, 1 and 3 subtypes of assemblage B, respectively. Moreover, four novel multilocus genotypes (MLGs novel-1 to novel-4) were identified in assemblage B. This first report of G. intestinalis in donkeys in China indicates that further studies of nation-wide molecular epidemiology and geographical distribution of Giardia in donkeys are warranted. Effective strategies should be implemented to control G. intestinalis infection in donkeys, other animals and humans.

Cognition and learning in horses (Equus caballus): What we know and why we should ask more.

Science.gov (United States)

Brubaker, Lauren; Udell, Monique A R

2016-05-01

Horses (Equus caballus) have a rich history in their relationship with humans. Across different cultures and eras they have been utilized for work, show, cultural rituals, consumption, therapy, and companionship and continue to serve in many of these roles today. As one of the most commonly trained domestic animals, understanding how horses learn and how their relationship with humans and other horses impacts their ability to learn has implications for horse welfare, training, husbandry and management. Given that unlike dogs and cats, domesticated horses have evolved from prey animals, the horse-human relationship poses interesting and unique scientific questions of theoretical value. There is still much to be learned about the cognition and behaviour of horses from a scientific perspective. This review explores current research within three related areas of horse cognition: human-horse interactions, social learning and independent learning in horses. Research on these topics is summarized and suggestions for future research are provided. Copyright © 2016 Elsevier B.V. All rights reserved.

Seroepidemiology of Sarcocystis neurona and Neospora hughesi infections in domestic donkeys (Equus asinus in Durango, Mexico

Directory of Open Access Journals (Sweden)

Alvarado-Esquivel Cosme

2017-01-01

Full Text Available There is currently no information regarding Sarcocystis neurona and Neospora hughesi infections in donkeys in Mexico. Here, we determined the presence of antibodies against S. neurona and N. hughesi in donkeys in the northern Mexican state of Durango. Serum samples of 239 domestic donkeys (Equus asinus were assayed for S. neurona and N. hughesi antibodies using home-made enzyme-linked immunoassays; six (2.5% of the 239 donkeys tested seropositive for S. neurona. The seroprevalence of S. neurona infection was comparable among donkeys regardless of their origin, health status, or sex. Multivariate analysis showed that seropositivity to S. neurona was associated with increased age (OR = 2.95; 95% CI: 1.11–7.82; p = 0.02. Antibodies to N. hughesi were found in two (0.8% of the 239 donkeys. Both exposed donkeys were healthy, 3- and 6-year-old females. This is the first evidence of S. neurona and N. hughesi infections in donkeys in Mexico.

Domestic horses (Equus ferus caballus) fail to intuitively reason about object properties like solidity and weight.

Science.gov (United States)

Haemmerli, Sarah; Thill, Corinne; Amici, Federica; Cacchione, Trix

2018-05-01

From early infancy, humans reason about the external world in terms of identifiable, solid, cohesive objects persisting in space and time. This is one of the most fundamental human skills, which may be part of our innate conception of object properties. Although object permanence has been extensively studied across a variety of taxa, little is known about how non-human animals reason about other object properties. In this study, we therefore tested how domestic horses (Equus ferus caballus) intuitively reason about object properties like solidity and height, to locate hidden food. Horses were allowed to look for a food reward behind two opaque screens, only one of which had either the proper height or inclination to hide food rewards. Our results suggest that horses could not intuitively reason about physical object properties, but rather learned to select the screen with the proper height or inclination from the second set of 5 trials.

Seroepidemiology of Sarcocystis neurona and Neospora hughesi infections in domestic donkeys (Equus asinus) in Durango, Mexico.

Science.gov (United States)

Alvarado-Esquivel, Cosme; Howe, Daniel K; Yeargan, Michelle R; Alvarado-Esquivel, Domingo; Alfredo Zamarripa-Barboza, José; Dubey, Jitender P

2017-01-01

There is currently no information regarding Sarcocystis neurona and Neospora hughesi infections in donkeys in Mexico. Here, we determined the presence of antibodies against S. neurona and N. hughesi in donkeys in the northern Mexican state of Durango. Serum samples of 239 domestic donkeys (Equus asinus) were assayed for S. neurona and N. hughesi antibodies using home-made enzyme-linked immunoassays; six (2.5%) of the 239 donkeys tested seropositive for S. neurona. The seroprevalence of S. neurona infection was comparable among donkeys regardless of their origin, health status, or sex. Multivariate analysis showed that seropositivity to S. neurona was associated with increased age (OR = 2.95; 95% CI: 1.11-7.82; p = 0.02). Antibodies to N. hughesi were found in two (0.8%) of the 239 donkeys. Both exposed donkeys were healthy, 3- and 6-year-old females. This is the first evidence of S. neurona and N. hughesi infections in donkeys in Mexico. © C. Alvarado-Esquivel et al., published by EDP Sciences, 2017.

Host social rank and parasites: plains zebra (Equus quagga) and intestinal helminths in Uganda.

Science.gov (United States)

Fugazzola, M C; Stancampiano, L

2012-08-13

The main aim of this study was to evaluate the relationship between the social hierarchy of plain zebra, Equus quagga, and the level of parasitism. For the study 141 fecal samples from the same number of animals were collected within the two major populations of E. quagga of Uganda (Lake Mburo Conservation Area and Kidepo Valley National Park). Quantitative (eggs per gram of feces) and qualitative parasite assessment were performed with standard methods. The relationship between parasite burden and individual host features was analyzed using Generalized Linear Models. Strongyles, cestodes, Strongyloides sp. and oxiurids where present in the examined samples. Social rank and age class significantly affect all parasites' abundance with dominant individuals being less parasitized than subordinate individuals, regardless of the parasite groups excluding oxiurids. Sex could not been shown to be related with any of the found parasites. Age was positively related with strongyles and oxiurids abundance and negatively related with cestodes and Strongyloides sp. The main result of the present study was the evidence that social status influences parasite level with dominant zebras shedding less parasite eggs than subordinate ones. Social rank appears, therefore, as an important factor giving rise to parasite aggregation in plain zebras. Copyright © 2012 Elsevier B.V. All rights reserved.

Frequency of Gastric Pathologies in Donkeys (Equus africanus asinus in Córdoba, Colombia

Directory of Open Access Journals (Sweden)

José Alberto Cardona Álvarez

2015-12-01

Full Text Available This study aimed to determine the frequency of gastric pathologies in donkeys (Equus africanus asinus in the department of Córdoba, Colombia. Stomachs of 137 donkeys (73 intact males, 16 castrated males, and 48 females, aged between 1 to 25 years, were examined, characterized and photographed post mortem. Data on sex, age and pathology were reported on the respective forms and then digitized. Of the total population (137 donkeys, stomach ulcers and associated gastritis were found in 100% of the samples, antral edema in 56.9%, parasites (Trichostrongylus axei in 10.2%, and impaction in 5.8%. Furthermore, Hemomelasma gastric was found in one stomach (0.7%. As a conclusion, 100% of the evaluated animals presented at least some kind of gastric pathology. Acute gastritis was the most frequent type (71.5%, followed in a smaller proportion by chronic gastritis (28.4%. The study showed a significant statistical dependence between age and the degree of injury to the glandular mucosa (p < 0.05. Thus, it evidenced a high incidence of gastric pathologies in donkeys in different livestock holdings in Córdoba, among which squamous ulcers are the most frequent ones, followed by acute gastritis and antral edema. For this reason, it is necessary to do more research and to raise awareness about the treatment of these pathologies in these animals.

Parasite-mediated selection drives an immunogenetic tradeoff in plains zebra (Equus quagga)

Science.gov (United States)

Kamath, Pauline L.; Turner, Wendy C.; Küsters, Martina; Getz, Wayne M.

2014-01-01

Pathogen evasion of the host immune system is a key force driving extreme polymorphism in genes of the major histocompatibility complex (MHC). Although this gene family is well characterized in structure and function, there is still much debate surrounding the mechanisms by which MHC diversity is selectively maintained. Many studies have investigated relationships between MHC variation and specific pathogens, and have found mixed support for and against the hypotheses of heterozygote advantage, frequency-dependent or fluctuating selection. Few, however, have focused on the selective effects of multiple parasite types on host immunogenetic patterns. Here, we examined relationships between variation in the equine MHC gene, ELA-DRA, and both gastrointestinal (GI) and ectoparasitism in plains zebras (Equus quagga). Specific alleles present at opposing population frequencies had antagonistic effects, with rare alleles associated with increased GI parasitism and common alleles with increased tick burdens. These results support a frequency-dependent mechanism, but are also consistent with fluctuating selection. Maladaptive GI parasite ‘susceptibility alleles’ were reduced in frequency, suggesting that these parasites may play a greater selective role at this locus. Heterozygote advantage, in terms of allele mutational divergence, also predicted decreased GI parasite burden in genotypes with a common allele. We conclude that an immunogenetic trade-off affects resistance/susceptibility to parasites in this system. Because GI and ectoparasites do not directly interact within hosts, our results uniquely show that antagonistic parasite interactions can be indirectly modulated through the host immune system. This study highlights the importance of investigating the role of multiple parasites in shaping patterns of host immunogenetic variation.

Interspecific communication from people to horses (Equus ferus caballus) is influenced by different horsemanship training styles.

Science.gov (United States)

Dorey, Nicole R; Conover, Alicia M; Udell, Monique A R

2014-11-01

The ability of many domesticated animals to follow human pointing gestures to locate hidden food has led to scientific debate on the relative importance of domestication and individual experience on the origins and development of this capacity. To further explore this question, we examined the influence of different prior training histories/methods on the ability of horses (Equus ferus caballus) to follow a momentary distal point. Ten horses previously trained using one of two methods (Parelli™ natural horsemanship or traditional horse training) were tested using a standard object choice task. The results show that neither group of horses was initially able to follow the momentary distal point. However, after more experience with the point, horses previously trained using the Parelli natural horsemanship method learned to follow momentary distal points significantly faster than those previously trained with traditional methods. The poor initial performance of horses on distal pointing tasks, coupled with the finding that prior training history and experimental experience can lead to success on this task, fails to support the predictions of the domestication hypothesis and instead lends support to the two-stage hypothesis. (PsycINFO Database Record (c) 2014 APA, all rights reserved).

Genetic diversity of the Ethiopian Grevy's zebra (Equus grevyi) populations that includes a unique population of the Alledeghi Plain.

Science.gov (United States)

Kebede, Fanuel; Rosenbom, Sonia; Khalatbari, Leili; Moehlman, Patricia D; Beja-Pereira, Albano; Bekele, Afework

2016-01-01

The endangered Grevy's Zebra (Equus grevyi) is confined to the Horn of Africa, specifically Ethiopia and Kenya. It is threatened by habitat loss and fragmentation due to human encroachment of historic range. Knowledge of population genetics is essential for the development of appropriate conservation actions and management. The focus of this study was to assess the heterogeneity and genetic distinctiveness of the two Grevy's zebra populations in Ethiopia. Non-invasive fecal samples (N = 120) were collected during 2009-2010 from Grevy's zebra populations in the Alledeghi Wildlife Reserve and the Sarite area, Ethiopia. Analyses of a 329 bp of the mtDNA control region of 47 sequences, revealed the existence of two unreported haplotypes in the northern population of Alledeghi, that were not shared with the southern population of Sarite. The Sarite population is contiguous with the Grevy's zebra population in Kenya. The nucleotide diversity levels found in both the populations are extremely low.

High variation and very low differentiation in wide ranging plains zebra (Equus quagga): insights from mtDNA and microsatellites.

Science.gov (United States)

Lorenzen, Eline D; Arctander, Peter; Siegismund, Hans R

2008-06-01

Patterns of genetic differentiation in the plains zebra (Equus quagga) were analysed using mitochondrial DNA control region variation and seven microsatellites. The six morphologically defined subspecies of plains zebra lacked the population genetic structure indicative of distinct evolutionary units. Both marker sets showed high levels of genetic variation and very low levels of differentiation. There was no geographical structuring of mitochondrial DNA haplotypes in the phylogenetic tree, and the plains zebra showed the lowest overall differentiation recorded in any African ungulate studied so far. Arid-adapted African ungulates have shown significant regional genetic structuring in support of the Pleistocene refuge theory. This was not the case in the zebra, and the data are discussed in relation to the impact of Pleistocene climate change on a nonbovid member of the savannah ungulate community. The only other species showing a similar absence of genetic structuring is the African buffalo (Syncerus caffer), but this taxon lacks the high levels of morphological variation present in the plains zebra.

Morphometric analysis of the neuronal numbers and densities of the inferior olivary complex in the donkey (Equus asinus).

Science.gov (United States)

Alkafafy, Mohamed; Rashed, Reda; Attia, Hossam

2011-07-01

The morphometric interrelations between the compartments of the inferior olivary complex (IOC) in the donkey (Equus asinus) were ascertained by examining serial sections throughout the entire length of the IOC for both sides. Nissl-stained celloidin sections of four brainstems of donkeys were used. The IOC consisted of three major nuclei and four small cell groups. The total neuronal count in both sides of the IOC was 202,040±8480 cells. The medial accessory olivary nucleus (MAO) had the largest relative area (46%) and the highest number of neurons (90,800±7600). The dorsal accessory olivary nucleus (DAO) had the second largest relative area (33%), while the principal olivary nucleus (PO) had the lowest relative area (21%). However, the total neuron count in the PO was larger (60,840±1840) than DAO (50,360±4040). The average neuronal density was 2700±400 cells/mm(3). The numerical values of the current study of the IOC in the donkey were similar to those of other mammals. Copyright © 2010 Elsevier GmbH. All rights reserved.

Human Activity Dampens the Benefits of Group Size on Vigilance in Khulan (Equus hemionus in Western China.

Directory of Open Access Journals (Sweden)

Mu-Yang Wang

Full Text Available Animals receive anti-predator benefits from social behavior. As part of a group, individuals spend less time being vigilant, and vigilance decreases with increasing group size. This phenomenon, called "the many-eyes effect", together with the "encounter dilution effect", is considered among the most important factors determining individual vigilance behavior. However, in addition to group size, other social and environmental factors also influence the degree of vigilance, including disturbance from human activities. In our study, we examined vigilance behavior of Khulans (Equus hemionus in the Xinjiang Province in western China to test whether and how human disturbance and group size affect vigilance. According to our results, Khulan showed a negative correlation between group size and the percentage time spent vigilant, although this negative correlation depended on the groups' disturbance level. Khulan in the more disturbed area had a dampened benefit from increases in group size, compared to those in the undisturbed core areas. Provision of continuous areas of high-quality habitat for Khulans will allow them to form larger undisturbed aggregations and to gain foraging benefits through reduced individual vigilance, as well as anti-predator benefits through increased probability of predator detection.

Human Activity Dampens the Benefits of Group Size on Vigilance in Khulan (Equus hemionus) in Western China.

Science.gov (United States)

Wang, Mu-Yang; Ruckstuhl, Kathreen E; Xu, Wen-Xuan; Blank, David; Yang, Wei-Kang

2016-01-01

Animals receive anti-predator benefits from social behavior. As part of a group, individuals spend less time being vigilant, and vigilance decreases with increasing group size. This phenomenon, called "the many-eyes effect", together with the "encounter dilution effect", is considered among the most important factors determining individual vigilance behavior. However, in addition to group size, other social and environmental factors also influence the degree of vigilance, including disturbance from human activities. In our study, we examined vigilance behavior of Khulans (Equus hemionus) in the Xinjiang Province in western China to test whether and how human disturbance and group size affect vigilance. According to our results, Khulan showed a negative correlation between group size and the percentage time spent vigilant, although this negative correlation depended on the groups' disturbance level. Khulan in the more disturbed area had a dampened benefit from increases in group size, compared to those in the undisturbed core areas. Provision of continuous areas of high-quality habitat for Khulans will allow them to form larger undisturbed aggregations and to gain foraging benefits through reduced individual vigilance, as well as anti-predator benefits through increased probability of predator detection.

Parasite-mediated selection drives an immunogenetic trade-off in plains zebras (Equus quagga).

Science.gov (United States)

Kamath, Pauline L; Turner, Wendy C; Küsters, Martina; Getz, Wayne M

2014-05-22

Pathogen evasion of the host immune system is a key force driving extreme polymorphism in genes of the major histocompatibility complex (MHC). Although this gene family is well characterized in structure and function, there is still much debate surrounding the mechanisms by which MHC diversity is selectively maintained. Many studies have investigated relationships between MHC variation and specific pathogens, and have found mixed support for and against the hypotheses of heterozygote advantage, frequency-dependent or fluctuating selection. Few, however, have focused on the selective effects of multiple parasite types on host immunogenetic patterns. Here, we examined relationships between variation in the equine MHC gene, ELA-DRA, and both gastrointestinal (GI) and ectoparasitism in plains zebras (Equus quagga). Specific alleles present at opposing population frequencies had antagonistic effects, with rare alleles associated with increased GI parasitism and common alleles with increased tick burdens. These results support a frequency-dependent mechanism, but are also consistent with fluctuating selection. Maladaptive GI parasite 'susceptibility alleles' were reduced in frequency, suggesting that these parasites may play a greater selective role at this locus. Heterozygote advantage, in terms of allele mutational divergence, also predicted decreased GI parasite burden in genotypes with a common allele. We conclude that an immunogenetic trade-off affects resistance/susceptibility to parasites in this system. Because GI and ectoparasites do not directly interact within hosts, our results uniquely show that antagonistic parasite interactions can be indirectly modulated through the host immune system. This study highlights the importance of investigating the role of multiple parasites in shaping patterns of host immunogenetic variation.

Social Class and Group Size as Predictors of Behavior in Male Equus kiang

Directory of Open Access Journals (Sweden)

Prameek M. Kannan

2017-11-01

Full Text Available Ethograms provide a systematic approach to identify and quantify the repertoire of behaviors of an organism. This information may assist animal welfare in zoos, increase awareness of conservation needs, and help curb high-risk behaviors during human-wildlife conflict. Our primary objective was to utilize an equid ethogram to produce activity budgets for Equus kiang males, a social ungulate that is among the least-studied mammals worldwide, and unknown to the ethological literature. We recently reported the existence of three social classes of this species; Territorial males, Bachelor males and ‘Transient’ males. Therefore, our secondary objective was to compare activity budgets in each of these three groups. We found that kiang spent >70% of their time performing six behaviors: vigilance (34%, locomotion (24.2%, resting (14.2%, mixed foraging (12.5%, browsing (5.1%, and antagonism (1.1%. Over 2% of the total behavioral investment was spent on olfactory investigations (genital sniffing, sniffing proximity and flehmen. Eleven of the eighteen behaviors differed by class. Habitat selection differed strongly by each group, with Territorial males favoring mesic sites with greater vegetation abundance. Vigilance also differed according to habitat selection, but not group size. Animals in the xeric, least vegetation-rich area were far less vigilant than animals at more attractive sites. We found that the full repertoire of behaviors, and relative investments in each, differ according to social class. These findings are a reminder that researchers should make every effort to disambiguate social class among ungulates– and other taxa where behaviors are class-dependent.

Proximate and fatty acid composition of zebra (Equus quagga burchellii) muscle and subcutaneous fat.

Science.gov (United States)

Hoffman, Louwrens C; Geldenhuys, Greta; Cawthorn, Donna-Mareè

2016-08-01

The meat from African game species is healthy, naturally produced and increasingly popular with consumers. Among these species, zebra (Equus quagga burchellii) are growing in number in South Africa, with the meat from surplus animals holding potential to contribute to food security and economic stability. Despite being consumed locally and globally, little information exists on the composition of zebra meat. This study aimed to determine the proximate composition of zebra meat as well as the fatty acid composition of the intramuscular (IMF) and subcutaneous (SCF) fat. Zebra longissimus lumborum muscle was shown to have a high mean protein content (22.29 g per 100 g) and low mean fat content (1.47 g per 100 g). High proportions of polyunsaturated fatty acids (PUFAs) were found in the IMF (41.15%) and SCF (37.71%), mainly comprising α-linolenic (C18:3n-3) and linoleic (C18:2n-6) acids. Furthermore, the IMF and SCF had favourable PUFA/saturated fatty acid ratios (>0.4) and omega-6/omega-3 ratios (<4), indicating that both components are healthy lipid food sources. This study has shed new light on the nutritional value of zebra meat, which will not only be important for food product labelling, nutritional education and incorporation into food composition databases, but will also be indispensable for marketing and export purposes. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Equus: a construção do personagem Alan Strang na tradução cinematográfica.

Directory of Open Access Journals (Sweden)

Lucyana do Amaral Brilhante

2005-01-01

Full Text Available Peter Shaffer is a British playwright of the second half of the twentieth century. One of his major works is the play Equus, that tells the story of a young man, Alan Strang, who is in psychiatric treatment. The film director Sidney Lumet, with the script of Shaffer, translated the play to the screen. Based on the concept of intersemiotic translation of Jackobson (1995, it may be said that a film adaptation is, in fact, an intersemiotic translation, which in turn is a kind of audiovisual translation. It is then natural that, in the translation of a play to the screen, the original changes because the translations become different texts, normally unattached to the original work. This work’s objective is to analyze the differences between the play and the film. This paper aims at looking at differences between the screenplay and the film, paying special attention to those that affect the character Alan Strang. So, the corpus of the research consists of the film and the play by Schaffer. The analysis of the character was based on translation and literary theories. Keywords: Audiovisual translation, intersemiotic translation, literature and cinema.

Effects of aquifer storage and recovery activities on water quality in the Little Arkansas River and Equus Beds Aquifer, south-central Kansas, 2011–14

Science.gov (United States)

Stone, Mandy L.; Garrett, Jessica D.; Poulton, Barry C.; Ziegler, Andrew C.

2016-07-18

The Equus Beds aquifer in south-central Kansas is aprimary water source for the city of Wichita. The Equus Beds aquifer storage and recovery (ASR) project was developed to help the city of Wichita meet increasing current (2016) and future water demands. The Equus Beds ASR project pumps water out of the Little Arkansas River during above-base flow conditions, treats it using drinking-water quality standards as a guideline, and recharges it into the Equus Beds aquifer for later use. Phase II of the Equus Beds ASR project currently (2016) includes a river intake facility and a surface-water treatment facility with a 30 million gallon per day capacity. Water diverted from the Little Arkansas River is delivered to an adjacent presedimentation basin for solids removal. Subsequently, waste from the surface-water treatment facility and the presedimentation basin is returned to the Little Arkansas River through a residuals return line. The U.S. Geological Survey, in cooperation with the city of Wichita, developed and implemented a hydrobiological monitoring program as part of the ASR project to characterize and quantify the effects of aquifer storage and recovery activities on the Little Arkansas River and Equus Beds aquifer water quality.Data were collected from 2 surface-water sites (one upstream and one downstream from the residuals return line), 1 residuals return line site, and 2 groundwater well sites (each having a shallow and deep part): the Little Arkansas River upstream from the ASR facility near Sedgwick, Kansas (upstream surface-water site 375350097262800), about 0.03 mile (mi) upstream from the residuals return line site; the Little Arkansas River near Sedgwick, Kans. (downstream surface-water site 07144100), about 1.68 mi downstream from the residuals return line site; discharge from the Little Arkansas River ASR facility near Sedgwick, Kansas (residuals return line site 375348097262800); 25S 01 W 07BCCC01 SMW–S11 near CW36 (MW–7 shallow groundwater well

Przewalski’ s Horse ( Equus ferus przewalskii Re-intr oduction in the Great Gobi B Strictly Protected Area: from Species to Ecosystem Conservation

Directory of Open Access Journals (Sweden)

P. Kaczensky

2007-05-01

Full Text Available The Przewalski’s horse ( Equus ferus przewalskii Po ljakov , 1881, or “T akhi” in Mongolian, became extinct in the wild by the mid 1960’ s. The last recorded sightings of Przewalski’s horses occurred in the Dzungarian Gobi desert in SW Mo ngolia, today’s Great Gobi B Strictly Protected Area (SP A. A re - introduction program was initiated in 1992 and the fi rs t group of captive-born Przewalski’s horses was airlifted to the SPA. Given the logistical challenges associated with such a venture, the initial project focus has been on transport logistics and the well-being of the re-introduced horses. Tod ay, conservation efforts are spread over the entire protected area. Present day ef forts include other mammals, vegetation and the local people. Due to its important symbolic value in Mongolian culture, the Przewalski’ s horse became an important fl agship species for the protected area’s conservation and management.

Genetic diversity detection of the domestic horse (Equus caballus by genes associated with coat color

Directory of Open Access Journals (Sweden)

Luz Correa A

2015-09-01

Full Text Available Objective. To assess the population structure and genetic diversity in populations of domestic horse (Equus caballus in the municipality Cienaga de Oro-Córdoba (Colombia. Materials and methods. Random sampling were conducted between August and October 2013, in adult animals on farms seven districts, which was carried out phenotypic characterization of each animal, based on autosomal markers encoding morphological Extension (E , Agouti (A, Cream (C, White (W, Gray (G, Tobiano (TO, Overo (O and Roan (RN. Population genetic parameters: allele frequency, genetic diversity, gene flow, Hardy-Weinberg equilibrium and genetic distance were calculated through the program POPGENE 1.31; the genetic structure was assessed using the program FSTAT v. 2.9.3.2. Results. 341 individuals were analyzed in the seven populations studied, where the Extension gene Was the MOST faq frequently as the Overo and Tobiano genes showed the lowest values. Insignificant values of genetic variability and population recorded a global level, likewise, low genetic differentiation among populations, accompanied by a high gene flow was obtained; an excess of heterozygotes at population and global level was observed; to this is added the presence of Hardy-Weinberg equilibrium in all populations relative to the markers studied and low genetic distance values were reported. Conclusions. The populations are highly genetically related, a situation that may result from the existing geographical proximity between them, favoring genetic exchange and the establishment of a metapopulation.

First evidence of autochthonous cases of Leishmania (Leishmania) infantum in horse (Equus caballus) in the Americas and mixed infection of Leishmania infantum and Leishmania (Viannia) braziliensis.

Science.gov (United States)

Soares, Isabel R; Silva, Soraia O; Moreira, Filipe Moraghi; Prado, Luan Gavião; Fantini, Priscila; Maranhão, Renata de Pino Albuquerque; da Silva Filho, José Monteiro; Melo, Maria Norma; Palhares, Maristela S

2013-11-08

This study reports the first evidence of infection by Leishmania infantum in Equus caballus in Americas and the first mixed infection of L. infantum/Leishmania braziliensis on this mammalian species in the world. The diagnoses was based on presence of parasites in lesions and bone marrow aspirates, their identification by using specific primers for L. infantum and L. braziliensis complexes and also serological methods IFAT and ELISA. The analysis of the PCR products suggested mixed infection in three animals. Further studies involving equine leishmaniasis are carrying out in order to clarify the dynamic of Leishmania sp. in this mammalian specie and their role in the transmission of those parasites in urban endemic area of Belo Horizonte, Minas Gerais State, Brazil. Copyright © 2013 Elsevier B.V. All rights reserved.

Prevalence of Toxoplasma gondii antibodies in domestic donkeys (Equus asinus) in Durango, Mexico slaughtered for human consumption.

Science.gov (United States)

Alvarado-Esquivel, Cosme; Alvarado-Esquivel, Domingo; Dubey, Jitender P

2015-01-17

Nothing is known about Toxoplasma gondii prevalence in donkeys in Mexico. Meat from donkey is consumed by humans in Mexico and also exported to other countries. We sought to determine the presence of antibodies against T. gondii in 239 domestic donkeys (Equus asinus) for slaughter in Durango, Mexico using the modified agglutination test (MAT). Donkeys were sampled in four premises (trade centers) where donkeys were gather for shipment to abattoirs in other Mexican states. Antibodies to T. gondii were found in 26 (10.9%) of 239 donkeys, with MAT titers of 1:25 in 7, 1:50 in 11, 1:100 in 6, and 1:200 in 2. Seropositive donkeys were found in three (75%) of the four gathering premises studied. Seroprevalence in donkeys varied from 0% to 23.1% among gathering premises. The seroprevalence of T. gondii infection was comparable among donkeys regardless their age, sex or health status. Seropositivity to T. gondii was found in donkeys between 1 to 12 years old. Multivariate analysis showed that seropositivity to T. gondii was associated with the gathering premises (OR = 1.58; 95% CI: 1.11-2.24; P = 0.009). This is the first report of T. gondii infection in donkeys in Mexico. Results indicate that consumption of undercooked or raw meat from T. gondii-infected donkeys is potentially a source of T. gondii infection for humans.

Risk Factors Associated with the Occurrence of Gastrointestinal Helminths among Indigenous Donkeys (Equus asinus in Northeastern Nigeria

Directory of Open Access Journals (Sweden)

Saleh Mohammed Jajere

2016-01-01

Full Text Available Aim. This survey study was conducted from April 2014 through March 2015 in Bauchi, Yobe, and Gombe states, northeastern Nigeria, to explore the risk factors associated with the occurrence of gastrointestinal helminthosis among indigenous donkeys (Equus asinus. Materials and Methods. A total of six hundred fresh faecal samples were randomly collected from indigenous donkeys of varying age, sex, and settlements. Simple flotation and sedimentation techniques were used for the detection of helminths eggs. Results. Three gastrointestinal nematode parasites were encountered including Strongyle, Parascaris equorum, and Oxyuris equi. An overall prevalence of 98.3% was obtained, of which 78.3%, 40.3%, and 17.5% were, respectively, from Strongyle, Parascaris equorum, and Oxyuris equi. Age, sex, and season were not statistically associated with the risk of helminth infection as were the different study areas (p>0.05. However, body condition score, settlement, anthelminthic medication history, and management practices were significantly associated with the risk of gastrointestinal helminthosis. Statistically high prevalence of helminthic infections was observed in donkeys, with poor (thin body condition, from rural settlements, that were not dewormed and raised under poor management systems (p<0.001. Conclusion. It is concluded from the study that gastrointestinal helminths particularly Strongyle were endemic among the indigenous donkeys in northeastern Nigeria. Further control and preventive measures were discussed.

Mitochondrial DNA analyses revealed low genetic diversity in the endangered Indian wild ass Equus hemionus khur.

Science.gov (United States)

Khaire, Devendra; Atkulwar, Ashwin; Farah, Sameera; Baig, Mumtaz

2017-09-01

The Indian wild ass Equus hemionus khur, belonging to ass-like equid branch, inhabits the dry and arid desert of the Little Rann of Kutch, Gujarat. The E. h. khur is the sole survivor of Asiatic wild ass species/subspecies in South Asia. To provide first ever insights into the genetic diversity, phylogeny, and demography of the endangered Indian wild ass, we sampled 52 free-ranging individuals from the Little Rann of Kutch by using a non-invasive methodology. The sequencing of 230 bp in cytochrome b (Cyt b) and displacement loop (D-loop) region revealed that current ∼4000 extant population of Indian wild ass harbours low genetic diversity. Phylogenetic analyses confirmed that E. h. khur, E. h. onager, and E. h. kulan belong to a single strict monophyletic clade. Therefore, we suggest the delimitation of the five E. hemionus subspecies in vogue to a single species E. hemionus. The application of molecular clock confirmed that the Asiatic wild ass had undergone diversification 0.65 Million years ago. Demographic measurements assessed using a Bayesian skyline plot demonstrated decline in the maternal effective population size of the Indian wild ass during different periods; these periods coincided with the origin and rise of the Indus civilization in the northwest of the Indian subcontinent during the Neolithic. In conclusion, maintaining high genetic diversity in the existing isolated population of 4000 Indian wild asses inhabiting the wild ass sanctuary is important compared with subspecies preservation alone.

Immunocontraception in wild horses (Equus caballus extends reproductive cycling beyond the normal breeding season.

Directory of Open Access Journals (Sweden)

Cassandra M V Nuñez

Full Text Available BACKGROUND: Although the physiological effects of immunocontraceptive treatment with porcine zona pellucida (PZP have been well studied, little is known about PZP's effects on the scheduling of reproductive cycling. Recent behavioral research has suggested that recipients of PZP extend the receptive breeding period into what is normally the non-breeding season. METHODOLOGY/PRINCIPAL FINDINGS: To determine if this is the case, we compiled foaling data from wild horses (Equus caballus living on Shackleford Banks, North Carolina for 4 years pre- and 8 years post-contraception management with PZP (pre-contraception, n = 65 births from 45 mares; post-contraception, n = 97 births from 46 mares. Gestation lasts approximately 11-12 months in wild horses, placing conception at approximately 11.5 months prior to birth. Since the contraception program began in January 2000, foaling has occurred over a significantly broader range than it had before the contraception program. Foaling in PZP recipients (n = 45 births from 27 mares has consistently occurred over a broader range than has foaling in non-recipients (n = 52 births from 19 mares. In addition, current recipients of PZP foaled later in the year than did prior recipient and non-recipient mares. Females receiving more consecutive PZP applications gave birth later in the season than did females receiving fewer applications. Finally, the efficacy of PZP declined with increasing consecutive applications before reaching 100% after five consecutive applications. CONCLUSIONS/SIGNIFICANCE: For a gregarious species such as the horse, the extension of reproductive cycling into the fall months has important social consequences, including decreased group stability and the extension of male reproductive behavior. In addition, reproductive cycling into the fall months could have long-term effects on foal survivorship. Managers should consider these factors before enacting immunocontraceptive programs in new

ONLINE RESOURCES

Indian Academy of Sciences (India)

Navya

Low genetic diversity of the endangered Indian wild ass Equus hemionus khur, as revealed by microsatellite ... species of the Asiatic wild asses, Equus hemionus and Equus kiang, have been .... 5'-TCA CCC ACT AAA TCT CAA ATC C-3'.

Plains zebra (Equus quagga) adrenocortical activity increases during times of large aggregations in the Serengeti ecosystem.

Science.gov (United States)

Seeber, P A; Franz, M; Dehnhard, M; Ganswindt, A; Greenwood, A D; East, M L

2018-04-20

Adverse environmental stimuli (stressors) activate the hypothalamic-pituitary-adrenal axis and contribute to allostatic load. This study investigates the contribution of environmental stressors and life history stage to allostatic load in a migratory population of plains zebras (Equus quagga) in the Serengeti ecosystem, in Tanzania, which experiences large local variations in aggregation. We expected higher fGCM response to the environmental stressors of feeding competition, predation pressure and unpredictable social relationships in larger than in smaller aggregations, and in animals at energetically costly life history stages. As the study was conducted during the 2016 El Niño, we did not expect food quality of forage or a lack of water to strongly affect fGCM responses in the dry season. We measured fecal glucocorticoid metabolite (fGCM) concentrations using an enzyme immunoassay (EIA) targeting 11β-hydroxyetiocholanolone and validated its reliability in captive plains zebras. Our results revealed significantly higher fGCM concentrations 1) in large aggregations than in smaller groupings, and 2) in band stallions than in bachelor males. Concentrations of fGCM were not significantly higher in females at the energetically costly life stage of late pregnancy/lactation. The higher allostatic load of stallions associated with females, than bachelor males is likely caused by social stressors. In conclusion, migratory zebras have elevated allostatic loads in large aggregations that probably result from their combined responses to increased feeding competition, predation pressure and various social stressors. Further research is required to disentangle the contribution of these stressors to allostatic load in migratory populations. Copyright © 2018 Elsevier Inc. All rights reserved.

Pre- and postnatal growth phenomena of Burchell's Zebra Equus Burchelli Antiquorum

Directory of Open Access Journals (Sweden)

G.L. Smuts

1975-07-01

Full Text Available Between 1969 and 1972 growth data were collected from 175 zebra Equus burchelli antiquorum and 138 zebra embryos and foetuses from the Central District of the Kruger National Park, Republic of South Africa. Statistical analysis of data indicated no significant difference between body mass of adult stallions (range == 267,3 to 373,3 kg; mean = 318,5 kg; n = 57 and adult non-pregnant mares (range = 272,6 to 386,9 kg; mean = 321,6 kg; n = 51 (t = 0,587. The heaviest zebra had a body mass of 429,4 kilogram. This was a pregnant mare carrying a 35,2 kg foetus. Von Bertalanffy growth curves indicated that shoulder heights in young zebra may reach the adult range by one year of age, the adult body mass range is, however, only attained after three years of age. These curves also showed that age classification of free roaming zebra is only reliable up to the age of about two years, after which individual variation is too great. Stallions were significantly taller at the shoulder than mares (mean = 1,8 cm (t = 2,032 and neck thickness was the only body dimension showing visible sexual dimorphism in adults. Here the stallion had a neck girth on average 8,1 cm greater than the mare. Regression equations for estimating body mass from body dimensions were calculated by using a standard logarithmic transformation and fitting a linear regression by the method of least squares and also by undertaking standard straight line linear regression analyses. Exponential curves obtained by the first method indicated that growth was not isometric (not linear and that the ratios of any of the dimensions of length to body mass were con- stantly changing, i.e. growth is allometric. Marked allometric growth differences existed between the two sexes except in the case of the heart girth-body mass relationship. Comparison of growth data from E. b. antiquorum with that of E. b. boehmi from Tanzania (Sachs 1967, indicates that E. b. antiquorum is considerably larger. Body masses

Field immobilization of feral 'Judas' donkeys (Equus asinus) by remote injection of medetomidine and ketamine and antagonism with atipamezole.

Science.gov (United States)

Woolnough, Andrew P; Hampton, Jordan O; Campbell, Susan; Lethbridge, Mark R; Boardman, Wayne S J; Sharp, Trudy; Rose, Ken

2012-04-01

The Judas technique is a method used for landscape control of feral donkeys (Equus asinus) in northern Australia. Central to the success of any Judas program is the safe, efficient, and humane attachment of the telemetry device. For feral donkeys, this involves the use of field immobilization. We examine the replacement of the current chemical capture agent, succinylcholine, with contemporary immobilization agents to achieve positive animal welfare outcomes. A combination of medetomidine and ketamine delivered by remote injection from a helicopter was used to capture 14 free-ranging feral donkeys for the fitting of telemetry collars in Western Australia in November 2010. Dose rates of 0.14 mg/kg medetomidine and 4.1 mg/kg ketamine were appropriate to immobilize animals in 9 min (± SD = 3). Mean recovery time (total time in recumbency) was 21 min (± 14). All animals recovered uneventfully after being administered atipamezole, a specific antagonist of medetomidine, intramuscularly at 0.35 mg/kg. Physiologic parameters were recorded during recumbency, with environment-related hyperthermia being the only abnormality recognized. No significant complications were encountered, and this drug combination represents an efficient approach to capturing wild donkeys. This new method allows a rapid, safe, cost-effective approach to the immobilization of feral donkeys for use as Judas animals. This drug combination will replace the relatively inhumane succinylcholine for the field immobilization of feral donkeys.

Značkování u koňovitých (Equidae)

OpenAIRE

TUČKOVÁ, Vladimíra

2012-01-01

This master thesis examined the scent marking behaviour by urine and faeces in four equid species, African wild ass (Equus africanus), Grevy?s zebra (Equus grevyi), Plain zebra (Equus quagga) and Mountain zebra (Equus zebra), in captivity. Data about scent marking were collected during two five-month seasons of behavioural observation of 15 equid herds in 5 Czech Zoos, Zoo Dvůr Králové, Zoo Liberec, Zoo Brno, Zoo Ostrava and Zoo Ústí nad Labem. The study focused mainly on testing several hypo...

Unraveling the effects of selection and demography on immune gene variation in free-ranging plains zebra (Equus quagga) populations.

Science.gov (United States)

Kamath, Pauline L; Getz, Wayne M

2012-01-01

Demography, migration and natural selection are predominant processes affecting the distribution of genetic variation among natural populations. Many studies use neutral genetic markers to make inferences about population history. However, the investigation of functional coding loci, which directly reflect fitness, is critical to our understanding of species' ecology and evolution. Immune genes, such as those of the Major Histocompatibility Complex (MHC), play an important role in pathogen recognition and provide a potent model system for studying selection. We contrasted diversity patterns of neutral data with MHC loci, ELA-DRA and -DQA, in two southern African plains zebra (Equus quagga) populations: Etosha National Park, Namibia, and Kruger National Park, South Africa. Results from neutrality tests, along with observations of elevated diversity and low differentiation across populations, supported previous genus-level evidence for balancing selection at these loci. Despite being low, MHC divergence across populations was significant and may be attributed to drift effects typical of geographically separated populations experiencing little to no gene flow, or alternatively to shifting allele frequency distributions driven by spatially variable and fluctuating pathogen communities. At the DRA, zebra exhibited geographic differentiation concordant with microsatellites and reduced levels of diversity in Etosha due to highly skewed allele frequencies that could not be explained by demography, suggestive of spatially heterogeneous selection and local adaptation. This study highlights the complexity in which selection affects immune gene diversity and warrants the need for further research on the ecological mechanisms shaping patterns of adaptive variation among natural populations.

Low plasma cortisol and fecal cortisol metabolite measures as indicators of compromised welfare in domestic horses (Equus caballus.

Directory of Open Access Journals (Sweden)

Jodi Pawluski

Full Text Available The hypothalamic-pituitary-adrenal (HPA axis response to chronic stress is far from straight forward, particularly with regards to animal welfare. There are reports of no effect as well as both decreases and increases in cortisol after chronic stressors. Therefore, the first aim of the present study was to determine how measures of compromised welfare, such as chronic pain and haematological anomalies, related to cortisol levels in domestic horses (Equus caballus. Domestic horses are an informative model to investigate the impact of chronic stress (due to environment, pain, work, housing conditions… on the HPA axis. The second aim was to determine whether levels of fecal cortisol metabolites (FCM may be used as an indicator of welfare measures. The present study used fifty-nine horses (44 geldings and 15 mares, from three riding centres in Brittany, France. The primary findings show that horses whose welfare was clearly compromised (as indicated by an unusual ears backward position, presence of vertebral problems or haematological anomalies, e.g. anaemia also had lower levels of both FCM and plasma cortisol. This work extends our previous findings showing that withdrawn postures, indicators of depressive-like behavior in horses, are associated with lower plasma cortisol levels. We also found that evening plasma cortisol levels positively correlated with FCM levels in horses. Future research aims to determine the extent to which factors of influence on welfare, such as living conditions (e.g. single stalls versus group housing in pasture or paddocks, early life factors, and human interaction, act as mediators of cortisol levels in horses.

Seropositivity of Toxoplasma gondii in domestic donkeys (Equus asinus) and isolation of T. gondii from farm cats.

Science.gov (United States)

Dubey, J P; Ness, S L; Kwok, O C H; Choudhary, S; Mittel, L D; Divers, T J

2014-01-17

Donkeys (Equus asinus) are used as both companion and working animals throughout the world and in some countries, their meat and milk are used for human consumption. Here we report the first serological survey of Toxoplasma gondii in donkeys in the United States. Serum samples from 373 donkeys from eight farms in five states were tested for T. gondii antibodies by the modified agglutination test (MAT). Twenty-four of 373 (6.4%) of donkeys were seropositive, with MAT titers ranging from 25 to ≥ 200. All seropositive donkeys were Miniature breed. Seropositivity prevalence was 7.0% in female donkeys (20/282) and 4.1% in male donkeys (4/91). No donkeys less than 24 months of age (129) were seropositive, suggesting postnatal transmission of infection. Domestic cats were present on six of the eight farms. Three cats from one farm had MAT titers of 200. Viable T. gondii was isolated from the hearts of two cats, but not from brain tissues. Genotyping of isolate DNA extracted from culture-derived tachyzoites using 10 PCR-restriction fragment length polymorphism (RFLP) markers (SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, PK1, L358 and Apico loci) revealed that both isolates were clonal Type II (ToxoDB PCR-RFLP genotype #1). This is the first serological survey for T. gondii in donkeys in the United States, and suggests that donkey milk and meat should be considered as a potential source for human infection. The role of barn cats in the transmission of T. gondii to donkeys on farms warrents further investigation. Copyright © 2013 Elsevier B.V. All rights reserved.

Space-Use Patterns of the Asiatic Wild Ass (Equus hemionus): Complementary Insights from Displacement, Recursion Movement and Habitat Selection Analyses.

Science.gov (United States)

Giotto, Nina; Gerard, Jean-François; Ziv, Alon; Bouskila, Amos; Bar-David, Shirli

2015-01-01

The way in which animals move and use the landscape is influenced by the spatial distribution of resources, and is of importance when considering species conservation. We aimed at exploring how landscape-related factors affect a large herbivore's space-use patterns by using a combined approach, integrating movement (displacement and recursions) and habitat selection analyses. We studied the endangered Asiatic wild ass (Equus hemionus) in the Negev Desert, Israel, using GPS monitoring and direct observation. We found that the main landscape-related factors affecting the species' space-use patterns, on a daily and seasonal basis, were vegetation cover, water sources and topography. Two main habitat types were selected: high-elevation sites during the day (specific microclimate: windy on warm summer days) and streambed surroundings during the night (coupled with high vegetation when the animals were active in summer). Distribution of recursion times (duration between visits) revealed a 24-hour periodicity, a pattern that could be widespread among large herbivores. Characterizing frequently revisited sites suggested that recursion movements were mainly driven by a few landscape features (water sources, vegetation patches, high-elevation points), but also by social factors, such as territoriality, which should be further explored. This study provided complementary insights into the space-use patterns of E. hemionus. Understanding of the species' space-use patterns, at both large and fine spatial scale, is required for developing appropriate conservation protocols. Our approach could be further applied for studying the space-use patterns of other species in heterogeneous landscapes.

Unraveling the effects of selection and demography on immune gene variation in free-ranging plains zebra (Equus quagga populations.

Directory of Open Access Journals (Sweden)

Pauline L Kamath

Full Text Available Demography, migration and natural selection are predominant processes affecting the distribution of genetic variation among natural populations. Many studies use neutral genetic markers to make inferences about population history. However, the investigation of functional coding loci, which directly reflect fitness, is critical to our understanding of species' ecology and evolution. Immune genes, such as those of the Major Histocompatibility Complex (MHC, play an important role in pathogen recognition and provide a potent model system for studying selection. We contrasted diversity patterns of neutral data with MHC loci, ELA-DRA and -DQA, in two southern African plains zebra (Equus quagga populations: Etosha National Park, Namibia, and Kruger National Park, South Africa. Results from neutrality tests, along with observations of elevated diversity and low differentiation across populations, supported previous genus-level evidence for balancing selection at these loci. Despite being low, MHC divergence across populations was significant and may be attributed to drift effects typical of geographically separated populations experiencing little to no gene flow, or alternatively to shifting allele frequency distributions driven by spatially variable and fluctuating pathogen communities. At the DRA, zebra exhibited geographic differentiation concordant with microsatellites and reduced levels of diversity in Etosha due to highly skewed allele frequencies that could not be explained by demography, suggestive of spatially heterogeneous selection and local adaptation. This study highlights the complexity in which selection affects immune gene diversity and warrants the need for further research on the ecological mechanisms shaping patterns of adaptive variation among natural populations.

Injection-Site Reactions in Wild Horses (Equus caballus) Receiving an Immunocontraceptive Vaccine

Science.gov (United States)

Roelle, James E.; Ransom, Jason I.

2009-01-01

The U.S. Geological Survey and the Bureau of Land Management are conducting research on the efficacy of the immunocontraceptive agent porcine zona pellucida (PZP) in reducing fertility of wild horses (Equus caballus). As an antigen, PZP stimulates antibody production when injected into many mammalian species. These antibodies bind to the external surface of the ovum, preventing fertilization. By itself, PZP is only weakly immunogenic and is therefore delivered with an adjuvant, most commonly one of the Freund adjuvants, designed to further stimulate antibody production. Freund's complete adjuvant (FCA) in particular is known to be very effective, but may also be associated with undesirable side effects such as formation of abscesses at injection sites. Such reactions may be exacerbated when accompanied by the additional trauma of a remotely delivered dart. Because horses in our three study herds were individually identifiable by color markings and harem association, we were able to monitor mares for injection-site reactions (abscesses, nodules, swelling, and stiffness) following inoculation with PZP. In 100 injections delivered by hand we observed a single nodule, two instances of swelling, and no other reactions. In two herds that received remotely delivered (dart) injections, the frequency of reactions was about 1 and 6 percent for abscesses, 25 percent for nodules (both herds), 11 and 33 percent for swelling, and 1 and 12 percent for stiffness. Abscesses were too infrequent to allow meaningful analysis of the relation to covariates, but for the other types of reactions we used logistic regression to examine the relation of occurrence to the delivery method (rifle or CO2-powered blowgun), adjuvant (FCA, Freund's modified adjuvant, and Freund's incomplete adjuvant), dart trauma (normal or abnormal), and age of mare. Abnormal dart trauma included cases where the dart hit bone or the needle broke off. We found strong evidence (odds ratio = 5.023, P = 0.001) for a

Age-Related Changes in Locomotor Performance Reveal a Similar Pattern for Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens.

Science.gov (United States)

Marck, Adrien; Berthelot, Geoffroy; Foulonneau, Vincent; Marc, Andy; Antero-Jacquemin, Juliana; Noirez, Philippe; Bronikowski, Anne M; Morgan, Theodore J; Garland, Theodore; Carter, Patrick A; Hersen, Pascal; Di Meglio, Jean-Marc; Toussaint, Jean-François

2017-04-01

Locomotion is one of the major physiological functions for most animals. Previous studies have described aging mechanisms linked to locomotor performance among different species. However, the precise dynamics of these age-related changes, and their interactions with development and senescence, are largely unknown. Here, we use the same conceptual framework to describe locomotor performances in Caenorhabditis elegans, Mus domesticus, Canis familiaris, Equus caballus, and Homo sapiens. We show that locomotion is a consistent biomarker of age-related changes, with an asymmetrical pattern throughout life, regardless of the type of effort or its duration. However, there is variation (i) among species for the same mode of locomotion, (ii) within species for different modes of locomotion, and (iii) among individuals of the same species for the same mode of locomotion. Age-related patterns are modulated by genetic (such as selective breeding) as well as environmental conditions (such as temperature). However, in all cases, the intersection of the rising developmental phase and the declining senescent phase reveals neither a sharp transition nor a plateau, but a smooth transition, emphasizing a crucial moment: the age at peak performance. This transition may define a specific target for future investigations on the dynamics of such biological interactions. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Characterization of a Full-Length Endogenous Beta-Retrovirus, EqERV-Beta1, in the Genome of the Horse (Equus caballus

Directory of Open Access Journals (Sweden)

Antoinette C. van der Kuyl

2011-06-01

Full Text Available Information on endogenous retroviruses fixed in the horse (Equus caballus genome is scarce. The recent availability of a draft sequence of the horse genome enables the detection of such integrated viruses by similarity search. Using translated nucleotide fragments from gamma-, beta-, and delta-retroviral genera for initial searches, a full-length beta-retrovirus genome was retrieved from a horse chromosome 5 contig. The provirus, tentatively named EqERV-beta1 (for the first equine endogenous beta-retrovirus, was 10434 nucleotide (nt in length with the usual retroviral genome structure of 5’LTR-gag-pro-pol-env-3’LTR. The LTRs were 1361 nt long, and differed approximately 1% from each other, suggestive of a relatively recent integration. Coding sequences for gag, pro and pol were present in three different reading-frames, as common for beta-retroviruses, and the reading frames were completely open, except that the env gene was interrupted by a single stopcodon. No reading frame was apparent downstream of the env gene, suggesting that EqERV-beta1 does not encode a superantigen like mouse mammary tumor virus (MMTV. A second proviral genome of EqERV-beta1, with no stopcodon in env, is additionally integrated on chromosome 5 downstream of the first virus. Single EqERV-beta1 LTRs were abundantly present on all chromosomes except chromosome 24. Phylogenetically, EqERV-beta1 most closely resembles an unclassified retroviral sequence from cattle (Bos taurus, and the murine beta-retrovirus MMTV.

Non-invasive Pregnancy Diagnosis from Urine by the Cuboni Reaction and the Barium Chloride Test in Donkeys (Equus asinus) and Alpacas (Vicugna pacos).

Science.gov (United States)

Kubátová, A; Fedorova, T; Skálová, I; Hyniová, L

2016-09-01

The aim of the research was to evaluate two chemical tests for non-invasive pregnancy diagnosis from urine, the Cuboni reaction and the barium chloride test, in donkeys (Equus asinus) and alpacas (Vicugna pacos). The research was carried out from April 2013 to September 2014. Urine samples were collected on five private Czech farms from 18 jennies and 12 alpaca females. Urine was collected non-invasively into plastic cups fastened on a telescopic rod, at 6-9 week intervals. In total, 60 and 54 urine samples from alpacas and jennies, respectively, were collected. The Cuboni reaction was performed by the State Veterinary Institute Prague. The barium chloride test was done with 5 ml of urine mixed together with 5 ml of 1% barium chloride solution. Results of the Cuboni reaction were strongly influenced by the reproductive status of jennies; the test was 100% successful throughout the second half of pregnancy. However, no relationship was found between the real reproductive status of alpaca females and results of the Cuboni reaction. It was concluded that the barium chloride test is not suitable for pregnancy diagnosis either in donkeys, due to significant influence of season on the results, or in alpacas, because no relationship between results of the test and the reproductive status of alpaca females was found. In conclusion, the Cuboni reaction has potential to become a standard pregnancy diagnostic method in donkeys.

50 CFR 17.11 - Endangered and threatened wildlife.

Science.gov (United States)

2010-10-01

... Argentina Entire E 15 NA NA Armadillo, pink fairy Chlamyphorus truncatus Argentina ......do E 3 NA NA Ass, African wild Equus asinus Somalia, Sudan, Ethiopia ......do E 3, 22 NA NA Ass, Asian wild Equus hemionus...

Konik - taaselustatud tarpan / Ingrid Randlaht

Index Scriptorium Estoniae

Randlaht, Ingrid

2011-01-01

Koniku (equus caballus ferus) tagasiaretusprojektidest 19. sajandil looduses väljasurnud ulukhobuse tarpanite (equus ferus ferus) suunal. Kinnikasvamise tõttu hävinenud elupaikade ja looduskeskkondade taastamisesst Euroopas - Lätis, Poolas, Hollandis - ulukhobuste ja ka veiste ning punahirvedega

Practical Bias Correction in Aerial Surveys of Large Mammals: Validation of Hybrid Double-Observer with Sightability Method against Known Abundance of Feral Horse (Equus caballus) Populations.

Science.gov (United States)

Lubow, Bruce C; Ransom, Jason I

2016-01-01

Reliably estimating wildlife abundance is fundamental to effective management. Aerial surveys are one of the only spatially robust tools for estimating large mammal populations, but statistical sampling methods are required to address detection biases that affect accuracy and precision of the estimates. Although various methods for correcting aerial survey bias are employed on large mammal species around the world, these have rarely been rigorously validated. Several populations of feral horses (Equus caballus) in the western United States have been intensively studied, resulting in identification of all unique individuals. This provided a rare opportunity to test aerial survey bias correction on populations of known abundance. We hypothesized that a hybrid method combining simultaneous double-observer and sightability bias correction techniques would accurately estimate abundance. We validated this integrated technique on populations of known size and also on a pair of surveys before and after a known number was removed. Our analysis identified several covariates across the surveys that explained and corrected biases in the estimates. All six tests on known populations produced estimates with deviations from the known value ranging from -8.5% to +13.7% and corrected by our statistical models. Our results validate the hybrid method, highlight its potentially broad applicability, identify some limitations, and provide insight and guidance for improving survey designs.

Adaptive molecular evolution of the Major Histocompatibility Complex genes, DRA and DQA, in the genus Equus.

Science.gov (United States)

Kamath, Pauline L; Getz, Wayne M

2011-05-18

Major Histocompatibility Complex (MHC) genes are central to vertebrate immune response and are believed to be under balancing selection by pathogens. This hypothesis has been supported by observations of extremely high polymorphism, elevated nonsynonymous to synonymous base pair substitution rates and trans-species polymorphisms at these loci. In equids, the organization and variability of this gene family has been described, however the full extent of diversity and selection is unknown. As selection is not expected to act uniformly on a functional gene, maximum likelihood codon-based models of selection that allow heterogeneity in selection across codon positions can be valuable for examining MHC gene evolution and the molecular basis for species adaptations. We investigated the evolution of two class II MHC genes of the Equine Lymphocyte Antigen (ELA), DRA and DQA, in the genus Equus with the addition of novel alleles identified in plains zebra (E. quagga, formerly E. burchelli). We found that both genes exhibited a high degree of polymorphism and inter-specific sharing of allele lineages. To our knowledge, DRA allelic diversity was discovered to be higher than has ever been observed in vertebrates. Evidence was also found to support a duplication of the DQA locus. Selection analyses, evaluated in terms of relative rates of nonsynonymous to synonymous mutations (dN/dS) averaged over the gene region, indicated that the majority of codon sites were conserved and under purifying selection (dN

Adaptive molecular evolution of the Major Histocompatibility Complex genes, DRA and DQA, in the genus Equus

Directory of Open Access Journals (Sweden)

Getz Wayne M

2011-05-01

Full Text Available Abstract Background Major Histocompatibility Complex (MHC genes are central to vertebrate immune response and are believed to be under balancing selection by pathogens. This hypothesis has been supported by observations of extremely high polymorphism, elevated nonsynonymous to synonymous base pair substitution rates and trans-species polymorphisms at these loci. In equids, the organization and variability of this gene family has been described, however the full extent of diversity and selection is unknown. As selection is not expected to act uniformly on a functional gene, maximum likelihood codon-based models of selection that allow heterogeneity in selection across codon positions can be valuable for examining MHC gene evolution and the molecular basis for species adaptations. Results We investigated the evolution of two class II MHC genes of the Equine Lymphocyte Antigen (ELA, DRA and DQA, in the genus Equus with the addition of novel alleles identified in plains zebra (E. quagga, formerly E. burchelli. We found that both genes exhibited a high degree of polymorphism and inter-specific sharing of allele lineages. To our knowledge, DRA allelic diversity was discovered to be higher than has ever been observed in vertebrates. Evidence was also found to support a duplication of the DQA locus. Selection analyses, evaluated in terms of relative rates of nonsynonymous to synonymous mutations (dN/dS averaged over the gene region, indicated that the majority of codon sites were conserved and under purifying selection (dN dS. However, the most likely evolutionary codon models allowed for variable rates of selection across codon sites at both loci and, at the DQA, supported the hypothesis of positive selection acting on specific sites. Conclusions Observations of elevated genetic diversity and trans-species polymorphisms supported the conclusion that balancing selection may be acting on these loci. Furthermore, at the DQA, positive selection was

Estimation and management of genetic diversity in small populations of plains zebra (Equus quagga) in KwaZulu-Natal, South Africa.

Science.gov (United States)

Bowland, A E.; Bishop, K S.; Taylor, P J.; Lamb, J; van der Bank, F H.; van Wyk, E; York, D

2001-06-01

Plains zebras (Equus quagga antiquorum) occur in few large, but many small, isolated populations in KwaZulu-Natal. Problems identified in small populations include reduced striping patterns on hind quarters, smaller size, elevated mortality rates and high number of still-births. Inbreeding may be implicated. Population viability analysis (PVA) was conducted with a computer model (VORTEX), and DNA and allozyme analyses were conducted to test the findings of the model. Using standard methods, DNA (PCR-RAPD) and allozyme diversity was assessed in blood samples from 72 plains zebra from four KwaZulu-Natal Nature Conservation Services (KZN-NCS) protected areas: Umfolozi Game Reserve (UGR), Albert Falls (AFNR), Vernon Crookes (VCNR) and Harold Johnson (HJNR) Nature Reserves. Populations of the latter three, small-sized (9-110 individuals) populations were seeded from the same source population (UGR: current population of 2000) during the past 25 years. Information from PCR-RAPD and allozyme analyses were compared with each other as well as to that predicted by population genetic modelling (using VORTEX). Allozyme heterozygosities were consistently high in all populations (12.1-12.9%), with no observable losses associated with reduced population size. On the other hand, percentage loss of polymorphism (20-39%) calculated from the PCR-RAPD study appeared to be positively correlated with the loss of heterozygosity predicted by population viability analysis (PVA), and negatively correlated with population size. On the basis of the above results, a policy of translocation was advocated for small, intensely managed populations of zebras, whereby a harem should be translocated every five years for a population size of nine (HJNR), while for a population size of 110 (VCNR) translocations should take place every 15 years if heterozygosity is to be maintained at more than 90% within each population over 100 years.

Influence of the cardiac glycoside digoxin on cardiac troponin I, acid-base and electrolyte balance, and haematobiochemical profiles in healthy donkeys (Equus asinus).

Science.gov (United States)

Tharwat, Mohamed; Al-Sobayil, Fahd

2014-03-12

The effect of digoxin administration on the serum concentration of the cardiac troponin I (cTnI) has not been reported to date in equidae. This study was therefore designed to evaluate the effect of digoxin on cardiac cell damage in donkeys (Equus asinus) as assessed by cTnI, acid-base and electrolyte balance and haematobiochemical profiles. Ten clinically healthy donkeys were given an IV infusion of digoxin at a dose of 14 μg/kg. Blood samples were collected from the donkeys up through 72 h post-injection. Three of the donkeys exhibited increased heart and respiratory rates post-injection. In the other seven animals, the heart and respiratory rates were lower 4 h post-injection. The serum digoxin concentration increased significantly at many time points after injection. The serum concentration of cTnI did not differ significantly between pre- and post-injection. An increase in blood pH was noted at 3 h after digoxin injection. There were also increases in PO2 and in oxygen saturation. Decreases in PCO2 at 2 to 48 h post-injection as well as a decrease in blood lactate at 4 h post-injection were observed. The serum concentration of glucose remained significantly elevated at all-time points after digoxin injection. It is concluded that administration of digoxin to healthy donkeys (14 μg/kg) did not result in elevations of serum cTnI concentration, signs of digoxin intoxication, ECG abnormalities and did not increase serum concentrations of blood urea nitrogen and creatinine.

Eighty years of cooperative water science

Science.gov (United States)

Stone, Mandy L.

2017-05-09

The Equus Beds aquifer in south-central Kansas is a primary water source for the city of Wichita. The Equus Beds aquifer storage and recovery (ASR) project was developed to help the city of Wichita meet increasing current and future demands. The Equus Beds ASR project is a recent part of an 80-year cooperative water science effort with the city of Wichita. The U.S. Geological Survey (USGS) Kansas Water Science Center characterizes river and aquifer water-quality and quantity and evaluates changes that may or may not be related to ASR. The USGS data are used by the city of Wichita to make informed management decisions, satisfy regulatory requirements, and serve as a baseline to detect any subsequent changes that may be related to ASR.

Physiological response to chemical immobilization: a case study of etorphine-azaperone in free-ranging plains zebra (Equus quagga in Kenya

Directory of Open Access Journals (Sweden)

Francesca Vitali

2018-06-01

Full Text Available Predictable immobilization of wild zebras is challenging and there is massive variation in opiate response within different species. Etorphine combined with azaperone is considered the protocol of choice, but no studies have investigated the physiological response to this procedure of immobilization in plains zebras.   Eleven free-ranging plains zebras (Equus quagga were immobilized in Kenya using a combination of etorphine 0.019 ± 0.003 mg/kg and azaperone 0.27 ± 0.05 mg/kg administered intramuscularly with a projectile dart. After recumbency, an arterial sample was performed for blood gas analysis and physiological parameters were recorded every five minutes. Descriptive scores were given to the exertion resulting from high-speed chasing and to the quality of induction, immobilization and recovery. Diprenorphine or naltrexone were used for opioid antagonism.   In all zebras, the combination induced quick inductions within 3.5 ± 0.8 minutes and provided reliable recumbencies without attempts to stand for the entire duration of the immobilization. The average heart rates, respiratory rates and mean arterial blood pressure recorded were 102 ± 42 beats/minute, 18 ± 4 breaths/minute and 145 ± 28 mmHg respectively. Arterial gas analyses demonstrated mild to severe and partially compensated metabolic acidosis and hypoxia, while electrolytes were within equids range. In particular, higher exertion levels during the chasing were significantly correlated to worse immobilization scores (p=0.008 and hyperthermia occurrence (p=0.0012 and non-significantly to more severe acidosis. Recoveries from anaesthesia were smooth, on average 121 ± 38 seconds after diprenorphine/naltrexone administration.             Etorphine-azaperone combination produced physiological alterations in free-ranging plains zebra such as tachycardia, hypertension, metabolic acidosis and hypoxemia. However, these preliminary results indicate that high-speed chase

A southern African origin and cryptic structure in the highly mobile plains zebra.

Science.gov (United States)

Pedersen, Casper-Emil T; Albrechtsen, Anders; Etter, Paul D; Johnson, Eric A; Orlando, Ludovic; Chikhi, Lounes; Siegismund, Hans R; Heller, Rasmus

2018-03-01

The plains zebra (Equus quagga) is an ecologically important species of the African savannah. It is also one of the most numerous and widely distributed ungulates, and six subspecies have been described based on morphological variation. However, the within-species evolutionary processes have been difficult to resolve due to its high mobility and a lack of consensus regarding the population structure. We obtained genome-wide DNA polymorphism data from more than 167,000 loci for 59 plains zebras from across the species range, encompassing all recognized extant subspecies, as well as three mountain zebras (Equus zebra) and three Grevy's zebras (Equus grevyi). Surprisingly, the population genetic structure does not mirror the morphology-based subspecies delineation, underlining the dangers of basing management units exclusively on morphological variation. We use demographic modelling to provide insights into the past phylogeography of the species. The results identify a southern African location as the most likely source region from which all extant populations expanded around 370,000 years ago. We show evidence for inclusion of the extinct and phenotypically divergent quagga (Equus quagga quagga) in the plains zebra variation and reveal that it was less divergent from the other subspecies than the northernmost (Ugandan) extant population.

Evolutionary movement of centromeres in horse, donkey, and zebra.

Science.gov (United States)

Carbone, Lucia; Nergadze, Solomon G; Magnani, Elisa; Misceo, Doriana; Francesca Cardone, Maria; Roberto, Roberta; Bertoni, Livia; Attolini, Carmen; Francesca Piras, Maria; de Jong, Pieter; Raudsepp, Terje; Chowdhary, Bhanu P; Guérin, Gérard; Archidiacono, Nicoletta; Rocchi, Mariano; Giulotto, Elena

2006-06-01

Centromere repositioning (CR) is a recently discovered biological phenomenon consisting of the emergence of a new centromere along a chromosome and the inactivation of the old one. After a CR, the primary constriction and the centromeric function are localized in a new position while the order of physical markers on the chromosome remains unchanged. These events profoundly affect chromosomal architecture. Since horses, asses, and zebras, whose evolutionary divergence is relatively recent, show remarkable morphological similarity and capacity to interbreed despite their chromosomes differing considerably, we investigated the role of CR in the karyotype evolution of the genus Equus. Using appropriate panels of BAC clones in FISH experiments, we compared the centromere position and marker order arrangement among orthologous chromosomes of Burchelli's zebra (Equus burchelli), donkey (Equus asinus), and horse (Equus caballus). Surprisingly, at least eight CRs took place during the evolution of this genus. Even more surprisingly, five cases of CR have occurred in the donkey after its divergence from zebra, that is, in a very short evolutionary time (approximately 1 million years). These findings suggest that in some species the CR phenomenon could have played an important role in karyotype shaping, with potential consequences on population dynamics and speciation.

Equus quagga

African Journals Online (AJOL)

FIGURE 3. 0. Family composition of 4 zebra populations. Solid line: total family size; .... stable, had a common sleeping ground where they stayed for the night and ..... because of a certain amount of segregation of stallion groups and families.

Shedding of Clostridium difficile PCR ribotype 078 by zoo animals, and report of an unstable metronidazole-resistant isolate from a zebra foal (Equus quagga burchellii).

Science.gov (United States)

Álvarez-Pérez, Sergio; Blanco, José L; Martínez-Nevado, Eva; Peláez, Teresa; Harmanus, Celine; Kuijper, Ed; García, Marta E

2014-03-14

Clostridium difficile is an emerging and potentially zoonotic pathogen, but its prevalence in most animal species, including exhibition animals, is currently unknown. In this study we assessed the prevalence of faecal shedding of C. difficile by zoo animals, and determined the ribotype, toxin profile and antimicrobial susceptibility of recovered isolates. A total of 200 samples from 40 animal species (36.5% of which came from plains zebra, Equus quagga burchellii) were analysed. C. difficile was isolated from 7 samples (3.5% of total), which came from the following animal species: chimpanzee (Pan troglodytes troglodytes), dwarf goat (Capra hircus), and Iberian ibex (Capra pyrenaica hispanica), with one positive sample each; and plains zebra, with 4 positive samples from 3 different individuals. Most recovered isolates (4/7, 57.1%) belonged to the epidemic PCR ribotype 078, produced toxins A and B, and had the genes encoding binary toxin (i.e. A(+)B(+)CDT(+) isolates). The remaining three isolates belonged to PCR ribotypes 039 (A(-)B(-)CDT(-)), 042 (A(+)B(+)CDT(-)) and 110 (A(-)B(+)CDT(-)). Regardless of their ribotype, all isolates displayed high-level resistance to the fluoroquinolones ciprofloxacin, enrofloxacin and levofloxacin. Some isolates were also resistant to meropenem and/or ertapenem. A ribotype 078 isolate recovered from a male zebra foal initially showed in vitro resistance to metronidazole (MIC ≥ 256 μg/ml), but lost that trait after subculturing on non-selective media. We conclude that zoo animals belonging to different species can carry ribotype 078 and other toxigenic strains of C. difficile showing resistance to antimicrobial compounds commonly used in veterinary and/or human medicine. Copyright © 2014 Elsevier B.V. All rights reserved.

INLUÊNCIA DO TEMPO DE DESCANSO “ANTE MORTEM” E DIETA DE MELAÇO SOBRE OS NÍVEIS DE GLICOGÊNIO MUSCULAR NA CARNE DE EQÜINOS (Equus caballus INFLUENCE OF “ANTE MORTEM” RESTING TIME AND MOLASSES DIET UPON MUSCULAR GLYCOGEN LEVELS IN EQUINES MEAT (Equus caballus

Directory of Open Access Journals (Sweden)

César Augusto Garcia

2007-09-01

Full Text Available

Foram coletadas 48 amostras de músculos tríceps braquial e bíceps femural de vinte e quatro eqüinos machos, sem raça definida, adultos e com pesos aproximadamente iguais. Antes do abate, os animais foram divididos em seis lotes que tiveram descanso ante mortem de zero, seis, quatorze, dezoito e vinte e quatro horas respectivamente. O lote de animais que descansou por dezoito horas foi subdividido em dois sublotes, sendo que um deles recebeu dieta de solução aquosa a 5% de melaço. Todos os outros animais só receberam água e ficaram em jejum. Não se observou influência sobre o pH. O glicogênio foi dosado pelos métodos de Pfluger e Nelson. O lote que apresentou menores índices de glicogênio foi o que descansou por zero hora, enquanto que o lote que apresentou maiores índices de glicogênio foi o que descansou por vinte e quatro horas.

Influence of “ante mortem” resting time and molasses diet upon muscular glycogen levels in equines meat (Equus caballus were studied. Forty-eight samples of triceps brachial and biceps femoral muscles of twenty-four adults and hybrids equines with approximately the same weights were analyzed. The animals were divided before death, in six groups with “ante mortem” resting time of zero, six, fourteen, eighteen and twenty-four hours, respectively. The animal groups with eighteen hours of rest were divided in two sub-groups and one received water solution with 5% of molasses. Alteration in pH levels were not observed. The glycogen was measured by Pfluger and Nelson’s methods. The group with smaller glycogen level was the group with zero hour of “ante mortem” rest, while the group with higher glycogen levels was the group with twenty-four hours of rest.

Archeological Investigations in the Truscott Reservoir Area. King and Knox Counties, Texas,

Science.gov (United States)

1978-06-01

postdate the deposit. Collections consist of an upper molar of Equus sp., two di’stal epiphyses of metapodials of Bison sp., a glenoid fossa of a...includes two lower molars of Equus sp., a fragment of a jaw condyle, and a rib fragment. Since very little material was found at any of these sites, and...Archeological Survey Report No. 6. Austin. 364 McCormick, Olin F. 1976 The Archaic Period in North Central Texas. In The Texas Archaic: A Symposium, edited

Molecular phylogeny of equine herpesvirus 1 isolates from onager, zebra and Thomson's gazelle.

Science.gov (United States)

Ghanem, Y M; Fukushi, H; Ibrahim, E S M; Ohya, K; Yamaguchi, T; Kennedy, M

2008-01-01

Viruses related to equine herpesvirus type 1 (EHV-1) were isolated from an aborted fetus of an onager (Equus hemionus) in 1984, an aborted fetus of Grevy's zebra (Equus grevyi) in 1984 and a Thomson's gazelle (Gazella thomsoni) with nonsuppurative encephalitis in 1996, all in the USA. The mother of the onager fetus and the gazelle were kept near plains zebras (Equus burchelli). In phylogenetic trees based on the nucleotide sequences of the genes for glycoproteins B (gB), I (gI), and E (gE), and teguments including ORF8 (UL51), ORF15 (UL45), and ORF68 (US2), the onager, Grevy's zebra and gazelle isolates formed a genetic group that was different from several horse EHV-1 isolates. Within this group, the onager and gazelle isolates were closely related, while the Grevy's zebra isolate was distantly related to these two isolates. The epizootiological origin of the viruses is discussed.

DNA sequences from the quagga, an extinct member of the horse family.

Science.gov (United States)

Higuchi, R; Bowman, B; Freiberger, M; Ryder, O A; Wilson, A C

To determine whether DNA survives and can be recovered from the remains of extinct creatures, we have examined dried muscle from a museum specimen of the quagga, a zebra-like species (Equus quagga) that became extinct in 1883 (ref. 1). We report that DNA was extracted from this tissue in amounts approaching 1% of that expected from fresh muscle, and that the DNA was of relatively low molecular weight. Among the many clones obtained from the quagga DNA, two containing pieces of mitochondrial DNA (mtDNA) were sequenced. These sequences, comprising 229 nucleotide pairs, differ by 12 base substitutions from the corresponding sequences of mtDNA from a mountain zebra, an extant member of the genus Equus. The number, nature and locations of the substitutions imply that there has been little or no postmortem modification of the quagga DNA sequences, and that the two species had a common ancestor 3-4 Myr ago, consistent with fossil evidence concerning the age of the genus Equus.

The albinism of the feral Asinara white donkeys (Equus asinus) is determined by a missense mutation in a highly conserved position of the tyrosinase (TYR) gene deduced protein.

Science.gov (United States)

Utzeri, V J; Bertolini, F; Ribani, A; Schiavo, G; Dall'Olio, S; Fontanesi, L

2016-02-01

A feral donkey population (Equus asinus), living in the Asinara National Park (an island north-west of Sardinia, Italy), includes a unique white albino donkey subpopulation or colour morph that is a major attraction of this park. Disrupting mutations in the tyrosinase (TYR) gene are known to cause recessive albinisms in humans (oculocutaneous albinism Type 1; OCA1) and other species. In this study, we analysed the donkey TYR gene as a strong candidate to identify the causative mutation of the albinism of these donkeys. The TYR gene was sequenced from 13 donkeys (seven Asinara white albino and six coloured animals). Seven single nucleotide polymorphisms were identified. A missense mutation (c.604C>G; p.His202Asp) in a highly conserved amino acid position (even across kingdoms), which disrupts the first copper-binding site (CuA) of functional protein, was identified in the homozygous condition (G/G or D/D) in all Asinara white albino donkeys and in the albino son of a trio (the grey parents had genotype C/G or H/D), supporting the recessive mode of inheritance of this mutation. Genotyping 82 donkeys confirmed that Asinara albino donkeys had genotype G/G whereas all other coloured donkeys had genotype C/C or C/G. Across-population association between the c.604C>G genotypes and the albino coat colour was highly significant (P = 6.17E-18). The identification of the causative mutation of the albinism in the Asinara white donkeys might open new perspectives to study the dynamics of this putative deleterious allele in a feral population and to manage this interesting animal genetic resource. © 2015 Stichting International Foundation for Animal Genetics.

DETOMIDINE AND BUTORPHANOL FOR STANDING SEDATION IN A RANGE OF ZOO-KEPT UNGULATE SPECIES.

Science.gov (United States)

Bouts, Tim; Dodds, Joanne; Berry, Karla; Arif, Abdi; Taylor, Polly; Routh, Andrew; Gasthuys, Frank

2017-09-01

General anesthesia poses risks for larger zoo species, like cardiorespiratory depression, myopathy, and hyperthermia. In ruminants, ruminal bloat and regurgitation of rumen contents with potential aspiration pneumonia are added risks. Thus, the use of sedation to perform minor procedures is justified in zoo animals. A combination of detomidine and butorphanol has been routinely used in domestic animals. This drug combination, administered by remote intramuscular injection, can also be applied for standing sedation in a range of zoo animals, allowing a number of minor procedures. The combination was successfully administered in five species of nondomesticated equids (Przewalski horse [ Equus ferus przewalskii; n = 1], onager [ Equus hemionus onager; n = 4], kiang [ Equus kiang ; n = 3], Grevy's zebra [ Equus grevyi ; n = 4], and Somali wild ass [ Equus africanus somaliensis; n = 7]), with a mean dose range of 0.10-0.17 mg/kg detomidine and 0.07-0.13 mg/kg butorphanol; the white ( Ceratotherium simum simum; n = 12) and greater one-horned rhinoceros ( Rhinoceros unicornis ; n = 4), with a mean dose of 0.015 mg/kg of both detomidine and butorphanol; and Asiatic elephant bulls ( Elephas maximus ; n = 2), with a mean dose of 0.018 mg/kg of both detomidine and butorphanol. In addition, the combination was successfully used for standing sedation in six species of artiodactylids: giraffe ( Giraffa camelopardalis reticulata; n = 3), western bongo ( Tragelaphus eurycerus eurycerus; n = 2), wisent ( Bison bonasus ; n = 5), yak ( Bos grunniens ; n = 1), water buffalo ( Bubalus bubalis ; n = 4) and Bactrian camel ( Camelus bactrianus ; n = 5). The mean dose range for artiodactylid species except bongo was 0.04-0.06 mg/kg detomidine and 0.03-0.06 mg/kg butorphanol. The dose in bongo, 0.15-0.20 mg/kg detomidine and 0.13-0.15 mg/kg butorphanol, was considerably higher. Times to first effect, approach, and recovery after antidote were short. The use of detomidine and butorphanol has

Next Generation Semiconductor Based Sequencing of the Donkey (Equus asinus) Genome Provided Comparative Sequence Data against the Horse Genome and a Few Millions of Single Nucleotide Polymorphisms

Science.gov (United States)

Bertolini, Francesca; Scimone, Concetta; Geraci, Claudia; Schiavo, Giuseppina; Utzeri, Valerio Joe; Chiofalo, Vincenzo; Fontanesi, Luca

2015-01-01

Few studies investigated the donkey (Equus asinus) at the whole genome level so far. Here, we sequenced the genome of two male donkeys using a next generation semiconductor based sequencing platform (the Ion Proton sequencer) and compared obtained sequence information with the available donkey draft genome (and its Illumina reads from which it was originated) and with the EquCab2.0 assembly of the horse genome. Moreover, the Ion Torrent Personal Genome Analyzer was used to sequence reduced representation libraries (RRL) obtained from a DNA pool including donkeys of different breeds (Grigio Siciliano, Ragusano and Martina Franca). The number of next generation sequencing reads aligned with the EquCab2.0 horse genome was larger than those aligned with the draft donkey genome. This was due to the larger N50 for contigs and scaffolds of the horse genome. Nucleotide divergence between E. caballus and E. asinus was estimated to be ~ 0.52-0.57%. Regions with low nucleotide divergence were identified in several autosomal chromosomes and in the whole chromosome X. These regions might be evolutionally important in equids. Comparing Y-chromosome regions we identified variants that could be useful to track donkey paternal lineages. Moreover, about 4.8 million of single nucleotide polymorphisms (SNPs) in the donkey genome were identified and annotated combining sequencing data from Ion Proton (whole genome sequencing) and Ion Torrent (RRL) runs with Illumina reads. A higher density of SNPs was present in regions homologous to horse chromosome 12, in which several studies reported a high frequency of copy number variants. The SNPs we identified constitute a first resource useful to describe variability at the population genomic level in E. asinus and to establish monitoring systems for the conservation of donkey genetic resources. PMID:26151450

Next Generation Semiconductor Based Sequencing of the Donkey (Equus asinus Genome Provided Comparative Sequence Data against the Horse Genome and a Few Millions of Single Nucleotide Polymorphisms.

Directory of Open Access Journals (Sweden)

Francesca Bertolini

Full Text Available Few studies investigated the donkey (Equus asinus at the whole genome level so far. Here, we sequenced the genome of two male donkeys using a next generation semiconductor based sequencing platform (the Ion Proton sequencer and compared obtained sequence information with the available donkey draft genome (and its Illumina reads from which it was originated and with the EquCab2.0 assembly of the horse genome. Moreover, the Ion Torrent Personal Genome Analyzer was used to sequence reduced representation libraries (RRL obtained from a DNA pool including donkeys of different breeds (Grigio Siciliano, Ragusano and Martina Franca. The number of next generation sequencing reads aligned with the EquCab2.0 horse genome was larger than those aligned with the draft donkey genome. This was due to the larger N50 for contigs and scaffolds of the horse genome. Nucleotide divergence between E. caballus and E. asinus was estimated to be ~ 0.52-0.57%. Regions with low nucleotide divergence were identified in several autosomal chromosomes and in the whole chromosome X. These regions might be evolutionally important in equids. Comparing Y-chromosome regions we identified variants that could be useful to track donkey paternal lineages. Moreover, about 4.8 million of single nucleotide polymorphisms (SNPs in the donkey genome were identified and annotated combining sequencing data from Ion Proton (whole genome sequencing and Ion Torrent (RRL runs with Illumina reads. A higher density of SNPs was present in regions homologous to horse chromosome 12, in which several studies reported a high frequency of copy number variants. The SNPs we identified constitute a first resource useful to describe variability at the population genomic level in E. asinus and to establish monitoring systems for the conservation of donkey genetic resources.

The Role of Science in Managed Aquifer Recharge--the Equus Beds aquifer near Wichita, Kansas Andrew Ziegler, Director Brian Kelly, Office Chief Michael Jacobs, Manager of Water Planning and Production Debra Ary, Engineer, Water Systems Planning (Invited)

Science.gov (United States)

Ziegler, A. C.; Jacobs, M.; Ary, D.; Kelly, B.

2013-12-01

Data collection and interpretation using statistical, geochemical, and numerical simulation tools are essential parts of a long-term cooperative study between the city of Wichita, U.S. Geological Survey, and others to describe water quantity and quality conditions in a 165 square-mile part of the Equus Beds aquifer and Arkansas and Little Arkansas Rivers. The Equus Beds aquifer, eastern part of the High Plains Aquifer in south-central Kansas, is a vital water resource for agriculture and city of Wichita. Withdrawals for public supply began in the 1940s and agricultural irrigation began in the 1950-60s. These withdrawals led to water-level declines of up to 40 feet (historic low in 1993), a storage loss of 250,000 acre feet compared to predevelopment, and may enhance movement of chloride contamination from a past oilfield disposal area near Burrton and from natural chloride along the Arkansas River. Monitoring data and modeling show chloride near Burrton moved about 3 miles in 45 years, is about 1 mile away from the nearest public supply wells, and will continue to move for decades to centuries making the water unusable for irrigation or water supply without treatment. These concerns led to development of Wichita's 1993 integrated local water-supply plan that increased use of Cheney Reservoir and implemented aquifer storage and recovery (ASR) within the aquifer using high flows from the Little Arkansas River. ASR benefits include replacing depleted storage and slowing chloride movement. Decreased withdrawals, increased precipitation, and artificial recharge increased water levels and added 100,000 acre feet of storage through 2010, but drought since 2011 has increased withdrawals. A calibrated model will be used to simulate transport of chloride under several withdrawal scenarios using MODFLOW coupled with SEAWAT. Since 1995, water-quality data collection for more than 400 organic and inorganic compounds in surface water, treated source water for artificial recharge

Equus burchelli antiquorum

African Journals Online (AJOL)

lowed up. This extends the range of Ptenopus into the Great and Little Karroo. Previously the southernmost record as given by Haacke (1975) is from Nuwerust on the west coast. REFERENCES. HAACKE, W. D. 1975. The burrowing geckos of southern Africa, 1 (Reptilia: Gekkonidae). Ann. Transvaal Mus. 29: 197-243. R ep.

equus burchelli antiquorum

African Journals Online (AJOL)

coherent family groups dominated by a single stallion and consist of 2-11 individuals ... determined using an electric balance. ... Observations on E.b. antiquorum indicate that social organization is similar to that observed in ..... supported to some extent by the work of Osterhoff (1966) on biochemical polymorphism in the.

Variation in skin surface lipid composition among the Equidae.

Science.gov (United States)

Colton, S W; Downing, D T

1983-01-01

Skin surface lipids from Equus caballus, E. przewalskii, E. asinus, E. grevyi, E. hemionus onager and a mule (E. asinus/E. caballus) were analyzed in detail. In all species the surface lipid mixtures consisted of giant-ring lactones, cholesterol, cholesteryl esters and minor amounts of wax diesters. In E. caballus, the lactone hydroxyacids were entirely branched chained, while in E. asinus and E. grevyi they were almost exclusively straight chained. In E. przewalskii, the onager and the mule there were both straight and branched chain hydroxyacid lactones. These results are in harmony with published interpretations of the evolutionary relationships among Equus species.

Haematological indices in Trypanosoma brucei brucei (Federe isolate infected Nigerian donkeys (Equus asinus treated with homidium and isometamidium chloride of ciprofloxacin in broiler chickens after single intravenous and intraingluvial administration

Directory of Open Access Journals (Sweden)

Queen Nneka Oparah

2017-03-01

Full Text Available The efficacy of intramuscular administration of Homidium chloride (Novidium® and Isometamidium chloride (Sécuridium® in Nigerian donkeys (Equus asinus experimentally infected with T. b. brucei (Federe isolate was investigated. Changes in haematological and serum biochemical indices were evaluated using clinical haematology and biochemistry methods. Red blood cell (RBC count for the negative control group was significantly higher than for the positive control, Novidium® and Sécuridium®-treatment groups. Haemoglobin (Hb concentration significantly reduced in the infected untreated group compared with other groups. Packed cell volume (PCV was significantly different between negative and positive controls, and also between the infected untreated and treatment groups. There was significant reduction in platelet counts post-infection and post-treatment. Mean corpuscular volume (MCV increased significantly in the treatment groups while mean corpuscular haemoglobin concentration (MCHC significantly reduced only in the Sécuridium®-treatment group. Lymphocyte count for infected untreated was non-significantly higher than for the uninfected controls, but treatment with both trypanocides recorded further increases, which were higher compared with that of the uninfected group. Post infection and treatment, aspartate aminotransferase (AST levels increased significantly. There were non-significant differences in electrolyte ion concentrations across the groups except for chloride ion which recorded a significant reduction in the Novidium®-treatment group. This experiment revealed that Nigerian donkeys infected with T. brucei brucei (Federe isolate developed symptoms of trypanosomosis; anaemia, lymphocytosis and thrombocytopenia. Treatment with the trypanocides ameliorated effects of the infection, and results suggest that immunosuppression may not be a substantial clinical manifestation of T. brucei brucei (Federe isolate trypanosomosis in Nigerian

Gene : CBRC-TTRU-01-0332 [SEVENS

Lifescience Database Archive (English)

Full Text Available 2| PREDICTED: similar to vomeronasal 1 receptor, k1 [Equus caballus] 5e-51 40% MTEVWSSLDCCTKFLRIRYSTVTILEIFF...LKPQTSTCVLPSFLFFWVINMLICIWIITNNETVTNASAAQPGYSPVYCKTKRGDYRESAVFQSAMLIRVFLCINLTVWTS

Estudio de los caballos del yacimiento de Quibas, Pleistoceno Inferior final (Abanilla, Murcia, España

Directory of Open Access Journals (Sweden)

Piñero, P.

2015-12-01

Full Text Available In this paper, over 60 fossil horse remains from the latest early Pleistocene karstic site of Quibas (Abanilla, Murcia, Spain are described. Their taxonomy and morphology, evolutionary stage, and paleoecological determining factors are studied. The multivariate analysis through comparison with different forms that occur in other Spanish and European localities shows that the majority of the fossils match the medium-sized species Equus altidens. This species represents the last form in the stenonoid lineage. In Spain, E. altidens is related to warm or warm-temperate climate, in woodlands or savanna-mosaic habitats. Equus suessenbornensis is also sparsely represented, first cited in the site of Quibas.En este artículo se describen más de 60 restos fósiles de équido recuperados en el yacimiento kárstico del Pleistoceno Inferior final de Quibas (Abanilla, Murcia. Se hace un estudio de su taxonomía y morfología, estado evolutivo y los factores paleoclimáticos vinculados. Comparando con fósiles de équidos hallados en otras localidades españolas y europeas a través de análisis multivariantes, los restos se asignan en su mayor parte a la especie de tamaño medio Equus altidens, último eslabón del linaje de los caballos estenonianos. En España, esta especie se relaciona con unas condiciones climáticas cálidas o cálidas-templadas, cuya vegetación principal estaría compuesta de bosque o bosque-sabana. Se constata también una escasa presencia de Equus suessenbornensis por primera vez en el yacimiento de Quibas.

Ancient DNA from Nubian and Somali wild ass provides insights into donkey ancestry and domestication.

Science.gov (United States)

Kimura, Birgitta; Marshall, Fiona B; Chen, Shanyuan; Rosenbom, Sónia; Moehlman, Patricia D; Tuross, Noreen; Sabin, Richard C; Peters, Joris; Barich, Barbara; Yohannes, Hagos; Kebede, Fanuel; Teclai, Redae; Beja-Pereira, Albano; Mulligan, Connie J

2011-01-07

Genetic data from extant donkeys (Equus asinus) have revealed two distinct mitochondrial DNA haplogroups, suggestive of two separate domestication events in northeast Africa about 5000 years ago. Without distinct phylogeographic structure in domestic donkey haplogroups and with little information on the genetic makeup of the ancestral African wild ass, however, it has been difficult to identify wild ancestors and geographical origins for the domestic mitochondrial clades. Our analysis of ancient archaeological and historic museum samples provides the first genetic information on the historic Nubian wild ass (Equus africanus africanus), Somali wild ass (Equus africanus somaliensis) and ancient donkey. The results demonstrate that the Nubian wild ass was an ancestor of the first donkey haplogroup. In contrast, the Somali wild ass has considerable mitochondrial divergence from the Nubian wild ass and domestic donkeys. These findings resolve the long-standing issue of the role of the Nubian wild ass in the domestication of the donkey, but raise new questions regarding the second ancestor for the donkey. Our results illustrate the complexity of animal domestication, and have conservation implications for critically endangered Nubian and Somali wild ass.

The evolution and anatomy of the horse manus with an emphasis on digit reduction

Science.gov (United States)

Danowitz, Melinda; Stachtiaris, Elizabeth; Khurana, Abhilasha; Araim, Marwan; Sayegh, Marc; Natale, Jessica

2018-01-01

We revisit digit reduction in the horse and propose that all five digits are partially present in the modern adult forelimb. Osteological descriptions of selected tetradactyl, tridactyl and monodactyl equids demonstrate the evolution of the forelimb. Histological, osteological and palaeontological evidence suggest that the Equus distal forelimb is more complex than traditionally conceived. The current understanding is that the horse distal forelimb consists of one complete digit (III) and two reduced splint metacarpals (II and IV). Metacarpals II and IV each exhibit a ventral ridge, which we suggest represents the undifferentiated digits I and V. These ridges are present in the tridactyl Mesohippus, but are absent in the tetradactyl Hyracotherium. The carpal articulations of the five metacarpals match those of pentadactyl taxa. Distally, the frog, a V-shaped structure on the ventral hoof represents digits II and IV, and the wings and hoof cartilages of the distal phalanx are digits I and V. We relate this revised interpretation of the Equus forelimb to Laetoli footprints, and suggest the Hipparion side impressions are created from the hooves of I and V, rather than from II and IV. We show shades of pentadactyly within the Equus manus. PMID:29410871

Analysis of horse genomes provides insight into the diversification and adaptive evolution of karyotype.

Science.gov (United States)

Huang, Jinlong; Zhao, Yiping; Shiraigol, Wunierfu; Li, Bei; Bai, Dongyi; Ye, Weixing; Daidiikhuu, Dorjsuren; Yang, Lihua; Jin, Burenqiqige; Zhao, Qinan; Gao, Yahan; Wu, Jing; Bao, Wuyundalai; Li, Anaer; Zhang, Yuhong; Han, Haige; Bai, Haitang; Bao, Yanqing; Zhao, Lele; Zhai, Zhengxiao; Zhao, Wenjing; Sun, Zikui; Zhang, Yan; Meng, He; Dugarjaviin, Manglai

2014-05-14

Karyotypic diversification is more prominent in Equus species than in other mammals. Here, using next generation sequencing technology, we generated and de novo assembled quality genomes sequences for a male wild horse (Przewalski's horse) and a male domestic horse (Mongolian horse), with about 93-fold and 91-fold coverage, respectively. Portion of Y chromosome from wild horse assemblies (3 M bp) and Mongolian horse (2 M bp) were also sequenced and de novo assembled. We confirmed a Robertsonian translocation event through the wild horse's chromosomes 23 and 24, which contained sequences that were highly homologous with those on the domestic horse's chromosome 5. The four main types of rearrangement, insertion of unknown origin, inserted duplication, inversion, and relocation, are not evenly distributed on all the chromosomes, and some chromosomes, such as the X chromosome, contain more rearrangements than others, and the number of inversions is far less than the number of insertions and relocations in the horse genome. Furthermore, we discovered the percentages of LINE_L1 and LTR_ERV1 are significantly increased in rearrangement regions. The analysis results of the two representative Equus species genomes improved our knowledge of Equus chromosome rearrangement and karyotype evolution.

Gene : CBRC-MMUR-01-1612 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1e-56 41% ref|XP_001497978.2| PREDICTED: similar to seven transmembrane helix receptor [Equus caballus] 5e-6...IPPVLRLACADTTEVEAIVFSSSALLILFTVMVILLSYAYILVTICSMRSLEAQGKALSTCASHLTIICLFYGTITFMYAQPSSHNSMEQNKVVSVVYTVVIPMLNPLIYSLRNKDVKHALKRRCQGKLPS ...

A lectin histochemical study to detect variation in glycosylation at the feto-maternal interface in three interbreeding equine species.

Science.gov (United States)

Jones, Carolyn J P; Allen, W R Twink; Wilsher, Sandra

2017-10-01

In this study, we compare glycosylation at the fetomaternal interface in 3 equine species: horse, donkey and zebra, all of which can interbreed to produce hybrids, to assess their glycan similarities and differences. Sections cut from 3 specimens of horse (Equus caballus) placenta (50, 200 and 280 days gestation), one donkey (Equus asinus) placenta (65 cm crown-rump length) and 5 specimens of zebra (Equus quagga) placentae (81-239 days gestation) were stained with a panel of 24 biotinylated lectins using an avidin-peroxidase revealing system. There were only slight quantitative differences in the lectin histochemistry at the feto-maternal interface between all three specimens; zebra placentae expressed more α2,6-linked sialic acid, with α1,2fucosyl residues at the microvillous interface. However, zebra trophoblast showed histological differences from the other two species, with polarised cells, prominent supranuclear Golgi bodies, and fewer intracellular granules. Our findings appear to confirm the hypothesis that closely related, interbreeding species with epitheliochorial placentae express similar glycans at the feto-maternal interface, thereby supporting the existence of a placental glycocode. We also observed intraspecies evolutionary diversion to be associated with a different histological architecture and the absence of significant intracellular granules. Copyright © 2017 Elsevier Ltd. All rights reserved.

Sennar Jacks (Equus asinus)

African Journals Online (AJOL)

This study was carried out with an objective of evaluating the breeding soundness and sexual behavior of Sennar jackasses. ... score of 7 for the breeding and 4.8 for the working jacks. The mean (iSE) of height at wither,the ..... Equine Reproductive Physiology, Breeding and Stud Manage- ment, 2ndEdn. Farming Press ...

Feeding niches of four large herbivores in the Hluhluwe Game ...

African Journals Online (AJOL)

Feeding niches of four large herbivores in the Hluhluwe Game Reserve, Natal. ... equus burchelli burchelli; feeding; grass; grasses; habitat; herbivores; hluhluwe game reserve; kwazulu-natal; large herbivores; ... AJOL African Journals Online.

Mitochondrial phylogenomics of modern and ancient equids.

Science.gov (United States)

Vilstrup, Julia T; Seguin-Orlando, Andaine; Stiller, Mathias; Ginolhac, Aurelien; Raghavan, Maanasa; Nielsen, Sandra C A; Weinstock, Jacobo; Froese, Duane; Vasiliev, Sergei K; Ovodov, Nikolai D; Clary, Joel; Helgen, Kristofer M; Fleischer, Robert C; Cooper, Alan; Shapiro, Beth; Orlando, Ludovic

2013-01-01

The genus Equus is richly represented in the fossil record, yet our understanding of taxonomic relationships within this genus remains limited. To estimate the phylogenetic relationships among modern horses, zebras, asses and donkeys, we generated the first data set including complete mitochondrial sequences from all seven extant lineages within the genus Equus. Bayesian and Maximum Likelihood phylogenetic inference confirms that zebras are monophyletic within the genus, and the Plains and Grevy's zebras form a well-supported monophyletic group. Using ancient DNA techniques, we further characterize the complete mitochondrial genomes of three extinct equid lineages (the New World stilt-legged horses, NWSLH; the subgenus Sussemionus; and the Quagga, Equus quagga quagga). Comparisons with extant taxa confirm the NWSLH as being part of the caballines, and the Quagga and Plains zebras as being conspecific. However, the evolutionary relationships among the non-caballine lineages, including the now-extinct subgenus Sussemionus, remain unresolved, most likely due to extremely rapid radiation within this group. The closest living outgroups (rhinos and tapirs) were found to be too phylogenetically distant to calibrate reliable molecular clocks. Additional mitochondrial genome sequence data, including radiocarbon dated ancient equids, will be required before revisiting the exact timing of the lineage radiation leading up to modern equids, which for now were found to have possibly shared a common ancestor as far as up to 4 Million years ago (Mya).

Mitochondrial Phylogenomics of Modern and Ancient Equids

Science.gov (United States)

Vilstrup, Julia T.; Seguin-Orlando, Andaine; Stiller, Mathias; Ginolhac, Aurelien; Raghavan, Maanasa; Nielsen, Sandra C. A.; Weinstock, Jacobo; Froese, Duane; Vasiliev, Sergei K.; Ovodov, Nikolai D.; Clary, Joel; Helgen, Kristofer M.; Fleischer, Robert C.; Cooper, Alan; Shapiro, Beth; Orlando, Ludovic

2013-01-01

The genus Equus is richly represented in the fossil record, yet our understanding of taxonomic relationships within this genus remains limited. To estimate the phylogenetic relationships among modern horses, zebras, asses and donkeys, we generated the first data set including complete mitochondrial sequences from all seven extant lineages within the genus Equus. Bayesian and Maximum Likelihood phylogenetic inference confirms that zebras are monophyletic within the genus, and the Plains and Grevy’s zebras form a well-supported monophyletic group. Using ancient DNA techniques, we further characterize the complete mitochondrial genomes of three extinct equid lineages (the New World stilt-legged horses, NWSLH; the subgenus Sussemionus; and the Quagga, Equus quagga quagga). Comparisons with extant taxa confirm the NWSLH as being part of the caballines, and the Quagga and Plains zebras as being conspecific. However, the evolutionary relationships among the non-caballine lineages, including the now-extinct subgenus Sussemionus, remain unresolved, most likely due to extremely rapid radiation within this group. The closest living outgroups (rhinos and tapirs) were found to be too phylogenetically distant to calibrate reliable molecular clocks. Additional mitochondrial genome sequence data, including radiocarbon dated ancient equids, will be required before revisiting the exact timing of the lineage radiation leading up to modern equids, which for now were found to have possibly shared a common ancestor as far as up to 4 Million years ago (Mya). PMID:23437078

Mitochondrial phylogenomics of modern and ancient equids.

Directory of Open Access Journals (Sweden)

Julia T Vilstrup

Full Text Available The genus Equus is richly represented in the fossil record, yet our understanding of taxonomic relationships within this genus remains limited. To estimate the phylogenetic relationships among modern horses, zebras, asses and donkeys, we generated the first data set including complete mitochondrial sequences from all seven extant lineages within the genus Equus. Bayesian and Maximum Likelihood phylogenetic inference confirms that zebras are monophyletic within the genus, and the Plains and Grevy's zebras form a well-supported monophyletic group. Using ancient DNA techniques, we further characterize the complete mitochondrial genomes of three extinct equid lineages (the New World stilt-legged horses, NWSLH; the subgenus Sussemionus; and the Quagga, Equus quagga quagga. Comparisons with extant taxa confirm the NWSLH as being part of the caballines, and the Quagga and Plains zebras as being conspecific. However, the evolutionary relationships among the non-caballine lineages, including the now-extinct subgenus Sussemionus, remain unresolved, most likely due to extremely rapid radiation within this group. The closest living outgroups (rhinos and tapirs were found to be too phylogenetically distant to calibrate reliable molecular clocks. Additional mitochondrial genome sequence data, including radiocarbon dated ancient equids, will be required before revisiting the exact timing of the lineage radiation leading up to modern equids, which for now were found to have possibly shared a common ancestor as far as up to 4 Million years ago (Mya.

IL26 gene inactivation in Equidae.

Science.gov (United States)

Shakhsi-Niaei, M; Drögemüller, M; Jagannathan, V; Gerber, V; Leeb, T

2013-12-01

Interleukin-26 (IL26) is a member of the IL10 cytokine family. The IL26 gene is located between two other well-known cytokines genes of this family encoding interferon-gamma (IFNG) and IL22 in an evolutionary conserved gene cluster. In contrast to humans and most other mammals, mice lack a functional Il26 gene. We analyzed the genome sequences of other vertebrates for the presence or absence of functional IL26 orthologs and found that the IL26 gene has also become inactivated in several equid species. We detected a one-base pair frameshift deletion in exon 2 of the IL26 gene in the domestic horse (Equus caballus), Przewalski horse (Equus przewalskii) and donkey (Equus asinus). The remnant IL26 gene in the horse is still transcribed and gives rise to at least five alternative transcripts. None of these transcripts share a conserved open reading frame with the human IL26 gene. A comparative analysis across diverse vertebrates revealed that the IL26 gene has also independently been inactivated in a few other mammals, including the African elephant and the European hedgehog. The IL26 gene thus appears to be highly variable, and the conserved open reading frame has been lost several times during mammalian evolution. © 2013 The Authors, Animal Genetics © 2013 Stichting International Foundation for Animal Genetics.

Zvířecí kosti ze středobronzové jámy ze Slaného (okr. Kladno)

Czech Academy of Sciences Publication Activity Database

Kyselý, René

2012-01-01

Roč. 2012, č. 3 (2012), s. 118-119 ISSN 1804-2953 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeozoology * osteology * Bronze Age * horse (Equus) Subject RIV: AC - Archeology, Anthropology, Ethnology

Unraveling the sequence and structure of the protein osteocalcin from a 42 ka fossil horse

Science.gov (United States)

Ostrom, Peggy H.; Gandhi, Hasand; Strahler, John R.; Walker, Angela K.; Andrews, Philip C.; Leykam, Joseph; Stafford, Thomas W.; Kelly, Robert L.; Walker, Danny N.; Buckley, Mike; Humpula, James

2006-04-01

We report the first complete amino acid sequence and evidence of secondary structure for osteocalcin from a temperate fossil. The osteocalcin derives from a 42 ka equid bone excavated from Juniper Cave, Wyoming. Results were determined by matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-MS) and Edman sequencing with independent confirmation of the sequence in two laboratories. The ancient sequence was compared to that of three modern taxa: horse ( Equus caballus), zebra ( Equus grevyi), and donkey ( Equus asinus). Although there was no difference in sequence among modern taxa, MALDI-MS and Edman sequencing show that residues 48 and 49 of our modern horse are Thr, Ala rather than Pro, Val as previously reported (Carstanjen B., Wattiez, R., Armory, H., Lepage, O.M., Remy, B., 2002. Isolation and characterization of equine osteocalcin. Ann. Med. Vet.146(1), 31-38). MALDI-MS and Edman sequencing data indicate that the osteocalcin sequence of the 42 ka fossil is similar to that of modern horse. Previously inaccessible structural attributes for ancient osteocalcin were observed. Glu 39 rather than Gln 39 is consistent with deamidation, a process known to occur during fossilization and aging. Two post-translational modifications were documented: Hyp 9 and a disulfide bridge. The latter suggests at least partial retention of secondary structure. As has been done for ancient DNA research, we recommend standards for preparation and criteria for authenticating results of ancient protein sequencing.

Dining in the Pleistocene—Who's on the menu?

Science.gov (United States)

Kohn, Matthew J.; McKay, Moriah P.; Knight, James L.

2005-08-01

The Camelot local fauna, a new fossil locality in southeastern South Carolina, has yielded a spectacularly abundant and well-preserved late Irvingtonian (ca. 400 ka) megafauna, including saber-toothed cat (Smilodon fatalis), wolf (Canis armbrusteri), cheetah (Miracinonyx inexpectatus), “camels” (Hemiauchenia macrocephala and Paleolama mirifica), tapir (Tapirus veroensis), deer (Odocoileus virginianus), sloth (Megalonyx jeffersoni), and horse (Equus sp.). Of particular interest is the number of well-preserved fossil teeth and the ability to decipher paleoecologies and paleodiets, especially for carnivores, by using carbon isotope compositions (δ13C) of these teeth. P. mirifica, M. jeffersoni, O. virginianus, and T. veroensis have the lowest δ13C values (-16‰ to -13‰, Vienna Peedee belemnite standard); C. armbrusteri, S. fatalis, and H. macrocephala have intermediate values (-13‰ to -8‰); and Equus sp. has the highest values (-7‰ to -1‰). High (>-5‰) vs. low (≤-9‰) δ13C values for herbivores indicate local habitats dominated by warm-climate grasses vs. trees and shrubs. The high δ13C values for Equus sp. indicate the presence of grasslands, whereas the low δ13C values for the other herbivores generally indicate the presence of forests. Although few data are available for carnivores, moderate δ13C values for C. armbrusteri indicate that it preyed mainly upon forest herbivores. S. fatalis appears to have preferred marginal woodland-grassland areas.

A rapid loss of stripes: the evolutionary history of the extinct quagga.

Science.gov (United States)

Leonard, Jennifer A; Rohland, Nadin; Glaberman, Scott; Fleischer, Robert C; Caccone, Adalgisa; Hofreiter, Michael

2005-09-22

Twenty years ago, the field of ancient DNA was launched with the publication of two short mitochondrial (mt) DNA sequences from a single quagga (Equus quagga) museum skin, an extinct South African equid (Higuchi et al. 1984 Nature312, 282-284). This was the first extinct species from which genetic information was retrieved. The DNA sequences of the quagga showed that it was more closely related to zebras than to horses. However, quagga evolutionary history is far from clear. We have isolated DNA from eight quaggas and a plains zebra (subspecies or phenotype Equus burchelli burchelli). We show that the quagga displayed little genetic diversity and very recently diverged from the plains zebra, probably during the penultimate glacial maximum. This emphasizes the importance of Pleistocene climate changes for phylogeographic patterns in African as well as Holarctic fauna.

A southern African origin and cryptic structure in the highly mobile plains zebra

DEFF Research Database (Denmark)

Pedersen, Casper-Emil T; Albrechtsen, Anders; Etter, Paul D.

2018-01-01

insights into the past phylogeography of the species. The results identify a southern African location as the most likely source region from which all extant populations expanded around 370,000 years ago. We show evidence for inclusion of the extinct and phenotypically divergent quagga (Equus quagga quagga......The plains zebra (Equus quagga) is an ecologically important species of the African savannah. It is also one of the most numerous and widely distributed ungulates, and six subspecies have been described based on morphological variation. However, the within-species evolutionary processes have been...... difficult to resolve due to its high mobility and a lack of consensus regarding the population structure. We obtained genome-wide DNA polymorphism data from more than 167,000 loci for 59 plains zebras from across the species range, encompassing all recognized extant subspecies, as well as three mountain...

Teismeliste üksindus ja kommerts - teema nii Londonis kui ka meil / Tõnis Mägi

Index Scriptorium Estoniae

Mägi, Tõnis, 1948-

2007-01-01

Muusik räägib, mida huvitavat ta nägi Londonis. Lähemalt Peter Shafferi näidendi "Equus" lavastusest, peaosades Richard Griffith ja Daniel Radcliffe. Artikkel ilmub Teatrikülgedel rubriigis "Teater & küljed" 5/17

Forage patch use by grazing herbivores in a South African grazing ecosystem

NARCIS (Netherlands)

Venter, J.A.; Nabe-Nielsen, J.; Prins, H.H.T.; Slotow, R.

2014-01-01

Understanding how different herbivores make forage patch use choices explains how they maintain an adequate nutritional status, which is important for effective conservation management of grazing ecosystems. Using telemetry data, we investigated nonruminant zebra (Equus burchelli) and ruminant red

Resource partitioning between large herbivores in Hustai National Park, Mongolia

NARCIS (Netherlands)

Sietses, D.J.; Faupin, G.; Boer, de W.F.; Jong, de C.B.; Henkens, R.J.H.G.; Usukhjargal, D.; Batbaatar, T.

2009-01-01

Re-introduced Przewalski horses in Hustai National Park, Mongolia could suffer from food competition with other herbivore species through food resource depletion. Diet composition of the Przewalski horse (Equus ferus przewalskii), red deer (Cervus elaphus) and four livestock species (sheep, goat,

Journal of Genetics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 96; Online resources. Low genetic diversity of the endangered Indian wild ass Equus hemionus khur, as revealed by microsatellite analyses. DEVENDRA KHAIRE ASHWIN ATKULWAR SAMEERA FARAH MUMTAZ BAIG. Online Resource Volume 96 Online resources 2017 pp ...

Mitochondrial phylogenomics of modern and ancient equids

DEFF Research Database (Denmark)

Mouatt, Julia Thidamarth Vilstrup; Seguin-Orlando, Andaine; Stiller, Mathias

2013-01-01

The genus Equus is richly represented in the fossil record, yet our understanding of taxonomic relationships within this genus remains limited. To estimate the phylogenetic relationships among modern horses, zebras, asses and donkeys, we generated the first data set including complete mitochondrial...

Genetic evaluation of the captive breeding program of the Persian wild ass

DEFF Research Database (Denmark)

Nielsen, R.K.; Pertoldi, C.; Loeschcke, Volker

2007-01-01

the interpretation of the results obtained from analyses based on such data. In this investigation, 12 microsatellite loci were investigated to evaluate the studbook information of the critically endangered Persian wild ass, Equus hemionus onager. Relatedness and inbreeding coefficients were calculated in order...

Wolf Predation Among Reintroduced Przewalski Horses in Hustai National Park, Mongolia

NARCIS (Netherlands)

Duyne, van C.; Ras, E.; Vos, de A.E.W.; Boer, de W.F.; Henkens, R.J.H.G.; Usukhjargal, D.

2009-01-01

Depredation by wolves (Canis lupus) could threaten survival of reintroduced wild Przewalski horses (Equus ferus przewalskii) in Hustai National Park (HNP), Mongolia. We conducted scat analysis, spatial analyses of kills, and interviews to study prey species selection and temporal and spatial factors

Investigating determinants of yawning in the domestic ( Equus caballus) and Przewalski ( Equus ferus przewalskii) horses

Science.gov (United States)

Górecka-Bruzda, Aleksandra; Fureix, Carole; Ouvrard, Anne; Bourjade, Marie; Hausberger, Martine

2016-10-01

Yawning is rare in herbivores which therefore may be an interesting group to disentangle the potential function(s) of yawning behaviour. Horses provide the opportunity to compare not only animals living in different conditions but also wild versus domestic species. Here, we tested three hypotheses by observing both domestic and Przewalski horses living in semi-natural conditions: (i) that domestic horses may show an elevated rate of yawning as a result of the domestication process (or as a result of life conditions), (ii) that individuals experiencing a higher level of social stress would yawn more than individuals with lower social stress and (iii) that males would yawn more often than females. The study involved 19 Przewalski horses (PHs) and 16 domestic horses (DHs) of different breeds living in large outdoor enclosures. The results showed that there was no difference between the PH and DH in yawning frequency (YF). PHs exhibited much higher levels of social interactions than DHs. There was a positive correlation between yawning frequency and aggressive behaviours in PHs, especially males, supporting the idea that yawning may be associated with more excitatory/stressful social situations. A correlation was found between yawning frequency and affiliative behaviours in DHs, which supports the potential relationship between yawning and social context. Finally, the entire males, but not castrated males, showed much higher levels of yawning than females in both species. The intensity (rather than the valence) of the interaction may be important in triggering yawning, which could therefore be a displacement activity that helps reduce tension.

Animal and plant remains in a tomb in test-pit 1/05, outside the fortified imperial palace Felix Romuliana

Directory of Open Access Journals (Sweden)

Dimitrijević Vesna

2007-01-01

Full Text Available During the excavations of a tomb located outside the defence walls of the imperial palace, Felix Romuliana, animal and plant remains were collected the analysis of which is the subject of the present study. The faunal remains include the bones and teeth of domestic animals - mule (Equus caballus x Equus asinus, domestic ox (Bos taurus, sheep (Ovis aries, sheep or goat (Ovis/Capra, pig (Sus domesticus and dog (Canis familiaris, a few remains of wild animals - red deer (Cervus elaphus and fox (Vulpes vulpes, and bone of a bird. Until now, no remains of mule have been discovered on sites originating from the classical period at the territory of Serbia. As for plant remains, pieces of carbonized oak wood (Quercus and maple wood (Acer were found, as well as a carbonized seed of a cultivated grapevine (Vitis vinifera vinifera and a tiny fruit of goosegrass (Galium aparine.

Sobre la identidad del fragmento craneal atribuido a Homo sp. en Venta Mlcena (Orce Granada

Directory of Open Access Journals (Sweden)

Moyá-Solá, S.

1987-12-01

Full Text Available The internal morphology of the cranial fragment attributed to Homo from Venta Micena (Granada is analysed. The presence of a coronal suture close to lambda does not permit its attribution to the genus Homo. The distace between the coronal suture and lambda (4 cm., the presence of tentorial procces and the digital impresions strongly suggesst its attribution to a juvenil specimen of Equus stenonis.Se analiza la morfología de la cara interna del fragmento craneal de Venta Micena atribuido inicialmente al género Homo. Se detecta la presencia de la sutura coronal a cuatro centímetros del punto lambda. Ello, conjuntamente a las fuertes impresiones digitales del endocraneo y la presencia de una cresta del proceso oseo tentoríal hacen imposible la adscripción de esta pieza al género Homo., atribuyendose a Equus stenonis.

Poppea's bath liquor: the secret proteome of she-donkey's milk.

Science.gov (United States)

Cunsolo, Vincenzo; Muccilli, Vera; Fasoli, Elisa; Saletti, Rosaria; Righetti, Pier Giorgio; Foti, Salvatore

2011-09-06

Donkey's milk is today categorized among the best mother's milk substitute for allergic newborns, due to its much reduced or absent allergenicity, coupled to excellent palatability and nutritional value. However, up to the present, only a handful of proteins had been characterized, just about the standard eight to ten major ones known in all types of milk. By exploiting the combinatorial peptide ligand library technology, and treating large volumes (up to 300 mL) of defatted, de-caseinized (whey) milk, we have been able to identify 106 unique gene products, by far the largest description so far of this precious nutrient. Due to poor knowledge of the donkey's genetic asset, only 10% of the proteins could be identified by consulting the data base of Equus asinus; the largest proportion (70%) could be identified by homology with the proteins of Equus caballus. Copyright © 2011 Elsevier B.V. All rights reserved.

Gasterophilus (Diptera, Gasterophilidae infestation of equids in the Kalamaili Nature Reserve, China

Directory of Open Access Journals (Sweden)

Huang Heqing

2016-01-01

Full Text Available We investigated infections with Gasterophilus spp. in three equids within the Kalamaili Nature Reserve (northern China. We conducted necropsies on 6 Przewalski’s horses (Equus ferus przewalskii and 6 Mongolian wild asses (Equus hemionus and administered ivermectin to 10 overwintering domestic horses to expel parasites during winter periods. All 22 equids studied (100% were infested with Gasterophilus spp. and a total of 17,225 larvae were collected. These included six species: G. haemorrhoidalis, G. inermis, G. intestinalis, G. nasalis, G. nigricornis, and G. pecorum. The mean intensity of Gasterophilus spp. larvae was 1904 in Przewalski’s horses, 780 in Mongolian wild asses, and 113 in domestic horses. Gasterophilus pecorum was the most abundant species in all three equids. Przewalski’s horses, a reintroduced species, had a significantly higher intensity of Gasterophilus spp. than the Mongolian wild ass, indicating greater susceptibility to parasites in its ancestral home.

Horse size and domestication: Early equid bones from the Czech Republic in the European context

Czech Academy of Sciences Publication Activity Database

Kyselý, René; Peške, L.

2016-01-01

Roč. 51, č. 1 (2016), s. 15-39 ISSN 0761-3032 Institutional support: RVO:67985912 Keywords : Horse (Equus) * E. hydruntinus * osteometry * domestication * Czech Republic * Bohemia * Neolithic * Copper Age * Bronze Age * LSI Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.607, year: 2016

Effects of feral free-roaming horses on semi-arid rangeland ecosystems: an example from the sagebrush steppe

Science.gov (United States)

Feral horses (Equus caballus) are viewed as a symbol of freedom and power; however, they are also a largely unmanaged, non-native grazer in North America, South America, and Australia. Information on their influence on vegetation and soil characteristics in semi-arid rangelands has been limited by ...

Zygomycetes from herbivore dung in the ecological reserve of Dois Irmãos, Northeast Brazil

Directory of Open Access Journals (Sweden)

André Luiz Cabral Monteiro de Azevedo Santiago

2011-03-01

Full Text Available Thirty-eight taxa of Zygomycetes distributed in 15 genera were recorded from tapir (Tapirus terrestris, camel (Camelus bactrianus, horse (Equus caballus, deer (Cervus elaphus, agouti (Dasyprocta aguti, donkey (Equus asinus, llama (Llama glama and waterbuck (Kobus ellipsiprymnus dung collected at the Reserva Ecológica de Dois Irmãos located in Recife, State of Pernambuco, Northeast Brazil. The samples were collected on a monthly basis from June 2005 to May 2006, taken to the laboratory and incubated in moist chambers. Higher number of taxa was observed in the excrements of tapir, followed by deer and donkey. The highest number of species was detected for Mucor, followed by Pilobolus. Statistical analyses showed significant differences in richness of Zygomycetes taxa between the herbivore dung types. Differences of species composition, however, were weak. Seasonality influenced the Zygomycetes species composition but not its richness. Variations in taxa composition between ruminants and non-ruminants dung were non significant.

Zygomycetes From Herbivore Dung in the Ecological Reserve of Dois IrmÃOs, Northeast Brazil

Science.gov (United States)

de Azevedo Santiago, André Luiz Cabral Monteiro; Botelho Trufem, Sandra Farto; Malosso, Elaine; dos Santos, Paulo Jorge Parreira; de Queiroz Cavalcanti, Maria Auxiliadora

2011-01-01

Thirty-eight taxa of Zygomycetes distributed in 15 genera were recorded from tapir (Tapirus terrestris), camel (Camelus bactrianus), horse (Equus caballus), deer (Cervus elaphus), agouti (Dasyprocta aguti), donkey (Equus asinus), llama (Llama glama) and waterbuck (Kobus ellipsiprymnus) dung collected at the Reserva Ecológica de Dois Irmãos located in Recife, State of Pernambuco, Northeast Brazil. The samples were collected on a monthly basis from June 2005 to May 2006, taken to the laboratory and incubated in moist chambers. Higher number of taxa was observed in the excrements of tapir, followed by deer and donkey. The highest number of species was detected for Mucor, followed by Pilobolus. Statistical analyses showed significant differences in richness of Zygomycetes taxa between the herbivore dung types. Differences of species composition, however, were weak. Seasonality influenced the Zygomycetes species composition but not its richness. Variations in taxa composition between ruminants and non-ruminants dung were non significant. PMID:24031609

Global evolution of Equidae and Gomphotheriidae from South America.

Science.gov (United States)

Prado, José L; Alberdi, María T

2014-08-01

The contemporary South American mammalian communities were determined by the emergence of the Isthmus of Panama and by the profound climatic oscillations during the Pleistocene. Horses and gomphotheres were 2 very conspicuous groups of immigrant mammals from North America that arrived in South America during the Pleistocene. The present study compiles updated data on the phylogeny, systematics and ecology of both groups in South America. The horses in South America are represented by 2 genera, Hippidion and Equus, as are the gomphotheres, represented by Cuvieronius and Stegomastodon. Both genera of horses include small (Hippidion devillei, H. saldiasi, E. andium and E. insulatus) and large forms (Equus neogeus and H. principale), which dispersed into South America using 2 different routes. The possible model for this dispersion indicates that the small forms used the Andes corridor, while larger horses dispersed through the eastern route and through some coastal areas. In the case of gomphotheres, Cuvieronius and Stegomastodon reached South America in 2 independent dispersal events, and Cuvieronius dispersed across the Andean corridor, while large Stegomastodon spread along the eastern route. Horses and gomphotheres present values of δ(13) C from woodlands to C4 grasslands. Hippidion present lower values of δ(13) C than Equus in the late Pleistocene, whereas the gomphotheres diverge from value of δ(18) O, reflecting that Cuvieronius inhabited the Andean corridor and Stegomastodon dispersed through eastern plains. The gomphothere and horse species recorded in South America became extinct around the time that humans arrived. © 2013 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and Wiley Publishing Asia Pty Ltd.

Mitochondrial DNA genetic variations among four horse populations in Egypt

Directory of Open Access Journals (Sweden)

Othman E. Othman

2017-12-01

It is concluded that sequence analysis of mtDNA control region is still the most informative tool for the identification of genetic biodiversity and phylogeny of different horse breeds and populations. The horse populations reared in Egypt possess low genetic diversity and all of them are belonged to Equus caballus breed.

75 FR 43853 - Endangered and Threatened Wildlife and Plants; Final Rule to List the Medium Tree-Finch...

Science.gov (United States)

2010-07-27

... confirmation of the success of the goat eradication program, was provided by one peer reviewer and has been... habitat is unprotected. A large amount of the highlands has been cleared or altered for farming. Much of... animals include goats (Capra hircus), donkeys (Equus asinus), cattle (Bos taurus), and pigs (Sus scrofa...

Evolutionary Genomics and Conservation of the Endangered Przewalski’s Horse

DEFF Research Database (Denmark)

Der Sarkissian, Clio; Ermini, Luca; Schubert, Mikkel

2015-01-01

Przewalski’s horses (PHs, Equus ferus ssp. przewalskii) were discovered in the Asian steppes in the 1870s and represent the last remaining true wild horses. PHs became extinct in the wild in the 1960s but survived in captivity, thanks to major conservation efforts. The current population is still...

77 FR 33100 - Endangered and Threatened Wildlife and Plants; Technical Correction for African Wild Ass

Science.gov (United States)

2012-06-05

... telecommunications device for the deaf (TDD), call the Federal Information Relay Service (FIRS) at 800-877-8339... recognizes the African wild ass as Equus asinus (CITES Resolution Conf. 12.11 (Rev. CoP15), Standard... the problems it created for enforcement officials, the Parties agreed to deviate from Wilson and...

Social behaviour of African Equidae | Klingel | African Zoology

African Journals Online (AJOL)

Two basically different forms of social organisation have been discovered in the equids. Type one is represented by the plains zebra, Equus quagga, and by the mountain zebra, E. zebra, who live in non-territorial and coherent family groups and stallion groups. The young leave their original families in a set pattern.

Origin and differentiation of a special fragment from Capra hircus ...

African Journals Online (AJOL)

Administrator

2011-09-07

Sep 7, 2011 ... regions of the special fragment in the GenBank of NCBI. A total number of 80 fragments with identity ... recombined during the long period of evolution within and among species, and might be related to ..... and their association to coat color phenotypes in horses (Equus caballus). Mammalian Genome, 12: ...

Ancient DNA provides new insight into the maternal lineages and domestication of Chinese donkeys.

Science.gov (United States)

Han, Lu; Zhu, Songbiao; Ning, Chao; Cai, Dawei; Wang, Kai; Chen, Quanjia; Hu, Songmei; Yang, Junkai; Shao, Jing; Zhu, Hong; Zhou, Hui

2014-11-30

The donkey (Equus asinus) is an important domestic animal that provides a reliable source of protein and method of transportation for many human populations. However, the process of domestication and the dispersal routes of the Chinese donkey are still unclear, as donkey remains are sparse in the archaeological record and often confused with horse remains. To explore the maternal origins and dispersal route of Chinese donkeys, both mitochondrial DNA D-loop and cytochrome b gene fragments of 21 suspected donkey remains from four archaeological sites in China were amplified and sequenced. Molecular methods of species identification show that 17 specimens were donkeys and three samples had the maternal genetic signature of horses. One sample that dates to about 20,000 years before present failed to amplify. In this study, the phylogenetic analysis reveals that ancient Chinese donkeys have high mitochondrial DNA diversity and two distinct mitochondrial maternal lineages, known as the Somali and Nubian lineages. These results indicate that the maternal origin of Chinese domestic donkeys was probably related to the African wild ass, which includes the Nubian wild ass (Equus africanus africanus) and the Somali wild ass (Equus africanus somaliensis). Combined with historical records, the results of this study implied that domestic donkeys spread into west and north China before the emergence of the Han dynasty. The number of Chinese domestic donkeys had increased primarily to meet demand for the expansion of trade, and they were likely used as commodities or for shipping goods along the Silk Road during the Tang Dynasty, when the Silk Road reached its golden age. This study is the first to provide valuable ancient animal DNA evidence for early trade between African and Asian populations. The ancient DNA analysis of Chinese donkeys also sheds light on the dynamic process of the maternal origin, domestication, and dispersal route of ancient Chinese donkeys.

Biometria de pontes de miocárdio em muares (Equus caballus x Equus asinus – Linnaeus 1758

Directory of Open Access Journals (Sweden)

André Luiz C. Ribeiro

2009-06-01

Full Text Available http://dx.doi.org/10.5007/2175-7925.2009v22n3p177 O presente estudo objetivou estudar a freqüência, largura e localização, especialmente no que diz respeito à posição e vasculotopia, das pontes de miocárdio sobre os ramos ventriculares das artérias coronárias direita e esquerda em muares, através da biometria. Estas informações podem contribuir na compreensão das doenças cardíacas, principalmente aquelas relacionadas à circulação coronariana, e na elucidação da importância e funcionalidade das pontes de miocárdio em animais submetidos ou não a esforços físicos. Para isso utilizou-se o muar (n = 30 como modelo, por ser este muitas vezes submetido a extenuantes exercícios físicos de tração. As pontes de miocárdio em muar ocorreram em 76,6% dos corações, o seu número variou de 1 a 7, sendo que foram mais freqüentemente encontradas na porção apical dos corações (37,5% e em igual freqüência sobre os ramos das artérias coronárias direita e esquerda.

Clinical and Histopathological Evaluation of Cutaneous Pythiosis in Donkeys (Equusasinus

Directory of Open Access Journals (Sweden)

José Alberto Cardona Álvarez

2013-06-01

Full Text Available The purpose of this study was to evaluate and characterize the clinical and histopathological aspects of cutaneous pythiosis in donkeys (Equus asinus in the Department of Cordoba, Colombia. A descriptive, non-probability study was conducted on domesticated animals. Nine donkeys clinically and histopathologically diagnosed with cutaneous pythiosis were analyzed. After describing the cases, a serious, crater-shaped granulomatous ulcer was observed, with necrotic tissue, a tumor appearance, abundant fibrinous-bloody exudation and yellowish-white caseous material known as kunkers. The lesions were found in the members, ventral abdomen and chest of the animals. Histopathologically, with the hematoxylin-eosin staining, severe pyogranulomatous dermatitis was observed, with abundant eosinophilic and neutrophilic inflammatory infiltrate; with the Grocott staining, hyphae with septa were found, partially branching into a right angle and brown in color. The definitive diagnosis of the disease was based on the clinical features, the differential diagnosis and the histopathological findings. The diagnosis of cutaneous pythiosis was conclusive. This study becomes the first report of this disease in donkeys (Equus asinus in the department of Córdoba and in Colombia.

Asia Beyond the Border: Physical Geography - Central and Northeastern Asia -

Science.gov (United States)

1961-03-21

Shan: the kiang species ( Equus hemionus kiang). Forest hoofed animals are characteristic only for the western and northern mountain groups which are...severe winter olinate or its hot suremers» ’ „ ,, . •The Hwang Ho has a bread a»4>in S»*** a low vamy «»«»S tee sand and alluvial desert

Fulltext PDF

Indian Academy of Sciences (India)

fragility at that, for Equus died in the land of its birth and had to be salvaged from a stock that had migrated elsewhere. (In a larger sense, horses form one of three dwindling lines. - tapirs and rhinos are the others - that now represent all the diversity of the formerly dominant order Perissodactyla, or odd-toed ungulates, ...

Detecting taxonomic and phylogenetic signals in equid cheek teeth: towards new palaeontological and archaeological proxies

Science.gov (United States)

Mohaseb, A.; Peigné, S.; Debue, K.; Orlando, L.; Mashkour, M.

2017-01-01

The Plio–Pleistocene evolution of Equus and the subsequent domestication of horses and donkeys remains poorly understood, due to the lack of phenotypic markers capable of tracing this evolutionary process in the palaeontological/archaeological record. Using images from 345 specimens, encompassing 15 extant taxa of equids, we quantified the occlusal enamel folding pattern in four mandibular cheek teeth with a single geometric morphometric protocol. We initially investigated the protocol accuracy by assigning each tooth to its correct anatomical position and taxonomic group. We then contrasted the phylogenetic signal present in each tooth shape with an exome-wide phylogeny from 10 extant equine species. We estimated the strength of the phylogenetic signal using a Brownian motion model of evolution with multivariate K statistic, and mapped the dental shape along the molecular phylogeny using an approach based on squared-change parsimony. We found clear evidence for the relevance of dental phenotypes to accurately discriminate all modern members of the genus Equus and capture their phylogenetic relationships. These results are valuable for both palaeontologists and zooarchaeologists exploring the spatial and temporal dynamics of the evolutionary history of the horse family, up to the latest domestication trajectories of horses and donkeys. PMID:28484618

Immunological systematics of the extinct quagga (Equidae).

Science.gov (United States)

Lowenstein, J M; Ryder, O A

1985-09-15

It has been debated whether the extinct quagga was a distinct fourth species of African zebra or whether it was merely the southern variant of the Plains zebra (Equus burchelli). Using a radioimmunoassay (RIA) technique, we have shown that proteins remaining in quagga skins from museums are much more similar to serum proteins of the Plains zebra than to those of the other two extant zebras.

Physiological responses of donkeys (Equus asinus, Perissodactyla ...

African Journals Online (AJOL)

admin

2013-04-03

Apr 3, 2013 ... This is because faecal water loss can account for ... rocky terrain. Donkeys have wooly hair which insulates .... lity, in hot climate, heat loss in donkeys has been obser- ved. ... need supplements, especially throughout the dry season, ..... Ambali SF, Akanbi D, Shittu M, Giwa A, Oladipo OO, Ayo JO (2010a).

[The morphology and differential diagnosis of parasitic larvae of Triodontophorus (Nematoda, Strongylidae)].

Science.gov (United States)

Kharchenko, V A; Dvoĭnos, G M

1989-01-01

356 parasitic larvae of the genus Triodontophorus from Equidae (two Equus hemionus and one E. grevyi) have been investigated. They belong to three phenons, which differ from each other by the shape and dimensions of a stoma, the structure of teeth and other signs. That phenons belong to three different species: T. serratus, T. tenuicollis and T. brevicauda. The differential diagnosis of L4 of that species of Triodontophorus are given.

Prime Contract Awards Over $25,000 by Major System, Contractor and State, FY83.

Science.gov (United States)

1983-01-01

EQUIPMENT 100 EP3CO INC ILLIN 6130 CONVERTERS ELECTRICAL NON ROTATING 201 EQUUS TOOL CORP OHIO 2540 VEHICULAR FURNITURE AND ACCESSORIES 74 Ea 4710 PIPE...LOUISVILLE UNIVERSITY OF KENTU 1095 MISCELLANEOUS WEAPONS MARCONI INSTRUMENTS NEW J 6115 GENERATORS AND GENERATOR SETS ELECTRICAL OLIN CORP ILLIN 1305...AMOUNT FSF ARMY CARTRI DOE--------------------- 50 CAL 4 BALL I TRACER OLIN CORP FLORI 1376 BULK EXPLOSIVES S 17,633 FUK ARMY CARTRIDE

The symbiotic intestinal ciliates and the evolution of their hosts.

Science.gov (United States)

Moon-van der Staay, Seung Yeo; van der Staay, Georg W M; Michalowski, Tadeusz; Jouany, Jean-Pierre; Pristas, Peter; Javorský, Peter; Kišidayová, Svetlana; Varadyova, Zora; McEwan, Neil R; Newbold, C Jamie; van Alen, Theo; de Graaf, Rob; Schmid, Markus; Huynen, Martijn A; Hackstein, Johannes H P

2014-04-01

The evolution of sophisticated differentiations of the gastro-intestinal tract enabled herbivorous mammals to digest dietary cellulose and hemicellulose with the aid of a complex anaerobic microbiota. Distinctive symbiotic ciliates, which are unique to this habitat, are the largest representatives of this microbial community. Analyses of a total of 484 different 18S rRNA genes show that extremely complex, but related ciliate communities can occur in the rumen of cattle, sheep, goats and red deer (301 sequences). The communities in the hindgut of equids (Equus caballus, Equus quagga), and elephants (Elephas maximus, Loxodonta africanus; 162 sequences), which are clearly distinct from the ruminant ciliate biota, exhibit a much higher diversity than anticipated on the basis of their morphology. All these ciliates from the gastro-intestinal tract constitute a monophyletic group, which consists of two major taxa, i.e. Vestibuliferida and Entodiniomorphida. The ciliates from the evolutionarily older hindgut fermenters exhibit a clustering that is specific for higher taxa of their hosts, as extant species of horse and zebra on the one hand, and Africa and Indian elephant on the other hand, share related ciliates. The evolutionary younger ruminants altogether share the various entodiniomorphs and the vestibuliferids from ruminants. Copyright © 2014 Elsevier GmbH. All rights reserved.

Identification of copy number variants in horses

KAUST Repository

Doan, R.

2012-03-01

Copy number variants (CNVs) represent a substantial source of genetic variation in mammals. However, the occurrence of CNVs in horses and their subsequent impact on phenotypic variation is unknown. We performed a study to identify CNVs in 16 horses representing 15 distinct breeds (Equus caballus) and an individual gray donkey (Equus asinus) using a whole-exome tiling array and the array comparative genomic hybridization methodology. We identified 2368 CNVs ranging in size from 197 bp to 3.5 Mb. Merging identical CNVs from each animal yielded 775 CNV regions (CNVRs), involving 1707 protein- and RNA-coding genes. The number of CNVs per animal ranged from 55 to 347, with median and mean sizes of CNVs of 5.3 kb and 99.4 kb, respectively. Approximately 6% of the genes investigated were affected by a CNV. Biological process enrichment analysis indicated CNVs primarily affected genes involved in sensory perception, signal transduction, and metabolism. CNVs also were identified in genes regulating blood group antigens, coat color, fecundity, lactation, keratin formation, neuronal homeostasis, and height in other species. Collectively, these data are the first report of copy number variation in horses and suggest that CNVs are common in the horse genome and may modulate biological processes underlying different traits observed among horses and horse breeds.

A vegetation description and floristic analyses of the springs on the Kammanassie Mountain, Western Cape

OpenAIRE

G. Cleaver; L.R. Brown; G.J. Bredenkamp

2004-01-01

The Kammanassie Mountain is a declared mountain catchment area and a Cape mountain zebra Equus zebra zebra population is preserved on the mountain. The high number of springs on the mountain not only provides water for the animal species but also contributes to overall ecosystem functioning. Long-term conservation of viable ecosystems requires a broader understanding of the ecological processes involved. It was therefore decided that a classification, description and mapping of the spring veg...

Arthroscopy of septic carpitis in donkeys (Equus asinus

Directory of Open Access Journals (Sweden)

A.H. Elkasapy

2014-11-01

Full Text Available Experimental septic arthritis was induced in the radiocarpal joint of 18 donkeys by intra-articular injection of Staphylococcus aureus (3-4X106 CFU. The inoculated animals were divided into three groups (6 donkeys in each group. The arthroscopic examination was carried out before induction of septic carpitis and 3 days (group I, 14 days (group II, and 28 days (group III after induction of infection. The arthroscopic examination of group I revealed hyperemia of synovial membrane and hypertrophied villi. In group II, severe hyperemia of synovial membrane, hypertrophied villi, pannus in the joint cavity and beginning of articular cartilage erosion were found. In group III, severe hyperemia of synovial membrane, hypertrophied villi and more prominent articular cartilage erosion were present.

Analysis of horse genomes provides insight into the diversification and adaptive evolution of karyotype

OpenAIRE

Huang, J. L.; Zhao, Y. P.; Shiraigol, W.; Li, B.; Bai, D. Y.; Ye, W. X.; Daidiikhuu, D.; Yang, L. H.; Jin, Brqqg; Zhao, Q. A.; Gao, Y. H.; Wu, J.; Bao, Wydl; Li, A. A.; Zhang, Y. H. Percival

2014-01-01

Karyotypic diversification is more prominent in Equus species than in other mammals. Here, using next generation sequencing technology, we generated and de novo assembled quality genomes sequences for a male wild horse (Przewalski's horse) and a male domestic horse (Mongolian horse), with about 93-fold and 91-fold coverage, respectively. Portion of Y chromosome from wild horse assemblies (3 M bp) and Mongolian horse (2 M bp) were also sequenced and de novo assembled. We confirmed a Robertsoni...

Mechanics of evolutionary digit reduction in fossil horses (Equidae).

Science.gov (United States)

McHorse, Brianna K; Biewener, Andrew A; Pierce, Stephanie E

2017-08-30

Digit reduction is a major trend that characterizes horse evolution, but its causes and consequences have rarely been quantitatively tested. Using beam analysis on fossilized centre metapodials, we tested how locomotor bone stresses changed with digit reduction and increasing body size across the horse lineage. Internal bone geometry was captured from 13 fossil horse genera that covered the breadth of the equid phylogeny and the spectrum of digit reduction and body sizes, from Hyracotherium to Equus To account for the load-bearing role of side digits, a novel, continuous measure of digit reduction was also established-toe reduction index (TRI). Our results show that without accounting for side digits, three-toed horses as late as Parahippus would have experienced physiologically untenable bone stresses. Conversely, when side digits are modelled as load-bearing, species at the base of the horse radiation through Equus probably maintained a similar safety factor to fracture stress. We conclude that the centre metapodial compensated for evolutionary digit reduction and body mass increases by becoming more resistant to bending through substantial positive allometry in internal geometry. These results lend support to two historical hypotheses: that increasing body mass selected for a single, robust metapodial rather than several smaller ones; and that, as horse limbs became elongated, the cost of inertia from the side toes outweighed their utility for stabilization or load-bearing. © 2017 The Author(s).

Network metrics reveal differences in social organization between two fission-fusion species, Grevy's zebra and onager.

Science.gov (United States)

Sundaresan, Siva R; Fischhoff, Ilya R; Dushoff, Jonathan; Rubenstein, Daniel I

2007-02-01

For species in which group membership frequently changes, it has been a challenge to characterize variation in individual interactions and social structure. Quantifying this variation is necessary to test hypotheses about ecological determinants of social patterns and to make predictions about how group dynamics affect the development of cooperative relationships and transmission processes. Network models have recently become popular for analyzing individual contacts within a population context. We use network metrics to compare populations of Grevy's zebra (Equus grevyi) and onagers (Equus hemionus khur). These closely related equids, previously described as having the same social system, inhabit environments differing in the distribution of food, water, and predators. Grevy's zebra and onagers are one example of many sets of coarsely similar fission-fusion species and populations, observed elsewhere in other ungulates, primates, and cetaceans. Our analysis of the population association networks reveals contrasts consistent with their distinctive environments. Grevy's zebra individuals are more selective in their association choices. Grevy's zebra form stable cliques, while onager associations are more fluid. We find evidence that females associate assortatively by reproductive state in Grevy's zebra but not in onagers. The current approach demonstrates the utility of network metrics for identifying fine-grained variation among individuals and populations in association patterns. From our analysis, we can make testable predictions about behavioral mechanisms underlying social structure and its effects on transmission processes.

A rapid loss of stripes: the evolutionary history of the extinct quagga

OpenAIRE

Leonard, Jennifer A; Rohland, Nadin; Glaberman, Scott; Fleischer, Robert C; Caccone, Adalgisa; Hofreiter, Michael

2005-01-01

Twenty years ago, the field of ancient DNA was launched with the publication of two short mitochondrial (mt) DNA sequences from a single quagga (Equus quagga) museum skin, an extinct South African equid (Higuchi et al. 1984 Nature 312, 282–284). This was the first extinct species from which genetic information was retrieved. The DNA sequences of the quagga showed that it was more closely related to zebras than to horses. However, quagga evolutionary history is far from clear. We have isolated...

Analysis of horse genomes provides insight into the diversification and adaptive evolution of karyotype

OpenAIRE

Huang, Jinlong; Zhao, Yiping; Shiraigol, Wunierfu; Li, Bei; Bai, Dongyi; Ye, Weixing; Daidiikhuu, Dorjsuren; Yang, Lihua; Jin, Burenqiqige; Zhao, Qinan; Gao, Yahan; Wu, Jing; Bao, Wuyundalai; Li, Anaer; Zhang, Yuhong

2014-01-01

Karyotypic diversification is more prominent in Equus species than in other mammals. Here, using next generation sequencing technology, we generated and de novo assembled quality genomes sequences for a male wild horse (Przewalski's horse) and a male domestic horse (Mongolian horse), with about 93-fold and 91-fold coverage, respectively. Portion of Y chromosome from wild horse assemblies (3 M bp) and Mongolian horse (2 M bp) were also sequenced and de novo assembled. We confirmed a Robertsoni...

Patent urachus with subsequent joint infection in a free-living Grevy's zebra foal.

Science.gov (United States)

Ndung'u, Francis K; Ndegwa, Margaret W; deMaar, Thomas W J

2003-01-01

A free-living, female Grevy's zebra (Equus grevyi) foal was found lethargic, lame, with swollen joints, pyrexia, and urine dripping from the umbilicus. It died 2 days later despite intensive care. Gross examination revealed patent urachus and suppurative arthritis. Swabs were taken from the joints, the patent urachus, and urine for bacteriology. The dominant isolate was Escherichia coli. The joint infection was probably secondary to septicemia, resulting from the patent urachus. To our knowledge, this is the first report of neonatal patent urachus in a wild equid.

Revising the recent evolutionary history of equids using ancient DNA.

Science.gov (United States)

Orlando, Ludovic; Metcalf, Jessica L; Alberdi, Maria T; Telles-Antunes, Miguel; Bonjean, Dominique; Otte, Marcel; Martin, Fabiana; Eisenmann, Véra; Mashkour, Marjan; Morello, Flavia; Prado, Jose L; Salas-Gismondi, Rodolfo; Shockey, Bruce J; Wrinn, Patrick J; Vasil'ev, Sergei K; Ovodov, Nikolai D; Cherry, Michael I; Hopwood, Blair; Male, Dean; Austin, Jeremy J; Hänni, Catherine; Cooper, Alan

2009-12-22

The rich fossil record of the family Equidae (Mammalia: Perissodactyla) over the past 55 MY has made it an icon for the patterns and processes of macroevolution. Despite this, many aspects of equid phylogenetic relationships and taxonomy remain unresolved. Recent genetic analyses of extinct equids have revealed unexpected evolutionary patterns and a need for major revisions at the generic, subgeneric, and species levels. To investigate this issue we examine 35 ancient equid specimens from four geographic regions (South America, Europe, Southwest Asia, and South Africa), of which 22 delivered 87-688 bp of reproducible aDNA mitochondrial sequence. Phylogenetic analyses support a major revision of the recent evolutionary history of equids and reveal two new species, a South American hippidion and a descendant of a basal lineage potentially related to Middle Pleistocene equids. Sequences from specimens assigned to the giant extinct Cape zebra, Equus capensis, formed a separate clade within the modern plain zebra species, a phenotypicically plastic group that also included the extinct quagga. In addition, we revise the currently recognized extinction times for two hemione-related equid groups. However, it is apparent that the current dataset cannot solve all of the taxonomic and phylogenetic questions relevant to the evolution of Equus. In light of these findings, we propose a rapid DNA barcoding approach to evaluate the taxonomic status of the many Late Pleistocene fossil Equidae species that have been described from purely morphological analyses.

Histological variability in the limb bones of the Asiatic wild ass and its significance for life history inferences.

Science.gov (United States)

Nacarino-Meneses, Carmen; Jordana, Xavier; Köhler, Meike

2016-01-01

The study of bone growth marks (BGMs) and other histological traits of bone tissue provides insights into the life history of present and past organisms. Important life history traits like longevity or age at maturity, which could be inferred from the analysis of these features, form the basis for estimations of demographic parameters that are essential in ecological and evolutionary studies of vertebrates. Here, we study the intraskeletal histological variability in an ontogenetic series of Asiatic wild ass ( Equus hemionus ) in order to assess the suitability of several skeletal elements to reconstruct the life history strategy of the species. Bone tissue types, vascular canal orientation and BGMs have been analyzed in 35 cross-sections of femur, tibia and metapodial bones of 9 individuals of different sexes, ages and habitats. Our results show that the number of BGMs recorded by the different limb bones varies within the same specimen. Our study supports that the femur is the most reliable bone for skeletochronology, as already suggested. Our findings also challenge traditional beliefs with regard to the meaning of deposition of the external fundamental system (EFS). In the Asiatic wild ass, this bone tissue is deposited some time after skeletal maturity and, in the case of the femora, coinciding with the reproductive maturity of the species. The results obtained from this research are not only relevant for future studies in fossil Equus , but could also contribute to improve the conservation strategies of threatened equid species.

Socioeconomic roles and welfare aspects of donkey ( Equus asinus ...

African Journals Online (AJOL)

Given the fact that donkeys contribute to valuable socio-economic activities in small holders agricultural sectors, they are under low welfare condition in developing countries. This is need assessment of the profiles, socioeconomic roles and welfare of donkeys in developing countries like Ethiopia. A total of 384 randomly ...

Toxoplasma gondii seroprevalence in donkeys (Equus asinus) from Italy

Science.gov (United States)

There is an increasing interest on donkeys due to their use in leisure activities, as pets, as working animals, for onotherapy, use of their milk for children affected with cow milk allergy, and consumption of donkey milk and meat for human consumption. Toxoplasmosis, important zoonosis, can be tran...

Population viability analysis on domestic horse breeds (Equus caballus)

DEFF Research Database (Denmark)

Thirstrup, Janne Pia; Bach, Lars; Loeschcke, Volker

2009-01-01

simulation package was used for the population viability analysis. First, we investigated the future viability of these breeds based on present demographic and environmental parameters. Second, a sensitivity analysis revealed the most important variables for the viability of these breeds. Third, we examined...... concerning reproduction of the mares had the greatest impact, with the number of mares actively breeding being the most influential on the population forecasts. The results suggest that closing the Knabstrupper studbooks can be done only if increasing the number of mares actively breeding counteracts...... the loss of genetic variation attributable to such a management strategy. It is recommended, based on these results, that the number of Frederiksborg and Knabstrupper mares actively breeding must be increased to approximately 30% in the 2 breeds that are presently using only 13%, while leaving the third...

Reassessing the evolutionary history of ass-like equids: insights from patterns of genetic variation in contemporary extant populations.

Science.gov (United States)

Rosenbom, Sónia; Costa, Vânia; Chen, Shanyuan; Khalatbari, Leili; Yusefi, Gholam Hosein; Abdukadir, Ablimit; Yangzom, Chamba; Kebede, Fanuel; Teclai, Redae; Yohannes, Hagos; Hagos, Futsum; Moehlman, Patricia D; Beja-Pereira, Albano

2015-04-01

All extant equid species are grouped in a single genus - Equus. Among those, ass-like equids have remained particularly unstudied and their phylogenetic relations were poorly understood, most probably because they inhabit extreme environments in remote geographic areas. To gain further insights into the evolutionary history of ass-like equids, we have used a non-invasive sampling approach to collect representative fecal samples of extant African and Asiatic ass-like equid populations across their distribution range and mitochondrial DNA (mtDNA) sequencing analyses to examine intraspecific genetic diversity and population structure, and to reconstruct phylogenetic relations among wild ass species/subspecies. Sequence analyses of 410 base pairs of the fast evolving mtDNA control region identified the Asiatic wild ass population of Kalamaili (China) as the one displaying the highest diversity among all wild ass populations. Phylogenetic analyses of complete cytochrome b sequences revealed that African and Asiatic wild asses shared a common ancestor approximately 2.3Mya and that diversification in both groups occurred much latter, probably driven by climatic events during the Pleistocene. Inferred genetic relationships among Asiatic wild ass species do not support E. kiang monophyly, highlighting the need of more extensive studies in order to clarify the taxonomic status of species/subspecies belonging to this branch of the Equus phylogeny. These results highlight the importance of re-assessing the evolutionary history of ass-like equid species, and urge to extend studies at the population level to efficiently design conservation and management actions for these threatened species. Copyright © 2015 Elsevier Inc. All rights reserved.

Investigating attentional processes in depressive-like domestic horses (Equus caballus).

Science.gov (United States)

Rochais, C; Henry, S; Fureix, C; Hausberger, M

2016-03-01

Some captive/domestic animals respond to confinement by becoming inactive and unresponsive to external stimuli. Human inactivity is one of the behavioural markers of clinical depression, a mental disorder diagnosed by the co-occurrence of symptoms including deficit in selective attention. Some riding horses display 'withdrawn' states of inactivity and low responsiveness to stimuli that resemble the reduced engagement with their environment of some depressed patients. We hypothesized that 'withdrawn' horses experience a depressive-like state and evaluated their level of attention by confronting them with auditory stimuli. Five novel auditory stimuli were broadcasted to 27 horses, including 12 'withdrawn' horses, for 5 days. The horses' reactions and durations of attention were recorded. Non-withdrawn horses reacted more and their attention lasted longer than that of withdrawn horses on the first day, but their durations of attention decreased over days, but those of withdrawn horses remained stable. These results suggest that the withdrawn horses' selective attention is altered, adding to already evidenced common features between this horses' state and human depression. Copyright © 2016. Published by Elsevier B.V.

Putative clinical piroplasmosis in a Burchell's zebra (Equus quagga burchelli).

Science.gov (United States)

Lampen, F; Bhoora, R; Collins, N E; Penzhorn, B L

2009-12-01

A 10-year-old tame zebra gelding was presented after suffering from lethargy, nervousness, reported anaemia and icterus as well as a decreased appetite. These symptoms were seen over some months, with changing severity. The animal was immobilised, treated, and blood specimens were submitted for haematology and biochemistry. This report describes molecular characterisation of Theileria equi recovered from this animal, as well as the clinical findings, treatment and historical relevance of piroplasmosis in zebra in southern Africa.

Biodiversité des ânes ( Equus asinus ) dans la zone ...

African Journals Online (AJOL)

La présente étude, menée entre octobre 2014 et janvier 2015 dans la Zone Soudano-Sahélienne du Tchad (Région du Chari-Baguirmi) avait pour objectif général de contribuer à une meilleure connaissance de la biodiversité des ânes en vue d'améliorer leur préservation et leur amélioration génétique. A cet effet, un ...

Desarrollo de resistencia a la insulina en caballos (Equus caballus)

DEFF Research Database (Denmark)

Gandarillas, Mónica; Matus, José Tomás; Márquez-Hernández, Roberto I.

2015-01-01

In horses, insulin resistance is associated with several comorbidities such as obesity, laminitis, colic and osteochondrosis. The multifactorial causes of insulin resistance in horses have been addressed, which include genetic and environmental factors. As a consequence of these factors, the cell...

Study of early pregnancy factor (EPF) in equine (Equus caballus).

Science.gov (United States)

Ohnuma, K; Yokoo, M; Ito, K; Nambo, Y; Miyake, Y I; Komatsu, M; Takahashi, J

2000-03-01

Early pregnancy factor (EPF) is an immunosuppressive protein detected in the early pregnancy serum. We have already reported that we developed the rosette inhibition test for mare EPF and detected EPF in thoroughbreds. The aim of this study was to determine whether or not our method could be used clinically. The rosette inhibition test for equine EPF was carried out on serum from six nonpregnant and six pregnant Shetland ponies, a female and a male Chinese pony, and four nonpregnant and 13 pregnant thoroughbred mares. In the thoroughbreds sera were collected during the pregnancy period. Furthermore, we measured progesterone and detected pregnant mare serum gonadotrophin (PMSG) in order to confirm pregnancy of the Chinese pony 3 and 6 months after mating. In the nonpregnant Shetland ponies, the rosette inhibition titre (RIT) was 6.0+/-1.0 and EPF was negative. In contrast, in the pregnant ponies, the RIT was 9.2+/-0.4 and EPF was positive. Based on these results, we diagnosed pregnancy of the Chinese pony. The RIT of the female Chinese pony (3 months after mating) was above 10 and EPF was positive. Furthermore, we detected PMSG and progesterone in the serum of this pony. EPF appeared in the maternal blood circulation at 24-72 hr after mating, it was detected until the second trimester, and after that it disappeared from the maternal serum. The pony's EPF was detected by using the same rosette inhibition test as in the thoroughbred and was present from 24 to 72 hr after mating until the second trimester. The results indicated that our method was useful for pregnancy diagnosis of Equine.

Economic benefit of fertility control in wild horse populations

Science.gov (United States)

Bartholow, J.

2007-01-01

I projected costs for several contraceptive treatments that could be used by the Bureau of Land Management (BLM) to manage 4 wild horse (Equus caballus) populations. Potential management alternatives included existing roundup and selective removal methods combined with contraceptives of different duration and effectiveness. I projected costs for a 20-year economic life using the WinEquus?? wild horse population model and state-by-state cost estimates reflecting BLM's operational expenses. Findings revealed that 1) currently available 2-year contraceptives in most situations are capable of reducing variable operating costs by 15%, 2) experimental 3-year contraceptives may be capable of reducing costs by 18%, and 3) combining contraceptives with modest changes to herd sex ratio (e.g., 55-60% M) could trim costs by 30%. Predicted savings can increase when contraception is applied in conjunction with a removal policy that targets horses aged 0-4 years instead of 0-5 years. However, reductions in herd size result in greater variation in annual operating expenses. Because the horse program's variable operating costs make up about half of the total program costs (which include other fixed costs), contraceptive application and management can only reduce total costs by 14%, saving about $6.1 million per year. None of the contraceptive options I examined eliminated the need for long-term holding facilities over the 20-year period simulated, but the number of horses held may be reduced by about 17% with contraceptive treatment. Cost estimates were most sensitive to the oldest age adoptable and per-day holding costs. The BLM will experience significant cost savings as carefully designed contraceptive programs become widespread in the wild horse herds it manages.

Human influence on distribution and extinctions of the late Pleistocene Eurasian megafauna.

Science.gov (United States)

Pushkina, Diana; Raia, Pasquale

2008-06-01

Late Pleistocene extinctions are of interest to paleontological and anthropological research. In North America and Australia, human occupation occurred during a short period of time and overexploitation may have led to the extinction of mammalian megafauna. In northern Eurasia megafaunal extinctions are believed to have occurred over a relatively longer period of time, perhaps as a result of changing environmental conditions, but the picture is much less clear. To consider megafaunal extinction in Eurasia, we compare differences in the geographical distribution and commonness of extinct and extant species between paleontological and archaeological localities from the late middle Pleistocene to Holocene. Purely paleontological localities, as well as most extinct species, were distributed north of archaeological sites and of the extant species, suggesting that apart from possible differences in adaptations between humans and other species, humans could also have a detrimental effect on large mammal distribution. However, evidence for human overexploitation applies only to the extinct steppe bison Bison priscus. Other human-preferred species survive into the Holocene, including Rangifer tarandus, Equus ferus, Capreolus capreolus, Cervus elaphus, Equus hemionus, Saiga tatarica, and Sus scrofa. Mammuthus primigenius and Megaloceros giganteus were rare in archaeological sites. Carnivores appear little influenced by human presence, although they become rarer in Holocene archaeological sites. Overall, the data are consistent with the conclusion that humans acted as efficient hunters selecting for the most abundant species. Our study supports the idea that the late Pleistocene extinctions were environmentally driven by climatic changes that triggered habitat fragmentation, species range reduction, and population decrease, after which human interference either by direct hunting or via indirect activities probably became critical.

Taxonomy of the poorly known Quedius mutilatus group of wingless montane species from Middle Asia (Coleoptera: Staphylinidae: Staphylinini

Directory of Open Access Journals (Sweden)

Maria Salnitska

2018-02-01

Full Text Available The Quedius mutilatus group, a very poorly known presumably monophyletic complex of wingless, possibly hypogean species confined to the Tien-Shan Mountains, is characterized as such for the first time. Newly available material clarified the identity of Q. mutilatus Eppelsheim, 1888 and Q. kalabi Smetana, 1995, each hitherto known from a handful of non-conspecific and vaguely georeferenced specimens only. Additional material is reported for Q. equus Smetana, 2014 and one species, Quedius kungeicus sp. nov., is described. All available data on the taxonomy, distribution and bionomics for all these four species of the group are summarized.

La fauna villafranquiense de El Rincón-1 (Albacete, Castilla-La Mancha

Directory of Open Access Journals (Sweden)

Soria, M. D.

1997-04-01

Full Text Available The El Rincón-1 locality is located at the top of the Casas del Rincón series (Albacete, Júcar basin with 13 micro- and macromammal species. The taphonomical features indicate a relatively rapid accumulation process of death and burial of the mammal remains, interpreted as a catastrophic event. The micromammals, Mimomys cf. medasensis and Castillomys crusafonti crusafonti, permit us to assign this locality to the Early Villafranchian. The horse, Equus livenzovensis, would be among the oldest ones recorded from Western Europe before the Gauss-Matuyama paleomagnetic boundary (2.48 Ma, revised calibration as 2.6 and 2.58 Ma. Therefore, the horse appears in the most recent part of this mammal age, as it was classically defined.El yacimiento de El Rincón-1 situado a techo de la serie continental de Casas del Rincón (Albacete, cuenca del Júcar, cuenta con una diversidad faunística de 13 especies de micro y macromamíferos. Sus características tafonómicas indican que el proceso de acumulación de los restos de mamíferos fósiles debió de ser un proceso catastrófico relativamente rápido de muerte y enterramiento. Los micromamíferos Mimomys cf. medasensis y Castillomys crusafonti crusafonti permiten situar el yacimiento en el Villafranquiense inferior. El caballo, Equus livenzovensis, sería uno de los más antiguos registrados en Europa Occidental, anterior al límite Gauss-Matuyama (2,48 Ma, recalibrado en 2,6 y 2,58 Ma. La aparición del caballo se sitúa por tanto en la parte más reciente de esta edad de mamíferos, como se había definido clásicamente.

DESCRIPTION OF GASTRIC ULCERS AND OF THEIR SUSPECTED, ASSOCIATED RISK FACTORS IN DECEASED WILD EQUIDS AT THE RÉSERVE AFRICAINE DE SIGEAN, FRANCE (2010-2016).

Science.gov (United States)

Lamglait, Benjamin; Vandenbunder-Beltrame, Marielle; Trunet, Elodie; Lemberger, Karin

2017-09-01

Gastric ulcers are common in domestic horses and foals, affecting at least 90% of unmedicated racehorses in active training. Despite these high prevalences in domestic horses, literature about this condition in wild equids is almost nonexistent. The presence of gastric ulcers was evaluated at necropsy in six species of wild equids that died at the Réserve Africane de Sigean, a safari park in the south of France from 2010 to 2016. Among the 55 individuals that died during that period, a description of the gastric mucosa was available in 82% (45/55) of cases. Considering the cases for which a description of the gastric mucosa was available, the prevalence of gastric ulcers was 64% (29/45). The highest prevalences were noted in Grant's zebra (Equus quagga boehmi) and Hartmann's mountain zebra (Equus zebra hartmannae) at 83% and 100%, respectively. In contrast to what is reported in domestic foals, gastric ulcerations were only diagnosed in one foal (out of 11 foals necropsied). The higher prevalence was noted in young individuals (3-36 mo old) at 93% (14/15); the lesions observed consisted mainly of single to multiple, superficial lesions, of which, only the mucosa was missing; these superficial lesions are often considered not clinically significant. The prevalence was lower for adults (74%; 14/19), but lesions were deeper or with a hyperemic or inflammatory appearance. All the lesions observed were located in the gastric, nonglandular, stratified squamous mucosa, along the margo plicatus. No statistical correlation could be found between the development of gastric ulcers and an ongoing, chronic pathologic process or a digestive tract pathology. The detection of gastric ulcers was, therefore, significantly greater in wild equids isolated in smaller enclosures. Nevertheless, additional larger-scale research is needed to point out predisposing factors in equids under human care.

Scanning electron microscopy of Strongylus spp. in zebra.

Science.gov (United States)

Els, H J; Malan, F S; Scialdo-Krecek, R C

1983-12-01

The external ultrastructure of the anterior and posterior extremities of the nematodes, Strongylus asini , Strongylus vulgaris, Strongylus equinus and Strongylus edentatus, was studied with scanning electron microscopy (SEM). Fresh specimens of S. asini were collected from the caecum, ventral colon and vena portae of Equus burchelli and Equus zebra hartmannae ; S. vulgaris from the caecum, colon and arteria ileocolica of E. burchelli ; S. equinus from the ventral colon of E. z. hartmannae and S. edentatus from the caecum and ventral colon of both zebras , during surveys of parasites in zebras in the Etosha Game Reserve, South West Africa/Namibia, and the Kruger National Park, Republic of South Africa. The worms were cleaned, fixed and mounted by standard methods and photographed in a JEOL JSM - 35C scanning electron microscope (SEM) operating at 12kV . The SEM showed the following differences: the tips of the external leaf-crowns varied and were fine and delicate in S. asini , coarse and broad in S. vulgaris and, in S. equinus and S. edentatus, closely adherent, separating into single elements for half their length. The excretory pores showed only slight variation, and the morphology of the copulatory bursae did not differ from those seen with light microscopy. The genital cones differed markedly: S. asini had a ventral triangular projection and laterally 2 finger-like projections: in S. vulgaris there were numerous bosses on the lateral and ventral aspects of the cone; in S. equinus 2 finger-like processes projected laterocaudally ; and in S. edentatus 2 pairs of papilla-like processes projected laterally on the ventral aspects, and a pair of rounded projections and a pair of hair-like structures adorned the dorsal aspects.(ABSTRACT TRUNCATED AT 250 WORDS)

Dietary analysis of Late Cenozoic Mexican equids from three different geographic/geologic settings using stable carbon isotopes: Coincidences, differences and paleobiologic significance

Science.gov (United States)

Pérez-Crespo, Víctor Adrian; Ferrusquía-Villafranca, Ismael; Bravo-Cuevas, Víctor Manuel; Morales-Puente, Pedro; Ruiz-González, José E.

2016-03-01

The development of Vertebrate Paleontology in Mexico is uneven, so that there is a strong bias in favor of Neogene/Quaternary mammals largely collected in the Trans-Mexican Volcanic Belt (TMVB hereafter) and Central Plateau (CeP hereafter) Morphotectonic Provinces [MP hereafter]; however, the time is ripe for pursuing research in other than taxonomic areas. Here we investigate C3/C4 plant consumption in the equid lineage in three such provinces, which provide different geographic/geologic and paleoecologic scenarios during the Barstovian, Hemphillian and Rancholabrean times. Our results show that the Barstovian equids from Oaxaca, Sierra Madre del Sur MP Cormohipparion aff. C. quinni, Merychippus cf. M. sejunctus and Pliohippus sp. largely fed on C3 plants, which were the chief food stuff of horses in Mexico, particularly in the Southeast. On the other hand, the Hemphillian equid from Guanajuato, CeP Astrohippus stocki, was an unbalanced C3/C4 mixed feeders in favor of C4 plants, a fact that indicates a profound plant diversification due to the inception and rapid diversification of C4 plants that occurred there at this time, as it occurred in temperate North America, resulting in the differential consumption of C4 plants over that of C3 plants. Such trend prevailed until the Rancholabrean, as born out by the inferred diet for Equus conversidens and Equus sp. from Hidalgo, TMVB. Clearly then, the coeval diet change observed in Mexico and temperate North America implies a correlative vegetation change resulting in the appearance and rapid diversification of C4 plants, which largely formed the preferred food stuff of equids since the Hemphillian, although some C3 plant consumption was maintained till the Rancholabrean. It should be noted that the development of hypsodonty in equids and many artiodactyls, has long been interpreted as the adaptive mammalian response to the new feeding conditions.

Evaluation of intranasal oxygen supplementation in mules anesthetized with the combination of ketamine, butorphanol, and guaifenesin

Directory of Open Access Journals (Sweden)

T.J.C. Módolo

Full Text Available ABSTRACT Hypoxemia is a major complication of field anesthesia and no studies regarding this occurrence in mules has been done. Thus, the aim of this study was to evaluate intranasal oxygen supplementation (IOS in mules (Equus caballus x Equus asinus anesthetized with ketamine/butorphanol/guaifenesin combination. For this, we used six male, adult mules (322±29kg which underwent premedication (MPA with 0.2mg/kg of midazolam intramuscularly after 15 minutes, 0.02mg/kg detomidine IV 5 minutes after, induction IV with combination of ketamine (2mg/mL, butorphanol (22.5mg/mL, and guaifenesin (50mg/mL (K/B/G until lateral decumbency. Maintenance was done with the same anesthetic combination. The animals were submitted twice to the protocol described above, 20 days apart, forming two groups. CG: MPA, induction (0.92±0.24mL/kg (mean±SD, and maintenance (2.2±0.2mL/kg/h without SIO; TG: MPA, induction (0.98±0.17mL/kg, and maintenance (2.3±0.4mL/kg/h with IOS flow 40mL/kg/h. During anesthesia arterial blood was collected every 20 minutes (T0, T20, T40, and T60 for blood gas analysis. Data analyzed by ANOVA followed by the Bonferroni test. P<0.05 was considered significant. Hypoxemia of the animals in the CG in periods (59±5; 55±5; 53±7; 49±8 with lower averages than the TG (160±4, 115±34, 92±25, 81±19 was observed, demonstrating that IOS increases PaO2 avoiding the occurrence of hypoxemia.

Horse domestication and conservation genetics of Przewalski's horse inferred from sex chromosomal and autosomal sequences.

Science.gov (United States)

Lau, Allison N; Peng, Lei; Goto, Hiroki; Chemnick, Leona; Ryder, Oliver A; Makova, Kateryna D

2009-01-01

Despite their ability to interbreed and produce fertile offspring, there is continued disagreement about the genetic relationship of the domestic horse (Equus caballus) to its endangered wild relative, Przewalski's horse (Equus przewalskii). Analyses have differed as to whether or not Przewalski's horse is placed phylogenetically as a separate sister group to domestic horses. Because Przewalski's horse and domestic horse are so closely related, genetic data can also be used to infer domestication-specific differences between the two. To investigate the genetic relationship of Przewalski's horse to the domestic horse and to address whether evolution of the domestic horse is driven by males or females, five homologous introns (a total of approximately 3 kb) were sequenced on the X and Y chromosomes in two Przewalski's horses and three breeds of domestic horses: Arabian horse, Mongolian domestic horse, and Dartmoor pony. Five autosomal introns (a total of approximately 6 kb) were sequenced for these horses as well. The sequences of sex chromosomal and autosomal introns were used to determine nucleotide diversity and the forces driving evolution in these species. As a result, X chromosomal and autosomal data do not place Przewalski's horses in a separate clade within phylogenetic trees for horses, suggesting a close relationship between domestic and Przewalski's horses. It was also found that there was a lack of nucleotide diversity on the Y chromosome and higher nucleotide diversity than expected on the X chromosome in domestic horses as compared with the Y chromosome and autosomes. This supports the hypothesis that very few male horses along with numerous female horses founded the various domestic horse breeds. Patterns of nucleotide diversity among different types of chromosomes were distinct for Przewalski's in contrast to domestic horses, supporting unique evolutionary histories of the two species.

Evidence for anthropophily in five species of phlebotomine sand flies (Diptera: Psychodidae) from northern Colombia, revealed by molecular identification of bloodmeals.

Science.gov (United States)

Paternina, Luís E; Verbel-Vergara, Daniel; Romero-Ricardo, Luís; Pérez-Doria, Alveiro; Paternina-Gómez, Margaret; Martínez, Lily; Bejarano, Eduar E

2016-01-01

Identification of the bloodmeal sources of phlebotomine sand flies is fundamental to determining which species are anthropophilic and understanding the transmission of Leishmania parasites in natural epidemiological settings. The objective of this study was to identify sand fly bloodmeals in the mixed leishmaniasis focus of the department of Sucre, northern Colombia. In all 141 engorged female sand flies were analyzed, after being captured in intradomiciliary, peridomiciliary and extradomiciliary habitats with Shannon and CDC traps and by active searching in diurnal resting sites. Bloodmeals were identified by sequencing and analysis of a 358bp fragment of the mitochondrial gene Cytochrome b (CYB) and a 330bp fragment of the nuclear gene prepronociceptin (PNOC). Using both genes 105 vertebrate bloodmeals were identified, with an efficiency of 72% for CYB but only 7% for PNOC. Ten species of vertebrates were identified as providing bloodmeal sources for 8 sand fly species: Homo sapiens (Lutzomyia evansi, Lutzomyia panamensis, Lutzomyia micropyga, Lutzomyia shannoni and Lutzomyia atroclavata), Equus caballus (L. evansi, L. panamensis and Lutzomyia cayennensis cayennensis), Equus asinus (L. evansi and L. panamensis), Bos taurus (L. evansi, L. panamensis and L. c. cayennensis), Tamandua mexicana (L. shannoni and Lutzomyia trinidadensis), Proechimys guyanensis (L. evansi, L. panamensis and L. c. cayennensis), Mabuya sp. (Lutzomyia micropyga), Anolissp. (L. micropyga), Sus scrofa (L. evansi and Lutzomyia gomezi) and Gallus gallus (L. evansi). Cattle, donkeys, humans and pigs were significantly more important than other animals (P=0.0001) as hosts of L. evansi, this being the most abundant sand fly species. The five Lutzomyia species in which blood samples of human origin were detected included L. micropyga and L. atroclavata, constituting the first evidence of anthropophily in both species. Copyright © 2015 Elsevier B.V. All rights reserved.

Strongylus vulgaris in donkeys (Equus asinus) from the highveld of Zimbabwe.

Science.gov (United States)

Pandey, V S; Eysker, M

1989-07-15

Strongylus vulgaris populations in the cranial mesenteric arteries, caecum and colon were studied in 14 donkeys obtained from a communal area of the Zimbabwean highveld during July and November, 1986, and January and April 1987. Adult parasites were present in all animals and larvae in the cranial mesenteric arteries of 12 animals. Aged animals had high worm burdens. The number of adult parasites varied from 63 to 1255 (mean 382) and of larvae in the arteries from 0 to 181 (mean 69). The mean adult worm burdens were highest in July (400) and November (488), and lowest in April (107). The mean arterial larval burden was highest in July (130) and lowest in November (21). These observations indicate that infection with S. vulgaris takes place during the rainy season resulting in the heavy arterial larval population from January onwards and the heavy adult population during the dry season.

CYTOLOGY PULMONARY IN HORSES (EQUUS CABALLUS MAINTAINED THE FIELD OR STABLED

Directory of Open Access Journals (Sweden)

W. F. Fortes Júnior

2016-11-01

Full Text Available Tracheobronchial secretion was collected by endoscopy (Welch-AllynÒ, 200cm long and 9mm diameter, from equines with different ages, races and sex, for posterior cytological analysis. Thirty-six equines were divided into two groups (Group I = stabled, n = 18; Group II = field regimen, n = 18. Animals of Group I (age = 3.5 years were lodged in the Tarumã´s Jockey Club in Curitiba, Parana State. The equines of Group II always were maintained at field condition (never were stabled, in the farm located in Jacarezinho, Paraná State. Following endoscopic exams, tracheobronchial secretion smears were stained by Pappenhein´s method and submitted to cytological analysis. Group I had higher frequency of tracheal discharge than Group II. The cytological analysis showed more presence of macrophages (58.8%, foamy cells (2.3%, body giant cells (0.2%, neutrophils (4.57%, eosinophils (0.7% and Curshmann´s spirals (0.04% on 3 of the 18 animals. The cytological analysis of Group II showed higher frequency of ciliated epithelial cells than Group I, and no Curshmann´s spirals were observed. In conclusion, data showed that horses stabled had more cytological alterations than the animals maintained at field, therefore more tracheobronchial complications. Thus, the care of place where horse are stabled have influence on development of respiratory diseases, may predispose to affections as Chronic Obstructive Pulmonary Disease and Exercise-Induced Pulmonary Hemorrhage, as well athletic horses may be never reach their full respiratory potential.

Identification of Novel Equine (Equus caballus Tendon Markers Using RNA Sequencing

Directory of Open Access Journals (Sweden)

Jan M. Kuemmerle

2016-11-01

Full Text Available Although several tendon-selective genes exist, they are also expressed in other musculoskeletal tissues. As cell and tissue engineering is reliant on specific molecular markers to discriminate between cell types, tendon-specific genes need to be identified. In order to accomplish this, we have used RNA sequencing (RNA-seq to compare gene expression between tendon, bone, cartilage and ligament from horses. We identified several tendon-selective gene markers, and established eyes absent homolog 2 (EYA2 and a G-protein regulated inducer of neurite outgrowth 3 (GPRIN3 as specific tendon markers using RT-qPCR. Equine tendon cells cultured as three-dimensional spheroids expressed significantly greater levels of EYA2 than GPRIN3, and stained positively for EYA2 using immunohistochemistry. EYA2 was also found in fibroblast-like cells within the tendon tissue matrix and in cells localized to the vascular endothelium. In summary, we have identified EYA2 and GPRIN3 as specific molecular markers of equine tendon as compared to bone, cartilage and ligament, and provide evidence for the use of EYA2 as an additional marker for tendon cells in vitro.

Seroprevalence of West Nile Virus in feral horses on Sheldon National Wildlife Refuge, Nevada, United States

Science.gov (United States)

Franson, J. Christian; Hofmeister, Erik K.; Collins, Gail H.; Dusek, Robert J.

2011-01-01

We screened 1,397 feral horses (Equus caballus) on Sheldon National Wildlife Refuge, Nevada, United States, for IgM and IgG against flavivirus during 2004–2006, 2008, and 2009. Positive serum samples were tested for neutralizing antibodies to West Nile virus (WNV) and St. Louis encephalitis virus (SLEV). One animal was positive for antibody against WNV in 2004, but all others tested in 2004–2006 were negative. In 2008 and 2009, we found evidence of increasing seropositive horses with age, whereas seroprevalence of WNV decreased from 19% in 2008 to 7.2% in 2009. No horses were positive for antibody against SLEV. Being unvaccinated, feral horses can be useful for WNV surveillance.

Faune magdalénienne de la Grande Grotte de Labastide. (Hautes - Pyrénées, France.

Directory of Open Access Journals (Sweden)

André Clot

1988-01-01

Full Text Available La cueva de Labastide (Altos Pirineos, francia ha proporcionado una fauna del Magdaleniense medio (datada en 14.260 ± 440 BP, con especies de gran tamaño, el caballo (Equus caballus cf. gallicus, el bisonte y el uro, el reno. Algunos restos señalan la presencia de la cabra de los Pirineos y del sarrio, sin embargo el ciervo está ausente. Entre los carnívoros, se deben anotar numerosos huesos de zorro   común, y algunos de restos de zorro polar, de línce nórdico y de gato montés. Unos treinta restos pertenecen al glotón, pocas veces citado en los Pirineos.

Gender and live weight on carcass and meat characteristics of donkeys

Directory of Open Access Journals (Sweden)

Pedro Hernández-Briano

2018-04-01

Full Text Available ABSTRACT: One hundred eighty-nine Catalan crossbreed donkeys (Equus africanus asinus were used to evaluate the effect of gender (gelding, n=106; or female, n=83 and live weight at slaughter (LW (kg, n=37 on carcass characteristics, non-carcass components and meat and fat color. Geldings had greater (P151kg. Meanwhile, the LW did not affect the color (L*, a* and b* values of subcutaneous fat (P>0.05. These results suggested that both gender and live weight should be considered when producing meat from donkeys. It is advisable to use geldings weighing more than 126kg at slaughter to obtain the greatest weight and carcass yield.

First stable isotope analysis of Asiatic wild ass tail hair from the Mongolian Gobi.

Science.gov (United States)

Horacek, Micha; Sturm, Martina Burnik; Kaczensky, Petra

Stable isotope analysis has become a powerful tool to study feeding ecology, water use or movement pattern in contemporary, historic and ancient species. Certain hair and teeth grow continuously, and when sampled longitudinally can provide temporally explicit information on dietary regime and movement pattern. In an initial trial, we analysed a tail sample of an Asiatic wild ass ( Equus hemionus ) from the Mongolian Gobi. We found seasonal variations in H, C and N isotope patterns, likely being the result of temporal variations in available feeds, water supply and possibly physiological status. Thus stable isotope analysis shows promise to study the comparative ecology of the three autochthonous equid species in the Mongolian Gobi.

Putative clinical piroplasmosis in a Burchell's zebra (Equus quagga burchelli : clinical communication

Directory of Open Access Journals (Sweden)

F. Lampen

2009-05-01

Full Text Available A 10-year-old tame zebra gelding was presented after suffering from lethargy, nervousness, reported anaemia and icterus as well as a decreased appetite. These symptoms were seen over some months, with changing severity. The animal was immobilised, treated, and blood specimens were submitted for haematology and biochemistry. This report describes molecular characterisation of Theileria equi recovered from this animal, as well as the clinical findings, treatment and historical relevance of piroplasmosis in zebra in southern Africa.

Note on subfossil teeth of Equus zebra L. from Orange free State

NARCIS (Netherlands)

Hooijer, D.A.

1945-01-01

Some time ago Dr. L. D. Brongersma, curator of the Leiden Museum, entrusted me for examination some subfossil equine teeth, received from Mr. H. van Hoepen, who had found them between Glen and Mazelspoort, in Orange Free State. The teeth proved to belong all to one and the same individual, and to

Behavioral and Transcriptomic Fingerprints of an Enriched Environment in Horses (Equus caballus.

Directory of Open Access Journals (Sweden)

Léa Lansade

Full Text Available The use of environmental enrichment (EE has grown in popularity over decades, particularly because EE is known to promote cognitive functions and well-being. Nonetheless, little is known about how EE may affect personality and gene expression. To address this question in a domestic animal, 10-month-old horses were maintained in a controlled environment or EE for 12 weeks. The control horses (n = 9 lived in individual stalls on wood shaving bedding. They were turned out to individual paddocks three times a week and were fed three times a day with pellets or hay. EE-treated horses (n = 10 were housed in large individual stalls on straw bedding 7 hours per day and spent the remainder of the time together at pasture. They were fed three times a day with flavored pellets, hay, or fruits and were exposed daily to various objects, odors, and music. The EE modified three dimensions of personality: fearfulness, reactivity to humans, and sensory sensitivity. Some of these changes persisted >3 months after treatment. These changes are suggestive of a more positive perception of the environment and a higher level of curiosity in EE-treated horses, explaining partly why these horses showed better learning performance in a Go/No-Go task. Reduced expression of stress indicators indicated that the EE also improved well-being. Finally, whole-blood transcriptomic analysis showed that in addition to an effect on the cortisol level, the EE induced the expression of genes involved in cell growth and proliferation, while the control treatment activated genes related to apoptosis. Changes in both behavior and gene expression may constitute a psychobiological signature of the effects of enrichment and result in improved well-being. This study illustrates how the environment interacts with genetic information in shaping the individual at both the behavioral and molecular levels.

Behavioral and Transcriptomic Fingerprints of an Enriched Environment in Horses (Equus caballus).

Science.gov (United States)

Lansade, Léa; Valenchon, Mathilde; Foury, Aline; Neveux, Claire; Cole, Steve W; Layé, Sophie; Cardinaud, Bruno; Lévy, Frédéric; Moisan, Marie-Pierre

2014-01-01

The use of environmental enrichment (EE) has grown in popularity over decades, particularly because EE is known to promote cognitive functions and well-being. Nonetheless, little is known about how EE may affect personality and gene expression. To address this question in a domestic animal, 10-month-old horses were maintained in a controlled environment or EE for 12 weeks. The control horses (n = 9) lived in individual stalls on wood shaving bedding. They were turned out to individual paddocks three times a week and were fed three times a day with pellets or hay. EE-treated horses (n = 10) were housed in large individual stalls on straw bedding 7 hours per day and spent the remainder of the time together at pasture. They were fed three times a day with flavored pellets, hay, or fruits and were exposed daily to various objects, odors, and music. The EE modified three dimensions of personality: fearfulness, reactivity to humans, and sensory sensitivity. Some of these changes persisted >3 months after treatment. These changes are suggestive of a more positive perception of the environment and a higher level of curiosity in EE-treated horses, explaining partly why these horses showed better learning performance in a Go/No-Go task. Reduced expression of stress indicators indicated that the EE also improved well-being. Finally, whole-blood transcriptomic analysis showed that in addition to an effect on the cortisol level, the EE induced the expression of genes involved in cell growth and proliferation, while the control treatment activated genes related to apoptosis. Changes in both behavior and gene expression may constitute a psychobiological signature of the effects of enrichment and result in improved well-being. This study illustrates how the environment interacts with genetic information in shaping the individual at both the behavioral and molecular levels.

Identification of equine influenza virus infection in Asian wild horses (Equus przewalskii).

Science.gov (United States)

Yin, Xin; Lu, Gang; Guo, Wei; Qi, Ting; Ma, Jian; Zhu, Chao; Zhao, Shihua; Pan, Jialiang; Xiang, Wenhua

2014-05-01

An outbreak of equine influenza was observed in the Asian wild horse population in Xinjiang Province, China, in 2007. Nasal swabs were collected from wild horses and inoculated into 9-10-day SPF embryonated eggs. The complete genome of the isolate was sequenced. A comparison of the amino acid sequence revealed that the isolate was an equine influenza virus strain, which we named A/equine/Xinjiang/4/2007. Each gene of the virus was found to have greater than 99 % homology to equine influenza virus strains of the Florida-2 sublineage, which were circulating simultaneously in China, and a lesser amount of homology was found to the strain A/equine/Qinghai/1/1994 (European lineage), which was isolated during the last outbreak in China. These observations were confirmed by phylogenetic analysis. In addition, the deduced amino acid sequence of the neuraminidase of the A/equine/Xinjiang/4/2007 strain was identical to that of A/equine/California/8560/2002, an American isolate, and was found to be similar to those of Florida-2 strains found in other countries by comparing them with nine other field strains that were isolated in China from 2007 to 2008. It is suggested that the neuraminidase segment of A/equine/Xinjiang/4/2007 may have been obtained from equine influenza virus strains from other countries. We report for the first time an outbreak of equine influenza in the Asian wild horse population, and the complete genome of the virus is provided and analyzed.

A brief and critical review on hydrofluorosis in diverse species of domestic animals in India.

Science.gov (United States)

Choubisa, Shanti Lal

2018-02-01

India is one of the fluoride-endemic countries where the maximum numbers of ground or drinking water sources are naturally fluoridated. In India, a total of 23, out of 36 states and union territories have drinking water contaminated with fluoride in varying concentration. In the present scenario, especially in rural India, besides the surface waters (perennial ponds, dams, rivers, etc.), bore wells and hand pumps are the principal drinking water sources for domestic animals such as cattle (Bos taurus), water buffaloes (Bubalus bubalis), sheep (Ovis aries), goats (Capra hircus), horses (Equus caballus), donkeys (Equus asinus) and dromedary camels (Camelus dromedarius). Out of 23 states, 17 states, namely Andhra Pradesh, Assam, Bihar, Chhattisgarh, Gujarat, Haryana, Jharkhand, Karnataka, Kerala, Madhya Pradesh, Maharashtra, Odisha (Orissa), Punjab, Rajasthan, Telangana, Uttar Pradesh and West Bengal, have fluoride beyond the maximum permissible limit of 1.0 or 1.5 ppm in drinking water. This situation is a great concern for the animal health because fluoride is a slow toxicant and causes chronic diverse serious health hazards or toxic effects. Despite the fact that domestic animals are the basic income sources in rural areas and possess a significant contributory role not only in the agriculture sector but also in the strengthening of economy as well as in sustainable development of the country, research work on chronic fluoride intoxication (hydrofluorosis) due to drinking of fluoridated water in domestic animals rearing in various fluoride-endemic states is not enough as compared to work done in humans. However, some interesting and excellent research works conducted on different aspects of hydrofluorosis in domesticated animals rearing in different states are briefly and critically reviewed in the present communication. Author believes that this review paper not only will be more useful for researchers to do some more advance research work on fluoride

Twenty years of immunocontraceptive research: lessons learned.

Science.gov (United States)

Miller, Lowell A; Fagerstone, Kathleen A; Eckery, Douglas C

2013-12-01

The National Wildlife Research Center (NWRC) began immunocontraception vaccine research by testing porcine zona pellucida (PZP) on white-tailed deer (Odocoileus virginianus). Early PZP research demonstrated that PZP induced infertility; however, increased length of the rut was observed in PZP-treated deer. An alternative vaccine using a keyhole limpet hemocyanin-gonadotropin-releasing hormone (KLH-GnRH) conjugate formulated with modified Freund's adjuvant was developed at NWRC. Suppression of GnRH has reduced reproduction in both sexes but is most effective in females. This vaccine was effective in preventing contraception in female deer for several years after a prime and boost. Due to adverse side effects of Freund's adjuvant, NWRC developed a new adjuvant called AdjuVac, a mineral oil/surfactant adjuvant with the addition of Mycobacterium avium as an immunostimulant. The price of KLH prompted a search for a more economical hemocyanin carrier protein for the GnRH peptide. Blue protein, derived from the mollusk Concholepas concholepas, proved to be a successful option. Formulation improvements resulted in a vaccine that can be effective as a single injection for multiple years, now called GonaCon. GonaCon is registered with the Environmental Protection Agency (EPA) for use in white-tailed deer in urban/suburban areas and for wild horses (Equus caballus) and burros (Equus asinus). Future GonaCon applications may include reducing reproduction to manage populations of other wildlife species, such as prairie dogs (Cynomys ludovicianus) in urban areas and suppressing reproduction to reduce the spread of venereal diseases such as brucellosis. Research is being conducted to develop a GnRH vaccine used in combination with the rabies vaccine to control population growth in free-roaming dogs, with the secondary effect of managing the spread of rabies. The EPA would regulate all these uses. Research is also ongoing on a GnRH vaccine to delay the onset of adrenocortical

Whole mitochondrial genome sequencing of domestic horses reveals incorporation of extensive wild horse diversity during domestication

Directory of Open Access Journals (Sweden)

Lippold Sebastian

2011-11-01

Full Text Available Abstract Background DNA target enrichment by micro-array capture combined with high throughput sequencing technologies provides the possibility to obtain large amounts of sequence data (e.g. whole mitochondrial DNA genomes from multiple individuals at relatively low costs. Previously, whole mitochondrial genome data for domestic horses (Equus caballus were limited to only a few specimens and only short parts of the mtDNA genome (especially the hypervariable region were investigated for larger sample sets. Results In this study we investigated whole mitochondrial genomes of 59 domestic horses from 44 breeds and a single Przewalski horse (Equus przewalski using a recently described multiplex micro-array capture approach. We found 473 variable positions within the domestic horses, 292 of which are parsimony-informative, providing a well resolved phylogenetic tree. Our divergence time estimate suggests that the mitochondrial genomes of modern horse breeds shared a common ancestor around 93,000 years ago and no later than 38,000 years ago. A Bayesian skyline plot (BSP reveals a significant population expansion beginning 6,000-8,000 years ago with an ongoing exponential growth until the present, similar to other domestic animal species. Our data further suggest that a large sample of wild horse diversity was incorporated into the domestic population; specifically, at least 46 of the mtDNA lineages observed in domestic horses (73% already existed before the beginning of domestication about 5,000 years ago. Conclusions Our study provides a window into the maternal origins of extant domestic horses and confirms that modern domestic breeds present a wide sample of the mtDNA diversity found in ancestral, now extinct, wild horse populations. The data obtained allow us to detect a population expansion event coinciding with the beginning of domestication and to estimate both the minimum number of female horses incorporated into the domestic gene pool and the

Initial study of wild horse and burro demography: determination of pregnancy and lactation rates in various herds. Final report

International Nuclear Information System (INIS)

Wolfe, M.L.; Ellis, L.C.

1982-01-01

Blood serum concentrations of reproductive hormones were used to estimate pregnancy rates in 558 wild and free-roaming horses (Equus caballus) from Nevada, Oregon, and Wyoming; and 165 burros from California. Levels of progesterone, pregnant mares' serum gonadotropin (PMSG), and estradiol 17B were determined by radioimmunoassay procedures. Based on comparison with the results of pregnancy diagnosis from rectal palpations (n =124), the following endocrine concentrations were established as criteria sufficient to indicate pregnancy: progesterone, 0.05 ng/ml; and/or PMSG, 3.0 mg/ml; and/or estradiol, 300 pg/ml. Estimated accuracy of pregnancy diagnoses from endocrine criteria was 80 to 85 percent. The mean incidence of pregnancy among mares sampled from Nevada, Oregon, and Wyoming was 58.4 percent, 69.2 percent, and 85.3 percent respectively

The optimized advanced demonstrator for the SC CW heavy ion linac at GSI

Energy Technology Data Exchange (ETDEWEB)

Schwarz, Malte; Basten, Markus; Busch, Marco; Dziuba, Florian; Podlech, Holger; Ratzinger, Ulrich; Tiede, Rudolf [Institut fuer Angewandte Physik, Goethe-Universitaet Frankfurt am Main (Germany); Gettmann, Viktor; Heilmann, Manuel [GSI Helmholtzzentrum, Darmstadt (Germany); Barth, Winfried; Mickat, Sascha [GSI Helmholtzzentrum, Darmstadt (Germany); HIM, Helmholtzinstitut, Mainz (Germany); Miski-Oglu, Maksym [HIM, Helmholtzinstitut, Mainz (Germany); Aulenbacher, Kurt [KPH, Johannes Gutenberg Universitaet, Mainz (Germany)

2016-07-01

For future experiments with heavy ions at the coulomb barrier within the SHE research project a multi-stage R and D program of GSI, HIM and IAP is currently under progress. It aims at developing a superconducting (sc) continuous wave (cw) LINAC with multiple CH-cavities as key components. As intermediate step towards the whole LINAC, the Optimized Advanced Demonstrator is proposed. Consisting of short CH-cavities and cryostats, it could provide several advantages regarding velocity acceptance, higher tolerance with respect to frequency and field deviation, easier mounting, handling and maintenance as well as a more robust longitudinal beam dynamic. The beam dynamics concept is based on EQUUS (Equidistant Multigap Structure) constant-beta cavities. The corresponding simulations for the proposed next extension stage - the Optimized Advanced Demonstrator - will be presented.

First Report of Echinococcus equinus in a Donkey in Turkey.

Science.gov (United States)

Simsek, Sami; Roinioti, Erifylli; Eroksuz, Hatice

2015-12-01

A 2-year-old female donkey (Equus asinus) was euthanized in the Pathology Department of Firat University, Elazig, Turkey. Necropsy disclosed the presence of 7 hydatid cysts distributed throughout the lung parenchyma. One of those cysts represented the parasite material of the present study and was molecularly identified through sequencing of a fragment of cytochrome c oxidase subunit 1 (CO1) and nicotinamide adenine dinucleotide dehydrogenase subunit 1 (NADH1) gene, as Echinococcus equinus. The generated CO1 sequence supports the presence of the dominant haplotype as has been described in Europe and Africa. The NADH1 sequence was found similar to sequences reported in equids in Egypt and the United Kingdom. The molecular identification of E. equinus in a donkey is being reported for the first time in Turkey.

EFFECT OF TWO PROTOCOLS OF CRYOPRESERVATION ON FERTILIZING CAPACITY OF STALLION (Equus caballus SEMEN EFECTO DE DOS PROTOCOLOS DE CRIOPRESERVACIÓN SOBRE LA CAPACIDAD FECUNDANTE DE SEMEN EQUINO (Equus caballus

Directory of Open Access Journals (Sweden)

Giovanni Restrepo Betancur

2012-06-01

Full Text Available Abstract. Semen cryopreservation is a fundamental process for the development of biotechnologies for assisted reproduction in horses. The use of cryopreservation techniques with changes in concentrations and the nature of the cryoprotectant, as well as, the different types of vials for storage of semen, have become an alternative to improve the protocols used. The objective of this work was to evaluate the effect of two protocols of cryopreservation (freezing and vitrification on the fertilizing capacity of stallion semen. The study was conducted with horses of the Criollo Colombiano breed. For freezing was used a extender supplemented with egg yolk (4% and dimethyl formamide (5%, and 0.5 mL straws as vials, whereas for vitrification, the extender was supplemented with egg yolk (8% and dimethyl formamide (8%, and cryovials were used as carriers. As post thaw parameters were evaluated: progressive motility, vitality, normal morphology and integrity of the plasma membrane through the hypoosmotic swelling test (HOS. For statistical evaluation was fitted a generalized linear model (GLM and means were compared by the Tukey test. Were found average percentages of progressive motility, vitality, normal morphology and HOS of 41.6 ± 11.8 and 37 ± 8.5, 54.3 ± 10.2 and 52.3 ± 7.8, 83.1 ± 5.4 and 83.6 ± 5.8, 41.7 ± 9.8 and 38.9 ± 3.6, for cryopreserved semen by freezing and vitrification, respectively. There were no statistically significant differences (P ≤ 0.05 between treatments for any of the parameters evaluated. The fertilizing capacity of equine semen cryopreserved by vitrification is comparable to that obtained by conventional freezing.Resumen. La criopreservación de semen es un proceso fundamental en el desarrollo de biotecnologías para la reproducción asistida en equinos. El uso de diferentes técnicas de criopreservación con cambios en las concentraciones y la naturaleza de los crioprotectores, así como en los diferentes tipos de soportes para el almacenamiento del semen, se ha constituido en una alternativa para mejorar los protocolos empleados. El objetivo de este trabajo fue evaluar el efecto de dos protocolos de criopreservación (congelación y vitrificación, sobre la capacidad fecundante del semen equino. El estudio se realizó con equinos de la raza Criollo Colombiano. Para la congelación se empleó un diluyente suplementado con de yema de huevo (4% y dimetilformamida (5%, y pajillas de 0,5 mL como soportes; mientras que para la vitrificación, el diluyente fue suplementado con yema de huevo (8% y dimetilformamida (8% y se usaron crioviales como soportes. Post-descongelación, se evaluaron los parámetros: movilidad progresiva, vitalidad, morfología normal e integridad de la membrana plasmática (HOS. Para la evaluación estadística se ajustó un modelo lineal generalizado (GLM y las medias se compararon por la prueba de Tukey. Se encontraron porcentajes promedio de movilidad progresiva, vitalidad, morfología normal y HOS de 41,6±11,8 y 37,0±8,5, 54,3±10,2 y 52,3±7,8, 83,1±5,4 y 83,6±5,8, 41,7±9,8 y 38,9±3,6, para el semen criopreservado por congelación y vitrificación, respectivamente. No se encontraron diferencias estadísticamente significativas (P ≤ 0,05 entre los tratamientos para ninguno de los parámetros evaluados. La capacidad fecundante del semen equino criopreservado por vitrificación es equiparable a la obtenida por congelación convencional.

Recalibrating Equus evolution using the genome sequence of an early Middle Pleistocene horse

DEFF Research Database (Denmark)

Orlando, Ludovic Antoine Alexandre; Ginolhac, Aurélien; Zhang, Guojie

2013-01-01

The rich fossil record of equids has made them a model for evolutionary processes. Here we present a 1.12-times coverage draft genome from a horse bone recovered from permafrost dated to approximately 560-780 thousand years before present (kyr bp). Our data represent the oldest full genome sequen...

Computed tomography and sectional anatomy of the head cavities in donkey (Equus asinus).

Science.gov (United States)

El-Gendy, S A A; Alsafy, M A M; El Sharaby, A A

2014-06-01

The purpose of this study was to describe the computed tomographic (CT) anatomy of normal donkey head cavities to be used as a basis for interpretation of CT images of donkey. Six adult donkeys' heads of undetermined sex were used in this study. The donkey heads were divided into three regions-nasal, orbital, and cranial-to show the morphology of the following cavities: nasal cavity, paranasal sinuses, orbital cavity, oral cavity, pharyngeal cavity, especially the guttural pouch, cranial cavity and temporomandibular joint. The donkey head had six pairs of sinuses: three paranasal (the frontal, maxillary and sphenopalatine sinuses) and three nasal (dorsal, middle and ventral conchal) sinuses. The maxillary sinus was subdivided into rostral and caudal compartments by a thin incomplete bony septum that was identified and labeled according to cheek teeth landmarks. The topographic description and relationship between the nasal, oral, orbital, cranial, temporomandibular joint, pharyngeal cavities and paranasal sinuses were demonstrated. The articular disc, articular surface and joint capsule of the temporomandibular joint were indicated easily in our CT and cross sectional images.

Dermatophytosis in donkeys (Equus asinus due to Microsporum racemosum, an unusual geophilic agent

Directory of Open Access Journals (Sweden)

Simona Nardoni

2016-06-01

Full Text Available Reports about ringworm in donkeys are scanty and refer to zoonotic agents such as Trichophyton mentagrophytes and Trichophyton verrucosum. Seventeen Asino Amiatina donkeys semi-extensively farmed in paddocks showed alopecic nummular, scaling areas mainly on head and neck. Microsporum racemosum cultivated from the lesions was identified by morphology and PCR. Affected animals healed spontaneously. The present record reports for the first time the occurrence of ringworm due to M. racemosum in naturally infected animals.

Bacterial and fungal microflora on the external genitalia of male donkeys (Equus asinus).

Science.gov (United States)

Carleton, Carla L; Donahue, J Michael; Marteniuk, Judith V; Sells, Stephen F; Timoney, Peter J

2015-02-01

This study was undertaken to investigate the bacterial and fungal microflora on the external genitalia of a population of healthy male donkeys in the state of Michigan, USA. The aim was to identify and determine the frequency of occurrence of these microorganisms using seven different isolation media and standard microbiological procedures. The sites (urethral fossa [fossa glandis], dorsal diverticulum of the urethral sinus, distal urethra, and penile surface) in the distal reproductive tract were cultured and each isolated microorganism identified. Ten different genera of gram-positive bacteria, eight different genera of gram-negative bacteria, and two genera of fungi were isolated from the external genitalia of the 43 donkeys in this study. All 43 donkeys yielded gram-positive bacteria (2-8 species) from all four sites sampled. Arcanobacterium spp., Corynebacterium spp., and Bacillus spp. were the most frequently isolated gram-positive bacteria. Gram-negative bacteria were cultured from 16 (37.2%) of the 43 donkeys, with Acinetobacterlwoffii (16.3%), Oligella urethralis (11.6%), and Taylorellaasinigenitalis (9.3%), the most frequently isolated. Fungi were cultured from only 5 (11.6%) of the 43 donkeys, with Rhizopus spp. isolated from 3 (7.0%) and Cladosporium spp. from 2 (4.7%) individuals. The testes and epididymides collected from 40 donkeys at time of castration were culture negative. Few differences were found in the bacterial flora between prepubertal and mature intact and castrated donkeys. Of notable interest was the scarcity of known equine pathogens across the population tested and isolation of T. asinigenitalis from normal donkeys, especially prepubertal individuals and previously castrated males. Copyright © 2014 Elsevier B.V. All rights reserved.

Influences of immunocontraception on time budgets, social behavior, and body condition in feral horses

Science.gov (United States)

Ransom, J.I.; Cade, B.S.; Hobbs, N.T.

2010-01-01

Managers concerned with shrinking habitats and limited resources for wildlife seek effective tools for limiting population growth in some species. Fertility control is one such tool, yet little is known about its impacts on the behavioral ecology of wild, free-roaming animals. We investigated influences of the immunocontraceptive porcine zona pellucida (PZP) on individual and social behavior in bands of feral horses (Equus caballus) in three discrete populations and used 14 hierarchical mixed effect models to gain insight into the influences of PZP treatment on feral horse behavior. A model of body condition was the strongest predictor of feeding, resting, maintenance, and social behaviors, with treated females allocating their time similarly to control females. Time spent feeding declined 11.4% from low condition to high condition females (F1,154 = 26.427, P modifications in feral horses.

Spotted hyaenas Crocuta crocuta prey on new-born elephant calves in Hwange National Park, Zimbabwe

Directory of Open Access Journals (Sweden)

Julia Salnicki

2001-07-01

Full Text Available Spotted hyaena Crocuta crocuta are known to be opportunists and to have a varied diet including mammals, reptiles and birds. Prey most often hunted are medium sized ungulates but spotted hyaenas will on occasion take larger species such as giraffe Giraffa camelopardalis and zebra Equus burchellii. They are also known to hunt whichever species are most abundant and will vary their prey seasonally. In this study spotted hyaenas were observed to take an unusual prey species in the form of elephant calves (Loxodonta africana. On a number of occasions hyaenas were observed feeding on or killing newborn and very young elephant calves. These observations were made whilst the authors were conducting research on spotted hyaena ecology in the woodlands of Hwange National Park, Zimbabwe and were made during the dry season between September and November 1999.

Determining Home Range and Preferred Habitat of Feral Horses on the Nevada National Security Site Using Geographic Information Systems

Energy Technology Data Exchange (ETDEWEB)

Burns, Ashley V. [Univ. of Denver, CO (United States)

2014-05-30

Feral horses (Equus caballus) are free-roaming descendants of domesticated horses and legally protected by the Wild and Free-Roaming Horses and Burros Act of 1971, which mandates how feral horses and burros should be managed and protected on federal lands. Using a geographic information system to determine the home range and suitable habitat of feral horses on the federally managed Nevada National Security Site can enable wildlife biologists in making best management practice recommendations. Home range was estimated at 88.1 square kilometers. Site suitability was calculated for elevation, forage, slope, water presence and horse observations. These variables were combined in successive iterations into one polygon. Suitability rankings established that 85 square kilometers are most suitable habitat, with 2,052 square kilometers of good habitat 1,252 square kilometers of fair habitat and 122 square kilometers of least suitable habitat.

Adaptive evolution of the mitochondrial ND6 gene in the domestic horse.

Science.gov (United States)

Ning, T; Xiao, H; Li, J; Hua, S; Zhang, Y P

2010-01-26

Mitochondria play a crucial role in energy metabolism through oxidative phosphorylation. Organisms living at high altitudes are potentially influenced by oxygen deficits and cold temperatures. The severe environmental conditions can impact on metabolism and direct selection of mitochondrial DNA. As a wide-ranging animal, the domestic horse (Equus caballus) has developed various morphological and physiological characteristics for adapting to different altitudes. Thus, this is a good species for studying adaption to high altitudes at a molecular level. We sequenced the complete NADH dehydrogenase 6 gene (ND6) of 509 horses from 24 sampling locations. By comparative analysis of three horse populations living at different altitudes (>2200 m, 1200-1700 m, and horses was found distributed on the selected branches. We conclude that the high-altitude environment has directed adaptive evolution of the mitochondrial ND6 gene in the plateau horse.

Stable isotopes suggest differences in diet between historic and reintroduced Przewalskís horses in the Gobi desert

Science.gov (United States)

Burnik Šturm, Martina; Spasskaya, Natalia N.; Sablin, Mikhail V.; Voigt, Christian C.; Kaczensky, Petra

2016-04-01

In historic times, two wild equid species, the Przewalski᾽s horse (PH; Equus ferus przewalskii) and the Asiatic wild ass (khulan, KH; Equus hemionus), roamed the Eurasian steppes. By the end of the 1960s, PHs had been driven to extinction in the wild and the range of KHs became severely restricted to the least productive habitats. However, PHs survived in captivity and reintroductions since the 1990s have brought the species back to parts of its native range in Mongolia and northern China where they again overlap with KHs. Ecological research on PHs and KHs has increased in recent years, but very little information is available on the ecology of the original PHs prior to extinction in the wild. We applied stable isotope analysis (13C, 15N, and 2H) of segmentally cut tail hair of PHs and KHs, collected during expeditions in NW China and SW Mongolia in 1889-1899, to draw inferences about the species feeding ecology. We compared tail hair isotope patterns of historic individuals to those of their extant counterparts from the Mongolian Gobi. A previous study of isotopic tail hair signatures of extant PHs (N=6) and KHs (N=6) suggested species specific differences in diet, with PHs being year-round grazers, but KHs switching between being grazers in summer and mixed feeders in winter (Burnik Šturm et al., in prep.). The comparison of isotope patterns of extant with historic samples confirms diet seasonality in historic KHs (N=3), but detects the same seasonality in five out of six PHs, suggesting that historic PHs had a different isotopic dietary niche than extant PHs. While we are still unable to fully understand the underlying reasons for this change in PHs, our results clearly suggest that the isotopic dietary niche of PHs was wider in the past, suggesting a higher diet flexibility, and overlapped with that of KHs, suggesting a high competition potential over Gobi pastures between the two equid species in historic times. Reference: Burnik Šturm, M., Ganbaatar, O

Morphological characteristics of Amiata donkey reared in Tuscany

Directory of Open Access Journals (Sweden)

Alessandro Giorgetti

2010-01-01

Full Text Available In this work were studied morphological characteristics and biometric parameters of the Amiata donkey. The Amiata donkey is a local endangered breed and derives from the homonym mountain in Tuscany. This donkey, which was used, over the past, like pack animal in farms and in mines, is now involved in milk production, onotherapy and trekking. The averages and the standard deviations of the biometric parameters and the frequency of the morphological characters of foals, adult females and stallions were calculated. The measures of the adult females were estimated by ANOVA considering three different classes of age: 3-4, 5-6, over6yearsold. 3-4, 5-6, over 6 years old.. The average sizes were: height at withers of 129.8±4.7and125.8±5.6cm,thoraxcircumferenceof145.6±7.8and145.0±7.8cm, 129.8±4.7 and125.8±5.6cm,thoraxcircumferenceof145.6±7.8and145.0±7.8cm, and 125.8±5.6cm,thoraxcircumferenceof145.6±7.8and145.0±7.8cm, 125.8±5.6 cm,thoraxcircumferenceof145.6±7.8and145.0±7.8cm, , thorax circumference of 145.6±7.8and145.0±7.8cm, 145.6±7.8and145.0±7.8cm, and 145.0±7.8cm, 145.0±7.8 cm,, front shank circumference of 18.3±0.8and16.9±1.5cm,forstallionsandadultfemalesrespectively.All 18.3±0.8 and16.9±1.5cm,forstallionsandadultfemalesrespectively.All and 16.9±1.5cm,forstallionsandadultfemalesrespectively.All 16.9±1.5 cm,forstallionsandadultfemalesrespectively.All , for stallions and adult females respectively. All the observed donkeys presented dark grey coat with the shoulder stripe. The zoometric indices of the adult females did not differ between the classes and showed that the somatic adult proportions had al- ready reached in 3-4 years old donkeys. This breed showed the features of the ancestors: the shoulder stripe of the Equus asinus africanus and the legs stripes of the Equus asinus somaliensis.

Breed and species comparison of amino acid transport variation in equine erythrocytes.

Science.gov (United States)

Fincham, D A; Young, J D; Mason, D K; Collins, E A; Snow, D H

1985-05-01

The amino acid permeability of red blood cells from Equus caballus (thoroughbred, Arab, shire and pony), E przewalskii (Przewalski's horse), E asinus (donkey and mule) and E burchelli (common or plains zebra) was measured. Individual animals exhibited stable but widely differing rates of L-[U-14C]alanine uptake in the range 5 to 1554 mumol (litre cells)-1 h-1 (0.2 mM extracellular L-alanine, 37 degrees C). Of the thoroughbreds tested, 30 per cent had red blood cells which were essentially impermeable to L-alanine (5 to 10 mumol (litre cells)-1 h-1, giving transport rates similar to those found previously in amino acid transport-deficient sheep erythrocytes. In contrast, only 3 per cent of the ponies tested had red blood cells impermeable to L-alanine. No cases of erythrocyte amino acid transport deficiency were found in the other horse breeds and species tested.

Lactate turnover in fast-moving vertebrates: The control of plasma metabolite fluxes

Energy Technology Data Exchange (ETDEWEB)

Weber, J.M.

1987-01-01

The goals of this thesis were: (1) to investigate the major factors involved in the regulation of plasma metabolite turnover at the whole-organism level-using lactate as a model, and (2) to determine whether endurance-adapted animals can support higher lactate turnover rates than sedentary animals. Lactate turnover was measured by bolus injection of (U{sup {minus}14}C)lacetate in skipjack tuna, Katsuwonus pelamis, and in thoroughbred race horses, Equus caballus. In tuna, turnover rates ranged from 112 to 431 umol min{sup {minus}1} kg{sup {minus}1}, and they were positively correlated with (lactate). These rates were higher than expected for a mammal of equivalent size. Plots of resting lactate and glucose turnover rates vs body mass on a log-log scale were linear for a wide range mammalian body sizes, and they showed the same slope as the classic body mass vs metabolic rate relationship.

Home range sizes for burchell's zebra equus burchelli antiquorum from the Kruger National Park

Directory of Open Access Journals (Sweden)

G.L. Smuts

1975-07-01

Full Text Available Annual home range sizes were determined for 49 marked zebra family groups in the Kruger National Park. Sizes varied from 49 to 566 sq. km, the mean for the Park being 164 square kilometre. Mean home range sizes for different zebra sub-populations and biotic areas were found to differ considerably. Present herbivore densities have not influenced intra- and inter-specific tolerance levels to the extent that home range sizes have increased. Local habitat conditions, and particularly seasonal vegetational changes, were found to have the most profound influence on the shape and mean size of home ranges. The large home range sizes obtained in the Kruger Park, when compared to an area such as the Ngorongoro Crater, can be ascribed to a lower carrying capacity with respect to zebra, large portions of the habitat being sub-optimal, either seasonally or annually.

Cranial Mesenteric Arterial Obstruction Due To Strongylus vulgaris Larvae in a Donkey (Equus asinus).

OpenAIRE

Hassan Borji; Zahra Moosavi; Fatemeh Ahmadi

2014-01-01

Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors? knowledge, a complete...

Cranial Mesenteric Arterial Obstruction Due To Strongylus vulgaris Larvae in a Donkey (Equus asinus).

Science.gov (United States)

Borji, Hassan; Moosavi, Zahra; Ahmadi, Fatemeh

2014-09-01

Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors' knowledge, a complete cranial mesenteric arterial obstruction due to verminous arteritis has rarely been described in horses and donkeys. Based on recent reports of fatal arterial obstruction due to S. vulgaris infection in donkeys, it may be evident to consider acute colic caused by this pathogenic parasite a re-emerging disease in donkeys and horses.

Cranial Mesenteric Arterial Obstruction Due To Strongylus vulgaris Larvae in a Donkey (Equus asinus.

Directory of Open Access Journals (Sweden)

Hassan Borji

2014-09-01

Full Text Available Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors' knowledge, a complete cranial mesenteric arterial obstruction due to verminous arteritis has rarely been described in horses and donkeys. Based on recent reports of fatal arterial obstruction due to S. vulgaris infection in donkeys, it may be evident to consider acute colic caused by this pathogenic parasite a re-emerging disease in donkeys and horses.

Angiographic aspect of the distal forelimb in donkeys (Equus asinus used for animal traction

Directory of Open Access Journals (Sweden)

Maria Angélica Miglino

2009-12-01

Full Text Available The asinine species was originated thousands of years ago from the same branch of domestic equine. Asinines have been undergoing a great adaptation resulting in different characteristics observed in their populations around the world. In the northeastern region of Brazil, they play an essential role in the economy of local families. Due to a large number of locomotor disorders and a lack of professional care for these animals, a radiographic study of the distal forelimb region of the asinine was carried out in order to gather information for the improvement of clinical and surgical practices in this species, and to explain their low susceptibility to locomotor disorders compared to that of the domestic equine. The angiographic examination revealed the main arterial vessels committed to the blood supply of the forelimbs in these animals, providing evidence of the vascular pattern of the median and palmar common digital arteries, which originated a great number of collateral branches, mainly to the distal phalanx. The distal forelimbs in donkeys have shown great vascular anastomosis, promoting additional blood supply to the deep endosteum and periosteum regions, probably as a response to the physical activity developed by these animals.

Glanders in donkeys (Equus asinus in the state of Pernambuco, Brazil: a case report

Directory of Open Access Journals (Sweden)

Rinaldo Aparecido Mota

2010-03-01

Full Text Available The clinical, anatomical and histopatological findings of glanders diagnosis in donkeys in the state of Pernambuco-Brazil are reported. The animals were euthanized and necropsied, and evaluated for lesions in respiratory and lymphatic systems, confirming the disease by isolation of Burkholderia mallei and Strauss test.

Molecular and serological detection of tick-borne pathogens in donkeys (Equus asinus) in Italy.

Science.gov (United States)

Veronesi, Fabrizia; Morganti, Giulia; Ravagnan, Silvia; Laus, Fulvio; Spaterna, Andrea; Diaferia, Manuela; Moretti, Annabella; Fioretti, Daniela Piergili; Capelli, Gioia

2014-10-10

Donkeys, owing to the frequent outdoor activity, are exposed to a high risk of infection with tick-borne pathogens. This work aimed to detect exposure to Theileria equi, Babesia caballi, Anaplasma phagocytophilum and Borrelia burgdorferi s.l. of donkeys reared in Central Italy. For this purpose 122 adult donkeys were selected within 11 herds and submitted to blood collection. IgG antibodies to T. equi, B. caballi, A. phagocytophilum and B. burgdorferi s.l. were detected by IFAT. Conventional PCRs targeting the genes MSP2 and the flagellin were used for the detection of A. phagocytophilum and B. burgdorferi s.l. respectively and a Real Time PCR Sybr Green was used to detect Babesia/Theileria spp…. The species identity was determined by amplicons sequencing. Forty eight (39.3%) and 58 (47.5%) animals tested positive for T. equi and B. caballi antibodies, respectively; nine animals (7.4%) were found positive for antibodies against A. phagocytophilum whereas negative results were obtained for B. burgdorferi s.l. Twenty-six (21.3%) animals showed antibodies for both T. equi and B. caballi. Twenty-three (18.8%) donkeys were positive to Babesia/Theileria spp. PCR assay. Out of 21 sequenced amplicons, 20 were identified as T. equi, belonging to three main groups designated A, B and D and one as B. caballi group A. Neither A. phagocytophilum nor B. burgdorferi PCR results were positive. The study showed a high exposure of donkeys to tick-borne pathogens and provides information on the genetic identity of the T. equi strains circulating in Central Italy. Copyright © 2014 Elsevier B.V. All rights reserved.

From ‘Bad’ to ‘Mad’: Labelling and Behaviour in Peter Shaffer’s Equus

OpenAIRE

Méndez García, Carmen María

2016-01-01

The process of ‘labelling’ (whereby labels are socially imposed on a given behaviour by a given person) is an extensive and recurrent one in our society, as proved by the labelling of behaviours and people even into the literary text. In our analysis, we will try to show how applying one of two most different labels (psychopathic or psychotic) greatly influences our understanding of the existence of ‘evil’ or moral responsibility in the deeds of a person. To such end, we will use Peter Shaffe...

Analysis of Horse Myostatin Gene and Identification of Single Nucleotide Polymorphisms in Breeds of Different Morphological Types

Directory of Open Access Journals (Sweden)

Stefania Dall'Olio

2010-01-01

Full Text Available Myostatin (MSTN is a negative modulator of muscle mass. We characterized the horse (Equus caballus MSTN gene and identified and analysed single nucleotide polymorphisms (SNPs in breeds of different morphological types. Sequencing of coding, untranslated, intronic, and regulatory regions of MSTN gene in 12 horses from 10 breeds revealed seven SNPs: two in the promoter, four in intron 1, and one in intron 2. The SNPs of the promoter (GQ183900:g.26T>C and GQ183900:g.156T>C, the latter located within a conserved TATA-box like motif were screened in 396 horses from 16 breeds. The g.26C and the g.156C alleles presented higher frequency in heavy (brachymorphic type than in light breeds (dolichomorphic type such as Italian Trotter breed. The significant difference of allele frequencies for the SNPs at the promoter and analysis of molecular variance (AMOVA on haplotypes indicates that these polymorphisms could be associated with variability of morphology traits in horse breeds.

Species identification in meat products: A new screening method based on high resolution melting analysis of cyt b gene.

Science.gov (United States)

Lopez-Oceja, A; Nuñez, C; Baeta, M; Gamarra, D; de Pancorbo, M M

2017-12-15

Meat adulteration by substitution with lower value products and/or mislabeling involves economic, health, quality and socio-religious issues. Therefore, identification and traceability of meat species has become an important subject to detect possible fraudulent practices. In the present study the development of a high resolution melt (HRM) screening method for the identification of eight common meat species is reported. Samples from Bos taurus, Ovis aries, Sus scrofa domestica, Equus caballus, Oryctolagus cuniculus, Gallus gallus domesticus, Meleagris gallopavo and Coturnix coturnix were analyzed through the amplification of a 148 bp fragment from the cyt b gene with a universal primer pair in HRM analyses. Melting profiles from each species, as well as from several DNA mixtures of these species and blind samples, allowed a successful species differentiation. The results demonstrated that the HRM method here proposed is a fast, reliable, and low-cost screening technique. Copyright © 2017 Elsevier Ltd. All rights reserved.

Analysis of Horse Myostatin Gene and Identification of Single Nucleotide Polymorphisms in Breeds of Different Morphological Types

Science.gov (United States)

Dall'Olio, Stefania; Fontanesi, Luca; Nanni Costa, Leonardo; Tassinari, Marco; Minieri, Laura; Falaschini, Adalberto

2010-01-01

Myostatin (MSTN) is a negative modulator of muscle mass. We characterized the horse (Equus caballus) MSTN gene and identified and analysed single nucleotide polymorphisms (SNPs) in breeds of different morphological types. Sequencing of coding, untranslated, intronic, and regulatory regions of MSTN gene in 12 horses from 10 breeds revealed seven SNPs: two in the promoter, four in intron 1, and one in intron 2. The SNPs of the promoter (GQ183900:g.26T>C and GQ183900:g.156T>C, the latter located within a conserved TATA-box like motif) were screened in 396 horses from 16 breeds. The g.26C and the g.156C alleles presented higher frequency in heavy (brachymorphic type) than in light breeds (dolichomorphic type such as Italian Trotter breed). The significant difference of allele frequencies for the SNPs at the promoter and analysis of molecular variance (AMOVA) on haplotypes indicates that these polymorphisms could be associated with variability of morphology traits in horse breeds. PMID:20706663

Deciphering Equine Evolution and Spatial Ancestry with Ancient Data

DEFF Research Database (Denmark)

Jónsson, Hákon

High-throughput sequencing has opened ancient DNA research to genomics, revolutionizing the amount of genetic information retrievable from archaeological and paleontological remains. Paleogenomics is still in infancy and requires substantial improvements in computational methods tailored to the s......High-throughput sequencing has opened ancient DNA research to genomics, revolutionizing the amount of genetic information retrievable from archaeological and paleontological remains. Paleogenomics is still in infancy and requires substantial improvements in computational methods tailored...... in the analysis of environmental bacterial sequences, which generally dominate ancient DNA extracts, and in the first pipeline completely devoted to the computational analysis of raw ancient DNA sequences. We then develop a spatially explicit method for determining which extant populations show the greatest...... genetic anity to ancient individuals, which often represents the key question in human paleogenomic projects. We applied the computational infrastructure developed to complete the genomic characterization of extant members of the genus Equus, which is composed of horses, asses and zebras. We sequenced...

Monitoring acute equine visceral pain with the Equine Utrecht University Scale for Composite Pain Assessment (EQUUS-COMPASS) and the Equine Utrecht University Scale for Facial Assessment of Pain (EQUUS-FAP) : A scale-construction study

NARCIS (Netherlands)

van Loon, Johannes P A M; Van Dierendonck, Machteld C

2015-01-01

Although recognition of equine pain has been studied extensively over the past decades there is still need for improvement in objective identification of pain in horses with acute colic. This study describes scale construction and clinical applicability of the Equine Utrecht University Scale for

Relationship between conventional semen characteristics, sperm motility patterns and fertility of Andalusian donkeys (Equus asinus).

Science.gov (United States)

Dorado, J; Acha, D; Ortiz, I; Gálvez, M J; Carrasco, J J; Díaz, B; Gómez-Arrones, V; Calero-Carretero, R; Hidalgo, M

2013-12-01

Sperm quality has an important role in determining fertility. The aims of this study were to compare the conventional sperm parameters, plus the characteristics of the motility patterns of the different sperm subpopulations, of donkey donors with different fertility level, and to determine their relationships to fertility. Thirty ejaculates from 6 Andalusian donkeys were assessed for gel-free volume, pH, sperm concentration, motility and morphology. The fertility of donkeys was classified on the basis of pregnancy rates per cycle, where donkeys with a per cycle pregnancy rate ≥60% were considered to be "fertile" (n=3) and those with a per cycle pregnancy rate donkeys with in vitro measures of sperm motility using computer-assisted sperm analysis techniques. Copyright © 2013 Elsevier B.V. All rights reserved.

Non-surgical sterilisation methods may offer a sustainable solution to feral horse (Equus caballus) overpopulation.

Science.gov (United States)

Hall, Sally Elizabeth; Nixon, Brett; Aitken, R John

2017-09-01

Feral horses are a significant pest species in many parts of the world, contributing to land erosion, weed dispersal and the loss of native flora and fauna. There is an urgent need to modify feral horse management strategies to achieve public acceptance and long-term population control. One way to achieve this is by using non-surgical methods of sterilisation, which are suitable in the context of this mobile and long-lived species. In this review we consider the benefits of implementing novel mechanisms designed to elicit a state of permanent sterility (including redox cycling to generate oxidative stress in the gonad, random peptide phage display to target non-renewable germ cells and the generation of autoantibodies against proteins essential for conception via covalent modification) compared with that of traditional immunocontraceptive approaches. The need for a better understanding of mare folliculogenesis and conception factors, including maternal recognition of pregnancy, is also reviewed because they hold considerable potential in providing a non-surgical mechanism for sterilisation. In conclusion, the authors contend that non-surgical measures that are single shot and irreversible may provide a sustainable and effective strategy for feral horse control.

Affiliative and aggressive behavior in a group of female Somali wild ass (Equus africanus somalicus).

Science.gov (United States)

Asa, Cheryl S; Marshall, Fiona; Fischer, Martha

2012-01-01

We observed a group of three young female Somali wild asses to develop an ethogram of social behavior in the first phase of a longer term study of social, sexual, and maternal/infant behavior. The most unexpected finding was the frequency and extent of aggressive interactions, which included Charge, Drive, Neck Wrestle, Head Butt, and Body Slam, behaviors previously reported only for males of other equid species. The overall frequency of aggressive behavior was higher than that of affiliative behavior (84±16.5 vs. 32±5.5, P=0.03), yet no injuries occurred. The dyadic directionality of aggressive behavior suggested a dominance hierarchy, a feature not previously reported for either wild ass or domestic donkeys. The aggression observed may be an accurate representation of the behavior of this species, or their relatively young ages, or their recent transfer from their natal group through quarantine and into a new enclosure may have heightened agonistic tendencies. Further studies will determine whether with time their aggressive behavior becomes more intense or dissipates with maturity. © 2011 Wiley Periodicals, Inc.

Visual attention, an indicator of human-animal relationships? A study of domestic horses (Equus caballus

Directory of Open Access Journals (Sweden)

Céline eRochais

2014-02-01

Full Text Available As visual attention is an intrinsic part of social relationships, and because relationships are built on a succession of interactions, their establishment involves learning and attention. The emotional, rewarding or punishing, content can modulate selective attention. In horses, the use of positive/negative reinforcement during training determines short and long-term human-horse relationships. In a recent study in horses, where either food or withers’ grooming were used as a reward, it appeared that only the food-rewarded horses learned the task and show better relationship with humans. In the present study, we hypothesized that this differential effect of grooming/food rewards on learning performances could be due to attentional processes. Monitoring, gazes and behaviors directed towards the trainer revealed that the use of a food reward (FR as positive reinforcement increased horses’ selective attention towards their trainer. Conversely, horses trained with grooming reward (GR expressed more inattentive responses and did not show a decrease of agitated behavior. However, individual plotting of attention versus rate of learning performances revealed a complex pattern. Thus, while all FR horses showed a window of attention related to faster learning performances, GR horses’ pattern followed an almost normal curve where the extreme animals (i.e. highest and lowest attention had the slowest learning performances. On the other hand, learning was influenced by attention: at the end of training, the more attentive horses had also better learning performances. This study, based on horses, contributes to the general debates on the place of attentional processes at the interface of emotion and cognition and open new lines of thought about individual sensitivities (only individuals can tell what an appropriate reward is, attentional processes and learning.

Domestic donkey (Equus africanus asinus bites: An unusual aetiology of severe scalp injuries in Morocco

Directory of Open Access Journals (Sweden)

Hatim Droussi

2014-12-01

Discussion: The bite of a donkey is rare aetiology of scalp injuries. Special features of these injuries, including a literature review, are discussed focusing on the care of these patients in the emergency centre, describing the surgical procedures required and antibiotic choice. Recommendations for the management of donkey bite scalp injuries are provided.

The extinction of Equidae and Proboscidea in South America. A test using Carbon isotope data

Directory of Open Access Journals (Sweden)

Prado, J. L.

2011-12-01

Full Text Available Carbon isotopes, preserved in 166 samples of fossil teeth and bone, provide key data for understanding the ecology of extinct horses and gomphotheres during the Plio-Pleistocene in South America. To analyze the patterns of dietary partitioning throughout this time we divided the samples into 19 groups, taking into account the genus and the age of the corresponding localities. In this study, the diets of both groups are assessed to test extinction hypotheses. The strong resource partitioning among herbivores assumed under Co-evolutionary disequilibrium hypothesis is supported by isotopic data of horses from latest Pleistocene. Hippidon and Equus had very different diets. In contrast, species of gomphotheres from late Pleistocene in South America seem to have had less specialized diets containing a broad mix of both C₃ and C₄ plants, which is in line with the dietary assumptions of the mosaic-nutrient hypothesis, but does not support the assumptions of Co-evolutionary disequilibrium hypothesis.

Los isótopos del carbono preservados en 166 muestras de dientes y huesos fósiles son un dato clave para entender la ecología de los de caballos y gonfoterios durante el Plio-Pleistoceno en América del Sur. Para analizar los cambios en las reconstrucciones de la dieta durante este lapso temporal hemos dividido las muestras en 19 grupos, teniendo en cuenta la sistemática y la cronología de cada localidad. En este estudio, las dietas de ambos grupos son evaluadas para probar las hipótesis sobre su extinción. El alto fraccionamiento en el uso de los recursos entre los herbívoros que asume la hipótesis del desequilibrio co-evolutivo es sustentada por los datos isotópicos de los caballos del Pleistoceno tardío. Hippidion y Equus tenían una dieta muy diferente. En contraste, las especies de gonfoterios de finales del Pleistoceno parecen tener una dieta menos especializada con una combinación de

Manual semen collection from a Grevy's zebra stallion (Equus grevyi), onset of sperm production, semen characteristics, and cryopreservation of semen, with a comparison to the sperm production from a Grant's Zebra stallion (Equus burchelli boehmi).

Science.gov (United States)

Crump, J P; Crump, J W

1994-01-01

A manual technique was used to collect representative ejaculates from an unrestrained Grevy's zebra stallion beginning at 13 mo of age to determine the onset of sperm production, to calculate the number of spermatozoa produced per ejaculate, and to determine any seasonality associated with sperm production. Spermatozoa first appeared in the ejaculate at 31 mo of age. By 48 mo of age the zebra was producing up to 40 billion spermatozoa per ejaculate. Progressive sperm motility ranged from 75 to 95%. Gel-free semen volume averaged 75 to 120 ml/ejaculate. Gel volume ranged from 0 to 1100 ml/ejaculate. Semen was frozen in 2 different extenders in 0.5-ml PVC straws. The post-thaw motility of cryopreserved spermatozoa ranged from 30 to 70%. A domestic horse mare became pregnant on the first cycle after insemination with frozen-thawed spermatozoa from this zebra. Sperm production data obtained from semen collections made on a Grant's Zebra stallion from 3 to 8 yr of age is presented for comparison of the 2 species.

Inter- and intra-specific differences in serum proteins of different species and subspecies of zebras.

Science.gov (United States)

Stratil, A; Cízová, D; Gábrisová, E; Pokorný, R

1992-11-01

1. Serum proteins of Equus grevyi, E. zebra hartmannae, E. burchelli boehmi, E. b. chapmanni and E. b. antiquorum were studied using starch-gel electrophoresis, 1-D polyacrylamide-gel electrophoresis, inhibitions of trypsin and chymotrypsin, immunoblotting, and specific staining for esterase. 2. Clear species-specific patterns were observed in albumin, transferrin, and for E. grevyi in protease inhibitor-1. Specific esterase was detected only in E. z. hartmannae. 3. Protein polymorphism was found in all studied species: E. grevyi--transferrin; E. z. hartmannae--protease inhibitor-1; E. b. boehmi--albumin, GC, transferrin, protease inhibitor-1, protease inhibitor-T; E. b. chapmanni--albumin, GC, transferrin, protease inhibitor-1; E. b. antiquorum--GC, transferrin, protease inhibitor-1. 4. Phenotype patterns of the polymorphic proteins were indicative of simple codominant inheritance. Further studies of polymorphism of protease inhibitor-2 and variability of protease inhibitor-X are needed. 5. alpha 1B glycoprotein in all zebra species was monomorphic. 6. The main transferrin components and alpha 1B glycoprotein of zebra (E. b. boehmi) were characterized for terminal sialic acid content.

Inter-birth interval in zebras is longer following the birth of male foals than after female foals

Science.gov (United States)

Barnier, Florian; Grange, Sophie; Ganswindt, Andre; Ncube, Hlengisizwe; Duncan, Patrick

2012-07-01

Mammalian reproductive rates vary among individuals for physiological and environmental reasons. This study aims to determine reproductive rates from an individually monitored population of wild Plains zebras Equus quagga, and to assess the sources of variability in inter-birth intervals. The animals were monitored, where possible, every six months from 2004 to 2011. Thirty nine intervals corresponding to 65 births in 26 mares were identified, using direct observations and faecal steroid monitoring. Mean foaling rate of the population is 0.74 foal/year, and comparable with the literature. There was no significant effect of mother's age, nor of the season of previous birth on the length of inter-birth intervals. Inter-birth interval was significantly longer when the first foal was a male. This finding indicates that additional costs of having a son may delay future reproduction and thus reduce the total number of offspring a mare can have during her lifetime. Individually-based data provide critical information on the determinants of reproductive rates, and are therefore a key to understanding the causes of variations in life-history traits.

[Development and application of real-time PCR for identification and detection of horse meat in animal-origin products].

Science.gov (United States)

Li, Nan; Wang, Jiahui; Shen, Qing; Han, Chunhui; Zhang, Jing; Li, Fengqin; Xu, Jin; Jiang, Tao

2013-11-01

To develop a real-time PCR method for identification and detection of domestic horse meat (Equus caballus) in animal-origin products. The primer and TaqMan-probe was designed and synthesized according to the EU reference laboratory and 87 bp fragments was amplified for horse ingredients. The specificity and sensitivity was tested by artificially spiked horse meat into other domestic meat, such as cattle, sheep, pork, chicken, duck and rabbit. 122 samples of cattle and sheep products were random collected in Beijing market and the detection of horse meat was carried out. The real-time PCR in this study has high specificity and sensitivity for horse meat. No cross-reaction was observed between the horse and sheep, pork, chicken, duck and rabbit meat. There was little cross reaction between horse and cattle when the CT value reach 33. 81. The method can detect 0.1% of horse meat mixed with other domestic animal-origin products. No horse meat ingredients were detected in 122 samples in this survey. There was no horse meat mixed into cattle and sheep products in Beijing marked.

Pathology of gastric lesions in donkeys: A preliminary study.

Science.gov (United States)

Al-Mokaddem, A K; Ahmed, K A; Doghaim, R E

2015-11-01

Donkeys (Equus africanus asinus) are important working animals, particularly in countries where the majority of the population lives below the poverty line. Gastric ulceration has been shown to be common in British donkeys but donkeys from other parts of the world have not been as extensively researched. This study was performed as a preliminary overview of the severity and distribution of gastric lesions in mature donkeys and to document which parasites were present. Descriptive study of pathological findings. Stomachs of 35 mature draught donkeys were examined grossly and histopathology samples taken from 5 regions of the gastric mucosa. Gross examination revealed hyperaemia, oedema, erosions and ulcers in addition to parasitic lesions. Histopathological examination revealed hyperkeratosis, acanthosis, vacuolar degeneration of stratified squamous cells, gastritis, erosions, ulcerations, scarring, hyperactivity of mucus glands, periglandular fibroplasia and parasitic granulomes with infestation by Gasterophilus spp. larvae, Habronema spp. and Draschia megastoma. In donkeys, ulceration of the nonglandular regions of the stomach is more prominent than the glandular regions and parasitic infestations were frequent. © 2014 EVJ Ltd.

Anaerobic respiratory growth of Vibrio harveyi, Vibrio fischeri and Photobacterium leiognathi with trimethylamine N-oxide, nitrate and fumarate: ecological implications.

Science.gov (United States)

Proctor, L M; Gunsalus, R P

2000-08-01

Two symbiotic species, Photobacterium leiognathi and Vibrio fischeri, and one non-symbiotic species, Vibrio harveyi, of the Vibrionaceae were tested for their ability to grow by anaerobic respiration on various electron acceptors, including trimethylamine N-oxide (TMAO) and dimethylsulphoxide (DMSO), compounds common in the marine environment. Each species was able to grow anaerobically with TMAO, nitrate or fumarate, but not with DMSO, as an electron acceptor. Cell growth under microaerophilic growth conditions resulted in elevated levels of TMAO reductase, nitrate reductase and fumarate reductase activity in each strain, whereas growth in the presence of the respective substrate for each enzyme further elevated enzyme activity. TMAO reductase specific activity was the highest of all the reductases. Interestingly, the bacteria-colonized light organs from the two squids, Euprymna scolopes and Euprymna morsei, and the light organ of the ponyfish, Leiognathus equus, also had high levels of TMAO reductase enzyme activity, in contrast to non-symbiotic tissues. The ability of these bacterial symbionts to support cell growth by respiration with TMAO may conceivably eliminate the competition for oxygen needed for both bioluminescence and metabolism.

Characterization of several milk proteins in Domestic Balkan donkey breed during lactation, using lab-on-a-chip capillary electrophoresis

Directory of Open Access Journals (Sweden)

Gubić Jasmina

2016-01-01

Full Text Available Domestic Balkan donkey (Equus asinus asinus is a native donkey breed, primarily found in the northern and eastern regions of Serbia. The objective of the study was to analyze proteins of Domestic Balkan donkey milk during the lactation period (from the 45th to the 280th day by applying Lab-on-a-Chip electrophoresis. The chip-based separations were performed on the Agilent 2100 Bioanalyzer in combination with the Protein 80 Plus Lab Chip kit. The protein content of Domestic Balkan donkey milk during the lactation period of 280 days ranged from 1.40 % to 1.92 % and the content of αs1-casein, αs2-casein, b-casein, α-, β- lactoglobulin, lysozyme, lactoferrin and serum albumin was relatively quantified. Lysozyme (1040-2970 mg/L, α-lactalbumin 12 kDa (1990-2730 mg/L and α-lactalbumin 17.7 kDa (2240-3090 mg/L were found to be the proteins with the highest relative concentrations. [Projekat Ministarstva nauke Republike Srbije, br. III46012

Oxytocin, vasopressin, prostaglandin F(2alpha), luteinizing hormone, testosterone, estrone sulfate, and cortisol plasma concentrations after sexual stimulation in stallions.

Science.gov (United States)

Veronesi, M C; Tosi, U; Villani, M; Govoni, N; Faustini, M; Kindahl, H; Madej, A; Carluccio, A

2010-03-01

This experiment was designed to determine the effects of sexual stimulation on plasma concentrations of oxytocin (OT), vasopressin (VP), 15-ketodihydro-PGF(2alpha) (PG-metabolite), luteinizing hormone (LH), testosterone (T), estrone sulfate (ES), and cortisol (C) in stallions. Semen samples were collected from 14 light horse stallions (Equus caballus) of proven fertility using a Missouri model artificial vagina. Blood samples were collected at 15, 12, 9, 6, and 3 min before estrous mare exposure, at erection, at ejaculation, and at 3, 6, and 9 min after ejaculation. Afterwards, blood sampling was performed every 10 min for the following 60 min. Sexual activity determined an increase in plasma concentrations of OT, VP, C, PG-metabolite, and ES and caused no changes in LH and T concentrations. The finding of a negative correlation between C and VP at erection, and between C and T before erection and at the time of erection, could be explained by a possible inhibitory role exerted by C in the mechanism of sexual arousal described for men. Copyright 2010 Elsevier Inc. All rights reserved.

Gastric Ulcers Syndrome in Donkeys

Directory of Open Access Journals (Sweden)

Abelardo Morales Briceño

2015-09-01

Full Text Available This study aimed to describe gastric ulcer in donkeys. 10 donkeys (Equus asinus were studied in Bodonal de la Sierra, Badajoz-Extremadura, Spain. They were referred for necropsy and dead due to non-digestive causes. 4 males and 6 females were examined. The ages were classified of 4-16 years old. The stomach and gastric mucosa was evaluated for classified Merrit, 2003. Samples of gastric tissue were collected. The samples fixed in formalin were processed by conventional histological techniques and examined by histopathology. None of the donkeys presented clinical signs for gastric ulcers syndrome. Of the 10 donkeys studied, 10% had Grade 0; 30% Grade 1; 40% Grade 2; 10% Grade 3; and 10% Grade 4. In 30% (3/10 parasites such as Gasterophilus sp. were observed. The histological slices revealed severe damage on the gastric mucosa, a loss of continuity of the gastric mucosa with corium exposure, and subchorionic edema with parakeratotic hyperkeratosis, together with a mixed lymphoplasmocytic mononuclear infiltrate. In conclusion, we reported gastric ulcers syndrome in donkeys in Spain.

Mitochondrial D-loop sequence variation among Italian horse breeds

Directory of Open Access Journals (Sweden)

Zanotti Marta

2004-11-01

Full Text Available Abstract The genetic variability of the mitochondrial D-loop DNA sequence in seven horse breeds bred in Italy (Giara, Haflinger, Italian trotter, Lipizzan, Maremmano, Thoroughbred and Sarcidano was analysed. Five unrelated horses were chosen in each breed and twenty-two haplotypes were identified. The sequences obtained were aligned and compared with a reference sequence and with 27 mtDNA D-loop sequences selected in the GenBank database, representing Spanish, Portuguese, North African, wild horses and an Equus asinus sequence as the outgroup. Kimura two-parameter distances were calculated and a cluster analysis using the Neighbour-joining method was performed to obtain phylogenetic trees among breeds bred in Italy and among Italian and foreign breeds. The cluster analysis indicates that all the breeds but Giara are divided in the two trees, and no clear relationships were revealed between Italian populations and the other breeds. These results could be interpreted as showing the mixed origin of breeds bred in Italy and probably indicate the presence of many ancient maternal lineages with high diversity in mtDNA sequences.

Study of two new methods of geochronometry: dating method of carbonaceous formations by U-series disequilibrium gamma spectrometry; ESR dating method of rich U-content fossil dental enamel

International Nuclear Information System (INIS)

Ma, Jean-Luc

1984-01-01

First, the U-series disequilibrium dating method was re-examined using non-destructive γ-spectrometry. A new low-background (≤ 10 ppb U- equivalent) Ge-HP γ-spectrometer has been used to date travertine with small U-content (∼ 0.1 ppm) and low (≤ 5%) Th/U , content, by comparison with old-limestone γ-spectra. Second, a new ESR dating method has been developed using fossil dental enamel which is rich in U-content (10 - 100 ppm). Both methods were applied to Arago Cave (Tautavel, France): - with an ionium-age of 120 ka (10%), the upper travertine seems to have been set up during the Riss-deglaciation period. - the high (∼ 50%) Th/U-content samples of the intermediate travertine are un-datable. - the ESR-age of EQUUS mosbachensis enamel is 400 ka (10%) for the G-soil of Arago. XXI H. erectus, and 600 ka (10%) for the Q-soil above (- 1 m) of the lower travertine of which Io-age is older than 350 ka. (author)

Histopathological Study of Esophageal Infection with Gasterophilus pecorum (Diptera: Oestridae in Persian Onager (Equus hemionus onager

Directory of Open Access Journals (Sweden)

Seyed Mohammad Hoseini

2017-10-01

Full Text Available Background: The larval stages of Gasterophilus are obligate parasites in the gastrointestinal tract of equine account­able for pathologic ulcers in the Persian onager gastrointestinal. The aim of the current report was to study the histo­pathological change with G. pecorum larvae in the esophagus of a Persian onager.Methods: This study was performed in Iranian Zebra propagation and breeding site in Khartouran National Park, southeast of Shahrud City, Semnan Province, Iran in 2014. Following a necropsy with specific refer to esophagus of one adult female Persian onager were transmitted to the laboratory. After autopsy, parasites collected from the esophagus were transmitted into 70% alcohol. For histopathological investigation, tissue samples were collected from the esophagus. The tissues were fixed in 10% buffered formalin, and conformity routine processing, there were stained with Hematoxylin and eosin.Results: After clarity by lactophenol parasites were identified as G. pecorum. Microscopic recognition contained hyperemia, inflammatory cell infiltration, epithelial destruction, esophageal gland hyperplasia.Conclusion: This is the first survey of G. pecorum and histopathological study in the Persian onager esophagus in the world.

Histopathological Study of Esophageal Infection with Gasterophilus pecorum (Diptera: Oestridae) in Persian Onager (Equus hemionus onager).

Science.gov (United States)

Hoseini, Seyed Mohammad; Zaheri, Bahram Ali; Adibi, Mohamad Ali; Ronaghi, Hooman; Moshrefi, Amir Hossein

2017-09-01

The larval stages of Gasterophilus are obligate parasites in the gastrointestinal tract of equine accountable for pathologic ulcers in the Persian onager gastrointestinal. The aim of the current report was to study the histopathological change with G. pecorum larvae in the esophagus of a Persian onager. This study was performed in Iranian Zebra propagation and breeding site in Khartouran National Park, southeast of Shahrud City, Semnan Province, Iran in 2014. Following a necropsy with specific refer to esophagus of one adult female Persian onager were transmitted to the laboratory. After autopsy, parasites collected from the esophagus were transmitted into 70% alcohol. For histopathological investigation, tissue samples were collected from the esophagus. The tissues were fixed in 10% buffered formalin, and conformity routine processing, there were stained with Hematoxylin and eosin. After clarity by lactophenol parasites were identified as G. pecorum . Microscopic recognition contained hyperemia, inflammatory cell infiltration, epithelial destruction, esophageal gland hyperplasia. This is the first survey of G. pecorum and histopathological study in the Persian onager esophagus in the world.

Persistence of α-cypermethrin residues in milk of lactating donkeys (Equus asinus) using UHPLC-MS/MS.

Science.gov (United States)

Chirollo, Claudia; Radovnikovic, Anita; Veneziano, Vincenzo; Marrone, Raffaele; Pepe, Tiziana; Danaher, Martin; Anastasio, Aniello

2014-01-01

The aim of this study was to measure the persistence of residues of the pyrethroid insecticide α-cypermethrin (ACYP) in the milk of lactating donkeys following pour-on treatment. Milk was collected from animals (n = 7) before the treatment and at 12, 24, 36, 48, 60, 72 and 84 h post-treatment. The last sampling was taken 7 days post-treatment (168 h). Milk samples were analysed by ultra-high-performance liquid chromatography coupled to tandem mass spectrometry (UHPLC-MS/MS). The analytical method was validated following requirements of Commission Decision 2002/657/EC. All samples showed levels of ACYP below the maximum residue limit (MRL) of 20 μg kg(-1) established for bovine milk (Commission Regulation (EU) No. 37/2010). The results demonstrate that there is minimal partitioning of ACYP into milk in lactating donkeys from pour-on treatment.

KONTRIBUSI HEWAN MAMALIA SAPI, KERBAU, KUDA, BABI DAN ANJING DALAM PENULARAN SCHISTOSOMIASIS DI KECAMATAN LINDU KABUPATEN SIGI PROPINSI SULAWESI TENGAH TAHUN 2013

Directory of Open Access Journals (Sweden)

Gunawan Gunawan

2015-01-01

Full Text Available AbstrakSchistosomiasis merupakan penyakit parasitik jaringan yang terabaikan. Schistosomiasis adalah penyakit parasitik yang bersifat zoonosis, selain menginfeksi manusia juga menginfeksi hewan mamalia lainnya. Ada 13 mamalia yang diketahui dapat terinfeksi oleh schistosomiasis antara lain sapi(Bos sundaicus, kerbau (Bubalus bubalis, kuda (Equus cabalus, anjing (Canis familiaris, babi (Sus sp, musang (Vivera tangalunga, rusa (Carvus timorensis, dan berbagai jenis tikus (Rattus exulans, R. hoffmani, R. chysomomusrallus, R. marmosurus, R norvegicus, R palallae. Di Indonesia schistosomiasis disebabkan oleh cacing Schistosoma japonicum dan hanya ditemukan endemik di Sulawesi Tengah yaitu di dataran tinggi Lindu, Napu dan Bada.Penelitian ini bertujuan untuk mengetahui kontribusi reservoir dalam penularan schistosomiasis di Kecamatan Lindu, Kabupaten Sigi, Propinsi Sulawesi Tengah. Metode penelitian ini adalah deskriptif observational dengan pendekatan cross sectional. Pengumpulan data primer dilakukan dengan mengobservasi mamalia yang berisiko,dengan pengambilan dan pemeriksaan sampel tinja hewan mamali tersebut. Sejumlah 219 sampel tinja hewan mamalia yang terdiri dari sapi, kerbau, anjing, babi dan kuda diperiksa dengan menggunakan metode sentrifugasi formalin-eter. Dari hasil pemeriksaan tinja yang dilakukan dilaboratorium Parasitologi Balai Litbang P2B2 Donggala sebanyak 54 sampel tinja hewan mamalia (sapi, kerbau, anjing, babi dan kuda positif terinfeksi S.japonicum.Kata kunci : Schistosomiasis, hewan mamalia, Schistosoma japonicumAbstractSchistosomiasis is one of neglected parasitic diseaseds and also a zoonosic disease, in addition to humans it also infect mammals. There were 13 known mammals that can be infected by schistosomiasis, i.e. cattle (Bos sundaicus, buffalo (Bubalus bubalis, horse (Equus Cabalus, dog (Canis familiaris, pig(Sus sp, civet cat(Vivera tangalunga, deer (Cervus timorensis, and various types of rat (Rattus exulans, R

Seasonal fluctuation of parasitic infestation in donkeys (Equus asinus in Oodi village, Kgatleng District, Botswana : short communication

Directory of Open Access Journals (Sweden)

E.Z. Mushi

2003-06-01

Full Text Available During the period March to September 2000, a study was conducted in Oodi village, Kgatleng District, Botswana, to investigate the seasonal fluctuation of internal, external and blood parasites of donkeys. Twelve adult donkeys were randomly selected from a farmer with a herd of 15 donkeys. Monthly visits were made to the farmer when the donkeys were examined for parasites. The only ectoparasites recovered from the donkeys were instars of various tick species. The most prevalent tick was Rhipicephalus evertsi evertsi (98.4 %, followed by Amblyomma hebraeum and Hyalomma species. The only haemoparasite seen on microscopy was Babesia equi at low parasitaemia in 26.8% of the donkeys. However, no clinical babesiosis was evident. Coprological examination showed the presence of strongyle eggs in moderate numbers. Very low numbers of coccidia oocysts were found in the faecal samples. High tick numbers and worm egg counts coincided with the warm, wet months in contrast to the low numbers recovered during the cold, dry months. An interview conducted by the authors indicated that donkeys were nutritionally marginalised by owners. Supplementary feeding was therefore recommended, especially during the winter months when grazing is poor.

Infertilidade associada a defeito microtubular dos espermatozóides de jumento (Equus asinus avaliados por microscopia eletrônica de transmissão Infertility associated with microtubular defect in a donkey (Equus asinus spermatozoa evaluated by transmission electron microscopy

Directory of Open Access Journals (Sweden)

André Maciel Crespilho

2006-10-01

Full Text Available Descreve-se um caso de infertilidade de um jumento SRD confirmada por meio de microscopia eletrônica de transmissão (MET. O espermiograma, avaliado sob microscopia ótica, revelou baixa motilidade e alta concentração de anormalidades espermáticas do tipo gota citoplasmática proximal. O material foi avaliado por MET, observando-se um acúmulo desordenado de microtúbulos causando protusões irregulares na região do colo espermático. O último teste realizado correspondeu ao de fertilidade in vivo, utilizando-se quatro éguas portadoras de bom histórico reprodutivo, nas quais não foi possível confirmar nenhuma prenhez. Frente aos resultados obtidos, associados aos achados da MET, estabeleceu-se o diagnóstico de infertilidade associada a defeito microtubular dos espermatozóides.A donkey infertility was described by transmission electron microscopy (MET. The spermiogram evaluated by light microscopy showed low sperm motility and high concentration of abnormal sperm with proximal cytoplasmic droplets. The material was evaluated by MET, where it was observed disarrangement of microtubules, causing irregular protrusions in the spermatic neck. The last test done was the in vivo fertility, using four mares, with a reproductive healthy historic, where no pregnancy occurred. Facing the results that we had in vivo, associated with the MET findings, we diagnosed infertility associated with microtubular defect of the spermatozoa.

A vegetation description and floristic analyses of the springs on the Kammanassie Mountain, Western Cape

Directory of Open Access Journals (Sweden)

G. Cleaver

2004-12-01

Full Text Available The Kammanassie Mountain is a declared mountain catchment area and a Cape mountain zebra Equus zebra zebra population is preserved on the mountain. The high number of springs on the mountain not only provides water for the animal species but also contributes to overall ecosystem functioning. Long-term conservation of viable ecosystems requires a broader understanding of the ecological processes involved. It was therefore decided that a classification, description and mapping of the spring vegetation of the Kammanassie Mountain be undertaken. A TWINSPAN classification, refined by Braun-Blanquet procedures, revealed 11 major plant communities that could be related to geological origin. Habitat factors associated with differences in vegetation include topography, soil type and grazing. Descriptions of the plant communities include diagnostic species as well as prominent and less conspicuous species of the tree, shrub and herbaceous layers. The results also indicate a high species richness compared to similar regions and the difference between plant communities of wet and dry springs. This data is important for long-term monitoring of the spring ecosystems as well as for the compilation of management plans.

Pattern of faecal 20-oxopregnane and oestrogen concentrations during pregnancy in wild plains zebra mares.

Science.gov (United States)

Ncube, Hlengisizwe; Duncan, Patrick; Grange, Sophie; Cameron, Elissa Z; Barnier, Florian; Ganswindt, Andre

2011-07-01

Regulative endocrine mechanisms influence the reproductive behaviour and success of mammals, but they have been studied predominantly in domestic and captive animals. The study aims at describing the pattern of faecal 20-oxopregnane and oestrogen concentrations during pregnancy in wild plains zebra Equus quagga chapmani. Data were collected during wet and dry seasons 2007-2009. Enzyme Immunoassays were used to determine 20-oxopregnane and oestrogen concentrations in faecal samples (n=74) collected from individual mares (n=32) whose dates of foaling were known through long-term monitoring. Hormonal profiles were described with a General Additive Model (GAM: Hormone ∼ Days to Foaling). Faecal 20-oxopregnanes have a complex cycle during pregnancy (GAM, n=70, R(2)=0.616, p200 ng/g DW) of faecal 20-oxopregnanes associated with high (>160 ng/g DW) faecal oestrogen levels indicate mid-pregnancy in c.90% of cases (16/17). High faecal 20-oxopregnanes (>200 ng/g DW) and low faecal oestrogen levels (<160 ng/g DW) indicate late pregnancy, again in c.90% of cases. Two faecal samples would allow the stage of pregnancy to be determined with confidence. Copyright © 2011 Elsevier Inc. All rights reserved.

Seasonal and demographic factors influencing gastrointestinal parasitism in ungulates of Etosha National Park.

Science.gov (United States)

Turner, Wendy C; Getz, Wayne M

2010-10-01

Host-parasite dynamics can be strongly affected by seasonality and age-related host immune responses. We investigated how observed variation in the prevalence and intensity of parasite egg or oocyst shedding in four co-occurring ungulate species may reflect underlying seasonal variation in transmission and host immunity. This study was conducted July 2005-October 2006 in Etosha National Park, Namibia, using indices of parasitism recorded from 1,022 fecal samples collected from plains zebra (Equus quagga), springbok (Antidorcas marsupialis), blue wildebeest (Connochaetes taurinus), and gemsbok (Oryx gazella). The presence and intensity of strongyle nematodes, Strongyloides spp. and Eimeria spp. parasites, were strongly seasonal for most host-parasite combinations, with more hosts infected in the wet season than the dry season. Strongyle intensity in zebra was significantly lower in juveniles than adults, and in springbok hosts, Eimeria spp. intensity was significantly greater in juveniles than adults. These results provide evidence that acquired immunity is less protective against strongyle nematodes than Eimeria spp. infections. The seasonal patterns in parasitism further indicate that the long dry season may limit development and survival of parasite stages in the environment and, as a result, host contact and parasite transmission.

Stable isotopes reveal diet shift from pre-extinction to reintroduced Przewalski's horses.

Science.gov (United States)

Kaczensky, Petra; Burnik Šturm, Martina; Sablin, Mikhail V; Voigt, Christian C; Smith, Steve; Ganbaatar, Oyunsaikhan; Balint, Boglarka; Walzer, Chris; Spasskaya, Natalia N

2017-07-20

The Przewalski's horse (Equus ferus przewalskii), the only remaining wild horse within the equid family, is one of only a handful of species worldwide that went extinct in the wild, was saved by captive breeding, and has been successfully returned to the wild. However, concerns remain that after multiple generations in captivity the ecology of the Przewalski's horse and / or the ecological conditions in its former range have changed in a way compromising the species' long term survival. We analyzed stable isotope chronologies from tail hair of pre-extinction and reintroduced Przewalski's horses from the Dzungarian Gobi and detected a clear difference in the isotopic dietary composition. The direction of the dietary shift from being a mixed feeder in winter and a grazer in summer in the past, to a year-round grazer nowadays, is best explained by a release from human hunting pressure. A changed, positive societal attitude towards the species allows reintroduced Przewalski's horses to utilize the scarce, grass-dominated pastures of the Gobi alongside local people and their livestock whereas their historic conspecifics were forced into less productive habitats dominated by browse.

First Blindness Cases of Horses Infected with Setaria Digitata (Nematoda: Filarioidea) in the Republic of Korea.

Science.gov (United States)

Shin, Jihun; Ahn, Kyu-Sung; Suh, Guk-Hyun; Kim, Ha-Jung; Jeong, Hak-Sub; Kim, Byung-Su; Choi, Eunsang; Shin, Sung-Shik

2017-12-01

Ocular setariases of cattle were reported but those of equine hosts have never been reported in the Republic of Korea (Korea). We found motile worms in the aqueous humor of 15 horses (Equus spp.) from 12 localities in southern parts of Korea between January 2004 and November 2017. After the affected animals were properly restrained under sedation and local anesthesia, 10 ml disposable syringe with a 16-gauge needle was inserted into the anterior chamber of the affected eye to successfully remove the parasites. The male worm that was found in 7 of the cases showed a pair of lateral appendages near the posterior terminal end of the body. The papillar arrangement was 3 pairs of precloacal, a pair of adcloacal, and 3 pairs of postcloacal papillae, plus a central papilla just in front of the cloaca. The female worms found in the eyes of 8 horses were characterized by the tapering posterior terminal end of the body with a smooth knob. Worms were all identified as Setaria digitata (von Linstow, 1906) by the morphologic characteristics using light and electron microscopic observations. This is the first blindness cases of 15 horses infected with S. digitata (Nematoda: Filarioidea) in Korea.

Biochemical Analysis of Synovial Fluid, Cerebrospinal Fluid and Vitreous Humor at Early Postmortem Intervals in Donkeys

Directory of Open Access Journals (Sweden)

Doha Yahia

2014-01-01

Full Text Available Biochemical analysis of body fluids after death is a helpful tool in veterinary forensic medicine. Synovial fluid, cerebrospinal fluid (CSF and vitreous humor are easily accessible and well preserved from contamination. Five donkeys (Equus africanus asinus aged 1 - 2 years old were subjected to the study. Samples (Synovial fluid, CSF and vitreous humor were collected before death (antimortem and then at 2, 4, 6, 8, 10 and 12 hours postmortem. Samples were analyzed for glucose, chloride, sodium, magnesium, potassium, enzymes and total protein. Synovial fluid analysis showed that glucose concentration started to decrease at 6 hours postmortem, while magnesium level increased with time. Other parameters were more stable. CSF analysis showed several changes related to time after death as the decrease in glucose and sodium levels, and the increased levels of potassium, magnesium, calcium and total protein. Vitreous analysis revealed a reduction in glucose level and increased potassium and magnesium concentrations. The present study concluded that biochemical analysis of synovial fluid, vitreous humor and CSF can help in determination of time since death in donkeys. This study recommend using CSF for determination of early post-mortem intervals.

Multidirectional cross-species painting illuminates the history of karyotypic evolution in Perissodactyla.

Science.gov (United States)

Trifonov, Vladimir A; Stanyon, Roscoe; Nesterenko, Anastasia I; Fu, Beiyuan; Perelman, Polina L; O'Brien, Patricia C M; Stone, Gary; Rubtsova, Nadezhda V; Houck, Marlys L; Robinson, Terence J; Ferguson-Smith, Malcolm A; Dobigny, Gauthier; Graphodatsky, Alexander S; Yang, Fengtang

2008-01-01

The order Perissodactyla, the group of odd-toed ungulates, includes three extant families: Equidae, Tapiridae, and Rhinocerotidae. The extremely rapid karyotypic diversification in perissodactyls has so far prevented the establishment of genome-wide homology maps between these three families by traditional cytogenetic approaches. Here we report the first genome-wide comparative chromosome maps of African rhinoceroses, four tapir species, four equine species, and humans. These maps were established by multidirectional chromosome painting, with paint probes derived from flow-sorted chromosomes of Equus grevyi, Tapirus indicus, and Ceratotherium simum as well as painting probes from horse and human. The Malayan tapir (Tapirus indicus), Baird's tapir (T. bairdii), mountain tapir (T. pinchaque), lowland tapir (T. terrestris), and onager (E. hemionus onager), were studied by cross-species chromosome painting for the first time. Our results, when integrated with previously published comparative chromosome maps of the other perissodactyl species, have enabled the reconstruction of perissodactyl, ceratomorph, and equid ancestral karyotypes, and the identification of the defining evolutionary chromosomal rearrangements along each lineage. Our results allow a more reliable estimate of the mode and tempo of evolutionary chromosomal rearrangements, revealing a striking switch between the slowly evolving ceratomorphs and extremely rapidly evolving equids.

Late Pleistocene ecological, environmental and climatic reconstruction based on megafauna stable isotopes from northwestern Chilean Patagonia

Science.gov (United States)

González-Guarda, Erwin; Domingo, Laura; Tornero, Carlos; Pino, Mario; Hernández Fernández, Manuel; Sevilla, Paloma; Villavicencio, Natalia; Agustí, Jordi

2017-08-01

Stable isotope analyses have been performed on the bioapatite (δ13C; δ18O) and collagen (δ13C; δ15N) of four late Pleistocene South American megafaunal taxa (Notiomastodon platensis, Equus andium, cf. Hemiauchenia paradoxa and Xenarthra indet.) to evaluate paleoclimatic and paleoenvironmental conditions as well as paleoecological features of this time period. The analyzed megafauna was found at several locations in the northwestern Chilean Patagonia (38°-42°S, 74°-71°W). The bioapatite δ13C values indicated the presence of C3 vegetation ranging from forestal to woodland areas. The collagen δ15N values pointed to temperate and humid ecosystems, and to the consumption of shrubs, trees, grasses and sedges. Mean annual temperatures estimated from bioapatite δ18OPO4 values show a similarity to modern temperatures and suggested that the megafauna under study may have lived during warm stages (interstadials) of the late Pleistocene. When comparing our results with those obtained from other South American regions, we find that the diet of this particular Chilean megafauna appears to have been more influenced by resource availability than by the potential dietary range of the taxa.

ANATOMIA ÓSSEA E MUSCULAR DO CÍNGULO ESCAPULAR E BRAÇO DE Tapirus terrestris (PERISSODACTYLA: TAPIRIDAE

Directory of Open Access Journals (Sweden)

Saulo Gonçalves Pereira

2015-04-01

Full Text Available Tapirus terrestris (Linneaus, 1758 is a mammal found in South America and in almost all Brazilian biomes. The aim of this study was to describe the anatomy of bone and muscle of the scapular cingulum and arm of Tapirus terrestris and compare it with other species of mammals, especially equines. We used four animals donated to the Laboratory of Education and Research of Wild Animals of the Federal University of Uberlândia, after their death with no trauma. The bones were carefully analyzed, described and the muscles were dissected, analyzed and described in accordance with the usual techniques of gross anatomy. The skeleton of the scapular cingulum and arm of Tapirus terrestris is formed by scapula and humerus bones, the lateral muscles of the scapula are subclavian m., deltoid m. supraspinatus m. and infraspinatus, teres minor m., subscapularis m., teres major m., coracobrachialis m., shoulder joint m., biceps brachii m., brachial m. triceps, forearm tensor fasciae m., anconeus m. The muscular and bone standard found is similar to the horse (Equus caballus T. terrestris has bone and muscle characteristics of a suitable animal to displacement and eventual swimming with obvious bone accidents and developed muscles .

Evaluating the impact of domestication and captivity on the horse gut microbiome.

Science.gov (United States)

Metcalf, Jessica L; Song, Se Jin; Morton, James T; Weiss, Sophie; Seguin-Orlando, Andaine; Joly, Frédéric; Feh, Claudia; Taberlet, Pierre; Coissac, Eric; Amir, Amnon; Willerslev, Eske; Knight, Rob; McKenzie, Valerie; Orlando, Ludovic

2017-11-14

The mammal gut microbiome, which includes host microbes and their respective genes, is now recognized as an essential second genome that provides critical functions to the host. In humans, studies have revealed that lifestyle strongly influences the composition and diversity of the gastrointestinal microbiome. We hypothesized that these trends in humans may be paralleled in mammals subjected to anthropogenic forces such as domestication and captivity, in which diets and natural life histories are often greatly modified. We investigated fecal microbiomes of Przewalski's horse (PH; Equus ferus przewalskii), the only horses alive today not successfully domesticated by humans, and herded, domestic horse (E. f. caballus) living in adjacent natural grasslands. We discovered PH fecal microbiomes hosted a distinct and more diverse community of bacteria compared to domestic horses, which is likely partly explained by different plant diets as revealed by trnL maker data. Within the PH population, four individuals were born in captivity in European zoos and hosted a strikingly low diversity of fecal microbiota compared to individuals born in natural reserves in France and Mongolia. These results suggest that anthropogenic forces can dramatically reshape equid gastrointestinal microbiomes, which has broader implications for the conservation management of endangered mammals.

Tafonomia del yacimiento de vertebrados pleistoceno de Huéscar-1 (Granada, españa

Directory of Open Access Journals (Sweden)

Alberdi, M. T.

2003-08-01

Full Text Available This work analyses the sedimentary and taphonomic processes that induced the selective preservation and spatial distribution of Húescar-1 bone assemblage (early Galerian. The bone fossil remains are associated with an alluvial fan system that flowed into a lacustrine area with calcareous sedimentation. The fossils show numerous scratch and abrasion marks produced during their transportation as channel lag. The remains appear in three sedimentological settings: in paleochannel filling-up sequences, in pockets built at the outlet of the channels in the lacustrine area, and scattered within calcareous silts. Nevertheless, most of them are found in the second instante. The cumulative process was attritional as pointed out by the mortality profiles of Equus altidens and could be explained by selective predation and/or seasonal bone accumulation. The notably small number of artiodactyl species, particularly in the typical foms of bush or forest habitats and the presence of amphibious forms (Hippopotamus are indicative of an open grassland habitat. The aquatic birds represent the autochthonous component of the association. For each bone recovered severa1 variables were measured, the data obtained underwent graphic and statistical treatment that provided useful information for the site taphonomic interpretation.Se estudia el conjunto de procesos sedimentarios y rasgos tafonómicos que condicionaron la preservación selectiva y disposición espacial de los restos de vertebrados que forman el yacimiento de edad Galeriense inferior de Huéscar-l. Los restos óseos están asociados a un sistema de abanicos aluviales que desembocaba en una zona lacustre carbonatada amplia. Es un conjunto transportado donde los restos muestran numerosas señales de abrasión y arrastre. Los restos óseos aparecen en tres situaciones sedimentológicas: carga de fondo en el relleno de los paleocanales, bolsadas formadas en el punto de la desembocadura y dispersos espor

Urinary androgen concentrations and social status in two species of free ranging zebra (Equus burchelli and E. grevyi).

Science.gov (United States)

Chaudhuri, M; Ginsberg, J R

1990-01-01

In both species of zebra, breeding males had higher urinary androgen concentrations (ng androgens/mg Cr) than did non-breeding bachelor males (30.0 +/- 5.0 (N = 9) versus 11.4 +/- 2.8, (N = 7) in the plains zebra; 19.0 +/- 2.2 (N = 17) versus 10.7 +/- 1.2 (N = 14) in the Grevy's zebra). In the more stable family structure of the plains zebra (single male non-territorial groups) variations in androgen concentrations could not be ascribed to any measured variable. In the Grevy's zebra, androgen values were significantly lower in samples taken from territorial (breeding) males which had temporarily abandoned their territories (N = 4) and the urinary androgen concentration for a male on his territory was negatively correlated with the time since females last visited the territory.

Dimensions of temperament modulate cue-controlled behavior: a study on Pavlovian to instrumental transfer in horses (Equus caballus.

Directory of Open Access Journals (Sweden)

Léa Lansade

Full Text Available Pavlovian to instrumental transfer (PIT is a central factor in how cues influence animal behavior. PIT refers to the capacity of a Pavlovian cue that predicts a reward to elicit or increase a response intended to obtain the same reward. In the present study, using an equine model, we assessed whether PIT occurs in hoofed domestic animals and whether its efficacy can be modulated by temperamental dimensions. To study PIT, horses were submitted to Pavlovian conditioning whereby an auditory-visual stimulus was repeatedly followed by food delivery. Then, horses were submitted to instrumental conditioning during which they learned to touch with their noses an object signaled by the experimenter in order to obtain the same reward. During the PIT test, the Pavlovian conditioned stimulus was presented to the animal in the absence of reward. At the end of the experiment, a battery of behavioral tests was performed on all animals to assess five temperamental dimensions and investigate their relationships with instrumental performance. The results indicate that PIT can be observed in horses and that its efficacy is greatly modulated by individual temperament. Indeed, individuals with a specific pattern of temperamental dimensions (i.e., higher levels of gregariousness, fearfulness, and sensory sensitivity exhibited the strongest PIT. The demonstration of the existence of PIT in domesticated animals (i.e., horses is important for the optimization of its use by humans and the improvement of training methods. Moreover, because PIT may be implicated in psychological phenomena, including addictive behaviors, the observation of relationships between specific temperamental dimensions and PIT efficacy may aid in identifying predisposing temperamental attributes.

Evaluation of cardiorespiratory and biochemical effects of ketamine-propofol and guaifenesin-ketamine-xylazine anesthesia in donkeys (Equus asinus).

Science.gov (United States)

Molinaro Coelho, Cássia M; Duque Moreno, Juan C; Goulart, Daniel da S; Caetano, Leandro B; Soares, Lorena K; Coutinho, Gustavo H; Alves, Geraldo Es; da Silva, Luiz Antonio F

2014-11-01

To evaluate the cardiorespiratory and biochemical effects of ketamine-propofol (KP) or guaifenesin-ketamine-xylazine (GKX) anesthesia in donkeys. Prospective crossover trial. Eight healthy, standard donkeys, aged 10 ± 5 years and weighing 153 ± 23 kg. Donkeys were premedicated with 1.0 mg kg(-1) of xylazine (IV) in both treatments. Eight donkeys were administered ketamine (1.5 mg kg(-1)) and propofol (0.5 mg kg(-1) for induction, and anesthesia was maintained by constant rate infusion (CRI) of ketamine (0.05 mg kg(-1) minute(-1)) and propofol (0.15 mg kg(-1) minute(-1)) in the KP treatment. After 10 days, diazepam (0.05 mg kg(-1)) and ketamine (2.2 mg kg(-1)) were administered for induction, and anesthesia was maintained by a CRI (2.0 mL kg(-1) hour(-1)) of ketamine (2.0 mg mL(-1), xylazine (0.5 mg mL(-1)) and guaifenesin (50 mg mL(-1)) solution. Quality of anesthesia was assessed along with cardiorespiratory and biochemical measurements. Anesthetic induction took longer in GKX than in KP. The induction was considered good in 7/8 with KP and in 6/8 in GKX. Anesthetic recovery was classified as good in 7/8 animals in both treatments. Xylazine administration decreased heart rate (HR) in both treatments, but in KP the HR increased and was higher than GKX throughout the anesthetic period. Respiratory rate was higher in GKX than in KP. PaO(2) decreased significantly in both groups during the anesthetic period. Glucose concentrations [GLU] increased and rectal temperature and PCV decreased in both treatments. Arterial lactate [LAC] increased at recovery compared with all time points in KP. [GLU] and calcium were higher in GKX than in KP at recovery. These protocols induced significant hypoxemia but no other cardiorespiratory or metabolic changes. These protocols could be used to maintain anesthesia in donkeys, however, they were not tested in animals undergoing surgery. © 2014 Association of Veterinary Anaesthetists and the American College of Veterinary Anesthesia and Analgesia.

Detection and genotyping of Toxoplasma gondii DNA in the blood and milk of naturally infected donkeys (Equus asinus).

Science.gov (United States)

Mancianti, Francesca; Nardoni, Simona; Papini, Roberto; Mugnaini, Linda; Martini, Mina; Altomonte, Iolanda; Salari, Federica; D'Ascenzi, Carlo; Dubey, Jitender P

2014-04-03

Toxoplasma gondii is a worldwide zoonotic protozoan. Consumption of raw milk from infected animals is considered a risk factor for acquiring toxoplasmosis in humans. Recently, donkey milk has been indicated for therapeutic and nutritional purposes and T. gondii infection is common in donkeys. The purpose of the present paper was to detect the presence of parasite DNA in milk of T. gondii positive donkeys. Antibodies to T. gondii were found in 11 out of 44 healthy lactating donkeys by IFAT. T. gondii DNA was detected by PCR in blood of 6 and milk of 3 seropositive jennies. Results of limited RFLP-PCR genotyping indicated the presence of T. gondii genotype II or III, commonly found in Europe. The occurrence of T. gondii DNA in milk suggests that the consumption of raw milk from seropositive donkeys could be a potential source of human infection.

Cryptic etiopathological conditions of equine nervous system with special emphasis on viral diseases

Directory of Open Access Journals (Sweden)

Rakesh Kumar

2017-12-01

Full Text Available The importance of horse (Equus caballus to equine practitioners and researchers cannot be ignored. An unevenly distributed population of equids harbors numerous diseases, which can affect horses of any age and breed. Among these, the affections of nervous system are potent reason for death and euthanasia in equids. Many episodes associated with the emergence of equine encephalitic conditions have also pose a threat to human population as well, which signifies their pathogenic zoonotic potential. Intensification of most of the arboviruses is associated with sophisticated interaction between vectors and hosts, which supports their transmission. The alphaviruses, bunyaviruses, and flaviviruses are the major implicated groups of viruses involved with equines/humans epizootic/epidemic. In recent years, many outbreaks of deadly zoonotic diseases such as Nipah virus, Hendra virus, and Japanese encephalitis in many parts of the globe addresses their alarming significance. The equine encephalitic viruses differ in their global distribution, transmission and main vector species involved, as discussed in this article. The current review summarizes the status, pathogenesis, pathology, and impact of equine neuro-invasive conditions of viral origin. A greater understanding of these aspects might be able to provide development of advances in neuro-protective strategies in equine population.

Variation in faecal water content may confound estimates of gastro-intestinal parasite intensity in wild African herbivores.

Science.gov (United States)

Turner, W C; Cizauskas, C A; Getz, W M

2010-03-01

Estimates of parasite intensity within host populations are essential for many studies of host-parasite relationships. Here we evaluated the seasonal, age- and sex-related variability in faecal water content for two wild ungulate species, springbok (Antidorcas marsupialis) and plains zebra (Equus quagga). We then assessed whether or not faecal water content biased conclusions regarding differences in strongyle infection rates by season, age or sex. There was evidence of significant variation in faecal water content by season and age for both species, and by sex in springbok. Analyses of faecal egg counts demonstrated that sex was a near-significant factor in explaining variation in strongyle parasite infection rates in zebra (P = 0.055) and springbok (P = 0.052) using wet-weight faecal samples. However, once these intensity estimates were re-scaled by the percent of dry matter in the faeces, sex was no longer a significant factor (zebra, P = 0.268; springbok, P = 0.234). These results demonstrate that variation in faecal water content may confound analyses and could produce spurious conclusions, as was the case with host sex as a factor in the analysis. We thus recommend that researchers assess whether water variation could be a confounding factor when designing and performing research using faecal indices of parasite intensity.

Population genetic diversity and hybrid detection in captive zebras.

Science.gov (United States)

Ito, Hideyuki; Langenhorst, Tanya; Ogden, Rob; Inoue-Murayama, Miho

2015-08-21

Zebras are members of the horse family. There are three species of zebras: the plains zebra Equus quagga, the Grevy's zebra E. grevyi and the mountain zebra E. zebra. The Grevy's zebra and the mountain zebra are endangered, and hybridization between the Grevy's zebra and the plains zebra has been documented, leading to a requirement for conservation genetic management within and between the species. We characterized 28 microsatellite markers in Grevy's zebra and assessed cross-amplification in plains zebra and two of its subspecies, as well as mountain zebra. A range of standard indices were employed to examine population genetic diversity and hybrid populations between Grevy's and plains zebra were simulated to investigate subspecies and hybrid detection. Microsatellite marker polymorphism was conserved across species with sufficient variation to enable individual identification in all populations. Comparative diversity estimates indicated greater genetic variation in plains zebra and its subspecies than Grevy's zebra, despite potential ascertainment bias. Species and subspecies differentiation were clearly demonstrated and F1 and F2 hybrids were correctly identified. These findings provide insights into captive population genetic diversity in zebras and support the use of these markers for identifying hybrids, including the known hybrid issue in the endangered Grevy's zebra.

Diet quality in a wild grazer declines under the threat of an ambush predator.

Science.gov (United States)

Barnier, Florian; Valeix, Marion; Duncan, Patrick; Chamaillé-Jammes, Simon; Barre, Philippe; Loveridge, Andrew J; Macdonald, David W; Fritz, Hervé

2014-06-22

Predators influence prey populations not only through predation itself, but also indirectly through prompting changes in prey behaviour. The behavioural adjustments of prey to predation risk may carry nutritional costs, but this has seldom been studied in the wild in large mammals. Here, we studied the effects of an ambush predator, the African lion (Panthera leo), on the diet quality of plains zebras (Equus quagga) in Hwange National Park, Zimbabwe. We combined information on movements of both prey and predators, using GPS data, and measurements of faecal crude protein, an index of diet quality in the prey. Zebras which had been in close proximity to lions had a lower quality diet, showing that adjustments in behaviour when lions are within short distance carry nutritional costs. The ultimate fitness cost will depend on the frequency of predator-prey encounters and on whether bottom-up or top-down forces are more important in the prey population. Our finding is the first attempt to our knowledge to assess nutritionally mediated risk effects in a large mammalian prey species under the threat of an ambush predator, and brings support to the hypothesis that the behavioural effects of predation induce important risk effects on prey populations.

The effects of age, rank and neophobia on social learning in horses.

Science.gov (United States)

Krueger, Konstanze; Farmer, Kate; Heinze, Jürgen

2014-05-01

Social learning is said to meet the demands of complex environments in which individuals compete over resources and cooperate to share resources. Horses (Equus caballus) were thought to lack social learning skills because they feed on homogenously distributed resources with few reasons for conflict. However, the horse's social environment is complex, which raises the possibility that its capacity for social transfer of feeding behaviour has been underestimated. We conducted a social learning experiment using 30 socially kept horses of different ages. Five horses, one from each group, were chosen as demonstrators, and the remaining 25 horses were designated observers. Observers from each group were allowed to watch their group demonstrator opening a feeding apparatus. We found that young, low-ranking and more exploratory horses learned by observing older members of their own group, and the older the horse, the more slowly it appeared to learn. Social learning may be an adaptive specialisation to the social environment. Older animals may avoid the potential costs of acquiring complex and potentially disadvantageous feeding behaviours from younger group members. We argue that horses show social learning in the context of their social ecology and that research procedures must take such contexts into account. Misconceptions about the horse's sociality may have hampered earlier studies.

The brain of the horse: weight and cephalization quotients.

Science.gov (United States)

Cozzi, Bruno; Povinelli, Michele; Ballarin, Cristina; Granato, Alberto

2014-01-01

The horse is a common domestic animal whose anatomy has been studied since the XVI century. However, a modern neuroanatomy of this species does not exist and most of the data utilized in textbooks and reviews derive from single specimens or relatively old literature. Here, we report information on the brain of Equus caballus obtained by sampling 131 horses, including brain weight (as a whole and subdivided into its constituents), encephalization quotient (EQ), and cerebellar quotient (CQ), and comparisons with what is known about other relevant species. The mean weight of the fresh brains in our experimental series was 598.63 g (SEM ± 7.65), with a mean body weight of 514.12 kg (SEM ± 15.42). The EQ was 0.78 and the CQ was 0.841. The data we obtained indicate that the horse possesses a large, convoluted brain, with a weight similar to that of other hoofed species of like mass. However, the shape of the brain, the noteworthy folding of the neocortex, and the peculiar longitudinal distribution of the gyri suggest an evolutionary specificity at least partially separate from that of the Cetartiodactyla (even-toed mammals and cetaceans) with whom Perissodactyla (odd-toed mammals) are often grouped.

Analysis of the 227 bp short interspersed nuclear element (SINE insertion of the promoter of the myostatin (MSTN gene in different horse breeds

Directory of Open Access Journals (Sweden)

Stefania Dall'Olio

2014-09-01

Full Text Available The myostatin (MSTN gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic. The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81 and in the Thoroughbred (0.51, whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

Analysis of the 227 bp short interspersed nuclear element (SINE) insertion of the promoter of the myostatin (MSTN) gene in different horse breeds.

Science.gov (United States)

Dall'Olio, Stefania; Scotti, Emilio; Fontanesi, Luca; Tassinari, Marco

2014-01-01

The myostatin (MSTN) gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus) MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE) insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs) generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot) and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81) and in the Thoroughbred (0.51), whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.

Peeling back the evolutionary layers of molecular mechanisms responsive to exercise-stress in the skeletal muscle of the racing horse.

Science.gov (United States)

Kim, Hyeongmin; Lee, Taeheon; Park, Woncheoul; Lee, Jin Woo; Kim, Jaemin; Lee, Bo-Young; Ahn, Hyeonju; Moon, Sunjin; Cho, Seoae; Do, Kyoung-Tag; Kim, Heui-Soo; Lee, Hak-Kyo; Lee, Chang-Kyu; Kong, Hong-Sik; Yang, Young-Mok; Park, Jongsun; Kim, Hak-Min; Kim, Byung Chul; Hwang, Seungwoo; Bhak, Jong; Burt, Dave; Park, Kyoung-Do; Cho, Byung-Wook; Kim, Heebal

2013-06-01

The modern horse (Equus caballus) is the product of over 50 million yrs of evolution. The athletic abilities of the horse have been enhanced during the past 6000 yrs under domestication. Therefore, the horse serves as a valuable model to understand the physiology and molecular mechanisms of adaptive responses to exercise. The structure and function of skeletal muscle show remarkable plasticity to the physical and metabolic challenges following exercise. Here, we reveal an evolutionary layer of responsiveness to exercise-stress in the skeletal muscle of the racing horse. We analysed differentially expressed genes and their co-expression networks in a large-scale RNA-sequence dataset comparing expression before and after exercise. By estimating genome-wide dN/dS ratios using six mammalian genomes, and FST and iHS using re-sequencing data derived from 20 horses, we were able to peel back the evolutionary layers of adaptations to exercise-stress in the horse. We found that the oldest and thickest layer (dN/dS) consists of system-wide tissue and organ adaptations. We further find that, during the period of horse domestication, the older layer (FST) is mainly responsible for adaptations to inflammation and energy metabolism, and the most recent layer (iHS) for neurological system process, cell adhesion, and proteolysis.

Systemic infection by equid herpesvirus-1 in a Grevy's zebra stallion (Equus grevyi) with particular reference to genital pathology.

Science.gov (United States)

Blunden, A S; Smith, K C; Whitwell, K E; Dunn, K A

1998-11-01

A severe multi-systemic form of equid herpesvirus-1 infection is described in an adult zebra stallion. There was multifocal necrotizing rhinitis, marked hydrothorax and pulmonary oedema, with viral antigen expression in degenerating epithelial cells, local endothelial cells and intravascular leucocytes of the nasal mucosa and lung. Specific localization of EHV-1 infection was seen in the testes and epididymides, including infection of Leydig cells and germinal epithelium, which would have facilitated venereal shedding of virus in life. The case provided a unique opportunity to study hitherto undescribed aspects of the pathogenesis of naturally occurring EHV-1 infection in the male equine genital tract. Restriction digests of the isolate demonstrated a pattern similar to that of EHV-1 isolates previously recovered from aborted zebra and onager fetuses.

Adding injury to infection: The relationship between injury status and genetic diversity of Theileria infecting plains zebra, Equus quagga.

Science.gov (United States)

King'ori, Edward M; Obanda, Vincent; Ndambiri, Ephantus M; Runo, Steven M; Chiyo, Patrick I

2018-03-01

Asymptomatic tick-borne infections are a common feature in wild herbivores. In human-dominated habitats, snare injuries to wild herbivores are common and are likely to co-occur with enzootic infections. The influence of injury on pattern, course and outcome of enzootic infection in wild herbivores is unknown. We identified Theileria species infecting zebra and assessed the relationship between host injury-status and parasitaemia, parasite diversity and selection regimes. We also determined host leucocyte differential as this can reveal mechanisms by which injuries influence infections. Theileria infecting zebra was identified using PCR and sequencing of the V4 region of the 18 s rRNA gene and confirmed with phylogenetic analyses. The influence of injury status on parasite infection patterns, genetic diversity and selection were assessed using population genetic tools. Parasitaemia estimated from prevalence and leucocyte differential were determined from microscopic examination of Giemsa stained thin blood smears. Phylogenetic and sequence analyses revealed that the zebra population studied was infected with three Theileria equi haplotypes. Parasitaemia was lower among injured compared to non-injured animals and lower during dry than wet season. Mean (±SD) genetic diversity was 0.386 (±0.128) in injured and 0.513 (±0.144) in non-injured zebra (P = .549). Neutrality tests indicated that T. equi is under strong purifying selection in injured females (Li & Fu's D* = -2.037) and demographic expansion in all zebra during the wet season (Tajima D = -1.904). Injured zebras had a higher median per cent of neutrophils (64% vs 37%) a lower median per cent of basophils (0% vs 1%) and eosinophils (2% vs 4.5%) than non-injured animals, suggesting a heightened immune response and a shift from a Th2 to Th1 T-Cell response favoring the elimination of intracellular parasites in injured animals. This study demonstrates the utility of population genetics in revealing factors influencing parasite diversity and infection patterns. Copyright © 2018 Elsevier B.V. All rights reserved.

Determination of reference values for intraocular pressure and Schirmer tear test results in clinically normal domestic donkeys (Equus asinus).

Science.gov (United States)

Selk Ghaffari, Masoud; Sabzevari, Amin; Ghamsari, SeyedMehdi; Shad, Hussein

2017-11-25

This study was conducted to establish normal reference range for the Schirmer tear test (STT) and intraocular pressure (IOP) in clinically normal donkeys for use in clinical practice. Sixteen adult Ethiopian domestic donkeys were used in this study. Complete ophthalmic examinations were performed without chemical restraint. STT values were evaluated in both eyes of all donkeys using a commercial STT strip. IOP was measured in both eyes with a Tono-Pen Vet (Reichert. USA) without using regional nerve blocks. STT values for all eyes (n=32) were 22.1±6.9 mm/minute with a range of 13-35 mm/minute. Comparison of mean STT values between right (n=16) and left eyes (n=16) showed no differences (P=0.6). Mean ±sd IOP values by applanation tonometry were 17.8±3.7 mmHg (range 13.5-24.5 mmHg). Comparison of mean IOP values between right (n=16) and left eyes (n=16) showed no differences (P=0.7). This initial survey provides means and ranges for IOP and STT values in donkeys. These data will assist veterinary ophthalmologists in more accurate diagnosis and management of ophthalmic diseases in donkeys, including keratoconjunctivitis sicca and glaucoma. © British Veterinary Association (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

Comparative analgesic and sedative effects of tramadol, tramadol-lidocaine and lidocaine for caudal epidural analgesia in donkeys (Equus asinus).

Science.gov (United States)

Marzok, Mohamed A; El-khodery, Sabry A

2015-03-01

To compare anti-nociceptive and sedative effects of tramadol, a combination of tramadol-lidocaine, and lidocaine alone for perineal analgesia in donkeys. Experimental 'blinded' randomized cross-over study. Six healthy adult donkeys. Treatments were tramadol (TR) (1.0 mg kg(-1) ), tramadol-lidocaine (TRLD) (0.5 and 0.2 mg kg(-1) respectively) and lidocaine (LD) (0.4 mg kg(-1) ) given into the epidural space. The volume of all treatments was 0.02 mL kg(-1) . Nociception was tested at the perineal region by pin prick, followed, if no reaction, by pressure from a haemostat clamp. Times to onset, degree and duration of anti-nociception of the perineal region were recorded. Response was tested immediately after drug administration and at: 2, 5, 10, 15, 30, 45, and 60 minutes post-administration and then at 30 minute intervals thereafter until a response re-occurred. Physiologic data and degree of sedation and ataxia were recorded pre-administration and at intervals for 240 minutes post-administration. Results were analyzed using anova, Kruskal-Wallis tests, and Wilks' Lambda test as relevant. Significance was taken as p donkeys. © 2014 Association of Veterinary Anaesthetists and the American College of Veterinary Anesthesia and Analgesia.

Capture and Anaesthesia of Wild Mongolian Equids – the Przewalski’s Horse ( Equus ferus przewalskii and Khulan ( E. hemionus

Directory of Open Access Journals (Sweden)

Chris Walzer

2006-06-01

Full Text Available Science-based conservation efforts in general, and wide-ranging equid conservation speci fi cally, of- ten require capture and subsequent handling of the subject animal. Safe and animal-welfare appropriate wild equid capture and anaesthesia is a complex operation necessitating a multitude of skills that require appropriate veterinary training. The agent of choice for wild equid capture and anaesthesia is the potent opiate ethorphine in combination with speci fi c opiate antagonists that allow for the complete reversal of the anaesthetic effects. The recommended dosage for a healthy, wild adult Przewalski’s horse is 2.5- 3.0 mg ethorphine, 10 mg of the alpha2-agonist detomidine and 10 mg of the opioid agonist-antagonist butorphanol. In Przewalski’s horses ethorphine is reversed with the opioid antagonist naltrexone (200 mg. In khulan procedures anaesthesia was induced with a combination of 4.4 mg Ethorphine, 10 mg Detomidine and 10 mg Buthorphanol. Anaesthesia was reversed with the opioid antagonist-agonist di- prenorphine or a combination of 200 mg naltrexone and the alpha2-antagonist 20 mg atipamezole. All equids were standing and alert approximately two minutes following administration of the antagonists.

Sulfate influx on band 3 protein of equine erythrocyte membrane (Equus caballus) using different experimental temperatures and buffer solutions.

Science.gov (United States)

Casella, S; Piccione, D; Ielati, S; Bocchino, E G; Piccione, G

2013-06-01

The aim of this study was to assess the anion transport in equine erythrocytes through the measurement of the sulfate uptake operating from band 3 using different experimental temperatures and buffer solutions. Blood samples of six clinically healthy horses were collected via jugular vein puncture, and an emochrome-citometric examination was performed. The blood was divided into four aliquots and by centrifugation and aspiration the plasma and buffy coat were carefully discarded. The red blood cells were washed with an isosmotic medium and centrifuged. The obtained cell suspensions were incubated with two different experimental buffer solutions (buffer A: 115 mM Na2SO4, 10 mM NaCl, 20 mM ethylenediaminetetraacetic acid, 30 mM glucose; and buffer B: 115 mM Na2SO4, 10 mM NaCl, 20 mM ethylenediaminetetraacetic acid, 30 mM MgCl2) in a water bath for 1 h at 25 °C and 37 °C. Normal erythrocytes, suspended at 3% hematocrit, were used to measure the SO4= influx by absorption spectrophotometry at 425 nm wavelength. Unpaired Student's t-test showed a statistically significant decrease (P buffer solutions. Comparing the buffer A with buffer B unpaired Student's t-test showed statistically lower values (P < 0.0001) for A solution versus B solution both at 25 °C and at 37 °C. The greater inhibition of SO4 (=) influx measured in equine erythrocytes indicates the increased formation of the sulfydryl bonds in band 3 and the modulation of the sulfydryl groups, culminating in the conformational changes in band 3. Copyright © 2012 John Wiley & Sons, Ltd.

Historical notes on the Quagga [Equus quagga Gmelin, 1788; Mammalia, Perissodactyla], comprising some remarks on Buffon-editions published in Holland

NARCIS (Netherlands)

Tuijn, P.

1966-01-01

As our knowledge of extinct mammals is rather poor, is seems worthwhile to publish the following notes on the Quagga. Mr. Haga was so kind as to call my attention to the 6 volumes of bound watercolour-drawings in the Print Room at the Rijksmuseum in Amsterdam known as the Gordon-Atlas. It consists

Predictors and risk factors for the intestinal shedding of Escherichia coli O157 among working donkeys (Equus asinus) in Nigeria

Science.gov (United States)

Jedial, Jesse T.; Shittu, Aminu; Tambuwal, Faruk M.; Abubakar, Mikail B.; Garba, Muhammed K.; Kwaga, Jacob P.; Fasina, Folorunso O.

2015-01-01

Objectives Escherichia coli are an important group of bacteria in the normal gastrointestinal system but can sometimes cause infections in domestic animals and man. Donkeys are routinely used as multipurpose animal but details of burdens of potentially infectious bacteria associated with it are limited. The prevalence and associations between intestinal shedding of E. coli O157 and animal characteristics and management factors were studied among 240 randomly selected working donkeys in north-western Nigeria. Design Four local government areas, of Sokoto State in north-western Nigeria were recruited in this study. A multistage randomised cluster design was used to select subjects and donkey owners within selected zones. Confirmation of infection was based on bacterial culture, isolation and biochemical test for E. coli O157 from faecal samples. Results Of the total bacteria isolated, 203 of the 329 (61.70 per cent) were E. coli, 76 of which was E. coli serotype O157. A multivariable logistic regression model was used to examine the relation between intestinal shedding of E. coli O157 and selected variables. The analysis yielded five potential predictors of shedding: soft faeces in donkeys, Akaza and Fari ecotypes of donkey were positive predictors while maize straw as feed and sampling during the cold dry period were negative predictors. Conclusions This study concludes that controlling intestinal shedding of E. coli O157 among working donkeys in Nigeria is possible using the identified predictors in planning appropriate interventions to reduced human risk of infection. PMID:26392892

Diagnostic value of computed tomography, radiography and ultrasonography in metacarpophalangeal joint disorders in horses

Directory of Open Access Journals (Sweden)

V.M.V. Machado

2016-02-01

Full Text Available In modern society the work and athletic performance of horses has led to a very important animal production sector in which Brazil possesses the third largest horse stock. Among all equine lesions described, metacarpophalangeal (fetlock joint lesions are considered one of the main causes of lameness. Consequently, there is a need to improve the understanding and diagnosis of these injuries. The most efficient imaging diagnostic methods for the fetlock region are computed tomography, radiography and ultrasound. Imaging studies of the anatomical structures involving this joint are extremely important to obtain a more precise diagnose. The present study was performed in order to evaluate the capacity of different imaging diagnostic modalities to detect a variety of lesions in different fetlock structures. Twenty horses (Equus caballus used for horsemanship activities were referred to the Department of Animal Reproduction and Veterinary Radiology of São Paulo State University, Botucatu campus, with clinical signs of metacarpophalangeal joint injuries. Horses were submitted to radiographic and ultrasonographic exam and computed tomography scan. Image analysis revealed a significant capacity of these methods to characterize lesions in this region. However, computed tomography provided broader and better evaluation of lesions in bones and adjacent structures, because it allows the analysis to be performed on three-dimensional projections, with attenuation coefficients (window selections and tissue density measurement through Hounsfield Units (HU.

Fatal attraction: vegetation responses to nutrient inputs attract herbivores to infectious anthrax carcass sites.

Science.gov (United States)

Turner, Wendy C; Kausrud, Kyrre L; Krishnappa, Yathin S; Cromsigt, Joris P G M; Ganz, Holly H; Mapaure, Isaac; Cloete, Claudine C; Havarua, Zepee; Küsters, Martina; Getz, Wayne M; Stenseth, Nils Chr

2014-11-22

Parasites can shape the foraging behaviour of their hosts through cues indicating risk of infection. When cues for risk co-occur with desired traits such as forage quality, individuals face a trade-off between nutrient acquisition and parasite exposure. We evaluated how this trade-off may influence disease transmission in a 3-year experimental study of anthrax in a guild of mammalian herbivores in Etosha National Park, Namibia. At plains zebra (Equus quagga) carcass sites we assessed (i) carcass nutrient effects on soils and grasses, (ii) concentrations of Bacillus anthracis (BA) on grasses and in soils, and (iii) herbivore grazing behaviour, compared with control sites, using motion-sensing camera traps. We found that carcass-mediated nutrient pulses improved soil and vegetation, and that BA is found on grasses up to 2 years after death. Host foraging responses to carcass sites shifted from avoidance to attraction, and ultimately to no preference, with the strength and duration of these behavioural responses varying among herbivore species. Our results demonstrate that animal carcasses alter the environment and attract grazing hosts to parasite aggregations. This attraction may enhance transmission rates, suggesting that hosts are limited in their ability to trade off nutrient intake with parasite avoidance when relying on indirect cues. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

Systemic equid alphaherpesvirus 9 in a Grant's zebra.

Science.gov (United States)

Moeller, Robert B; Crossley, Beate; Pipkin, Arlena; Li, Yanqiu; Balasuriya, Udeni B R

2018-04-01

A 2-y-old female Grant's zebra ( Equus quagga [ burchellii] boehmi) was presented with a clinical history of depression, anorexia, and weakness of 1-wk duration. Postmortem examination identified ulcers on the tongue and palate; a large abscess adjacent to the larynx; left lung consolidation; mild swelling, darkening, and congestion of the liver with accentuation of the lobular pattern; and edema and congestion of the distal small and large intestines. Histologic examination identified necrotizing bronchopneumonia, necrotizing hepatitis, nephritis, and enterocolitis. Eosinophilic intranuclear inclusions were detected in syncytial cells and degenerate bronchial epithelium in the lungs and in some hepatocytes associated with necrotic foci. Bacterial cultures of the lung, liver, and laryngeal abscess failed to detect any significant pathogen. Lung and liver tested positive for equine herpesvirus with neuropathogenic marker by real-time PCR. Subsequently, equine herpesvirus was isolated in tissue culture, and the entire viral DNA polymerase gene (ORF30) was sequenced. The zebra lung isolate had a very close nucleotide and amino acid sequence identity to equid alphaherpesvirus 9 (EHV-9; 99.6% and 99.8%, respectively) in contrast to the neuropathogenic T953 strain of EHV-1 (94.7% and 96.6%, respectively). Although zebras are considered the natural host for EHV-9, we document an unusual acute systemic, fatal EHV-9 infection in a 2-y-old Grant's zebra.

Quantifying Equid Behavior - A Research Ethogram for Free-Roaming Feral Horses

Science.gov (United States)

Ransom, Jason I.; Cade, Brian S.

2009-01-01

Feral horses (Equus caballus) are globally distributed in free-roaming populations on all continents except Antarctica and occupy a wide range of habitats including forest, grassland, desert, and montane environments. The largest populations occur in Australia and North America and have been the subject of scientific study for decades, yet guidelines and ethograms for feral horse behavioral research are largely absent in the scientific literature. The U.S. Geological Survey (USGS) Fort Collins Science Center conducted research on the influences of the immunocontraceptive porcine zona pellucida (PZP) on feral horse behavior from 2003-2006 in three discrete populations in the American west. These populations were the Little Book Cliffs Wild Horse Range in Colorado, McCullough Peaks Herd Management Area in Wyoming, and Pryor Mountain Wild Horse Range in Montana; the research effort included over 1,800 hours of behavioral observations of 317 adult free-roaming feral horses. An ethogram was developed during the course of this study to facilitate accurate scientific data collection on feral horse behavior, which is often challenging to quantify. By developing this set of discrete behavioral definitions and a set of strict research protocols, scientists were better able to address both applied questions, such as behavioral changes related to fertility control, and theoretical questions, such as understanding networks and dominance hierarchies within social groups of equids.

De Novo Assembly of the Donkey White Blood Cell Transcriptome and a Comparative Analysis of Phenotype-Associated Genes between Donkeys and Horses.

Science.gov (United States)

Xie, Feng-Yun; Feng, Yu-Long; Wang, Hong-Hui; Ma, Yun-Feng; Yang, Yang; Wang, Yin-Chao; Shen, Wei; Pan, Qing-Jie; Yin, Shen; Sun, Yu-Jiang; Ma, Jun-Yu

2015-01-01

Prior to the mechanization of agriculture and labor-intensive tasks, humans used donkeys (Equus africanus asinus) for farm work and packing. However, as mechanization increased, donkeys have been increasingly raised for meat, milk, and fur in China. To maintain the development of the donkey industry, breeding programs should focus on traits related to these new uses. Compared to conventional marker-assisted breeding plans, genome- and transcriptome-based selection methods are more efficient and effective. To analyze the coding genes of the donkey genome, we assembled the transcriptome of donkey white blood cells de novo. Using transcriptomic deep-sequencing data, we identified 264,714 distinct donkey unigenes and predicted 38,949 protein fragments. We annotated the donkey unigenes by BLAST searches against the non-redundant (NR) protein database. We also compared the donkey protein sequences with those of the horse (E. caballus) and wild horse (E. przewalskii), and linked the donkey protein fragments with mammalian phenotypes. As the outer ear size of donkeys and horses are obviously different, we compared the outer ear size-associated proteins in donkeys and horses. We identified three ear size-associated proteins, HIC1, PRKRA, and KMT2A, with sequence differences among the donkey, horse, and wild horse loci. Since the donkey genome sequence has not been released, the de novo assembled donkey transcriptome is helpful for preliminary investigations of donkey cultivars and for genetic improvement.

Are California Sea Lions (Zalophus californianus Sensitive to the Attentional State of their Caretakers?

Directory of Open Access Journals (Sweden)

Marie Penel

2014-11-01

Full Text Available Human-animal relations appear in various contexts (homes, farms, zoos, aquatic parks, etc. possibly favoring the emergence of the ability to understand heterospecific communication signals in several species. Studies show that dogs (Canis familiaris have developed the ability to attribute attention to humans, reading their body, head and gaze cues. Horses (Equus caballus and other species including African gray parrots (Psittacus erithacus show this ability too. Here, we asked if California sea lions (Zalophus californianus can discriminate the attentional state of their caretakers. Four sea lions were tested in three increasingly complex experiments requiring them to make a choice between an attentive versus an inattentive caretaker. The first test asked whether sea lions could attribute attention to a human facing them versus facing away. In the second test, the caretaker’s head orientation towards the sea lion served as the attentional cue. In the final test, the inattentive caretaker wore dark sunglasses. The results were heterogeneous and showed a higher rate of success than failure in the test 1, but the opposite in test 2. The results in the test 3 were not significant. Furthermore, the latency measures suggested that the subjects did not understand the tasks. It therefore appears that in the situation used here sea lions mainly focused their attention on the experimenter’s body orientation; the head did not seem to be a pertinent cue.

Is leadership a reliable concept in animals? An empirical study in the horse.

Science.gov (United States)

Bourjade, Marie; Thierry, Bernard; Hausberger, Martine; Petit, Odile

2015-01-01

Leadership is commonly invoked when accounting for the coordination of group movements in animals, yet it remains loosely defined. In parallel, there is increased evidence of the sharing of group decisions by animals on the move. How leadership integrates within this recent framework on collective decision-making is unclear. Here, we question the occurrence of leadership in horses, a species in which this concept is of prevalent use. The relevance of the three main definitions of leadership--departing first, walking in front travel position, and eliciting the joining of mates--was tested on the collective movements of two semi-free ranging groups of Przewalski horses (Equus ferus przewalskii). We did not find any leader capable of driving most group movements or recruiting mates more quickly than others. Several group members often displayed pre-departure behaviours at the same time, and the simultaneous departure of several individuals was common. We conclude that the decision-making process was shared by several group members a group movement (i.e., partially shared consensus) and that the leadership concept did not help to depict individual departure and leading behaviour across movements in both study groups. Rather, the different proxies of leadership produced conflicting information about individual contributions to group coordination. This study discusses the implications of these findings for the field of coordination and decision-making research.

Is leadership a reliable concept in animals? An empirical study in the horse.

Directory of Open Access Journals (Sweden)

Marie Bourjade

Full Text Available Leadership is commonly invoked when accounting for the coordination of group movements in animals, yet it remains loosely defined. In parallel, there is increased evidence of the sharing of group decisions by animals on the move. How leadership integrates within this recent framework on collective decision-making is unclear. Here, we question the occurrence of leadership in horses, a species in which this concept is of prevalent use. The relevance of the three main definitions of leadership--departing first, walking in front travel position, and eliciting the joining of mates--was tested on the collective movements of two semi-free ranging groups of Przewalski horses (Equus ferus przewalskii. We did not find any leader capable of driving most group movements or recruiting mates more quickly than others. Several group members often displayed pre-departure behaviours at the same time, and the simultaneous departure of several individuals was common. We conclude that the decision-making process was shared by several group members a group movement (i.e., partially shared consensus and that the leadership concept did not help to depict individual departure and leading behaviour across movements in both study groups. Rather, the different proxies of leadership produced conflicting information about individual contributions to group coordination. This study discusses the implications of these findings for the field of coordination and decision-making research.

Large herbivores that strive mightily but eat and drink as friends.

Science.gov (United States)

de Boer, W F; Prins, H H T

1990-02-01

Grazing in patches of Cynodon dactylon and of Sporobolus spicatus by four large herbivores, and the interaction between these sedentary herbivores was studied in Lake Manyara National Park, northern Tanzania. The herbivores were the African buffalo, Syncerus caffer; the African elephan, Loxodonta africana; the Burchell's zebra, Equus burchelli; and the wildebeest, Connochaetus taurinus. Four different hypotheses of the interactions between the herbivores were tested, viz., increased predator detection/protection through association of species, facilitation of the food intake through the influence of other species, use by other species of the food manipulation strategy of buffalo, and interspecific competition for food. On the level of a single day, zebra and wildebeest were symbiotic, which could have been caused by an increased chance of predator detection. A similar association between buffalo and wildebeest or zebra was also detected on C. dactylon grasslands. There was no indication of facilitation between any of the herbivores. Buffalo had a despotic relationship with elephant, that is the elephant's consumption was lowered when buffalo had visited a patch prior to their arrival. When elephant and buffalo arrived at the same time there appeared to be scramble competition between them.Habitat overlap was calculated for four pairs of species. In conjunction with the analyses of the patch visits, it was concluded that a small overlap was associated with interspecific competition and a large habitat overlap was associated with symbiosis.

Science programs in Kansas

Science.gov (United States)

Kramer, Ariele R.; Kelly, Brian P.

2017-05-08

The U.S. Geological Survey (USGS) is a non-regulatory Earth science agency within the Department of the Interior that provides impartial scientific information to describe and understand the health of our ecosystems and environment; minimize loss of life and property from natural disasters; manage water, biological, energy, and mineral resources; and enhance and protect our quality of life. The USGS cooperates with Federal, State, tribal, and local agencies in Kansas to deliver long-term data in real-time and interpretive reports describing what those data mean to the public and resource management agencies. USGS science programs in Kansas provide real-time groundwater monitoring at more than 23 locations; streamflow monitoring at more than 218 locations; water-quality and trends in the Little Arkansas and Kansas Rivers; inflows and outflows of sediment to/from reservoirs and in streams; harmful algal bloom research in the Kansas River, Milford Lake, and Cheney Reservoir; water-quantity and water-quality effects of artificial groundwater recharge for the Equus Beds Aquifer Storage and Recovery project near Wichita, Kansas; compilation of Kansas municipal and irrigation water-use data statewide; the occurrence, effects, and movement of environmental pesticides, antibiotics, algal toxins, and taste-and-odor compounds; and funding to the Kansas Water Resources Research Institute to further research and education through Kansas universities.

Comportamento sexual, parâmetros seminais e fertilidade do sêmen congelado de jumentos (Equus asinus) da raça Pêga

OpenAIRE

Canisso, Igor Frederico

2008-01-01

Esta dissertação compreende quatro experimentos. Experimento1: Este estudo descreve algumas características do comportamento sexual de jumentos quando uma égua em estro foi usada para a coleta de sêmen. Foram usados neste estudo seis jumentos (J: 1, 2, 3, 4, 5, 6) da raça Pêga, com idade variando de 3,5 a 16 anos e pesando de 230 a 330 kg. Os animais foram previamente condicionados em um haras comercial de produção de muares localizado em Guaraciaba, Minas Gerais, Brasil. Para a colheita de s...

High variation and very low differentiation in wide ranging plains zebra (Equus quagga): insights from mtDNA and microsatellites

DEFF Research Database (Denmark)

Lorenzen, Eline D; Arctander, Peter; Siegismund, Hans R

2008-01-01

units. Both marker sets showed high levels of genetic variation and very low levels of differentiation. There was no geographical structuring of mitochondrial DNA haplotypes in the phylogenetic tree, and the plains zebra showed the lowest overall differentiation recorded in any African ungulate studied...

Effect of post-thaw addition of seminal plasma on motility, viability and chromatin integrity of cryopreserved donkey jack (Equus asinus) spermatozoa.

Science.gov (United States)

Sabatini, C; Mari, G; Mislei, B; Love, Cc; Panzani, D; Camillo, F; Rota, A

2014-12-01

Pregnancy rates in donkeys after artificial insemination with cryopreserved semen are still low, compared to the horse species. Addition of autologous seminal plasma to frozen-thawed semen appeared to improve pregnancy rates. The aims of this study were to evaluate (1) sperm motility and plasma membrane integrity after thawing (T0) and after one and 2 h (T1 and T2) of post-thaw incubation in either 0% (SP0) or 70% (SP70) autologous seminal plasma and (2) sperm motility, plasma membrane integrity and DNA quality (%COMP-αt) after thawing (T0) and after 2 and 4 h (T2 and T4) of post-thaw incubation in either 0% (SP0), 5% (SP5) or 20% (SP20) homologous seminal plasma. In experiment 1, seminal plasma decreased total and progressive sperm motility and plasma membrane intact spermatozoa immediately after dilution and at all following time points (p < 0.05). In experiment 2, total and progressive motility did not differ between treatments immediately after dilution and between SP0 and SP5 at T2, while they were lower in both SP5 and SP20 than in SP0 at T4. Plasma membrane intact sperm cells did not differ between SP0 and SP5 and were lower in SP20 at all time points. DNA quality was not affected by treatment immediately after dilution and was significantly worse for SP20 after 4 h of incubation (p < 0.05). The post-thaw addition of seminal plasma at the tested concentrations did not improve donkey frozen semen characteristics in vitro over time. © 2014 Blackwell Verlag GmbH.

Neoplasia in 125 donkeys (Equus asinus): literature review and a survey of five veterinary schools in the United States and Canada.

Science.gov (United States)

Davis, Corrine R; Valentine, Beth A; Gordon, Emma; McDonough, Sean P; Schaffer, Paula A; Allen, Andrew L; Pesavento, Patricia

2016-11-01

A diagnosis of neoplasia was noted in 125 of 357 donkeys (35%) in our review of medical records from 5 veterinary schools in the United States and Canada. Equine sarcoid was the most common tumor in our study, accounting for 72% of all tumors and 82% of cutaneous tumors. Soft-tissue sarcomas were the second most common skin tumors. All other types of neoplasia were rare. Important differences in the occurrence of neoplasia in donkeys compared to horses included the rarity or absence of squamous cell carcinoma in any organ system and gray horse melanoma. Lymphosarcoma, the most common malignant tumor in horses, appears to be very rare in donkeys. We report several tumors in donkeys including melanocytoma, peripheral nerve sheath tumor, and gastrointestinal stromal tumor. Our data demonstrate commonalities as well as differences in neoplastic diseases of donkeys and horses. Understanding differences in carcinogenesis among these 2 closely related species can inform researchers pursuing pathogenic mechanisms of equine disease and inform veterinary diagnosticians regarding tumor prevalence. © 2016 The Author(s).

Pleistocene vertebrates of the Yukon Territory

Science.gov (United States)

Harington, C. R.

2011-08-01

Unglaciated parts of the Yukon constitute one of the most important areas in North America for yielding Pleistocene vertebrate fossils. Nearly 30 vertebrate faunal localities are reviewed spanning a period of about 1.6 Ma (million years ago) to the close of the Pleistocene some 10 000 BP (radiocarbon years before present, taken as 1950). The vertebrate fossils represent at least 8 species of fishes, 1 amphibian, 41 species of birds and 83 species of mammals. Dominant among the large mammals are: steppe bison ( Bison priscus), horse ( Equus sp.), woolly mammoth ( Mammuthus primigenius), and caribou ( Rangifer tarandus) - signature species of the Mammoth Steppe fauna ( Fig. 1), which was widespread from the British Isles, through northern Europe, and Siberia to Alaska, Yukon and adjacent Northwest Territories. The Yukon faunas extend from Herschel Island in the north to Revenue Creek in the south and from the Alaskan border in the west to Ketza River in the east. The Yukon holds evidence of the earliest-known people in North America. Artifacts made from bison, mammoth and caribou bones from Bluefish Caves, Old Crow Basin and Dawson City areas show that people had a substantial knowledge of making and using bone tools at least by 25 000 BP, and possibly as early as 40 000 BP. A suggested chronological sequence of Yukon Pleistocene vertebrates ( Table 1) facilitates comparison of selected faunas and indicates the known duration of various taxa.

The Pleistocene archaeology and environments of the Wasiriya Beds, Rusinga Island, Kenya.

Science.gov (United States)

Tryon, Christian A; Tyler Faith, J; Peppe, Daniel J; Fox, David L; McNulty, Kieran P; Jenkins, Kirsten; Dunsworth, Holly; Harcourt-Smith, Will

2010-12-01

Western Kenya is well known for abundant early Miocene hominoid fossils. However, the Wasiriya Beds of Rusinga Island, Kenya, preserve a Pleistocene sedimentary archive with radiocarbon age estimates of >33-45 ka that contains Middle Stone Age artifacts and abundant, well-preserved fossil fauna: a co-occurrence rare in eastern Africa, particularly in the region bounding Lake Victoria. Artifacts and fossils are associated with distal volcanic ash deposits that occur at multiple localities in the Wasiriya Beds, correlated on the basis of geochemical composition as determined by electron probe microanalysis. Sediment lithology and the fossil ungulates suggest a local fluvial system and associated riparian wooded habitat within a predominantly arid grassland setting that differs substantially from the modern environment, where local climate is strongly affected by moisture availability from Lake Victoria. In particular, the presence of oryx (Oryx gazella) and Grevy's zebra (Equus grevyi) suggest a pre-Last Glacial Maximum expansion of arid grasslands, an environmental reconstruction further supported by the presence of several extinct specialized grazers (Pelorovis antiquus, Megalotragus sp., and a small alcelaphine) that are unknown from Holocene deposits in eastern Africa. The combination of artifacts, a rich fossil fauna, and volcaniclastic sediments makes the Wasiriya Beds a key site for examining the Lake Victoria basin, a biogeographically important area for understanding the diversification and dispersal of Homo sapiens from Africa, whose pre-Last Glacial Maximum history remains poorly understood. Copyright © 2010 Elsevier Ltd. All rights reserved.

Influence of social upbringing on the activity pattern of captive lion Panthera leo cubs: Benefits of behavior enrichment

Directory of Open Access Journals (Sweden)

Sibonokuhle NCUBE, Hilton Garikai Taambuka NDAGURWA

2010-08-01

Full Text Available The influence of social upbringing on the activity pattern of lion Panthera leo cubs was investigated at three sites. In this study, stimulus objects such as sticks, grass, fresh dung (elephant Loxondota africana, zebra Equus quagga, impala Aepyceros melampus, duiker Sylvicapra grimmia, kudu Tragelaphus strepsiceros, giraffe Giraffa camelopardalis and wildebeest Connochaetes taurinus and cardboard boxes, were utilized in an enrichment program aimed at encouraging active behaviors of captive lion cubs at Antelope Park and Masuwe. Lion cubs at Chipangali were not behaviorally enriched. Activity patterns were recorded for 10 days at each site. We recorded moving, resting, playing, grooming, visual exploration and display of hunting instincts. We found that behavioral enrichment enhanced the active behaviors of captive lion cubs. Orphan-raised cubs spent more time moving, playing and displaying hunting instincts than mother-raised cubs, but the time spent grooming was similar across areas and suggests that grooming is not influenced by enrichment. Mother-raised cubs spent more time engaged in visual exploration than orphan-raised cubs and this could be a behavior acquired from mothers or a result of confidence to explore because of their presence. Activity patterns were different among time treatments across our three study sites. Based on these findings, we suggest that lion cubs raised in captivity could benefit from behavioral enrichment to encourage active behaviors essential for eventual reintroduction into the wild [Current Zoology 56 (4: 389–394, 2010].

Investigation of an outbreak of besnoitiosis in donkeys in northeastern Pennsylvania.

Science.gov (United States)

Ness, SallyAnne L; Peters-Kennedy, Jeanine; Schares, Gereon; Dubey, Jitender P; Mittel, Linda D; Mohammed, Hussni O; Bowman, Dwight D; Felippe, M Julia B; Wade, Susan E; Shultz, Nicole; Divers, Thomas J

2012-06-01

To describe the clinical, endoscopic, and serologic features of an outbreak of besnoitiosis in 2 donkey operations in northeastern Pennsylvania and to report the outcome of attempted treatment of 1 naturally infected individual. Observational study. 29 donkeys (Equus asinus) in northeastern Pennsylvania. Donkeys were examined for lesions suggestive of besnoitiosis in an outbreak investigation. Information was collected regarding the history and signalment of animals on each premises. Rhinolaryngoscopy was performed to identify nasopharyngeal and laryngeal lesions. Serum samples were collected for immunofluorescent antibody testing and immunoblotting for Besnoitia spp. Skin biopsy samples were obtained from 8 animals with lesions suggestive of besnoitiosis for histologic examination. Quantitative real-time PCR assay for Besnoitia spp was performed on tissue samples from 5 animals. Besnoitiosis was confirmed in 6 of the 8 suspected cases. The most common lesion site was the nares, followed by the skin and sclera. Donkeys with clinical signs of disease had higher serum antibody titers and tested positive for a greater number of immunoblot bands than did donkeys without clinical signs of disease. All animals evaluated by PCR assay tested positive. Putative risk factors for disease included age and sex. Ponazuril was not effective at treating besnoitiosis in a naturally infected donkey. Knowledge of clinical and serologic features of besnoitiosis in donkeys will assist clinicians in the diagnosis and prevention of this disease in donkey populations. Besnoitiosis may be an emerging disease of donkeys in the United States.

A collaborative approach for estimating terrestrial wildlife abundance

Science.gov (United States)

Ransom, Jason I.; Kaczensky, Petra; Lubow, Bruce C.; Ganbaatar, Oyunsaikhan; Altansukh, Nanjid

2012-01-01

Accurately estimating abundance of wildlife is critical for establishing effective conservation and management strategies. Aerial methodologies for estimating abundance are common in developed countries, but they are often impractical for remote areas of developing countries where many of the world's endangered and threatened fauna exist. The alternative terrestrial methodologies can be constrained by limitations on access, technology, and human resources, and have rarely been comprehensively conducted for large terrestrial mammals at landscape scales. We attempted to overcome these problems by incorporating local peoples into a simultaneous point count of Asiatic wild ass (Equus hemionus) and goitered gazelle (Gazella subgutturosa) across the Great Gobi B Strictly Protected Area, Mongolia. Paired observers collected abundance and covariate metrics at 50 observation points and we estimated population sizes using distance sampling theory, but also assessed individual observer error to examine potential bias introduced by the large number of minimally trained observers. We estimated 5671 (95% CI = 3611–8907) wild asses and 5909 (95% CI = 3762–9279) gazelle inhabited the 11,027 km2 study area at the time of our survey and found that the methodology developed was robust at absorbing the logistical challenges and wide range of observer abilities. This initiative serves as a functional model for estimating terrestrial wildlife abundance while integrating local people into scientific and conservation projects. This, in turn, creates vested interest in conservation by the people who are most influential in, and most affected by, the outcomes.

De Novo Assembly of the Donkey White Blood Cell Transcriptome and a Comparative Analysis of Phenotype-Associated Genes between Donkeys and Horses.

Directory of Open Access Journals (Sweden)

Feng-Yun Xie

Full Text Available Prior to the mechanization of agriculture and labor-intensive tasks, humans used donkeys (Equus africanus asinus for farm work and packing. However, as mechanization increased, donkeys have been increasingly raised for meat, milk, and fur in China. To maintain the development of the donkey industry, breeding programs should focus on traits related to these new uses. Compared to conventional marker-assisted breeding plans, genome- and transcriptome-based selection methods are more efficient and effective. To analyze the coding genes of the donkey genome, we assembled the transcriptome of donkey white blood cells de novo. Using transcriptomic deep-sequencing data, we identified 264,714 distinct donkey unigenes and predicted 38,949 protein fragments. We annotated the donkey unigenes by BLAST searches against the non-redundant (NR protein database. We also compared the donkey protein sequences with those of the horse (E. caballus and wild horse (E. przewalskii, and linked the donkey protein fragments with mammalian phenotypes. As the outer ear size of donkeys and horses are obviously different, we compared the outer ear size-associated proteins in donkeys and horses. We identified three ear size-associated proteins, HIC1, PRKRA, and KMT2A, with sequence differences among the donkey, horse, and wild horse loci. Since the donkey genome sequence has not been released, the de novo assembled donkey transcriptome is helpful for preliminary investigations of donkey cultivars and for genetic improvement.

Vertebrate paleontology, stratigraphy, and paleohydrology of Tule Springs Fossil Beds National Monument, Nevada (USA)

Science.gov (United States)

Springer, Kathleen; Pigati, Jeffery S.; Scott, Eric

2017-01-01

Tule Springs Fossil Beds National Monument (TUSK) preserves 22,650 acres of the upper Las Vegas Wash in the northern Las Vegas Valley (Nevada, USA). TUSK is home to extensive and stratigraphically complex groundwater discharge (GWD) deposits, called the Las Vegas Formation, which represent springs and desert wetlands that covered much of the valley during the late Quaternary. The GWD deposits record hydrologic changes that occurred here in a dynamic and temporally congruent response to abrupt climatic oscillations over the last ~300 ka (thousands of years). The deposits also entomb the Tule Springs Local Fauna (TSLF), one of the most significant late Pleistocene (Rancholabrean) vertebrate assemblages in the American Southwest. The TSLF is both prolific and diverse, and includes a large mammal assemblage dominated by Mammuthus columbi and Camelops hesternus. Two (and possibly three) distinct species of Equus, two species of Bison, Panthera atrox, Smilodon fatalis, Canis dirus, Megalonyx jeffersonii, and Nothrotheriops shastensis are also present, and newly recognized faunal components include micromammals, amphibians, snakes, and birds. Invertebrates, plant macrofossils, and pollen also occur in the deposits and provide important and complementary paleoenvironmental information. This field compendium highlights the faunal assemblage in the classic stratigraphic sequences of the Las Vegas Formation within TUSK, emphasizes the significant hydrologic changes that occurred in the area during the recent geologic past, and examines the subsequent and repeated effect of rapid climate change on the local desert wetland ecosystem.

Virtual Screening of Acetylcholinesterase Inhibitors Using the Lipinski’s Rule of Five and ZINC Databank

Directory of Open Access Journals (Sweden)

Pablo Andrei Nogara

2015-01-01

Full Text Available Alzheimer’s disease (AD is a progressive and neurodegenerative pathology that can affect people over 65 years of age. It causes several complications, such as behavioral changes, language deficits, depression, and memory impairments. One of the methods used to treat AD is the increase of acetylcholine (ACh in the brain by using acetylcholinesterase inhibitors (AChEIs. In this study, we used the ZINC databank and the Lipinski’s rule of five to perform a virtual screening and a molecular docking (using Auto Dock Vina 1.1.1 aiming to select possible compounds that have quaternary ammonium atom able to inhibit acetylcholinesterase (AChE activity. The molecules were obtained by screening and further in vitro assays were performed to analyze the most potent inhibitors through the IC50 value and also to describe the interaction models between inhibitors and enzyme by molecular docking. The results showed that compound D inhibited AChE activity from different vertebrate sources and butyrylcholinesterase (BChE from Equus ferus (EfBChE, with IC50 ranging from 1.69 ± 0.46 to 5.64 ± 2.47 µM. Compound D interacted with the peripheral anionic subsite in both enzymes, blocking substrate entrance to the active site. In contrast, compound C had higher specificity as inhibitor of EfBChE. In conclusion, the screening was effective in finding inhibitors of AChE and BuChE from different organisms.

Poor horse traders: large mammals trade survival for reproduction during the process of feralization

Science.gov (United States)

Grange, Sophie; Duncan, Patrick; Gaillard, Jean-Michel

2009-01-01

We investigated density dependence on the demographic parameters of a population of Camargue horses (Equus caballus), individually monitored and unmanaged for eight years. We also analysed the contributions of individual demographic parameters to changes in the population growth rates. The decrease in resources caused a loss of body condition. Adult male survival was not affected, but the survival of foals and adult females decreased with increasing density. Prime-aged females maintained high reproductive performance at high density, and their survival decreased. The higher survival of adult males compared with females at high density presumably results from higher investment in reproduction by mares. The high fecundity in prime-aged females, even when at high density, may result from artificial selection for high reproductive performance, which is known to have occurred in all the major domestic ungulates. Other studies suggest that feral ungulates including cattle and sheep, as these horses, respond differently from wild ungulates to increases in density, by trading adult survival for reproduction. As a consequence, populations of feral animals should oscillate more strongly than their wild counterparts, since they should be both more invasive (as they breed faster), and more sensitive to harsh environmental conditions (as the population growth rate of long-lived species is consistently more sensitive to a given proportional change in adult survival than to the same change in any other vital rate). If this principle proves to be general, it has important implications for management of populations of feral ungulates. PMID:19324787

Geography and Timing of Cases of Eastern Equine Encephalitis in New York State from 1992 to 2012.

Science.gov (United States)

Oliver, JoAnne; Lukacik, Gary; Kramer, Laura D; Backenson, P Bryon; Sherwood, James A; Howard, John J

2016-04-01

In New York State (NYS), Eastern equine encephalitis (EEE) was first reported in a human in 1971, in horses in 1970, and in pheasants in 1952. Following work for the interval from 1970 to 1991, we identified cases in vertebrates from 1992 to 2012, through a passive surveillance system involving veterinarians in clinical practice, county health departments, and the Departments of Agriculture and Markets, Environmental Conservation, and Health, of the State of New York. During an 11-year hiatus, from 1992 to 2002, no case in any vertebrate was observed. In a re-emergence, from 2003 to 2012, disease occurred in 12 counties, including 7 counties where disease had never been documented. Vertebrate cases included 4 cases in humans and 77 nonhuman occurrences; in 58 horses, Equus ferus caballus L.; 2 deer, Odocoileus virginianus Zimmermann; 6 dogs, Canis familiaris; 10 birds; and 1 flock of pheasants, Phasianus colchicus L. These were the first reported cases in NYS in white-tailed deer, the domestic dog, and in five species of birds: American crow, Corvus brachyrhynchos Brehm; American goldfinch, Carduelis tristis L.; bald eagle, Haliaeetus leucocephalus L.; blue jay, Cyanocitta cristata (L.); and red-tailed hawk, Buteo jamaicensis Gmelin. One crow was dually infected with EEE virus and West Nile virus. The northern, southern, and southeastern borders of the state were newly affected. The geographic area, time periods, and vertebrate species with risk of EEE disease expanded from 1992 to 2012.

La fauna del pleistoceno inferior de la Sierra de Quibas (Abanilla, Murcia

Directory of Open Access Journals (Sweden)

Szyndlar, Z.

1999-08-01

Full Text Available The Quaternary karstic site of Sierra de Quibas (Abanilla, Murcia, Spain has provided a wide faunistic list with 53 species distributed among gastropods, myriapods, amphibians, reptiles, birds and mammals. Especially interesting among the gastropods is Palaeoglandina that became extinct in Europe during the Pliocene. It remains as a relict genus in the Pleistocene of the Iberian Peninsula. Two of the birds, Gypaetus barbatus and Geronticus eremita, and a snake, Elaphe cf. E. sealaris, are scarcely represented in the fossil record. For several birds, it is the first record in the Lower Pleistocene of the Iberian Peninsula. Among the mammals, the presence of the Cercopithecine Macaca sylvanus is especially relevant one. The assemblage of the taxa Arvicola deucalion, Castillomys rivas rivas, Eliomys intermedius, Equus altidens and Capra sp. aff. C. alba allows the correlation with Plines 1, Orce 3 and Venta Micena, among other sites. Therefore Quibas can be dated before the end of Lower Pleistocene, between 1.3 and 1 Ma. A dry paleoclimatic regime, very similar to the current climate in the geographical area, though perhaps slightly wetter and warmer, can be inferred from the faunistic assemblage. The environment of the karstic cavity was a rocky place with open brushwood areas, but in the proximities there were wetlands and woodlands, as can be inferred from the presence of birds and micromammals characteristic of these habitats.El yacimiento kárstico cuaternario de la Sierra de Quibas (Abanilla, Murcia ha proporcionado una amplia lista faunística constituida por 53 especies repartidas entre gasterópodos, miriápodos, anfibios, reptiles, aves y mamíferos. En el conjunto de los gasterópodos destaca Palaeoglandina, un género que se extingue en el resto de Europa durante el Plioceno y que se mantiene como relicto en el Pleistoceno de la Península Ibérica. Dos de las especies de aves determinadas, Gypaetus barbatus y Gerontieus eremita, y una

The Responses of Young Domestic Horses to Human-Given Cues

Science.gov (United States)

Proops, Leanne; Rayner, Jenny; Taylor, Anna M.; McComb, Karen

2013-01-01

It has been suggested that the process of domestication, at least in some species, has led to an innate predisposition to be skilled at reading human communicative and attentional cues. Adult domestic horses (Equus caballus) are highly sensitive to subtle bodily cues when determining if a person is attending to them but they are less adept at using human communicative cues in object choice tasks. Here we provide the first study into the ontogeny of such skills in order to gain insights into the mechanisms underlying these abilities. Compared with adult horses, youngsters under the age of three could use body orientation but not more subtle cues such as head movement and open/closed eyes to correctly choose an attentive person to approach for food. Across two object choice experiments, the performance of young horses was comparable to that of adult horses – subjects were able to correctly choose a rewarded bucket using marker placement, pointing and touching cues but could not use body orientation, gaze, elbow pointing or tapping cues. Taken together these results do not support the theory that horses possess an innate predisposition to be particularly skilled at using human cues. Horses' ability to determine whether humans are attending to them using subtle body cues appears to require significant experience to fully develop and their perhaps less remarkable use of limited cues in object choice tasks, although present at a much earlier age, is likely to reflect a more general learning ability related to stimulus enhancement rather than a specific ‘human-reading’ skill. PMID:23840572

Severe Streptococcus infection in spotted hyenas in the Ngorongoro Crater, Tanzania.

Science.gov (United States)

Höner, Oliver P; Wachter, Bettina; Speck, Stephanie; Wibbelt, Gudrun; Ludwig, Arne; Fyumagwa, Robert D; Wohlsein, Peter; Lieckfeldt, Dietmar; Hofer, Heribert; East, Marion L

2006-06-15

In a population of spotted hyenas (Crocuta crocuta) monitored between 1996 and 2005 in the Ngorongoro Crater, Tanzania, 16 individuals from five of eight social groups displayed clinical signs of an infection, including severe unilateral swelling of the head followed by abscess formation at the mandibular angle, respiratory distress, mild ataxia, and lethargy. Two (12.5%) of these 16 individuals died within days of developing signs. Clinical signs in hyenas were first noted in 2001, and most cases occurred between September 2002 and February 2003, suggesting an outbreak of infection during this period. Histopathological examination of internal organs from one hyena that died with signs revealed morphological changes consistent with severe bacterial infection. Phenotypic examination and phylogenetic analysis of the 16S rRNA gene of the causative agent of infection revealed a Lancefield group C Streptococcus with a high level of homology to S. equi subsp. ruminatorum, a subspecies of S. equi recently described in domestic sheep (Ovis aries) and goats (Capra hircus) with mastitis in Spain. Strains similar to this bacterium were also isolated from two hyenas without obvious clinical signs, suggesting that hyenas may be 'carriers' of this bacterium, and from a sympatric Burchell's zebra (Equus burchelli), a herbivore species often consumed by hyenas. To our knowledge this is the first report of a Streptococcus infection in these two wildlife species. The high genetic similarity between the hyena and zebra isolates indicates that inter-specific transmission may occur, possibly when hyenas consume infected zebra carcasses.

OAS1 polymorphisms are associated with susceptibility to West Nile encephalitis in horses.

Directory of Open Access Journals (Sweden)

Jonathan J Rios

Full Text Available West Nile virus, first identified within the United States in 1999, has since spread across the continental states and infected birds, humans and domestic animals, resulting in numerous deaths. Previous studies in mice identified the Oas1b gene, a member of the OAS/RNASEL innate immune system, as a determining factor for resistance to West Nile virus (WNV infection. A recent case-control association study described mutations of human OAS1 associated with clinical susceptibility to WNV infection. Similar studies in horses, a particularly susceptible species, have been lacking, in part, because of the difficulty in collecting populations sufficiently homogenous in their infection and disease states. The equine OAS gene cluster most closely resembles the human cluster, with single copies of OAS1, OAS3 and OAS2 in the same orientation. With naturally occurring susceptible and resistant sub-populations to lethal West Nile encephalitis, we undertook a case-control association study to investigate whether, similar to humans (OAS1 and mice (Oas1b, equine OAS1 plays a role in resistance to severe WNV infection. We identified naturally occurring single nucleotide mutations in equine (Equus caballus OAS1 and RNASEL genes and, using Fisher's Exact test, we provide evidence that mutations in equine OAS1 contribute to host susceptibility. Virtually all of the associated OAS1 polymorphisms were located within the interferon-inducible promoter, suggesting that differences in OAS1 gene expression may determine the host's ability to resist clinical manifestations associated with WNV infection.

Testing the effects of perimeter fencing and elephant exclosures on lion predation patterns in a Kenyan wildlife conservancy.

Science.gov (United States)

Dupuis-Desormeaux, Marc; Davidson, Zeke; Pratt, Laura; Mwololo, Mary; MacDonald, Suzanne E

2016-01-01

The use of fences to segregate wildlife can change predator and prey behaviour. Predators can learn to incorporate fencing into their hunting strategies and prey can learn to avoid foraging near fences. A twelve-strand electric predator-proof fence surrounds our study site. There are also porous one-strand electric fences used to create exclosures where elephant (and giraffe) cannot enter in order to protect blocs of browse vegetation for two critically endangered species, the black rhinoceros (Diceros bicornis) and the Grevy's zebra (Equus grevyi). The denser vegetation in these exclosures attracts both browsing prey and ambush predators. In this study we examined if lion predation patterns differed near the perimeter fencing and inside the elephant exclosures by mapping the location of kills. We used a spatial analysis to compare the predation patterns near the perimeter fencing and inside the exclosures to predation in the rest of the conservancy. Predation was not over-represented near the perimeter fence but the pattern of predation near the fence suggests that fences may be a contributing factor to predation success. Overall, we found that predation was over-represented inside and within 50 m of the exclosures. However, by examining individual exclosures in greater detail using a hot spot analysis, we found that only a few exclosures contained lion predation hot spots. Although some exclosures provide good hunting grounds for lions, we concluded that exclosures did not necessarily create prey-traps per se and that managers could continue to use this type of exclusionary fencing to protect stands of dense vegetation.

Speciation with gene flow in equids despite extensive chromosomal plasticity.

Science.gov (United States)

Jónsson, Hákon; Schubert, Mikkel; Seguin-Orlando, Andaine; Ginolhac, Aurélien; Petersen, Lillian; Fumagalli, Matteo; Albrechtsen, Anders; Petersen, Bent; Korneliussen, Thorfinn S; Vilstrup, Julia T; Lear, Teri; Myka, Jennifer Leigh; Lundquist, Judith; Miller, Donald C; Alfarhan, Ahmed H; Alquraishi, Saleh A; Al-Rasheid, Khaled A S; Stagegaard, Julia; Strauss, Günter; Bertelsen, Mads Frost; Sicheritz-Ponten, Thomas; Antczak, Douglas F; Bailey, Ernest; Nielsen, Rasmus; Willerslev, Eske; Orlando, Ludovic

2014-12-30

Horses, asses, and zebras belong to a single genus, Equus, which emerged 4.0-4.5 Mya. Although the equine fossil record represents a textbook example of evolution, the succession of events that gave rise to the diversity of species existing today remains unclear. Here we present six genomes from each living species of asses and zebras. This completes the set of genomes available for all extant species in the genus, which was hitherto represented only by the horse and the domestic donkey. In addition, we used a museum specimen to characterize the genome of the quagga zebra, which was driven to extinction in the early 1900s. We scan the genomes for lineage-specific adaptations and identify 48 genes that have evolved under positive selection and are involved in olfaction, immune response, development, locomotion, and behavior. Our extensive genome dataset reveals a highly dynamic demographic history with synchronous expansions and collapses on different continents during the last 400 ky after major climatic events. We show that the earliest speciation occurred with gene flow in Northern America, and that the ancestor of present-day asses and zebras dispersed into the Old World 2.1-3.4 Mya. Strikingly, we also find evidence for gene flow involving three contemporary equine species despite chromosomal numbers varying from 16 pairs to 31 pairs. These findings challenge the claim that the accumulation of chromosomal rearrangements drive complete reproductive isolation, and promote equids as a fundamental model for understanding the interplay between chromosomal structure, gene flow, and, ultimately, speciation.

Between-gender differences in vigilance do not necessarily lead to differences in foraging-vigilance tradeoffs.

Science.gov (United States)

Barnier, Florian; Duncan, Patrick; Fritz, Hervé; Blanchard, Pierrick; Rubenstein, Daniel I; Pays, Olivier

2016-07-01

When prey are time limited in their access to food, any trade-off involving time should ultimately affect their intake rate. In many herbivores, males and females experience different ecological pressures affecting their survival and reproduction because of differences in morphology, physiology and energy/nutrient requirements. If males and females have different vigilance strategies that affect their intake rates differently, they will suffer different foraging costs. This is particularly relevant in sexually monomorphic herbivores, where the two sexes have similar basal energy/nutrient requirements and risk of predation. We investigated how gender, reproductive status, age, group size, predation risk, and food biomass affected vigilance, intake rate, and their trade-off in a monomorphic species, the plains zebra (Equus quagga). Males were more vigilant than females, and lactating females were less vigilant than other females; the levels of vigilance were low (ca. 10 % of feeding time). The effects on time spent feeding, bite rates and intake rates were small and statistically not significant. Reproductive status did not affect the strength of the relationship between vigilance and intake rate, but intake rates increased with group size and, for adult females, were higher in tall grass. While gender and reproductive status were major drivers of vigilance, and group size and food biomass of the rate of food intake, males and females adjust their bite rates and food intake with vigilance in similar ways. Our results support the hypothesis that in monomorphic animals, males and females seem to make similar trade-offs (i.e. adjustments) between vigilance and intake rate.

Applying tribology to teeth of hoofed mammals.

Science.gov (United States)

Schulz, Ellen; Calandra, Ivan; Kaiser, Thomas M

2010-01-01

Mammals inhabit all types of environments and have evolved chewing systems capable of processing a huge variety of structurally diverse food components. Surface textures of cheek teeth should thus reflect the mechanisms of wear as well as the functional traits involved. We employed surface textures parameters from ISO/DIS 25178 and scale-sensitive fractal analysis (SSFA) to quantify dental wear in herbivorous mammals at the level of an individual wear enamel facet. We evaluated cheek dentitions of two grazing ungulates: the Blue Wildebeest (Connochaetes taurinus) and the Grevy's Zebra (Equus grevyi). Both inhabit the east African grassland savanna habitat, but they belong to fundamentally different taxonomic units. We tested the hypothesis that the foregut fermenting wildebeest and the hindgut fermenting zebra show functional traits in their dentitions that relate to their specific mode of food-composition processing and digestion. In general, surface texture parameters from SSFA as well as ISO/DIS 25178 indicated that individual enamel ridges acting as crushing blades and individual wear facets of upper cheek teeth are significantly different in surface textures in the zebra when compared with the wildebeest. We interpreted the complexity and anisotropy signals to be clearly related to the brittle, dry grass component in the diet of the zebra, unlike the wildebeest, which ingests a more heterogeneous diet including fresh grass and herbs. Thus, SSFA and ISO parameters allow distinctions within the subtle dietary strategies that evolved in herbivorous ungulates with fundamentally different systematic affinities but which exploit a similar dietary niche. © 2010 Wiley Periodicals, Inc.

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Science.gov (United States)

Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

2016-01-01

The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

Feral livestock threatens landscapes dominated by columnar cacti

Science.gov (United States)

Malo, J. E.; Acebes, P.; Giannoni, S. M.; Traba, J.

2011-05-01

The introduction and naturalization of alien species represents a serious threat to many natural protected areas. One such case of worldwide concern is the impact of feral livestock on arid ecosystems. Damage suffered by Echinopsis (= Trichocereus) terscheckii dominating the landscape of rocky slopes was surveyed in seven locations within the Ischigualasto-Talampaya World Heritage Site (Argentina) by measuring the frequency, position on the plant and extent of damage. At the same time we employed transects to estimate the abundance of autochtonous and feral large herbivores ( Lama guanicoe, Bos taurus, Equus asinus) from their dung. Our results show relatively high damage levels (40-77% of individuals damaged, more than 5 dm 3 removed by plant in some sites), particularly within 0.50-1.75 m above the ground, showing herbivores to be the main responsible for them. We also found significant differences between sites in variables measuring damage level and in the intensity of use by the two feral livestock species but not by guanacos. The frequency of damaged cacti below 1.75 m (but not above) was significantly positively correlated among locations with the frequencies of cattle and donkey dung, and the damage suffered by individual cacti was also correlated with donkey and cattle dung in their surroundings after correcting for spatial effects. However, all correlations were non-significant in the case of guanacos. We conclude that the continued presence of feral livestock, particularly donkeys, leads to damages to columnar cacti with potential effects on their populations and the physiognomy of this protected landscape.

A Systematic Review of Wild Burro Grazing Effects on Mojave Desert Vegetation, USA

Science.gov (United States)

Abella, Scott R.

2008-06-01

Wild burros ( Equus asinus), protected by the 1971 Wild Free-Roaming Horse and Burro Act on some federal lands but exotic animals many ecologists and resource mangers view as damaging to native ecosystems, represent one of the most contentious environmental management problems in American Southwest arid lands. This review synthesizes the scattered literature about burro effects on plant communities of the Mojave Desert, a center of burro management contentions. I classified 24 documents meeting selection criteria for this review into five categories of research: (i) diet analyses directly determining which plant species burros consume, (ii) utilization studies of individual species, (iii) control-impact comparisons, (iv) exclosure studies, and (v) forage analyses examining chemical characteristics of forage plants. Ten diet studies recorded 175 total species that burros consumed. However, these studies and two exclosure studies suggested that burros preferentially eat graminoid and forb groups over shrubs. One study in Death Valley National Park, for example, found that Achnatherum hymenoides (Indian ricegrass) was 11 times more abundant in burro diets than expected based on its availability. Utilization studies revealed that burros also exhibit preferences within the shrub group. Eighty-three percent of reviewed documents were produced in a 12-year period, from 1972 to 1983, with the most recent document produced in 1988. Because burros remain abundant on many federal lands and grazing may interact with other management concerns (e.g., desert wildfires fueled by exotic grasses), rejuvenating grazing research to better understand both past and present burro effects could help guide revegetation and grazing management scenarios.

The MC1R and ASIP Coat Color Loci May Impact Behavior in the Horse

Science.gov (United States)

Jacobs, Lauren N.; Staiger, Elizabeth A.; Albright, Julia D.

2016-01-01

Shared signaling pathways utilized by melanocytes and neurons result in pleiotropic traits of coat color and behavior in many mammalian species. For example, in humans polymorphisms at MC1R cause red hair, increased heat sensitivity, and lower pain tolerance. In deer mice, rats, and foxes, ASIP polymorphisms causing black coat color lead to more docile demeanors and reduced activity. Horse (Equus caballus) base coat color is primarily determined by polymorphisms at the Melanocortin-1 Receptor (MC1R) and Agouti Signaling Protein (ASIP) loci, creating a black, bay, or chestnut coat. Our goal was to investigate correlations between genetic loci for coat color and temperament traits in the horse. We genotyped a total of 215 North American Tennessee Walking Horses for the 2 most common alleles at the MC1R (E/e) and ASIP (A/a) loci using previously published PCR and RFLP methods. The horses had a mean age of 10.5 years and comprised 83 geldings, 25 stallions, and 107 mares. To assess behavior, we adapted a previously published survey for handlers to score horses from 1 to 9 on 20 questions related to specific aspects of temperament. We utilized principle component analysis to combine the individual survey scores into 4 factors of variation in temperament phenotype. A factor component detailing self-reliance correlated with genotypes at the ASIP locus; black mares (aa) were more independent than bay mares (A_) (P = 0.0063). These findings illuminate a promising and novel animal model for future study of neuroendocrine mechanisms in complex behavioral phenotypes. PMID:26884605

Geographic variability of Escherichia coli ribotypes from animals in Idaho and Georgia.

Science.gov (United States)

Hartel, Peter G; Summer, Jacob D; Hill, Jennifer L; Collins, J Victoria; Entry, James A; Segars, William I

2002-01-01

Several genotypic methods have been developed for determining the host origin of fecal bacteria in contaminated waters. Some of these methods rely on a host origin database to identify environmental isolates. It is not well understood to what degree these host origin isolates are geographically variable (i.e., cosmopolitan or endemic). This is important because a geographically limited host origin database may or may not be universally applicable. The objective of our study was to use one genotypic method, ribotyping, to determine the geographic variability of the fecal bacterium, Escherichia coli, from one location in Idaho and three locations in Georgia for cattle (Bos taurus), horse (Equus caballus), swine (Sus scrofa), and chicken (Gallus gallus domesticus). A total of 568 fecal E. coli isolates from Kimberly, ID (125 isolates), Athens, GA (210 isolates), Brunswick, GA (102 isolates), and Tifton, GA (131 isolates), yielded 213 ribotypes. The percentage of ribotype sharing within an animal species increased with decreased distance between geographic locations for cattle and horses, but not for swine and chicken. When the E. coli ribotypes among the four host species were compared at one location, the percent of unshared ribotypes was 86, 89, 81, and 79% for Kimberly, Athens, Brunswick, and Tifton, respectively. These data suggest that there is good ribotype separation among host animal species at each location. The ability to match environmental isolates to a host origin database may depend on a large number of environmental and host origin isolates that ideally are not geographically separated.

Testing the effects of perimeter fencing and elephant exclosures on lion predation patterns in a Kenyan wildlife conservancy

Directory of Open Access Journals (Sweden)

Marc Dupuis-Desormeaux

2016-02-01

Full Text Available The use of fences to segregate wildlife can change predator and prey behaviour. Predators can learn to incorporate fencing into their hunting strategies and prey can learn to avoid foraging near fences. A twelve-strand electric predator-proof fence surrounds our study site. There are also porous one-strand electric fences used to create exclosures where elephant (and giraffe cannot enter in order to protect blocs of browse vegetation for two critically endangered species, the black rhinoceros (Diceros bicornis and the Grevy’s zebra (Equus grevyi. The denser vegetation in these exclosures attracts both browsing prey and ambush predators. In this study we examined if lion predation patterns differed near the perimeter fencing and inside the elephant exclosures by mapping the location of kills. We used a spatial analysis to compare the predation patterns near the perimeter fencing and inside the exclosures to predation in the rest of the conservancy. Predation was not over-represented near the perimeter fence but the pattern of predation near the fence suggests that fences may be a contributing factor to predation success. Overall, we found that predation was over-represented inside and within 50 m of the exclosures. However, by examining individual exclosures in greater detail using a hot spot analysis, we found that only a few exclosures contained lion predation hot spots. Although some exclosures provide good hunting grounds for lions, we concluded that exclosures did not necessarily create prey-traps per se and that managers could continue to use this type of exclusionary fencing to protect stands of dense vegetation.

Ghosts of yellowstone: multi-decadal histories of wildlife populations captured by bones on a modern landscape.

Directory of Open Access Journals (Sweden)

Joshua H Miller

Full Text Available Natural accumulations of skeletal material (death assemblages have the potential to provide historical data on species diversity and population structure for regions lacking decades of wildlife monitoring, thereby contributing valuable baseline data for conservation and management strategies. Previous studies of the ecological and temporal resolutions of death assemblages from terrestrial large-mammal communities, however, have largely focused on broad patterns of community composition in tropical settings. Here, I expand the environmental sampling of large-mammal death assemblages into a temperate biome and explore more demanding assessments of ecological fidelity by testing their capacity to record past population fluctuations of individual species in the well-studied ungulate community of Yellowstone National Park (Yellowstone. Despite dramatic ecological changes following the 1988 wildfires and 1995 wolf re-introduction, the Yellowstone death assemblage is highly faithful to the living community in species richness and community structure. These results agree with studies of tropical death assemblages and establish the broad capability of vertebrate remains to provide high-quality ecological data from disparate ecosystems and biomes. Importantly, the Yellowstone death assemblage also correctly identifies species that changed significantly in abundance over the last 20 to ∼80 years and the directions of those shifts (including local invasions and extinctions. The relative frequency of fresh versus weathered bones for individual species is also consistent with documented trends in living population sizes. Radiocarbon dating verifies the historical source of bones from Equus caballus (horse: a functionally extinct species. Bone surveys are a broadly valuable tool for obtaining population trends and baseline shifts over decadal-to-centennial timescales.

Taming the late Quaternary phylogeography of the Eurasiatic wild ass through ancient and modern DNA.

Science.gov (United States)

Bennett, E Andrew; Champlot, Sophie; Peters, Joris; Arbuckle, Benjamin S; Guimaraes, Silvia; Pruvost, Mélanie; Bar-David, Shirli; Davis, Simon J M; Gautier, Mathieu; Kaczensky, Petra; Kuehn, Ralph; Mashkour, Marjan; Morales-Muñiz, Arturo; Pucher, Erich; Tournepiche, Jean-François; Uerpmann, Hans-Peter; Bălăşescu, Adrian; Germonpré, Mietje; Gündem, Can Y; Hemami, Mahmoud-Reza; Moullé, Pierre-Elie; Ötzan, Aliye; Uerpmann, Margarete; Walzer, Chris; Grange, Thierry; Geigl, Eva-Maria

2017-01-01

Taxonomic over-splitting of extinct or endangered taxa, due to an incomplete knowledge of both skeletal morphological variability and the geographical ranges of past populations, continues to confuse the link between isolated extant populations and their ancestors. This is particularly problematic with the genus Equus. To more reliably determine the evolution and phylogeographic history of the endangered Asiatic wild ass, we studied the genetic diversity and inter-relationships of both extinct and extant populations over the last 100,000 years, including samples throughout its previous range from Western Europe to Southwest and East Asia. Using 229 bp of the mitochondrial hypervariable region, an approach which allowed the inclusion of information from extremely poorly preserved ancient samples, we classify all non-African wild asses into eleven clades that show a clear phylogeographic structure revealing their phylogenetic history. This study places the extinct European wild ass, E. hydruntinus, the phylogeny of which has been debated since the end of the 19th century, into its phylogenetic context within the Asiatic wild asses and reveals recent mitochondrial introgression between populations currently regarded as separate species. The phylogeographic organization of clades resulting from these efforts can be used not only to improve future taxonomic determination of a poorly characterized group of equids, but also to identify historic ranges, interbreeding events between various populations, and the impact of ancient climatic changes. In addition, appropriately placing extant relict populations into a broader phylogeographic and genetic context can better inform ongoing conservation strategies for this highly-endangered species.

How grazing affects soil quality of soils formed in the glaciated northeastern United States.

Science.gov (United States)

Cox, Alissa H; Amador, José A

2018-02-21

Historically, much of the New England landscape was converted to pasture for grazing animals and harvesting hay. Both consumer demand for local sustainably produced food, and the number of small farms is increasing in RI, highlighting the importance of characterizing the effects livestock have on the quality of pasture soils. To assess how livestock affect pasture on Charlton and Canton soils series in RI, we examined soil quality in farms raising beef cattle (Bos taurus), sheep (Ovis aries), and horses (Equus ferus caballus), using hayed pastures as a control. We sampled three pastures per livestock type and three control hayed pastures in May, August, and October 2012. Hay fields and pastures grazed by sheep had statistically significant (P soil quality than pastures grazed by beef cattle or horses. This was driven by parameters including penetration resistance, bulk density, aggregate stability, and infiltration rate. Hayfields also showed higher soil quality measures than grazed pastures for organic matter content and active C. In addition, significant differences in nitrate and phosphate concentrations were observed among livestock types. Respiration and infiltration rates, pH, and ammonium concentrations, on the other hand, did not differ significantly among pasture types. When all soil quality indicators in this study were weighed equally, soil quality scores followed the order: hay > sheep > beef cattle > horses. The results of our study provide baseline data on the effect different types of livestock have on pasture soil quality in RI, which may be useful in making sound land use and agricultural management decisions.

How landscape scale changes affect ecological processes in conservation areas: external factors influence land use by zebra (Equus burchelli) in the Okavango Delta.

Science.gov (United States)

Bartlam-Brooks, Hattie L A; Bonyongo, Mpaphi C; Harris, Stephen

2013-09-01

Most large-bodied wildlife populations in sub-Saharan Africa only survive in conservation areas, but are continuing to decline because external changes influence ecological processes within reserves, leading to a lack of functionality. However, failure to understand how landscape scale changes influence ecological processes limits our ability to manage protected areas. We used GPS movement data to calculate dry season home ranges for 14 zebra mares in the Okavango Delta and investigated the effects of a range of landscape characteristics (number of habitat patches, mean patch shape, mean index of juxtaposition, and interspersion) on home range size. Resource utilization functions (RUF) were calculated to investigate how specific landscape characteristics affected space use. Space use by all zebra was clustered. In the wetter (Central) parts of the Delta home range size was negatively correlated with the density of habitat patches, more complex patch shapes, low juxtaposition of habitats and an increased availability of floodplain and grassland habitats. In the drier (Peripheral) parts of the Delta, higher use by zebra was also associated with a greater availability of floodplain and grassland habitats, but a lower density of patches and simpler patch shapes. The most important landscape characteristic was not consistent between zebra within the same area of the Delta, suggesting that no single foraging strategy is substantially superior to others, and so animals using different foraging strategies may all thrive. The distribution and complexity of habitat patches are crucial in determining space use by zebra. The extent and duration of seasonal flooding is the principal process affecting habitat patch characteristics in the Okavango Delta, particularly the availability of floodplains, which are the habitat at greatest risk from climate change and anthropogenic disturbance to the Okavango's catchment basin. Understanding how the factors that determine habitat complexity may change in the future is critical to the conservation of large mammal populations. Our study shows the importance of maintaining flood levels in the Okavango Delta and how the loss of seasonal floodplains will be compounded by changes in habitat configuration, forcing zebra to change their relative space use and enlarge home ranges, leading to increased competition for key resources and population declines.

Black rhinoceros (Diceros bicornis) and domestic horse (Equus caballus) hindgut microflora demonstrate similar fermentation responses to grape seed extract supplementation in vitro.

Science.gov (United States)

Huntley, N F; Naumann, H D; Kenny, A L; Kerley, M S

2017-10-01

The domestic horse is used as a nutritional model for rhinoceros maintained under human care. The validity of this model for browsing rhinoceros has been questioned due to high prevalence of iron overload disorder (IOD) in captive black rhinoceros (Diceros bicornis), which is associated with high morbidity and mortality. Iron chelators, such as tannins, are under investigation as dietary supplements to ameliorate or prevent IOD in prone species. Polyphenolic compounds variably affect microbial fermentation, so the first objective of this experiment was to evaluate the effects of grape seed extract (GSE; a concentrated source of condensed tannins; CT) on black rhinoceros hindgut fermentation. Equine nutrition knowledge is used to assess supplements for rhinoceros; therefore, the second objective was to evaluate the domestic horse model for black rhinoceros fermentation and compare fermentation responses to GSE using a continuous single-flow in vitro culture system. Two replicated continuous culture experiments were conducted using horse and black rhinoceros faeces as inoculum sources comparing four diets with increasing GSE inclusion (0.0%, 1.3%, 2.7% and 4.0% of diet dry matter). Diet and GSE polyphenolic compositions were determined, and sodium sulphite effect on neutral detergent fibre extraction of CT-containing forages was tested. Increasing GSE inclusion stimulated microbial growth and fermentation, and proportionally increased diet CT concentration and iron-binding capacity. Horse and black rhinoceros hindgut microflora nutrient digestibility and fermentation responses to GSE did not differ, and results supported equine fermentation as an adequate model for microbial fermentation in the black rhinoceros. Interpretation of these results is limited to hindgut fermentation and further research is needed to compare foregut digestibility and nutrient absorption between these two species. Supplementation of GSE in black rhinoceros diets up to 4% is unlikely to adversely affect hindgut nutrient digestibility or microbial viability and fermentation. Journal of Animal Physiology and Animal Nutrition © 2016 Blackwell Verlag GmbH.

Composição centesimal e teor de colesterol na carne de eqüinos (Equus caballus, Linneaus, 1758 machos e fêmeas agrupados por peso de carcaça Proximate composition and content of cholesterol in the meat of female and male equines (Equus cabalus, Linneaus 1758 with diferent carcasse weights

Directory of Open Access Journals (Sweden)

Antonio Carlos Andrade Junqueira

2005-04-01

Full Text Available O presente estudo foi conduzido em frigorífico comercial e as análises no Setor de Tecnologia de Carnes do Departamento de Ciências dos Alimentos da Universidade Federal de Lavras (UFLA. Com o objetivo de avaliar o efeito do sexo e categoria de peso sobre a composição centesimal e teor de colesterol, 20 eqüinos (10 machos castrados e 10 fêmeas foram abatidos e agrupados em categorias de peso ao abate preestabelecidas, sendo: C1( 88,82 a 97,88 kg; C2( 102,20 a 115,80 kg; C3(129,71 a 160,69 kg; C4(162,80 a 236,40 kg; com 5 animais por categoria. Os músculos longissimus dorsi (LD e semimembranosus (SM, após o abate, foram coletados e analisados: umidade, gordura, proteína e cinzas (AOAC, 1990 e o colesterol foi determinado por colorimetria (Bragagnolo, 1997. O modelo estatístico foi inteiramente casualizado, em esquema fatorial 2X4, e os dados foram analisadas pelo programa estatístico SAS. O fator sexo influenciou (pThe present study was conducted in a packing house, with the assays being done in the Sector of Meat Technology/Food Science Department of the Universidade Federal de Lavras (UFLA. With the objective of evaluating the effect of sex and category of weight on the meat proximate composition and content of cholesterol, 20 equines (10 castrated males and 10 females were slaughtered and grouped in pre-established categories of weight: C1 (88.82 to 97.88 kg; C2 (102.20 to 115.80 kg, C3 (129.7 to 160.69 kg and C4 (162.80 to 236.40 kg; with 5 animals for each category. The muscles longissimus dorsi (LD and semimembranosus (SM were collected and analyzed for: moisture, fat, protein and ashes (AOAC, 1990 and the cholesterol was determined by colorimetry (Bragagnolo, 1997. The statistical model was completely randomized, in factorial scheme 2X4, and the data were analyzed through the statistical program SAS. The factor sex influenced (p<0,05 the contents of cholesterol in LD muscle, with average values (in base of dry natural material of 36.77% and 56.08%, for males and females, respectively. The factors category of weight and sex had no influence in the values of moisture, protein, ash and fat in the muscles LD and SM, the averages seing: ashes (0.70% and 1.66%; moisture (75.53% and 75.83%; fat (0.67% and 2.03%; protein (21.63% and 22.49% for the muscles LD and SM, respectively. The rates of these chemical components show that, the meat of equines obtained in a packing house presents a high quantity of protein and low quantity of fat and can be considered as a light meat.

Towards an adaptive management approach for the conservation of rare antelope in the Kruger National Park - outcome of a workshop held in May 2000

Directory of Open Access Journals (Sweden)

C.C. Grant

2000-07-01

Full Text Available A precipitous drop in rare antelope numbers specifically roan (Hippotragus equinis sable (Hippotragus niger and tsessebe (Damaliscus lunatus since 1986 has become one of the main concerns of management. The zebra (Equus burchelli population in the preferred habitats of these species had increased with the development of artificial waterpoints especially in the areas occupied by roan and tsessebe, and these events are hypothesised to be the main cause of the decline. Closure of artificial waterpoints resulted in moving the high-density, water-dependent zebra from the northern basalt plains, the preferred roan habitat. However, the expected responding increase in the rare antelope populations did not materialise. This lack of response over six years necessitated a critical re-evaluation of the management of rare antelope in the Kruger National Park. Subsequently, a workshop was held at Skukuza during May 2000. The options for adaptive management of the declining rare antelope populations, which was discussed at the workshop, is the subject of this manuscript. The participants felt that the removal/closure of artificial waterpoints was the most unintrusive management tool available to move high density grazers from the habitats preferred by rare antelope. Waterpoints to be closed should be carefully evaluated, and time allowed for rare antelope to respond to habitat changes. Boosting populations of roan and tsessebe by supplementing animals was seriously considered, with the proviso that it should be done under favourable circumstances. Small patch fires that could provide green grazing over extended periods were recommended. Predator control was discussed but could not obtain general support as a viable option in the Kruger National Park.

EquiFACS: The Equine Facial Action Coding System.

Directory of Open Access Journals (Sweden)

Jen Wathan

Full Text Available Although previous studies of horses have investigated their facial expressions in specific contexts, e.g. pain, until now there has been no methodology available that documents all the possible facial movements of the horse and provides a way to record all potential facial configurations. This is essential for an objective description of horse facial expressions across a range of contexts that reflect different emotional states. Facial Action Coding Systems (FACS provide a systematic methodology of identifying and coding facial expressions on the basis of underlying facial musculature and muscle movement. FACS are anatomically based and document all possible facial movements rather than a configuration of movements associated with a particular situation. Consequently, FACS can be applied as a tool for a wide range of research questions. We developed FACS for the domestic horse (Equus caballus through anatomical investigation of the underlying musculature and subsequent analysis of naturally occurring behaviour captured on high quality video. Discrete facial movements were identified and described in terms of the underlying muscle contractions, in correspondence with previous FACS systems. The reliability of others to be able to learn this system (EquiFACS and consistently code behavioural sequences was high--and this included people with no previous experience of horses. A wide range of facial movements were identified, including many that are also seen in primates and other domestic animals (dogs and cats. EquiFACS provides a method that can now be used to document the facial movements associated with different social contexts and thus to address questions relevant to understanding social cognition and comparative psychology, as well as informing current veterinary and animal welfare practices.

The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

Directory of Open Access Journals (Sweden)

Cristina Ballarin

Full Text Available The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ, and Cerebellar Quotient (CQ. Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

Low habitat overlap at landscape scale between wild camelids and feral donkeys in the Chilean desert

Science.gov (United States)

Malo, Juan E.; González, Benito A.; Mata, Cristina; Vielma, André; Donoso, Denise S.; Fuentes, Nicolás; Estades, Cristián F.

2016-01-01

Feral domestic ungulates may compete with the populations of wild herbivores with which they coexist, particularly so in arid regions. The potential competition between wild camelids and feral donkeys at the eastern sector of the Atacama Desert is evaluated in terms of their coincidence or segregation in habitat use and complemented with a comparison of reproductive output (yearling/adult ratio) of vicuña family groups in the proximity vs. distant from donkey observations. Habitat use of wild camelids and donkeys was sampled driving some 1250 km of roads and tracks at the dry and wet seasons. There were 221 vicuñas (Vicugna vicugna) sightings, 77 for donkeys (Equus asinus), 25 for guanacos (Lama guanicoe) and 8 for hybrids between guanacos and domestic llamas (Lama glama), as well as 174 randomly selected control locations. By means of Generalised Discriminant Analysis and Analysis of Variance we show that all ungulates actively select their habitat, with significant differences between use and availability in the area. Donkeys are relatively abundant in comparison with camelids and coincide broadly with both of them across the altitudinal gradient, but they fall between them in local scale habitat selection and do not seem to force their displacement from their preferred habitats. Thus donkeys occur preferentially on slopes with a high cover of tall shrubs, whereas vicuñas use valley bottoms with grass and guanacos the upper slope zones with grass. The potential for competition between donkeys and wild camelids is thus limited and it does not affect the reproductive output of vicuña in this region. Therefore, with the present knowledge we suggest that population control is not currently merited for feral donkeys.

Stochastic modelling of shifts in allele frequencies reveals a strongly polygynous mating system in the re-introduced Asiatic wild ass.

Science.gov (United States)

Renan, Sharon; Greenbaum, Gili; Shahar, Naama; Templeton, Alan R; Bouskila, Amos; Bar-David, Shirli

2015-04-01

Small populations are prone to loss of genetic variation and hence to a reduction in their evolutionary potential. Therefore, studying the mating system of small populations and its potential effects on genetic drift and genetic diversity is of high importance for their viability assessments. The traditional method for studying genetic mating systems is paternity analysis. Yet, as small populations are often rare and elusive, the genetic data required for paternity analysis are frequently unavailable. The endangered Asiatic wild ass (Equus hemionus), like all equids, displays a behaviourally polygynous mating system; however, the level of polygyny has never been measured genetically in wild equids. Combining noninvasive genetic data with stochastic modelling of shifts in allele frequencies, we developed an alternative approach to paternity analysis for studying the genetic mating system of the re-introduced Asiatic wild ass in the Negev Desert, Israel. We compared the shifts in allele frequencies (as a measure of genetic drift) that have occurred in the wild ass population since re-introduction onset to simulated scenarios under different proportions of mating males. We revealed a strongly polygynous mating system in which less than 25% of all males participate in the mating process each generation. This strongly polygynous mating system and its potential effect on the re-introduced population's genetic diversity could have significant consequences for the long-term persistence of the population in the Negev. The stochastic modelling approach and the use of allele-frequency shifts can be further applied to systems that are affected by genetic drift and for which genetic data are limited. © 2015 John Wiley & Sons Ltd.

Phylogenetic relationships among Perissodactyla: secretoglobin 1A1 gene duplication and triplication in the Equidae family.

Science.gov (United States)

Côté, Olivier; Viel, Laurent; Bienzle, Dorothee

2013-12-01

Secretoglobin family 1A member 1 (SCGB 1A1) is a small anti-inflammatory and immunomodulatory protein that is abundantly secreted in airway surface fluids. We recently reported the existence of three distinct SCGB1A1 genes in the domestic horse genome as opposed to the single gene copy consensus present in other mammals. The origin of SCGB1A1 gene triplication and the evolutionary relationship of the three genes amongst Equidae family members are unknown. For this study, SCGB1A1 genomic data were collected from various Equus individuals including E. caballus, E. przewalskii, E. asinus, E. grevyi, and E. quagga. Three SCGB1A1 genes in E. przewalskii, two SCGB1A1 genes in E. asinus, and a single SCGB1A1 gene in E. grevyi and E. quagga were identified. Sequence analysis revealed that the non-synonymous nucleotide substitutions between the different equid genes coded for 17 amino acid changes. Most of these changes localized to the SCGB 1A1 central cavity that binds hydrophobic ligands, suggesting that this area of SCGB 1A1 evolved to accommodate diverse molecular interactions. Three-dimensional modeling of the proteins revealed that the size of the SCGB 1A1 central cavity is larger than that of SCGB 1A1A. Altogether, these findings suggest that evolution of the SCGB1A1 gene may parallel the separation of caballine and non-caballine species amongst Equidae, and may indicate an expansion of function for SCGB1A1 gene products. Copyright © 2013 Elsevier Inc. All rights reserved.

The major horse satellite DNA family is associated with centromere competence.

Science.gov (United States)

Cerutti, Federico; Gamba, Riccardo; Mazzagatti, Alice; Piras, Francesca M; Cappelletti, Eleonora; Belloni, Elisa; Nergadze, Solomon G; Raimondi, Elena; Giulotto, Elena

2016-01-01

The centromere is the specialized locus required for correct chromosome segregation during cell division. The DNA of most eukaryotic centromeres is composed of extended arrays of tandem repeats (satellite DNA). In the horse, we previously showed that, although the centromere of chromosome 11 is completely devoid of tandem repeat arrays, all other centromeres are characterized by the presence of satellite DNA. We isolated three horse satellite DNA sequences (37cen, 2P1 and EC137) and described their chromosomal localization in four species of the genus Equus. In the work presented here, using the ChIP-seq methodology, we showed that, in the horse, the 37cen satellite binds CENP-A, the centromere-specific histone-H3 variant. The 37cen sequence bound by CENP-A is GC-rich with 221 bp units organized in a head-to-tail fashion. The physical interaction of CENP-A with 37cen was confirmed through slot blot experiments. Immuno-FISH on stretched chromosomes and chromatin fibres demonstrated that the extension of satellite DNA stretches is variable and is not related to the organization of CENP-A binding domains. Finally, we proved that the centromeric satellite 37cen is transcriptionally active. Our data offer new insights into the organization of horse centromeres. Although three different satellite DNA families are cytogenetically located at centromeres, only the 37cen family is associated to the centromeric function. Moreover, similarly to other species, CENP-A binding domains are variable in size. The transcriptional competence of the 37cen satellite that we observed adds new evidence to the hypothesis that centromeric transcripts may be required for centromere function.

LESÕES PODAIS EM ASININOS (Equus asinus UTILIZADOS EM VEÍCULOS DE TRAÇÃO ANIMAL NA CIDADE DE SÃO LUÍS, MARANHÃO

Directory of Open Access Journals (Sweden)

NANCYLENI PINTO CHAVES

2011-06-01

Full Text Available Forty male and female animals, aged between 2.5 and 1 6years were clinically and radiographically examined inorder to study the occurrence of lesions of the distalphalanx of forelimbs in cart horses. The clinicalexamination showed that 20% of the animals had grade 2lameness, due, mainly, to hoof irregularity, sole damage and frog destruction. Radiographic exam showed 100% of pedal osteitis, 22.5% of phalanx fracture and 17.5% of phalanx rotation. Despite the severe level of injury in the third phalanx, animals did not show clinical signs consistent with the radiographic findings, concluding that donkeys are very resistant and that the lesions observed in the distal phalanx affect to a lesser extent the carrying out of these animal's activities.

Contribuição ao estudo do funículo espermático em eqüinos sem raça definida (Equus caballus, L.

Directory of Open Access Journals (Sweden)

André Luiz Quagliatto Santos

1992-06-01

Full Text Available Utilizando 35 pares de funículos esperméticos de eqüinos sem raça definida, estudaram-se os aspectos histológicos dos envoltórios funiculares, dos vasos arteriais e venosos e dos tecidos intervasculares, assim como o seu arranjo vascular e o comprimento do segmento da artéria testicular nele contido.

Foaling rates in feral horses treated with the immunocontraceptive porcine zona pellucida

Science.gov (United States)

Ransom, J.I.; Roelle, J.E.; Cade, B.S.; Coates-Markle, L.; Kane, A.J.

2011-01-01

Locally abundant feral horses (Equus caballus) can rapidly deplete available resources. Fertility control agents present promising nonlethal tools for reducing their population growth rates. We tested the effect of 2 forms of the immunocontraceptive porcine zona pellucida (PZP) on foaling rates in 3 populations of feral horses in the western United States. A liquid form requiring annual boosters was administered at Little Book Cliffs Wild Horse Range, Mesa County (CO), and Pryor Mountain Wild Horse Range, Bighorn County (WY) and Carbon County (MT), and a time-release pellet form designed to produce 2 yr of infertility was administered at McCullough Peaks Herd Management Area, Park County (WY). Average foaling rates (foals born/mare-yr) from direct observation of untreated and treated female horses (mares), 2004-2008, were 60.1% (n = 153 mare-yr) versus 6.6% (n = 91 mare-yr) at Little Book Cliffs, and 62.8% (n = 129 mare-yr) versus 17.7% (n = 79 mare-yr) at Pryor Mountain, respectively. At McCullough Peaks, mean annual foaling rates from 2006 to 2008 were 75.0% (n = 48 mare-yr) for untreated mares and 31.7% (n = 101 mare-yr) for treated mares. Controlling for age of mares and pretreatment differences in fertility, PZP reduced foaling rates in all 3 herds. The pellets used at McCullough Peaks (produced by cold evaporation) were less effective than pellets used in a previous trial and produced by heat extrusion. Immunocontraception with PZP may be a useful tool in reducing fertility rates in some western United States feral horse herds, but population growth reduction will depend on timely access to mares for inoculation and the proportion of mares that can be successfully treated. ?? 2011 The Wildlife Society.

Some maternal lineages of domestic horses may have origins in East Asia revealed with further evidence of mitochondrial genomes and HVR-1 sequences

Directory of Open Access Journals (Sweden)

Hongying Ma

2018-06-01

Full Text Available Objectives There are large populations of indigenous horse (Equus caballus in China and some other parts of East Asia. However, their matrilineal genetic diversity and origin remained poorly understood. Using a combination of mitochondrial DNA (mtDNA and hypervariable region (HVR-1 sequences, we aim to investigate the origin of matrilineal inheritance in these domestic horses. Methods To investigate patterns of matrilineal inheritance in domestic horses, we conducted a phylogenetic study using 31 de novo mtDNA genomes together with 317 others from the GenBank. In terms of the updated phylogeny, a total of 5,180 horse mitochondrial HVR-1 sequences were analyzed. Results Eightteen haplogroups (Aw-Rw were uncovered from the analysis of the whole mitochondrial genomes. Most of which have a divergence time before the earliest domestication of wild horses (about 5,800 years ago and during the Upper Paleolithic (35–10 KYA. The distribution of some haplogroups shows geographic patterns. The Lw haplogroup contained a significantly higher proportion of European horses than the horses from other regions, while haplogroups Jw, Rw, and some maternal lineages of Cw, have a higher frequency in the horses from East Asia. The 5,180 sequences of horse mitochondrial HVR-1 form nine major haplogroups (A-I. We revealed a corresponding relationship between the haplotypes of HVR-1 and those of whole mitochondrial DNA sequences. The data of the HVR-1 sequences also suggests that Jw, Rw, and some haplotypes of Cw may have originated in East Asia while Lw probably formed in Europe. Conclusions Our study supports the hypothesis of the multiple origins of the maternal lineage of domestic horses and some maternal lineages of domestic horses may have originated from East Asia.

Canyon Creek: A late Pleistocene vertebrate locality in interior Alaska

Science.gov (United States)

Weber, Florence R.; Hamilton, Thomas D.; Hopkins, David M.; Repenning, Charles A.; Haas, Herbert

1981-09-01

The Canyon Creek vertebrate-fossil locality is an extensive road cut near Fairbanks that exposes sediments that range in age from early Wisconsin to late Holocene. Tanana River gravel at the base of the section evidently formed during the Delta Glaciation of the north-central Alaska Range. Younger layers and lenses of fluvial sand are interbedded with arkosic gravel from Canyon Creek that contains tephra as well as fossil bones of an interstadial fauna about 40,000 years old. Solifluction deposits containing ventifacts, wedge casts, and rodent burrows formed during a subsequent period of periglacial activity that took place during the maximum phase of Donnelly Glaciation about 25,000-17,000 years ago. Overlying sheets of eolian sand are separated by a 9500-year-old paleosol that may correlate with a phase of early Holocene spruce expansion through central Alaska. The Pleistocene fauna from Canyon Creek consists of rodents (indicated by burrows), Mammuthus primigenius (woolly mammoth), Equus lambei (Yukon wild ass), Camelops hesternus (western camel), Bison sp. cf. B. crassicornis (large-horned bison), Ovis sp. cf. O. dalli (mountain sheep), Canis sp. cf. C. lupus (wolf), Lepus sp. cf. L. othus or L. arcticus (tundra hare), and Rangifer sp. (caribou). This assemblage suggests an open landscape in which trees and tall shrubs were either absent or confined to sheltered and moist sites. Camelops evidently was present in eastern Beringia during the middle Wisconsin interstadial interval but may have disappeared during the following glacial episode. The stratigraphic section at Canyon Creek appears to demonstrate that the Delta Glaciation of the north-central Alaska Range is at least in part of early Wisconsin age and was separated from the succeeding Donnelly Glaciation by an interstadial rather than interglacial episode.

Group dynamics of zebra and wildebeest in a woodland savanna: effects of predation risk and habitat density.

Directory of Open Access Journals (Sweden)

Maria Thaker

Full Text Available BACKGROUND: Group dynamics of gregarious ungulates in the grasslands of the African savanna have been well studied, but the trade-offs that affect grouping of these ungulates in woodland habitats or dense vegetation are less well understood. We examined the landscape-level distribution of groups of blue wildebeest, Connochaetes taurinus, and Burchell's zebra, Equus burchelli, in a predominantly woodland area (Karongwe Game Reserve, South Africa; KGR to test the hypothesis that group dynamics are a function of minimizing predation risk from their primary predator, lion, Panthera leo. METHODOLOGY/PRINCIPAL FINDINGS: Using generalized linear models, we examined the relative importance of habitat type (differing in vegetation density, probability of encountering lion (based on utilization distribution of all individual lions in the reserve, and season in predicting group size and composition. We found that only in open scrub habitat, group size for both ungulate species increased with the probability of encountering lion. Group composition differed between the two species and was driven by habitat selection as well as predation risk. For both species, composition of groups was, however, dominated by males in open scrub habitats, irrespective of the probability of encountering lion. CONCLUSIONS/SIGNIFICANCE: Distribution patterns of wildebeest and zebra groups at the landscape level directly support the theoretical and empirical evidence from a range of taxa predicting that grouping is favored in open habitats and when predation risk is high. Group composition reflected species-specific social, physiological and foraging constraints, as well as the importance of predation risk. Avoidance of high resource open scrub habitat by females can lead to loss of foraging opportunities, which can be particularly costly in areas such as KGR, where this resource is limited. Thus, landscape-level grouping dynamics are species specific and particular to the

Impacts of ungulates on the demography and diversity of small mammals in central Kenya.

Science.gov (United States)

Keesing, Felicia

1998-09-01

The impacts of ungulates on small mammals in an East African savanna habitat were investigated by monitoring the population and community responses of small mammals on replicated 4-ha plots from which ungulates had been excluded. The dominant small mammal in this habitat is the pouched mouse, Saccostomusmearnsi, a medium-sized murid rodent. Eight other small mammal species, including Arvicanthis sp., Mus sp., Mastomys sp., Dendromus sp., Crocidura sp., and, rarely, Tatera sp., Aethomys sp., and Acomys sp., were also captured. The dominant ungulates are elephant (Loxodonta africana), giraffe (Giraffa camelopardalis), Grevy's and common zebra (Equus grevyi and E. burchelli), buffalo (Syncerus cafer), eland (Taurotragus oryx), Grant's gazelle (Gazella granti), and domestic cattle. Within 1 year, S. mearnsi populations had responded dramatically to the exclusion of large mammals by a two-fold increase in density, a difference that was maintained through pronounced seasonal fluctuations in the second year. Though individual pouched mice showed no significant differences in their use of space with and without ungulates, male S. mearnsi maintained significantly higher body weights in the absence of ungulates, indicating that habitat quality had increased. One other species, Mastomys sp., also increased in the absence of ungulates. Overall, the small mammal community maintained relatively constant species diversity on the plots to which ungulates did not have access. On the plots to which ungulates did have access, on the other hand, there was a rapid 75% decrease in diversity in the control plots during one trapping session. Ungulates are most likely affecting small mammals through their effects on food quality, since there were no detectable differences in their exposure to predators, as determined by vegetative cover, in the absence of ungulates. These results demonstrate that ungulates can have strong and rapid impacts on small mammal abundance and diversity in East

Temporal dynamics in microbial soil communities at anthrax carcass sites.

Science.gov (United States)

Valseth, Karoline; Nesbø, Camilla L; Easterday, W Ryan; Turner, Wendy C; Olsen, Jaran S; Stenseth, Nils Chr; Haverkamp, Thomas H A

2017-09-26

Anthrax is a globally distributed disease affecting primarily herbivorous mammals. It is caused by the soil-dwelling and spore-forming bacterium Bacillus anthracis. The dormant B. anthracis spores become vegetative after ingestion by grazing mammals. After killing the host, B. anthracis cells return to the soil where they sporulate, completing the lifecycle of the bacterium. Here we present the first study describing temporal microbial soil community changes in Etosha National Park, Namibia, after decomposition of two plains zebra (Equus quagga) anthrax carcasses. To circumvent state-associated-challenges (i.e. vegetative cells/spores) we monitored B. anthracis throughout the period using cultivation, qPCR and shotgun metagenomic sequencing. The combined results suggest that abundance estimation of spore-forming bacteria in their natural habitat by DNA-based approaches alone is insufficient due to poor recovery of DNA from spores. However, our combined approached allowed us to follow B. anthracis population dynamics (vegetative cells and spores) in the soil, along with closely related organisms from the B. cereus group, despite their high sequence similarity. Vegetative B. anthracis abundance peaked early in the time-series and then dropped when cells either sporulated or died. The time-series revealed that after carcass deposition, the typical semi-arid soil community (e.g. Frankiales and Rhizobiales species) becomes temporarily dominated by the orders Bacillales and Pseudomonadales, known to contain plant growth-promoting species. Our work indicates that complementing DNA based approaches with cultivation may give a more complete picture of the ecology of spore forming pathogens. Furthermore, the results suggests that the increased vegetation biomass production found at carcass sites is due to both added nutrients and the proliferation of microbial taxa that can be beneficial for plant growth. Thus, future B. anthracis transmission events at carcass sites may be

Interspecific interference competition at the resource patch scale: do large herbivores spatially avoid elephants while accessing water?

Science.gov (United States)

Ferry, Nicolas; Dray, Stéphane; Fritz, Hervé; Valeix, Marion

2016-11-01

Animals may anticipate and try to avoid, at some costs, physical encounters with other competitors. This may ultimately impact their foraging distribution and intake rates. Such cryptic interference competition is difficult to measure in the field, and extremely little is known at the interspecific level. We tested the hypothesis that smaller species avoid larger ones because of potential costs of interference competition and hence expected them to segregate from larger competitors at the scale of a resource patch. We assessed fine-scale spatial segregation patterns between three African herbivore species (zebra Equus quagga, kudu Tragelaphus strepsiceros and giraffe Giraffa camelopardalis) and a megaherbivore, the African elephant Loxodonta africana, at the scale of water resource patches in the semi-arid ecosystem of Hwange National Park, Zimbabwe. Nine waterholes were monitored every two weeks during the dry season of a drought year, and observational scans of the spatial distribution of all herbivores were performed every 15 min. We developed a methodological approach to analyse such fine-scale spatial data. Elephants increasingly used waterholes as the dry season progressed, as did the probability of co-occurrence and agonistic interaction with elephants for the three study species. All three species segregated from elephants at the beginning of the dry season, suggesting a spatial avoidance of elephants and the existence of costs of being close to them. However, contrarily to our expectations, herbivores did not segregate from elephants the rest of the dry season but tended to increasingly aggregate with elephants as the dry season progressed. We discuss these surprising results and the existence of a trade-off between avoidance of interspecific interference competition and other potential factors such as access to quality water, which may have relative associated costs that change with the time of the year. © 2016 The Authors. Journal of Animal Ecology �

DUST-BATHING BEHAVIORS OF AFRICAN HERBIVORES AND THE POTENTIAL RISK OF INHALATIONAL ANTHRAX.

Science.gov (United States)

Barandongo, Zoe R; Mfune, John K E; Turner, Wendy C

2018-01-01

:  Anthrax in herbivorous wildlife and livestock is generally assumed to be transmitted via ingestion or inhalation of Bacillus anthracis spores. Although recent studies have highlighted the importance of the ingestion route for anthrax transmission, little is known about the inhalational route in natural systems. Dust bathing could aerosolize soilborne pathogens such as B. anthracis, exposing dust-bathing individuals to inhalational infections. We investigated the potential role of dust bathing in the transmission of inhalational anthrax to herbivorous wildlife in Etosha National Park, Namibia, an area with endemic seasonal anthrax outbreaks. We 1) cultured soils from dust-bathing sites for the presence and concentration of B. anthracis spores, 2) monitored anthrax carcass sites, the locations with the highest B. anthracis concentrations, for evidence of dust bathing, including a site where a zebra died of anthrax on a large dust bath, and 3) characterized the ecology and seasonality of dust bathing in plains zebra ( Equus quagga), blue wildebeest ( Connochaetes taurinus), and African savanna elephant ( Loxodonta africana) using a combination of motion-sensing camera traps and direct observations. Only two out of 83 dust-bath soils were positive for B. anthracis, both with low spore concentrations (≤20 colony-forming units per gram). We also detected no evidence of dust baths occurring at anthrax carcass sites, perhaps due to carcass-induced changes in soil composition that may deter dust bathing. Finally, despite observing some seasonal variation in dust bathing, preliminary evidence suggests that the seasonality of dust bathing and anthrax mortalities are not correlated. Thus, although dust bathing creates a dramatic cloud of aerosolized soil around an individual, our microbiologic, ecologic, and behavioral results in concert demonstrate that dust bathing is highly unlikely to transmit inhalational anthrax infections.

The micro-politics of macromolecules in the taxonomy and restoration of Quaggas

Directory of Open Access Journals (Sweden)

Peter Heywood

Full Text Available Quaggas, partially striped zebras from the Karoo, were a distinctive component of the South African fauna. They had dark stripes on their faces, necks and fore-bodies. Otherwise their bodies were unstriped, and the background colour of both the striped and unstriped upper parts of their bodies was chestnut. They were hunted extensively, and in the nineteenth century were increasingly excluded from grazing land and water. The Game Amendment Act of the Government of the Cape of Good Hope was intended to protect quaggas, as well as other fauna, but by the time of its passage in 1886 they were already extinct. Quaggas were given the binomial name Equus quagga in the eighteenth century and many viewed them as a species distinct from plains zebras. However, in 1984 the first DNA sequencing of an extinct organism demonstrated that quaggas were not a separate species but a subspecies of the plains zebra. This revised taxonomy made possible the Quagga Project in which selective breeding from plains zebras has resulted in animals termed 'Rau quaggas' whose bodies have reduced striping but which lack the chestnut background colour that is evident in most paintings of living quaggas. Rau quaggas now live in captivity in several locations in South Africa, and could help restore the ecology of damaged environments where quaggas once roamed. Both quagga DNA and the Quagga Project can be considered as 'boundary objects' that bring together a heterogeneous variety of stakeholders including scientists and hunters, nature lovers and commercial organisations. The successful micro-politics of the Quagga Project in negotiating with different bodies and in obtaining funding from diverse sources provides a model that could be emulated by conservation bodies.

Bone taphonomy of the Schöningen "Spear Horizon South" and its implications for site formation and hominin meat provisioning.

Science.gov (United States)

Starkovich, Britt M; Conard, Nicholas J

2015-12-01

This paper presents the faunal remains from the new excavation area at the Lower Paleolithic site of Schöningen. The focus of the study is on the southern extension of the main find horizon (Spear Horizon South), which includes the layer that yielded the famous Schöningen spears (13 II-4). Taxonomic data corroborate previous studies, that hominins primarily hunted Equus mosbachensis, a large Pleistocene horse. Equid body part representation at the site suggests that the animals were hunted and butchered locally. There is no evidence for density-mediated attrition in the assemblage. Weathering damage is uncommon, though there is ample evidence that carnivores had access to the bone. Carnivore bite sizes were measured and compared to experimental data provided by previous authors. Based on relationships between bite size and carnivore behavior and body size, we conclude that the primary modifying agents were large carnivores (i.e., wolves or saber-toothed cats). Previous studies show that carnivores often had secondary access to the remains, after hominins. Cut marks are commonly arranged haphazardly on the bones. This may indicate that multiple hominins participated in the butchery of horse skeletons, or that they were butchered over the course of hours or days. Cut marks on axial elements are more "orderly," which probably reflects the physical logistics of orienting one's body in relation to a large carcass. These data differ from sites formed by Middle and Upper Paleolithic hominins, which might suggest that in later times, a system of organized meat provisioning was already in place. Taken together, the faunal evidence from the Spear Horizon South indicates that late Lower Paleolithic hominins using the site understood the behaviors of different prey species, hunted socially to take down large game, and successfully competed with large carnivores on the landscape for primary access to ungulate remains. Copyright © 2015 Elsevier Ltd. All rights reserved.

Keeper-Animal Interactions: Differences between the Behaviour of Zoo Animals Affect Stockmanship.

Science.gov (United States)

Ward, Samantha J; Melfi, Vicky

2015-01-01

Stockmanship is a term used to describe the management of animals with a good stockperson someone who does this in a in a safe, effective, and low-stress manner for both the stock-keeper and animals involved. Although impacts of unfamiliar zoo visitors on animal behaviour have been extensively studied, the impact of stockmanship i.e familiar zoo keepers is a new area of research; which could reveal significant ramifications for zoo animal behaviour and welfare. It is likely that different relationships are formed dependant on the unique keeper-animal dyad (human-animal interaction, HAI). The aims of this study were to (1) investigate if unique keeper-animal dyads were formed in zoos, (2) determine whether keepers differed in their interactions towards animals regarding their attitude, animal knowledge and experience and (3) explore what factors affect keeper-animal dyads and ultimately influence animal behaviour and welfare. Eight black rhinoceros (Diceros bicornis), eleven Chapman's zebra (Equus burchellii), and twelve Sulawesi crested black macaques (Macaca nigra) were studied in 6 zoos across the UK and USA. Subtle cues and commands directed by keepers towards animals were identified. The animals latency to respond and the respective behavioural response (cue-response) was recorded per keeper-animal dyad (n = 93). A questionnaire was constructed following a five-point Likert Scale design to record keeper demographic information and assess the job satisfaction of keepers, their attitude towards the animals and their perceived relationship with them. There was a significant difference in the animals' latency to appropriately respond after cues and commands from different keepers, indicating unique keeper-animal dyads were formed. Stockmanship style was also different between keepers; two main components contributed equally towards this: "attitude towards the animals" and "knowledge and experience of the animals". In this novel study, data demonstrated unique dyads

Comparison of Vertebrate Cytochrome b and Prepronociceptin for Blood Meal Analyses in Culicoides

Science.gov (United States)

Hadj-Henni, Leila; De Meulemeester, Thibaut; Depaquit, Jérôme; Noël, Philippe; Germain, Adeline; Helder, Remi; Augot, Denis

2015-01-01

To date, studies on host preferences and blood meal identification have been conducted for Culicoides species using molecular-based methods such as PCR techniques to amplify only a fragment from universal vertebrate mitochondrial genes such as cytochrome c oxidase subunit I or cytochrome b (Cyt b). The vertebrate prepronociceptin gene (PNOC) was also tested in this field. However, the choice of molecular marker to identify blood meal is critical. The objective of our study is to compare the ability of Cyt b and PNOC as molecular markers for blood meal identification depending on the stage of blood meal digestion. In order to determine whether these Cyt b and PNOC could provide a positive result, 565 blood-fed females of Culicoides spp were collected and morphologically identified. The samples were collected between 2012 and 2014, in two localities in France. The collection localities were near either livestock or a forest. To catch the specimens, we used UV CDC miniature light traps. PNOC sequence of donkeys (Equus asinus) was sequenced and submitted because it was missing in GenBank. Our findings emphasize that the PNOC marker is not suitable to separate closely related Equid species such as horses and donkeys. The Cyt b marker was able to identify 204 more samples when compared to PNOC (99.55% of specimens). Cyt b appears to be better able to detect the origin of blood meals from females with digested blood in their abdomens. We conclude that Cyt b is a good marker as it increases the accuracy of blood meal identification of engorged females containing digested blood in their abdomens. The host opportunist behavior of Culicoides, especially that of C. obsoletus and C. scoticus, the main vectors of BTV in Europe was also highlighted. PMID:26664944

Documentation and quantitative analysis of local ethnozoological knowledge among traditional healers of Theni district, Tamil Nadu, India.

Science.gov (United States)

Chellappandian, M; Pandikumar, P; Mutheeswaran, S; Gabriel Paulraj, M; Prabakaran, S; Duraipandiyan, V; Ignacimuthu, S; Al-Dhabi, N A

2014-05-28

This study investigated the use of animals among the traditional healers in Theni district of Tamil Nadu, India. The data regarding the medicinal animals/animal products were documented and their usages were analyzed quantitatively. Based on free list interviews with the traditional healers, we documented the medicinal usage of animals/animal products and calculated the indices such as informant consensus factor (Fic) to determine the consensus over the species for an illness category, as well as the Index Agreement on Remedies (IAR) to determine the extent of potential utilization of each species. In this study, 69 medicinal animals/animal products were documented with the help of standardized questionnaires among the local healers. The results were tabulated and Fic value for each illness category was calculated. Three illness categories viz., jaundice (milk of Capra aegagrus hircus), orthopedics (egg white and meat of Gallus gallus domesticus) and pediatrics (milk of Equus africanus asinus) had got high Fic values. Fifteen illness categories had moderate Fic values. Highly cited animals in these illness categories were: Rusa unicolor (antiemetic), Reticulitermes spp. (diabetes), flesh of Varanus benghalensis (oral ailments), milk (eye ailments, fever) and urine (antidote) of Homo sepians, meat of Trachypithecus johnii (respiratory ailments), various parts of C. aegagrus hircus (blood ailments, coolants, diarrhea, pulmonary and urinary ailments), flesh of Chamaeleon zeyalnica (neural ailments), meat of Passer domesticus (aphrodisiac), curd and dung of Bos primigenius taurus (dermatological ailments), meat of G. domesticus (musculo-skeletal disorders, analgesic), meat of Lissemys punctata (hemorrhoids), and Pherthima posthuma (psychological ailments). Six illness categories had low Fic values. This study indicated that the animals are still being used by the local healers of Theni district, to treat various illnesses. Cross-disciplinary approaches to explore the

Globalization of the cashmere market and the decline of large mammals in central Asia.

Science.gov (United States)

Berger, Joel; Buuveibaatar, Bayarbaatar; Mishra, Charudutt

2013-08-01

As drivers of terrestrial ecosystems, humans have replaced large carnivores in most areas, and human influence not only exerts striking ecological pressures on biodiversity at local scales but also has indirect effects in distant corners of the world. We suggest that the multibillion dollar cashmere industry creates economic motivations that link western fashion preferences for cashmere to land use in Central Asia. This penchant for stylish clothing, in turn, encourages herders to increase livestock production which affects persistence of over 6 endangered large mammals in these remote, arid ecosystems. We hypothesized that global trade in cashmere has strong negative effects on native large mammals of deserts and grassland where cashmere-producing goats are raised. We used time series data, ecological snapshots of the biomass of native and domestic ungulates, and ecologically and behaviorally based fieldwork to test our hypothesis. In Mongolia increases in domestic goat production were associated with a 3-fold increase in local profits for herders coexisting with endangered saiga (Saiga tatarica).That increasing domestic grazing pressure carries fitness consequences was inferred on the basis of an approximately 4-fold difference in juvenile recruitment among blue sheep (Pseudois nayaur)in trans-Himalayan India. Across 7 study areas in Mongolia, India, and China's Tibetan Plateau, native ungulate biomass is now degradation and decreased capacity for the persistence of native species, including at least 8 Asian endemic species: saiga, chiru (Pantholops hodgsoni), Bactrian camel (Camelus bactrianus), snow leopard(Panthera uncia), khulan(Equus hemionus), kiang (E. kiang), takhi (E. przewalski), and wild yak (Bos mutus). Our results suggest striking yet indirect and unintended actions that link trophic-level effects to markets induced by the trade for cashmere. © 2013 Society for Conservation Biology.

Connectivity of the Asiatic wild ass population in the Mongolian Gobi.

Science.gov (United States)

Kaczensky, Petra; Kuehn, Ralph; Lhagvasuren, Badamjav; Pietsch, Stephanie; Yang, Weikang; Walzer, Chris

2011-02-01

Long-distance migrations of wildlife have been identified as important biological phenomena, but their conservation remains a major challenge. The Mongolian Gobi is one of the last refuges for the Asiatic wild ass (Equus hemionus) and other threatened migratory mammals. Using historic and current distribution ranges, population genetics, and telemetry data we assessed the connectivity of the wild ass population in the context of natural and anthropogenic landscape features and the existing network of protected areas. In the Mongolian Gobi mean biomass production is highly correlated with human and livestock density and seems to predict wild ass occurrence at the upper level. The current wild ass distribution range largely falls into areas below the 250 gC/m(2)/year productivity isoline, suggesting that under the present land use more productive areas have become unavailable for wild asses. Population genetics results identified two subpopulations and delineated a genetic boundary between the Dzungarian and Transaltai Gobi for which the most likely explanation are the mountain ranges separating the two areas. Home ranges and locations of 19 radiomarked wild asses support the assumed restricting effects of more productive habitats and mountain ranges and additionally point towards a barrier effect of fences. Furthermore, telemetry data shows that in the Dzungarian and Transaltai Gobi individual wild ass rarely ventured outside of the protected areas, whereas in the southeast Gobi asses only spend a small fraction of their time within the protected area network. Conserving the continuity of the wild ass population will need a landscape level approach, also including multi-use landscapes outside of protected areas, particularly in the southeast Gobi. In the southwest Gobi, allowing for openings in the border fence to China and managing the border area as an ecological corridor would connect three large protected areas together covering over 70,000 km(2) of wild ass

Applying clinically proven human techniques for contraception and fertility to endangered species and zoo animals: a review.

Science.gov (United States)

Silber, Sherman J; Barbey, Natalie; Lenahan, Kathy; Silber, David Z

2013-12-01

Reversible contraception that does not alter natural behavior is a critical need for managing zoo populations. In addition to reversible contraception, other fertility techniques perfected in humans may be useful, such as in vitro fertilization (IVF) or oocyte and embryo banking for endangered species like amphibians and Mexican wolves (Canis lupus baileyi). Furthermore, the genetics of human fertility can give a better understanding of fertility in more exotic species. Collaborations were established to apply human fertility techniques to the captive population. Reversible vasectomy might be one solution for reversible contraception that does not alter behavior. Reversible approaches to vasectomy, avoiding secondary epididymal disruption, were attempted in South American bush dogs (Speothos venaticus), chimpanzees (Pan troglodytes), gorillas (Gorilla gorilla), Przewalski's horse (Equus przewalski poliakov), and Sika deer (Cervus nippon) in a variety of zoos around the world. These techniques were first perfected in > 4,000 humans before attempting them in zoo animals. In vitro fertilization with gestational surrogacy was used to attempt to break the vicious cycle of hand rearing of purebred orangutans, and egg and ovary vitrification in humans have led to successful gamete banking for Mexican wolves and disappearing amphibians. The study of the human Y chromosome has even explained a mechanism of extinction related to global climate change. The best results with vasectomy reversal (normal sperm counts, pregnancy, and live offspring) were obtained when the original vasectomy was performed "open-ended," so as to avoid pressure-induced epididymal disruption. The attempt at gestational surrogacy for orangutans failed because of severe male infertility and the lack of success with human ovarian hyperstimulation protocols. Vitrification of oocytes is already being employed for the Amphibian Ark Project and for Mexican wolves. Vasectomy can be a reversible contraception

Comparison of vertebrate cytochrome b and prepronociceptin for blood meal analyses in Culicoides.

Directory of Open Access Journals (Sweden)

Leila eHadj-henni

2015-05-01

Full Text Available To date, studies on host preferences and blood meal identification have been conducted for Culicoides species using molecular-based methods such as PCR techniques to amplify only a fragment from universal vertebrate mitochondrial genes such as Cytochrome C oxidase subunit I (COI or Cytochrome b (Cyt b. The vertebrate prepronociceptin gene (PNOC was also tested in this field. However, the choice of molecular marker to identify blood meal is critical.The objective of our study is to compare the ability of Cyt b and PNOC as molecular markers for blood meal identification depending on the stage of blood meal digestion. In order to determine whether these Cyt b and PNOC could provide a positive result, 565 blood-fed females of Culicoides spp were collected and morphologically identified. The samples were collected between 2012 and 2014, in two localities in France. The collection localities were near either livestock or a forest. To catch the specimens, we used UV CDC miniature light traps. PNOC sequence of donkeys (Equus asinus was sequenced and submitted because it was missing in GenBank. Our findings emphasize that the PNOC marker is not suitable to separate closely related Equid species such as horses and donkeys. The Cyt b marker was able to identify 204 more samples when compared to PNOC (99.55% of specimens. Cyt b appears to be better able to detect the origin of blood meals from females with digested blood in their abdomens. We conclude that Cyt b is a good marker as it increases the accuracy of blood meal identification of engorged females containing digested blood in their abdomens. The host opportunist behavior of Culicoides, especially that of C. obsoletus and C. scoticus, the main vectors of BTV in Europe was also highlighted.

Influence of dental correction on nociceptive test responses, fecal appearance, body condition score, and apparent digestibility coefficient for dry matter of Zamorano-leones donkeys (Equus asinus).

Science.gov (United States)

Rodrigues, J B; Ferreira, L M; Bastos, E; San Roman, F; Viegas, C; Santos, A S

2013-10-01

The influence of dental correction on nociceptive (pressure) test responses, fecal appearance, BCS, and apparent digestibility coefficient for DM was studied in 18 Zamorano-Leonés donkeys, an endangered local breed from the Zamora province in Spain. For this purpose, donkeys were divided into 2 homogeneous control and treatment groups, based on age, BCS, and dental findings. On d 1, 45, 90, and 135, BCS and nociceptive test responses were evaluated in all donkeys. Feed and fecal samples were collected from all donkeys for 3 consecutive days, starting at each of the aforementioned days. Apparent digestibility coefficient for DM was estimated, using ADL as an internal marker. A progressive decrease of positive nociceptive test responses was observed from d 1 up to 90 (P donkeys but also the equid population, in general, to improve their welfare.

A clinical survey on the prevalence and types of cheek teeth disorders present in 400 Zamorano-Leonés and 400 Mirandês donkeys (Equus asinus).

Science.gov (United States)

Rodrigues, J B; Dixon, P M; Bastos, E; San Roman, F; Viegas, C

2013-12-14

Dental disease is now recognised as a major but often unrecognised disorder of equids, including horses and donkeys. However, very few large clinical studies have documented the prevalence and type of dental disease present in different equid populations and no dental studies have been reported in Zamorano-Leonés or Mirandês donkeys, two endangered donkey breeds. Clinical and detailed oral examinations were performed in 400 Mirandês and 400 Zamorano-Leonés donkeys in Portugal and Spain. It was found that just 4.5 per cent had ever received any previous dental care. Cheek teeth (CT) disorders were present in 82.8 per cent of these donkeys, ranging from a prevalence of 29.6 per cent in the 25-year-old group. These CT disorders included enamel overgrowths (73.1 per cent prevalence but with just 6.3 per cent having associated soft tissue injuries), focal overgrowths (37.3 per cent), periodontal disease (23.5 per cent) and diastemata (19.9 per cent). Peripheral caries was present in 5.9 per cent of cases, but inexplicably, infundibular caries was very rare (1.3 per cent prevalence); this may have been due to their almost fully foraged diet. The high prevalence of enamel overgrowths in these donkeys, most which never received concentrates, also raises questions about the aetiology of this disorder. This very high prevalence of CT disorders, especially in older donkeys, was of great welfare concern in some cases and emphasises the need for routine dental care in these cases on welfare grounds and in order to help preserve these unique breeds.

Fossil isotope records of seasonal climate and ecology: Straight from the horse's mouth

Science.gov (United States)

Sharp, Z. D.; Cerling, T. E.

1998-03-01

Isotope analysis of a bulk fossil tooth gives a “snapshot” impression of paleoclimatic conditions—a single point in time. However, hypsodont teeth grow over a period of a year or more, so that stable carbon and oxygen isotope variations along their length are a “tape recorder” of short-term seasonal variations from the distant past. We have used a new in situ micro-laser sampling method to determine submillimeter carbon and oxygen isotope variations in the enamel of individual fossil horse teeth to assess ancient annual meteoric water variations and feeding patterns. The δ18O values from a 6.8 Ma fossil horse tooth (Astrohippus ansae) from Texas vary cyclically along the 6 cm length of the tooth with a smoothed amplitude of >4‰, similar to the monthly averaged amplitude measured in modern meteoric waters from the region. The seasonal δ18O values are ˜3‰ to 4‰ higher than those calculated from modern meteoric water data, suggesting either a higher local meteoric water value in the Miocene of Texas, or that the animal received a high proportion of its dietary water from plants or highly evaporated water. A Holocene horse tooth from the shores of Glacial Lake Agassiz, North Dakota (Equus sp.), also has isotopic variations with the same 35 mm periodicity, but a smoothed amplitude of only 2‰. This horse most likely had a buffered drinking supply. The calculated δ18O of the water in equilibrium with this tooth is the same as the modern measured annual average. The variations within a single tooth can be as large as those generally observed in entire stratigraphic sections of fossil teeth analyzed by bulk methods. The new method provides an important technique for evaluating fossil diagenesis; conventional bulk analyses of teeth fragments may not be representative of the whole tooth, thus explaining analytical scatter that has been previously attributed to diagenesis.

Challenges faced in the conservation of rare antelope: a case study on the northern basalt plains of the Kruger National Park

Directory of Open Access Journals (Sweden)

C.C. Grant

2002-12-01

Full Text Available The conservation of rare antelope has long been one of the goals of the Kruger National Park. The roan antelope Hippotragus equinus, and to a lesser extent the tsessebe Damaliscus lunatus, represent low-density species or rare antelope in the park. Specific management approaches representing the older equilibrium approach, have been employed to conserve these antelope. Of these, the supply of artificial water over many decades was the most resource intensive. The sudden, severe drop in the roan antelope population towards the end of the 1980s was unexpected and, retrospectively, attributed to the development of a high density of perennial waterpoints. The postulated mechanism was that the perennial presence of water allowed Burchell’s zebra Equus burchelli to stay permanently in an area that was previously only seasonally accessible. The combined effect of a long, dry climatic cycle, high numbers of zebra and their associated predators was proposed to be the cause of this decline. As part of the new nature evolving or ecosystem resilience approach, twelve artificial waterpoints were closed in the prime roan antelope habitat in 1994 in an attempt to move the zebra out of this area. The zebra numbers declined as the rainfall increased. Closure of waterholes clearly led to redistribution of zebra numbers on the northern plains, zebra tending to avoid areas within several kilometres of closed waterpoints. However, at a larger scale, regional densities appeared similar in areas with and without closed waterpoints. There was an initial drop in the lion numbers in 1995, after which they stabilised. In spite of an improvement in the grass species composition and an increase in biomass the roan antelope population did not increase. The complexity of maintaining a population at the edge of their distribution and the problems associated with the conservation of such populations are discussed in terms of management options and monitoring approaches that

Revealing life-history traits by contrasting genetic estimations with predictions of effective population size.

Science.gov (United States)

Greenbaum, Gili; Renan, Sharon; Templeton, Alan R; Bouskila, Amos; Saltz, David; Rubenstein, Daniel I; Bar-David, Shirli

2017-12-22

Effective population size, a central concept in conservation biology, is now routinely estimated from genetic surveys and can also be theoretically predicted from demographic, life-history, and mating-system data. By evaluating the consistency of theoretical predictions with empirically estimated effective size, insights can be gained regarding life-history characteristics and the relative impact of different life-history traits on genetic drift. These insights can be used to design and inform management strategies aimed at increasing effective population size. We demonstrated this approach by addressing the conservation of a reintroduced population of Asiatic wild ass (Equus hemionus). We estimated the variance effective size (N ev ) from genetic data (N ev =24.3) and formulated predictions for the impacts on N ev of demography, polygyny, female variance in lifetime reproductive success (RS), and heritability of female RS. By contrasting the genetic estimation with theoretical predictions, we found that polygyny was the strongest factor affecting genetic drift because only when accounting for polygyny were predictions consistent with the genetically measured N ev . The comparison of effective-size estimation and predictions indicated that 10.6% of the males mated per generation when heritability of female RS was unaccounted for (polygyny responsible for 81% decrease in N ev ) and 19.5% mated when female RS was accounted for (polygyny responsible for 67% decrease in N ev ). Heritability of female RS also affected N ev ; hf2=0.91 (heritability responsible for 41% decrease in N ev ). The low effective size is of concern, and we suggest that management actions focus on factors identified as strongly affecting Nev, namely, increasing the availability of artificial water sources to increase number of dominant males contributing to the gene pool. This approach, evaluating life-history hypotheses in light of their impact on effective population size, and contrasting

Comparative analyses of tooth wear in free-ranging and captive wild equids.

Science.gov (United States)

Taylor, L A; Müller, D W H; Schwitzer, C; Kaiser, T M; Castell, J C; Clauss, M; Schulz-Kornas, E

2016-03-01

Captive breeding has played a crucial role in the conservation of threatened equid species. Grazing ruminants and rhinoceros in captivity have less abrasion-dominated tooth wear than their free-ranging conspecifics, with potential negative consequences for their health. However, a similar study on wild equids in captivity is missing. The aim was to establish if different tooth wear patterns are exhibited by free-ranging and captive equids. Cross-sectional study of museum specimens comparing free-ranging and captive equids. Dental casts of maxillary cheek teeth of 228 museum specimens (122 from free-ranging and 106 from captive individuals) of 7 wild equid species were analysed using the extended mesowear method. Although teeth showing specific abnormalities were not scored, the presence of focal overgrowths (hooks) of the rostral premolars (106, 206) was recorded. Captive Equus ferus przewalskii, E. grevyi, E. hemionus, E. quagga boehmi and E. zebra hartmannae have less abrasion-dominated tooth wear on their premolars than their free-ranging conspecifics (P<0.001). Fewer differences were exhibited between populations in the molars. No differences were exhibited in the distal cusp of the molars (110, 210) between populations, except in a small sample of E. kiang. Captive equids exhibited more homogeneous wear along the tooth row whereas free-ranging equids exhibited a tooth wear gradient, with more abrasion on premolars than molars. There were more rostral hooks on the premolars (106, 206) in the captive than the free-ranging population (P = 0.02). Captive equids did experience less abrasion-dominated tooth wear than their free-ranging conspecifics, but the differences in tooth wear were less pronounced than those between captive and free-ranging wild ruminant and rhinoceros species. This indicates that feeding regimes for captive equids deviate less from natural diets than those for captive ruminants and rhinoceros but that factors leading to hook

Quaternary Geochronology, Paleontology, and Archaeology of the Upper San Pedro River Valley, Sonora, Mexico

Science.gov (United States)

Gaines, E. P.

2013-12-01

This poster presents the results of multi-disciplinary investigations of the preservation and extent of Quaternary fossil-bearing strata in the San Pedro River Valley in Sonora, Mexico. Geologic deposits in the portions of the San Pedro Valley in southern Arizona contain one of the best late Cenozoic fossil records known in North America and the best record of early humans and extinct mammals on the continent. The basin in the U.S. is one of the type locations for the Blancan Land Mammal Age. Hemiphilian and Irvingtonian fossils are common. Rancholabrean remains are widespread. Strata in the valley adjacent to the international border with Mexico have yielded the densest concentration of archaeological mammoth-kill sites known in the western hemisphere. Despite more than 60 years of research in the U.S., however, and the fact that over one third of the San Pedro River lies south of the international boundary, little has been known about the late Cenozoic geology of the valley in Mexico. The study reported here utilized extensive field survey, archaeological documentation, paleontological excavations, stratigraphic mapping and alluvial geochronology to determine the nature and extent of Quaternary fossil-bearing deposits in the portions of the San Pedro Valley in Sonora, Mexico. The results demonstrate that the Plio-Pleistocene fossil -bearing formations known from the valley in Arizona extend into the uppermost reaches of the valley in Mexico. Several new fossil sites were discovered that yielded the remains of Camelids, Equus, Mammuthus, and other Proboscidean species. Late Pleistocene archaeological remains were found on the surface of the surrounding uplands. AMS radiocarbon dating demonstrates the widespread preservation of middle- to late- Holocene deposits. However, the late Pleistocene deposits that contain the archaeological mammoth-kill sites in Arizona are absent in the valley in Mexico, and are now known to be restricted to relatively small portions of

Seasonal movements of wildlife and livestock in a heterogenous pastoral landscape: Implications for coexistence and community based conservation

Directory of Open Access Journals (Sweden)

Peter Tyrrell

2017-10-01

Full Text Available Rangelands across the world are home to millions of pastoral people and vast wildlife populations, which create a complex landscape for conservation. Community based conservation has been used to promote human-wildlife coexistence on pastoral lands, protecting wildlife outside of official protected areas. With the spread of community based conservation within the rangelands there is a need for more information on successful management practices. This study provides an example of this in the South Rift, Kenya, where seasonal movements of pastoralists aid coexistence. We used Density Surface Modelling (DSM, a novel tool for conservation managers in the rangelands, to predict wildlife and livestock abundance across the landscape and seasons. Wildlife grazers, zebra (Equus burchelli and wildebeest (Connochaetes taurinus, follow expected metabolic patterns, feeding on short grass outside the conservation area in the wet season, before returning to the taller-lower quality grazing in the conservation areas during the drought. Browsing wildlife, impala (Aepyceros melampus and Grant’s gazelle (Nanger granti, move from open grassland and bushland areas into thicker, denser browse as the seasons progress towards the drought. Livestock, both shoats (Ovis aries, and Capra aegagrus hircus and cattle (Bos indicus, are managed by community grazing committees, who enforce a grazing plan that creates spatial–temporal separation between wildlife and livestock. They exploit the high-quality grazing in the livestock area during the wet season while conserving pasture in the conservation area, which is utilized only as forage is depleted. This ensures that wildlife has access to a diverse resource base across all seasons and potentially reduces competition, allowing for a diverse and abundant wildlife community to coexist with livestock. This highlights the importance of the presence and maintenance of spatial and temporal heterogeneity of forage resources

Cloning, Phylogenetic Analysis and 3D Modeling of a Putative Lysosomal Acid Lipase from the Camel, Camelus dromedarius

Directory of Open Access Journals (Sweden)

Farid Shokry Ataya

2012-08-01

Full Text Available Acid lipase belongs to a family of enzymes that is mainly present in lysosomes of different organs and the stomach. It is characterized by its capacity to withstand acidic conditions while maintaining high lipolytic activity. We cloned for the first time the full coding sequence of camel’s lysosomal acid lipase, cLIPA using RT-PCR technique (Genbank accession numbers JF803951 and AEG75815, for the nucleotide and aminoacid sequences respectively. The cDNA sequencing revealed an open reading frame of 1,197 nucleotides that encodes a protein of 399 aminoacids which was similar to that from other related mammalian species. Bioinformatic analysis was used to determine the aminoacid sequence, 3D structure and phylogeny of cLIPA. Bioinformatics analysis suggested the molecular weight of the translated protein to be 45.57 kDa, which could be decreased to 43.16 kDa after the removal of a signal peptide comprising the first 21 aminoacids. The deduced cLIPA sequences exhibited high identity with Equus caballus (86%, Numascus leucogenys (85%, Homo sapiens (84%, Sus scrofa (84%, Bos taurus (82% and Ovis aries (81%. cLIPA shows high aminoacid sequence identity with human and dog-gastric lipases (58%, and 59% respectively which makes it relevant to build a 3D structure model for cLIPA. The comparison confirms the presence of the catalytic triad and the oxyanion hole in cLIPA. Phylogenetic analysis revealed that camel cLIPA is grouped with monkey, human, pig, cow and goat. The level of expression of cLIPA in five camel tissues was examined using Real Time-PCR. The highest level of cLIPA transcript was found in the camel testis (162%, followed by spleen (129%, liver (100%, kidney (20.5% and lung (17.4%.

Aerial population estimates of wild horses (Equus caballus) in the adobe town and salt wells creek herd management areas using an integrated simultaneous double-count and sightability bias correction technique

Science.gov (United States)

Lubow, Bruce C.; Ransom, Jason I.

2007-01-01

An aerial survey technique combining simultaneous double-count and sightability bias correction methodologies was used to estimate the population of wild horses inhabiting Adobe Town and Salt Wells Creek Herd Management Areas, Wyoming. Based on 5 surveys over 4 years, we conclude that the technique produced estimates consistent with the known number of horses removed between surveys and an annual population growth rate of 16.2 percent per year. Therefore, evidence from this series of surveys supports the validity of this survey method. Our results also indicate that the ability of aerial observers to see horse groups is very strongly dependent on skill of the individual observer, size of the horse group, and vegetation cover. It is also more modestly dependent on the ruggedness of the terrain and the position of the sun relative to the observer. We further conclude that censuses, or uncorrected raw counts, are inadequate estimates of population size for this herd. Such uncorrected counts were all undercounts in our trials, and varied in magnitude from year to year and observer to observer. As of April 2007, we estimate that the population of the Adobe Town /Salt Wells Creek complex is 906 horses with a 95 percent confidence interval ranging from 857 to 981 horses.

Detection probability in aerial surveys of feral horses

Science.gov (United States)

Ransom, Jason I.

2011-01-01

Observation bias pervades data collected during aerial surveys of large animals, and although some sources can be mitigated with informed planning, others must be addressed using valid sampling techniques that carefully model detection probability. Nonetheless, aerial surveys are frequently employed to count large mammals without applying such methods to account for heterogeneity in visibility of animal groups on the landscape. This often leaves managers and interest groups at odds over decisions that are not adequately informed. I analyzed detection of feral horse (Equus caballus) groups by dual independent observers from 24 fixed-wing and 16 helicopter flights using mixed-effect logistic regression models to investigate potential sources of observation bias. I accounted for observer skill, population location, and aircraft type in the model structure and analyzed the effects of group size, sun effect (position related to observer), vegetation type, topography, cloud cover, percent snow cover, and observer fatigue on detection of horse groups. The most important model-averaged effects for both fixed-wing and helicopter surveys included group size (fixed-wing: odds ratio = 0.891, 95% CI = 0.850–0.935; helicopter: odds ratio = 0.640, 95% CI = 0.587–0.698) and sun effect (fixed-wing: odds ratio = 0.632, 95% CI = 0.350–1.141; helicopter: odds ratio = 0.194, 95% CI = 0.080–0.470). Observer fatigue was also an important effect in the best model for helicopter surveys, with detection probability declining after 3 hr of survey time (odds ratio = 0.278, 95% CI = 0.144–0.537). Biases arising from sun effect and observer fatigue can be mitigated by pre-flight survey design. Other sources of bias, such as those arising from group size, topography, and vegetation can only be addressed by employing valid sampling techniques such as double sampling, mark–resight (batch-marked animals), mark–recapture (uniquely marked and

Inorganic elements determination in human and animal whole blood samples by X-ray fluorescence technique (EDXRF)

International Nuclear Information System (INIS)

Redigolo, Marcelo Miyada

2011-01-01

Blood is a suspension of cells contained in a complex liquid called plasma. The term 'whole blood' refers to samples with both solid and liquid parts. Inorganic elements are responsible for essential functions, such as osmotic regulation, cardiac frequency and contractibility, blood clotting and neuromuscular excitability. The determination of inorganic elements in corporeal fluids such as blood, serum, plasma, tissue and urine is used as a monitor for a part or the whole organism. In this work, the X-Ray fluorescence technique (EDXRF) was used for the determination of inorganic elements in whole blood samples from humans and animals (golden hamsters, Mesocricetus auratus and crioula breed horses, Equus caballus). The reference intervals of Na (1788 - 1826 μg g'- 1 ), Mg (63 - 75 μg g -1 ), P (602 - 676 μg g -1 ), S (1519 - 1718 μg g -1 ), Cl (2743 - 2867 μg g -1 ), K (1508 - 1630 μg g -1 ), Ca (214 - 228 μg g'- 1 ), Cu (4 -6 μg g -1 ) e Zn (1 - 3 μg g'- 1 ) were determined for human blood. The reference intervals, for golden hamster blood were found to be: Na (1714 - 1819 μg g -1 ), Mg (51 - 79 μg g -1 ), P (970 - 1080 μg g -1 ), S (1231 - 1739 μg g -1 ), Cl (2775 - 2865 μg g -1 ), K (1968 - 2248 μg g -1 ), Ca (209 - 257 μg g-1), Cu (4 - 6 μg g -1 ) e Zn (3 - 5 μg g -1 ). The reference intervals, for crioula breed horse blood, showed to be: Na (1955 - 2013 μg g -1 ), Mg (51 - 75 μg g -1 ), P (443 - 476 μg g -1 ), S (1038 - 1140 μg g - '1), Cl (2388 - 2574 μg g -1 ), K (1678 - 1753 μg g -1 ), Ca (202 - 213 μg g -1 ), Cu (4,1 - 4,5 μg g -1 ) e Zn (2,0 - 2,2 μg g -1 ). Comparative study between NAA and EDXRF, both techniques showed the same performance for the analyses of biological matrices. The results contribute for the establishment of reference intervals for the Brazilian healthy population and the referred animal species. (author)

Molecular evolution of the mitochondrial 12S rRNA in Ungulata (mammalia).

Science.gov (United States)

Douzery, E; Catzeflis, F M

1995-11-01

The complete 12S rRNA gene has been sequenced in 4 Ungulata (hoofed eutherians) and 1 marsupial and compared to 38 available mammalian sequences in order to investigate the molecular evolution of the mitochondrial small-subunit ribosomal RNA molecule. Ungulata were represented by one artiodactyl (the collared peccary, Tayassu tajacu, suborder Suiformes), two perissodactyls (the Grevy's zebra, Equus grevyi, suborder Hippomorpha; the white rhinoceros, Ceratotherium simum, suborder Ceratomorpha), and one hyracoid (the tree hyrax, Dendrohyrax dorsalis). The fifth species was a marsupial, the eastern gray kangaroo (Macropus giganteus). Several transition/transversion biases characterized the pattern of changes between mammalian 12S rRNA molecules. A bias toward transitions was found among 12S rRNA sequences of Ungulata, illustrating the general bias exhibited by ribosomal and protein-encoding genes of the mitochondrial genome. The derivation of a mammalian 12S rRNA secondary structure model from the comparison of 43 eutherian and marsupial sequences evidenced a pronounced bias against transversions in stems. Moreover, transversional compensatory changes were rare events within double-stranded regions of the ribosomal RNA. Evolutionary characteristics of the 12S rRNA were compared with those of the nuclear 18S and 28S rRNAs. From a phylogenetic point of view, transitions, transversions and indels in stems as well as transversional and indels events in loops gave congruent results for comparisons within orders. Some compensatory changes in double-stranded regions and some indels in single-stranded regions also constituted diagnostic events. The 12S rRNA molecule confirmed the monophyly of infraorder Pecora and order Cetacea and demonstrated the monophyly of the suborder Ruminantia was not supported and the branching pattern between Cetacea and the artiodacytyl suborders Ruminantia and Suiformes was not established. The monophyly of the order Perissodactyla was evidenced

Migratory herds of wildebeests and zebras indirectly affect calf survival of giraffes.

Science.gov (United States)

Lee, Derek E; Kissui, Bernard M; Kiwango, Yustina A; Bond, Monica L

2016-12-01

In long-distance migratory systems, local fluctuations in the predator-prey ratio can exhibit extreme variability within a single year depending upon the seasonal location of migratory species. Such systems offer an opportunity to empirically investigate cyclic population density effects on short-term food web interactions by taking advantage of the large seasonal shifts in migratory prey biomass.We utilized a large-mammal predator-prey savanna food web to evaluate support for hypotheses relating to the indirect effects of "apparent competition" and "apparent mutualism" from migratory ungulate herds on survival of resident megaherbivore calves, mediated by their shared predator. African lions ( Panthera leo ) are generalist predators whose primary, preferred prey are wildebeests ( Connochaetes taurinus ) and zebras ( Equus quagga ), while lion predation on secondary prey such as giraffes ( Giraffa camelopardalis ) may change according to the relative abundance of the primary prey species.We used demographic data from five subpopulations of giraffes in the Tarangire Ecosystem of Tanzania, East Africa, to test hypotheses relating to direct predation and indirect effects of large migratory herds on calf survival of a resident megaherbivore. We examined neonatal survival via apparent reproduction of 860 adult females, and calf survival of 449 giraffe calves, during three precipitation seasons over 3 years, seeking evidence of some effect on neonate and calf survival as a consequence of the movements of large herds of migratory ungulates.We found that local lion predation pressure (lion density divided by primary prey density) was significantly negatively correlated with giraffe neonatal and calf survival probabilities. This supports the apparent mutualism hypothesis that the presence of migratory ungulates reduces lion predation on giraffe calves.Natural predation had a significant effect on giraffe calf and neonate survival, and could significantly affect giraffe

Gastrointestinal helminths may affect host susceptibility to anthrax through seasonal immune trade-offs.

Science.gov (United States)

Cizauskas, Carrie A; Turner, Wendy C; Wagner, Bettina; Küsters, Martina; Vance, Russell E; Getz, Wayne M

2014-11-12

Most vertebrates experience coinfections, and many pathogen-pathogen interactions occur indirectly through the host immune system. These interactions are particularly strong in mixed micro-macroparasite infections because of immunomodulatory effects of helminth parasites. While these trade-offs have been examined extensively in laboratory animals, few studies have examined them in natural systems. Additionally, many wildlife pathogens fluctuate seasonally, at least partly due to seasonal host immune changes. We therefore examined seasonality of immune resource allocation, pathogen abundance and exposure, and interactions between infections and immunity in plains zebra (Equus quagga) in Etosha National Park (ENP), Namibia, a system with strongly seasonal patterns of gastrointestinal (GI) helminth infection intensity and concurrent anthrax outbreaks. Both pathogens are environmentally transmitted, and helminth seasonality is driven by environmental pressures on free living life stages. The reasons behind anthrax seasonality are currently not understood, though anthrax is less likely directly driven by environmental factors. We measured a complex, interacting set of variables and found evidence that GI helminth infection intensities, eosinophil counts, IgE and IgGb antibody titers, and possibly IL-4 cytokine signaling were increased in wetter seasons, and that ectoparasite infestations and possibly IFN-γ cytokine signaling were increased in drier seasons. Monocyte counts and anti-anthrax antibody titers were negatively associated with wet season eosinophilia, and monocytes were negatively correlated with IgGb and IgE titers. Taken together, this supports the hypothesis that ENP wet seasons are characterized by immune resource allocation toward Th-2 type responses, while Th1-type immunity may prevail in drier seasons, and that hosts may experience Th1-Th2 trade-offs. We found evidence that this Th2-type resource allocation is likely driven by GI parasite infections

Frequent and seasonally variable sublethal anthrax infections are accompanied by short-lived immunity in an endemic system.

Science.gov (United States)

Cizauskas, Carrie A; Bellan, Steven E; Turner, Wendy C; Vance, Russell E; Getz, Wayne M

2014-09-01

Few studies have examined host-pathogen interactions in wildlife from an immunological perspective, particularly in the context of seasonal and longitudinal dynamics. In addition, though most ecological immunology studies employ serological antibody assays, endpoint titre determination is usually based on subjective criteria and needs to be made more objective. Despite the fact that anthrax is an ancient and emerging zoonotic infectious disease found world-wide, its natural ecology is not well understood. In particular, little is known about the adaptive immune responses of wild herbivore hosts against Bacillus anthracis. Working in the natural anthrax system of Etosha National Park, Namibia, we collected 154 serum samples from plains zebra (Equus quagga), 21 from springbok (Antidorcas marsupialis) and 45 from African elephants (Loxodonta africana) over 2-3 years, resampling individuals when possible for seasonal and longitudinal comparisons. We used enzyme-linked immunosorbent assays to measure anti-anthrax antibody titres and developed three increasingly conservative models to determine endpoint titres with more rigourous, objective mensuration. Between 52 and 87% of zebra, 0-15% of springbok and 3-52% of elephants had measurable anti-anthrax antibody titres, depending on the model used. While the ability of elephants and springbok to mount anti-anthrax adaptive immune responses is still equivocal, our results indicate that zebra in ENP often survive sublethal anthrax infections, encounter most B. anthracis in the wet season and can partially booster their immunity to B. anthracis. Thus, rather than being solely a lethal disease, anthrax often occurs as a sublethal infection in some susceptible hosts. Though we found that adaptive immunity to anthrax wanes rapidly, subsequent and frequent sublethal B. anthracis infections cause maturation of anti-anthrax immunity. By triggering host immune responses, these common sublethal infections may act as

Where is the game? Wild meat products authentication in South Africa: a case study.

Science.gov (United States)

D'Amato, Maria Eugenia; Alechine, Evguenia; Cloete, Kevin Wesley; Davison, Sean; Corach, Daniel

2013-03-01

Wild animals' meat is extensively consumed in South Africa, being obtained either from ranching, farming or hunting. To test the authenticity of the commercial labels of meat products in the local market, we obtained DNA sequence information from 146 samples (14 beef and 132 game labels) for barcoding cytochrome c oxidase subunit I and partial cytochrome b and mitochondrial fragments. The reliability of species assignments were evaluated using BLAST searches in GenBank, maximum likelihood phylogenetic analysis and the character-based method implemented in BLOG. The Kimura-2-parameter intra- and interspecific variation was evaluated for all matched species. The combined application of similarity, phylogenetic and character-based methods proved successful in species identification. Game meat samples showed 76.5% substitution, no beef samples were substituted. The substitutions showed a variety of domestic species (cattle, horse, pig, lamb), common game species in the market (kudu, gemsbok, ostrich, impala, springbok), uncommon species in the market (giraffe, waterbuck, bushbuck, duiker, mountain zebra) and extra-continental species (kangaroo). The mountain zebra Equus zebra is an International Union for Conservation of Nature (IUCN) red listed species. We also detected Damaliscus pygargus, which is composed of two subspecies with one listed by IUCN as 'near threatened'; however, these mitochondrial fragments were insufficient to distinguish between the subspecies. The genetic distance between African ungulate species often overlaps with within-species distance in cases of recent speciation events, and strong phylogeographic structure determines within-species distances that are similar to the commonly accepted distances between species. The reliability of commercial labeling of game meat in South Africa is very poor. The extensive substitution of wild game has important implications for conservation and commerce, and for the consumers making decisions on the basis of

Equine infectious anemia prevalence in feral donkeys from Northeast Brazil.

Science.gov (United States)

Oliveira, Fernanda G; Cook, R Frank; Naves, João H F; Oliveira, Cairo H S; Diniz, Rejane S; Freitas, Francisco J C; Lima, Joseney M; Sakamoto, Sidnei M; Leite, Rômulo C; Issel, Charles J; Reis, Jenner K P

2017-05-01

Equine infectious anemia virus (EIAV) is an important cause of morbidity and mortality throughout the world. Although the virus infects all members of the Equidae the vast majority of studies have been conducted in horses (Equus caballus) with comparatively little information available for other equid species. Brazil has one of the most abundant donkey (E. asinus) populations of any nation although the economic importance of these animals is declining as transportation becomes increasingly mechanized. As a result, considerable numbers of donkeys especially in the Northeast of the country have been released and allowed pursue an almost feral existence. Consequently, this large and growing population constitutes a significant risk as a reservoir for the maintenance and transmission of important equine infectious diseases such as glanders and equine arteritis virus in addition to EIAV. This study examines the prevalence of EIA in a semi-wild donkey population from Mossoró city, in Northeast Brazil, using AGID followed by cELISA, rgp90 ELISA and immunoblot (IB). Serum samples were collected from 367 donkeys without obvious EIA clinical signs. Subsequent testing revealed seropositive rates of 1.6% (6/367) in officially approved AGID tests, 3.3% (12/367) in cELISA and 14.4% (53/367) in the rgp90 ELISA. However, 88.7% (47/53) of the rgp90 ELISA positive samples were almost certainly false reactions because they failed to react with two or more antigens in IB. Consequently, the rpg90 ELISA has a similar sensitivity to AGID with donkey serum samples. Such high false positive rates have not been observed previously with serum samples from horses. Another highly significant finding is that 56.9% (33/58) of the donkey serum samples tested in IB had reactivity to EIAV p26 only. Although this could result from recent infection with the virus, it has been found that in some equids p26 only reactivity persists for extensive periods of time suggesting exposure to antigens

Effect of feeding glucose, fructose, and inulin on blood glucose and insulin concentrations in normal ponies and those predisposed to laminitis.

Science.gov (United States)

Borer, K E; Bailey, S R; Menzies-Gow, N J; Harris, P A; Elliott, J

2012-09-01

Identification of ponies (Equus caballus) at increased risk of pasture-associated laminitis would aid in the prevention of the disease. Insulin resistance has been associated with laminitis and could be used to identify susceptible individuals. Insulin resistance may be diagnosed by feeding supplementary water-soluble carbohydrate (WSC) and measuring blood glucose and insulin concentrations. The aim of this study was to assess the glycemic and insulinemic responses of 7 normal (NP) and 5 previously laminitic (PLP), mixed breed, native UK ponies fed glucose, fructose, and inulin [1 g/(kg·d) for 3 d] or no supplementary WSC (control) in spring and fall after a 7-d adaptation to a pasture or hay diet. Blood samples were taken for 12 h after feeding on each day, and baseline and peak concentrations and area under the curve (AUC) for glucose and insulin were recorded. Linear mixed models were used for statistical analysis. Differences between PLP and NP groups were most marked after glucose feeding with differences in peak glucose (P = 0.02) and peak insulin (P = 0.016) concentrations. Season and diet adaptation also affected results. Peak concentrations of glucose and insulin occurred 2 to 4 h after WSC feeding. Peak insulin concentration was greater and more variable in fall, particularly in PLP adapted to fall pasture. Baseline glucose and insulin concentrations varied between individuals and with season and diet adaptation but were not greater in PLP than NP. Insulin AUC was greater in PLP than NP after feeding both glucose and fructose (P = 0.017), but there were no differences between PLP and NP in glucose AUC. Glycemic and insulinemic changes were less (P ≤ 0.05) after feeding fructose than glucose, although differences between PLP and NP were still evident. Minimal changes in glucose and insulin concentrations occurred after inulin feeding. Measurement of peak insulin 2 h after feeding of a single dose of glucose (1 g/kg) may be a simple and practical way to

Seasonal Variations in Heart Rate Variability as an Indicator of Stress in Free-Ranging Pregnant Przewalski's Horses (E. ferus przewalskii within the Hortobágy National Park in Hungary

Directory of Open Access Journals (Sweden)

Friederike Pohlin

2017-09-01

Full Text Available Background: Ecosystems with seasonal fluctuations in climate and food availability present physiological challenges to resident mammals and may cause “stress.” The two predominant physiological responses to stressors are (1 the activation of the hypothalamic-pituitary-adrenal axis and (2 the modulation of the autonomic nervous system. To date, the primary indicator for “stress” in wildlife- and zoo animal research are glucocorticoid levels. By measuring the autonomic regulation of cardiac activity, particularly the vagal tone, heart rate variability (HRV is presently emerging as a suitable indicator of “stress” in farm- and domestic animal research.Objective: The aim of this study was to use HRV, a novel method in wildlife research, to assess seasonal patterns of “stress” in a group of free-ranging Przewalski's horses (Equus ferus przewalskii.Methods: Six pregnant Przewalski's horses from one harem within the Hortobágy National Park in Hungary were subjected to the study. We used a dedicated telemetry system consisting of a subcutaneously implanted transmitter and a receiver and storage unit in a collar to record HRV, heart rate (HR, subcutaneous body temperature, and activity throughout a one-year study period—climate data was also collected. We defined “stress” as a decrease in parasympathetic nervous system tone and calculated RMSSD (root mean square of successive differences as a measure of HRV. Linear mixed effects models with random intercept per individual were used for statistical analysis.Results: HRV and HR varied considerably throughout the year. Similar to temperate ruminants and hibernating mammals, Przewalski's horses experienced lower HR and HRV during winter, when resources are limited indicating decreased metabolic rates coupled with “stress.” In spring, we observed a drop of HRV along with a peak in HR indicating an increase of allostatic load that is most likely associated with increased energy

Middle Pleistocene protein sequences from the rhinoceros genus Stephanorhinus and the phylogeny of extant and extinct Middle/Late Pleistocene Rhinocerotidae.

Science.gov (United States)

Welker, Frido; Smith, Geoff M; Hutson, Jarod M; Kindler, Lutz; Garcia-Moreno, Alejandro; Villaluenga, Aritza; Turner, Elaine; Gaudzinski-Windheuser, Sabine

2017-01-01

Ancient protein sequences are increasingly used to elucidate the phylogenetic relationships between extinct and extant mammalian taxa. Here, we apply these recent developments to Middle Pleistocene bone specimens of the rhinoceros genus Stephanorhinus . No biomolecular sequence data is currently available for this genus, leaving phylogenetic hypotheses on its evolutionary relationships to extant and extinct rhinoceroses untested. Furthermore, recent phylogenies based on Rhinocerotidae (partial or complete) mitochondrial DNA sequences differ in the placement of the Sumatran rhinoceros ( Dicerorhinus sumatrensis ). Therefore, studies utilising ancient protein sequences from Middle Pleistocene contexts have the potential to provide further insights into the phylogenetic relationships between extant and extinct species, including Stephanorhinus and Dicerorhinus . ZooMS screening (zooarchaeology by mass spectrometry) was performed on several Late and Middle Pleistocene specimens from the genus Stephanorhinus , subsequently followed by liquid chromatography-tandem mass spectrometry (LC-MS/MS) to obtain ancient protein sequences from a Middle Pleistocene Stephanorhinus specimen. We performed parallel analysis on a Late Pleistocene woolly rhinoceros specimen and extant species of rhinoceroses, resulting in the availability of protein sequence data for five extant species and two extinct genera. Phylogenetic analysis additionally included all extant Perissodactyla genera ( Equus , Tapirus ), and was conducted using Bayesian (MrBayes) and maximum-likelihood (RAxML) methods. Various ancient proteins were identified in both the Middle and Late Pleistocene rhinoceros samples. Protein degradation and proteome complexity are consistent with an endogenous origin of the identified proteins. Phylogenetic analysis of informative proteins resolved the Perissodactyla phylogeny in agreement with previous studies in regards to the placement of the families Equidae, Tapiridae, and

Inorganic elements determination in human and animal whole blood samples by X-ray fluorescence technique (EDXRF); Determinacao de elementos quimicos inorganicos em amostras de sangue total humano e de animais de experimentacao (hamster dourado e cavalo da raca crioula) pela tecnica de fluorescencia de raios X (EDXRF)

Energy Technology Data Exchange (ETDEWEB)

Redigolo, Marcelo Miyada

2011-07-01

Blood is a suspension of cells contained in a complex liquid called plasma. The term 'whole blood' refers to samples with both solid and liquid parts. Inorganic elements are responsible for essential functions, such as osmotic regulation, cardiac frequency and contractibility, blood clotting and neuromuscular excitability. The determination of inorganic elements in corporeal fluids such as blood, serum, plasma, tissue and urine is used as a monitor for a part or the whole organism. In this work, the X-Ray fluorescence technique (EDXRF) was used for the determination of inorganic elements in whole blood samples from humans and animals (golden hamsters, Mesocricetus auratus and crioula breed horses, Equus caballus). The reference intervals of Na (1788 - 1826 {mu}g g'-{sup 1}), Mg (63 - 75 {mu}g g{sup -1}), P (602 - 676 {mu}g g{sup -1}), S (1519 - 1718 {mu}g g{sup -1}), Cl (2743 - 2867 {mu}g g{sup -1}), K (1508 - 1630 {mu}g g{sup -1}), Ca (214 - 228 {mu}g g'-{sup 1}), Cu (4 -6 {mu}g g{sup -1}) e Zn (1 - 3 {mu}g g'-{sup 1}) were determined for human blood. The reference intervals, for golden hamster blood were found to be: Na (1714 - 1819 {mu}g g{sup -1}), Mg (51 - 79 {mu}g g{sup -1}), P (970 - 1080 {mu}g g{sup -1}), S (1231 - 1739 {mu}g g{sup -1}), Cl (2775 - 2865 {mu}g g{sup -1}), K (1968 - 2248 {mu}g g{sup -1}), Ca (209 - 257 {mu}g g-1), Cu (4 - 6 {mu}g g{sup -1}) e Zn (3 - 5 {mu}g g{sup -1}). The reference intervals, for crioula breed horse blood, showed to be: Na (1955 - 2013 {mu}g g{sup -1}), Mg (51 - 75 {mu}g g{sup -1}), P (443 - 476 {mu}g g{sup -1}), S (1038 - 1140 {mu}g g{sup -}'1), Cl (2388 - 2574 {mu}g g{sup -1}), K (1678 - 1753 {mu}g g{sup -1}), Ca (202 - 213 {mu}g g{sup -1}), Cu (4,1 - 4,5 {mu}g g{sup -1}) e Zn (2,0 - 2,2 {mu}g g{sup -1}). Comparative study between NAA and EDXRF, both techniques showed the same performance for the analyses of biological matrices. The results contribute for the establishment of reference

Pathology and immunohistochemistry of papillomavirus-associated cutaneous lesions in Cape mountain zebra, giraffe, sable antelope and African buffalo in South Africa

Directory of Open Access Journals (Sweden)

J. H. Williams

2011-04-01

Full Text Available Skin lesions associated with papillomaviruses have been reported in many animal species and man. Bovine papillomavirus (BVP affects mainly the epidermis, but also the dermis in several species including bovine, the best-known example being equine sarcoid, which is associated with BVP types 1 and 2. This publication describes and illustrates the macroscopic and histological appearance of BPV-associated papillomatous, fibropapillomatous or sarcoid-like lesions in Cape mountain zebra (Equus zebra zebra from the Gariep Dam Nature Reserve, 2 giraffes (Giraffa camelopardalis from the Kruger National Park, and a sable antelope (Hippotragus niger from the Kimberley area of South Africa. An African buffalo (Syncerus caffer cow from Kruger National Park also had papillomatous lesions but molecular characterisation of lesional virus was not done. Immunohistochemical staining using polyclonal rabbit antiserum to chemically disrupted BPV-1, which cross-reacts with the L1 capsid of most known papillomaviruses, was positive in cells of the stratum granulosum of lesions in Giraffe 1, the sable and the buffalo and negative in those of the zebra and Giraffe 2. Fibropapillomatous and sarcoid-like lesions from an adult bovine were used as positive control for the immunohistochemistry and are described and the immunohistochemistry illustrated for comparison. Macroscopically, both adult female giraffe had severely thickened multifocal to coalescing nodular and occasionally ulcerated lesions of the head, neck and trunk with local poorly-circumscribed invasion into the subcutis. Necropsy performed on the 2nd giraffe revealed neither internal metastases nor serious underlying disease. Giraffe 1 had scattered, and Giraffe 2 numerous, large, anaplastic, at times indistinctly multinucleated dermal fibroblasts with bizarre nuclei within the sarcoid-like lesions, which were BPV-1 positive in Giraffe 1 and BPV-1 and -2 positive in Giraffe 2 by RT-PCR. The sable antelope

Mapping of Vegetation with the Geoinformation System and Determining of Carrying Capacity of the Pre-Urals Steppe area for a Newly Establishing Population of the Przewalski Horse Equus ferus przewalskii at the Orenburg State Nature Reserve

Science.gov (United States)

Fedorov, N. I.; Mikhailenko, O. I.; Zharkikh, T. L.; Bakirova, R. T.

2018-01-01

Mapping of the vegetation (1:25000) of the Pre-Urals Steppe area at the Orenburg State Nature Reserve was completed in 2016. A map created with the geoinformation system contains 1931 simple and complex polygons for 25 types of vegetation. In a drought year, the average stock of palatable vegetation of the whole area is estimated at 8380 tons dry weight. The estimation is based on the size of areas covered by different types of vegetation, their grass production, the correction coefficients for decreasing of pasture forage stocks in winter and decreasing of production of grass communities in dry years. Based on pasture forage stocks the area could tolerate the maximum population size of 1769 individuals of the Przewalski horse, their average density could be 0.11 horse per ha. Yet, as watering places for animals are limited in Pre-Urals Steppe, grazing pressures on the vegetation next to the water sources may increase in dry years. That is why the above-mentioned calculated maximum population size and density must be reduced at least by half until some additional watering places are established and monitoring of the grazing effect on the vegetation next to the places is carried out regularly. Thus, the maximum size of the population is estimated at 800 to 900 individuals, which is almost 1.5 times more than necessary to establish a self-sustained population of the Przewalski horse.

Population ecology of feral horses in an era of fertility control management

Science.gov (United States)

Ransom, J.I.

2012-01-01

Management of wildlife often requires intervention to regulate growth of populations that would otherwise become overabundant. Controlling fecundity using contraceptives has become an increasingly popular tool for attempting to manage locally overabundant wildlife species, but the population-level effects of such applications are largely unknown. Contraceptive treatments can produce unexpected feedbacks that act on births, survival, immigration, and emigration. Such feedbacks may considerably influence our ability to regulate populations using fertility control. I followed feral horses (Equus caballus) in three intensively managed populations to assess longitudinal treatment effects on demography. The transient contraceptive porcine zona pellucida (PZP) produced longer duration of infertility than intended. Repeated PZP vaccinations of females extended the duration of infertility far beyond the targeted management period, with time to first post-treatment parturition increasing 411days for every annual inoculation received. When these animals did conceive and give birth, parturition was later in the year and temporally asynchronous with forage abundance. An average of 30% (range=11–77%) of females were contracepted annually during the treatment period in all three populations and apparent annual population growth rate was 4–9% lower in the post-treatment years as compared to pretreatment years. Population growth was positive, however, and increased steadily every year that a management removal did not occur. The observed number of births was 33% fewer than the expected number of births, based on number of treated females, individual efficacy of treatment, and number of untreated females and their age-specific fecundity rates. Only half of this difference was explained by the apparent residual effect of treatment. Birth rate in the youngest untreated females (age 2–5 years old) was reduced in years when their conspecifics were treated, enhancing the effects of

Macromammalian faunas, biochronology and palaeoecology of the early Pleistocene Main Quarry hominin-bearing deposits of the Drimolen Palaeocave System, South Africa.

Science.gov (United States)

Adams, Justin W; Rovinsky, Douglass S; Herries, Andy I R; Menter, Colin G

2016-01-01

(Orycteropus cf. afer) that are rarely recovered from regional site deposits. Despite the diversity within the DMQ macromammalian faunas, there are few habitat- or biochronologically-sensitive species that provide specific ecologic or age boundaries for the deposits. Recovered species can only support the non-specific, mixed open-to-closed palaeohabitats around Drimolen that have been reconstructed for the other penecontemporaneous South African palaeokarst deposits. The identified Equus quagga ssp. specimens recovered from the floor of the current excavation (∾-4.5-5 m below datum) suggests that most, if not all the DMQ specimens, were deposited after 2.33 Ma. Simultaneously, the carnivore specimens (D. cf. barlowi, L. silberbergi) suggest earlier Pleistocene (pre- 2.0-1.8 Ma) to maximally 1.6 Ma deposition (D. aff. piveteaui) for most of the DMQ fossil assemblage.

Macromammalian faunas, biochronology and palaeoecology of the early Pleistocene Main Quarry hominin-bearing deposits of the Drimolen Palaeocave System, South Africa

Directory of Open Access Journals (Sweden)

Justin W. Adams

2016-04-01

and aardvark (Orycteropus cf. afer that are rarely recovered from regional site deposits. Despite the diversity within the DMQ macromammalian faunas, there are few habitat- or biochronologically-sensitive species that provide specific ecologic or age boundaries for the deposits. Recovered species can only support the non-specific, mixed open-to-closed palaeohabitats around Drimolen that have been reconstructed for the other penecontemporaneous South African palaeokarst deposits. The identified Equus quagga ssp. specimens recovered from the floor of the current excavation (∾−4.5–5 m below datum suggests that most, if not all the DMQ specimens, were deposited after 2.33 Ma. Simultaneously, the carnivore specimens (D. cf. barlowi, L. silberbergi suggest earlier Pleistocene (pre- 2.0–1.8 Ma to maximally 1.6 Ma deposition (D. aff. piveteaui for most of the DMQ fossil assemblage.

Molecular Cloning, Characterization and Predicted Structure of a Putative Copper-Zinc SOD from the Camel, Camelus dromedarius

Directory of Open Access Journals (Sweden)

Ajamaluddin Malik

2012-01-01

Full Text Available Superoxide dismutase (SOD is the first line of defense against oxidative stress induced by endogenous and/or exogenous factors and thus helps in maintaining the cellular integrity. Its activity is related to many diseases; so, it is of importance to study the structure and expression of SOD gene in an animal naturally exposed most of its life to the direct sunlight as a cause of oxidative stress. Arabian camel (one humped camel, Camelus dromedarius is adapted to the widely varying desert climatic conditions that extremely changes during daily life in the Arabian Gulf. Studying the cSOD1 in C. dromedarius could help understand the impact of exposure to direct sunlight and desert life on the health status of such mammal. The full coding region of a putative CuZnSOD gene of C. dromedarius (cSOD1 was amplified by reverse transcription PCR and cloned for the first time (gene bank accession number for nucleotides and amino acids are JF758876 and AEF32527, respectively. The cDNA sequencing revealed an open reading frame of 459 nucleotides encoding a protein of 153 amino acids which is equal to the coding region of SOD1 gene and protein from many organisms. The calculated molecular weight and isoelectric point of cSOD1 was 15.7 kDa and 6.2, respectively. The level of expression of cSOD1 in different camel tissues (liver, kidney, spleen, lung and testis was examined using Real Time-PCR. The highest level of cSOD1 transcript was found in the camel liver (represented as 100% followed by testis (45%, kidney (13%, lung (11% and spleen (10%, using 18S ribosomal subunit as endogenous control. The deduced amino acid sequence exhibited high similarity with Cebus apella (90%, Sus scrofa (88%, Cavia porcellus (88%, Mus musculus (88%, Macaca mulatta (87%, Pan troglodytes (87%, Homo sapiens (87%, Canis familiaris (86%, Bos taurus (86%, Pongo abelii (85% and Equus caballus (82%. Phylogenetic analysis revealed that cSOD1 is grouped together with S. scrofa. The

Molecular cloning, characterization and predicted structure of a putative copper-zinc SOD from the camel, Camelus dromedarius.

Science.gov (United States)

Ataya, Farid S; Fouad, Dalia; Al-Olayan, Ebtsam; Malik, Ajamaluddin

2012-01-01

Superoxide dismutase (SOD) is the first line of defense against oxidative stress induced by endogenous and/or exogenous factors and thus helps in maintaining the cellular integrity. Its activity is related to many diseases; so, it is of importance to study the structure and expression of SOD gene in an animal naturally exposed most of its life to the direct sunlight as a cause of oxidative stress. Arabian camel (one humped camel, Camelus dromedarius) is adapted to the widely varying desert climatic conditions that extremely changes during daily life in the Arabian Gulf. Studying the cSOD1 in C. dromedarius could help understand the impact of exposure to direct sunlight and desert life on the health status of such mammal. The full coding region of a putative CuZnSOD gene of C. dromedarius (cSOD1) was amplified by reverse transcription PCR and cloned for the first time (gene bank accession number for nucleotides and amino acids are JF758876 and AEF32527, respectively). The cDNA sequencing revealed an open reading frame of 459 nucleotides encoding a protein of 153 amino acids which is equal to the coding region of SOD1 gene and protein from many organisms. The calculated molecular weight and isoelectric point of cSOD1 was 15.7 kDa and 6.2, respectively. The level of expression of cSOD1 in different camel tissues (liver, kidney, spleen, lung and testis) was examined using Real Time-PCR. The highest level of cSOD1 transcript was found in the camel liver (represented as 100%) followed by testis (45%), kidney (13%), lung (11%) and spleen (10%), using 18S ribosomal subunit as endogenous control. The deduced amino acid sequence exhibited high similarity with Cebus apella (90%), Sus scrofa (88%), Cavia porcellus (88%), Mus musculus (88%), Macaca mulatta (87%), Pan troglodytes (87%), Homo sapiens (87%), Canis familiaris (86%), Bos taurus (86%), Pongo abelii (85%) and Equus caballus (82%). Phylogenetic analysis revealed that cSOD1 is grouped together with S. scrofa. The

Experimental induction of equine protozoal myeloencephalitis in horses using Sarcocystis sp. sporocysts from the opossum (Didelphis virginiana).

Science.gov (United States)

Fenger, C K; Granstrom, D E; Gajadhar, A A; Williams, N M; McCrillis, S A; Stamper, S; Langemeier, J L; Dubey, J P

1997-02-01

Sarcocystis sp. sporocysts isolated from eight feral opossums (Didelphis virginiana) were pooled and fed to 18 commercially reared budgerigars (Melopsittacus undulatus), 14 wild-caught sparrows (Passer domesticus), one wild-caught slate-colored Junco (Junco hyemalis) and five weanling horses (Equus caballus). All budgerigars died within 5 weeks post inoculation (wpi). Histologic examination revealed meronts within the pulmonary epithelia and typical Sarcocystis falcatula sarcocysts developing in the leg muscles. Sparrows were euthanized 13 and 17 wpi and their carcasses were fed to four laboratory raised opossums. Sporocysts were detected in the feces of two opossums on 15 days post inoculation (dpi) and in a third opossum on 40 dpi. Fecal samples from the fourth opossum remained negative; however, sporocysts were found in intestinal digests from all four opossums. Sporocysts were not found in feces or intestinal digest of an additional opossum that was fed three uninoculated sparrows. Five foals were fed sporocysts (Foals 2, 3, 4, 5, and 7) and two foals were maintained as uninoculated controls (Foals 1 and 6). Sporocysts from two additional feral opossums also were fed to foals. Foal 5 was given 0.05 mg kg-1 dexamethasone sodium phosphate daily beginning 2 days before inoculation for a total of 2 weeks. Horse sera were tested three times per week, and cerebrospinal fluid (CSF) samples were tested biweekly for anti-Sarcocystis neurona antibodies by Western blot analysis. No foals had any S. neurona-specific antibodies by Western blot analysis prior to sporocysts ingestion. Seroconversion occurred in Foals 3, 5, and 7 by 24 dpi, followed by positive CSF tests on 28 dpi. Foals 2 and 4 seroconverted by 40 dpi. Cerebrospinal fluid from Foal 2 tested positive by 42 dpi, but Foal 4 remained seronegative throughout the study. Sera and CSF from control Foals 1 and 6 remained seronegative. All foals with positive CSF developed neurologic clinical signs. Neurologic disease

Behavior of feral horses in response to culling and GnRH immunocontraception

Science.gov (United States)

Ransom, Jason I.; Powers, Jenny G.; Garbe, Heidi M.; Oehler, Michael W.; Nett, Terry M.; Baker, Dan L.

2014-01-01

Wildlife management actions can alter fundamental behaviors of individuals and groups,which may directly impact their life history parameters in unforeseen ways. This is especially true for highly social animals because changes in one individual’s behavior can cascade throughout its social network. When resources to support populations of social animals are limited and populations become locally overabundant, managers are faced with the daunting challenge of decreasing population size without disrupting core behavioral processes. Increasingly, managers are turning to fertility control technologies to supplement culling in efforts to suppress population growth, but little is quantitatively known about how either of these management tools affects behavior. Gonadotropin releasing hormone (GnRH) is a small neuropeptide that performs an obligatory role in mammalian reproduction and has been formulated into the immunocontraceptive GonaCon-BTM. We investigated the influences of this vaccine on behavior of feral horses (Equus caballus) at Theodore Roosevelt National Park, North Dakota, USA, for a year preceding and a year following nonlethal culling and GnRH-vaccine treatment. We observed horses during the breeding season and found only minimal differences in time budget behaviors of free-ranging female feral horses treated with GnRH and those treated with saline. The differences observed were consistent with the metabolic demands of pregnancy and lactation. We observed similar social behaviors between treatment groups, reflecting limited reproductive behavior among control females due to high rates of pregnancy and suppressed reproductive behavior among treated females due to GnRH-inhibited ovarian activity. In the treatment year, band stallion age was the only supported factor influencing herding behavior (P < 0.001), harem-tending behavior (P < 0.001), and agonistic behavior (P = 0.02). There was no difference between the mean body condition of control females (4

Ecological Monitoring and Compliance Program 2006 Report

Energy Technology Data Exchange (ETDEWEB)

David C. Anderson; Paul D. Greger; Derek B. Hall; Dennis J. Hansen; William K. Ostler

2007-03-01

The Ecological Monitoring and Compliance program (EMAC), funded through the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office (NNSA/NSO), monitors the ecosystem of the Nevada Test Site (NTS) and ensures compliance with laws and regulations pertaining to NTS biota. This report summarizes the program's activities conducted by National Security Technologies LLC (NSTec) during the Calendar Year 2006. Program activities included: (a) biological surveys at proposed construction sites, (b) desert tortoise compliance, (c) ecosystem mapping and data management, (d) sensitive plant species monitoring, (e) sensitive and protected/regulated animal monitoring, (f) habitat monitoring, (g) habitat restoration monitoring, and (h) monitoring of the Nonproliferation Test and Evaluation Complex (NPTEC). Sensitive and protected/regulated species of the NTS include 44 plants, 1 mollusk, 2 reptiles, over 250 birds, and 26 mammals protected, managed, or considered sensitive as per state or federal regulations and natural resource agencies and organizations. The threatened desert tortoise (Gopherus agassizii) is the only species on the NTS protected under the Endangered Species Act. Biological surveys for the presence of sensitive and protected/regulated species and important biological resources on which they depend were conducted for 34 projects. A total of 342.1 hectares (ha) (845.37 acres [ac]) was surveyed for these projects. Sensitive and protected/regulated species and important biological resources found included: 2 inactive tortoise burrows, 2 western burrowing owls (Athene cunicularia hypugaea), several horses (Equus caballus), 2 active predator burrows, mature Joshua trees (Yucca brevifolia), yuccas and cacti; and also 1 bird nest (2 eggs), 1 barn owl (Tyto alba) and 2 great-horned owls (Bubo virginianus). NSTec provided a written summary report of all survey findings and mitigation recommendations, where applicable. All flagged burrows

Ecological Monitoring and Compliance Program 2006 Report

Energy Technology Data Exchange (ETDEWEB)

David C. Anderson; Paul D. Greger; Derek B. Hall; Dennis J. Hansen; William K. Ostler

2007-03-01

The Ecological Monitoring and Compliance program (EMAC), funded through the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office (NNSA/NSO), monitors the ecosystem of the Nevada Test Site (NTS) and ensures compliance with laws and regulations pertaining to NTS biota. This report summarizes the program's activities conducted by National Security Technologies LLC (NSTec) during the Calendar Year 2006. Program activities included: (a) biological surveys at proposed construction sites, (b) desert tortoise compliance, (c) ecosystem mapping and data management, (d) sensitive plant species monitoring, (e) sensitive and protected/regulated animal monitoring, (f) habitat monitoring, (g) habitat restoration monitoring, and (h) monitoring of the Nonproliferation Test and Evaluation Complex (NPTEC). Sensitive and protected/regulated species of the NTS include 44 plants, 1 mollusk, 2 reptiles, over 250 birds, and 26 mammals protected, managed, or considered sensitive as per state or federal regulations and natural resource agencies and organizations. The threatened desert tortoise (Gopherus agassizii) is the only species on the NTS protected under the Endangered Species Act. Biological surveys for the presence of sensitive and protected/regulated species and important biological resources on which they depend were conducted for 34 projects. A total of 342.1 hectares (ha) (845.37 acres [ac]) was surveyed for these projects. Sensitive and protected/regulated species and important biological resources found included: 2 inactive tortoise burrows, 2 western burrowing owls (Athene cunicularia hypugaea), several horses (Equus caballus), 2 active predator burrows, mature Joshua trees (Yucca brevifolia), yuccas and cacti; and also 1 bird nest (2 eggs), 1 barn owl (Tyto alba) and 2 great-horned owls (Bubo virginianus). NSTec provided a written summary report of all survey findings and mitigation recommendations, where applicable. All flagged burrows

Demography of the Pryor Mountain wild horses, 1993-2007

Science.gov (United States)

Roelle, James E.; Singer, Francis J.; Zeigenfuss, Linda C.; Ransom, Jason I.; Coates-Markle, Linda; Schoenecker, Kathryn A.

2010-01-01

Wild horses (Equus caballus) at Pryor Mountain were studied by direct observation from 1993 through 2007. All horses present were individually identifiable on the basis of coat coloration, head and leg markings, gender, and band associations. Of the 609 horses either present prior to foaling in 1993 or born since, ages were precisely known for 491 (observed as a foal). Ages for 52 horses were estimated through tooth eruption and wear patterns, and for the remaining 66 horses through body size, morphology, and anecdotal evidence concerning when they were present on the range. At varying intensities, never less than 30 days per year, all horses were inventoried and their band associations noted. Foals were paired with dams based on observations of attachment during the early days and weeks of life. Year of death was determined by identification of the carcass where possible. In the absence of finding a carcass, an animal that was not observed for 2 years was considered to have died in the year that it went missing. Animals that were removed from the herd and mares that were part of a contraception study were excluded from calculations of survival and foaling rates, respectively, as appropriate. The average prefoaling population over the 15 years of the study was 148.8 animals (range = 120-187), and the annual foal crop averaged 32.1 (range = 23-40). Large removals (19-60 animals) in four years helped maintain the herd at this level; apparent growth rate (calculated as though removals had not occurred) was 9.6 percent annually (? = 1.096, range = 0.977-1.220). This annual growth rate is relatively low compared to that for many western horse herds, at least in part because of a decline in foal survival. Sex ratio of the foal crop varied widely among years, but pooled across years did not differ from 50:50. Sex ratio in the herd changed mostly as a result of removals. The average age of both males and females in the herd increased during the course of the study. Annual

Bighorn sheep (Ovis canadensis) survivorship and habitat studies in Bighorn Canyon National Recreation Area and surrounding lands, Wyoming and Montana, 2000–2003

Science.gov (United States)

Schoenecker, Kathryn A.; Singer, Francis J.; Grams, Kayla A.; Roelle, James E.

2004-01-01

In the 1850s, bighorn sheep (Ovis canadensis) were numerous and distributed throughout the Bighorn and Pryor Mountains of Montana and Wyoming. After European settlement, bighorn sheep populations declined, and local extinctions occurred in much of their historic range in the western United States. The current bighorn sheep population of Bighorn Canyon National Recreation Area (BICA) is the product of several reintroductions into BICA and surrounding lands. Following a release in 1973 and growth rates near maximum potential of 19.8% per year, the population grew to an estimated peak population of about 211 animals in 1993 and 1994 (Kissell and others, 1996). Recent counts indicate the bighorn sheep population has declined. Kissell and others (1996) reported that the population began to decline rapidly in 1995 and 1996. He noted low ewe:lamb ratios during the decline phase. Bighorn sheep numbers declined to the lowest minimum viable population size of 100 animals recommended by several bighorn sheep experts (Bailey, 1990; Berger, 1990; Smith and others, 1991). National Park Service (NPS) and Bureau of Land Management (BLM) managers were concerned about the decline and requested a study of its causes. In 2000, the U.S. Geological Survey- Biological Resources Division (USGS-BRD) received funding to start a 3-year study of survivorship, condition, and population growth rate of the BICA bighorn sheep population.Several possibilities exist for the bighorn sheep decline. The herd may have experienced a rapid population expansion, followed by a decline to stability at a lower long-term carrying capacity. This pattern of apparently overshooting carrying capacity following an initial release has been reported for a number of ungulates (Caughley, 1976). Disease may have caused the decline; predation and/or competition with wild horses (Equus caballus) may also have been factors. A spatial model of wild horse carrying capacity (Coughenour, 1999) was developed to assist managers

Geoarchaeologic and paleopedologic evidences for the holocene paleoenvironmental evolution of the Crisuri plain (Western Romania

Directory of Open Access Journals (Sweden)

Nicolae Josan

2007-12-01

 : Bos primigenius Boj (fréquent, Equus hemionus, Equus cabalus et Otis tarda. Ces espèces témoignent, pour la deuxième partie de la période Atlantique et bien sûr pour le Sub-boréal, d'un environnement aux aspects évidents d'aridité. La persistance de bonnes conditions paléoenvironnementales ressort cependant du grand nombre de sites présentant des niveaux de culture successifs depuis les anciens sites du Néolithique jusqu'à ceux de l'Âge du Bronze inférieur. Mais le fait qu'un grand nombre de sites se trouvent à l'ouest de la ligne Girişu de Criş-Cefa-Inand, dans un secteur où le niveau des nappes phréatique est actuellement situé à seulement 1-2 m de profondeur, est important à cet égard. Le niveau Coţofeni a été recouvert par les dépôts générés par l'accroissement de l'intensité du régime alluvial au début du Subatlantique (jusqu'à 1400-1000 avant J.C. environ. Ensuite, le climat a été de nouveau relativement sec, ce qui a entraîné l'extension vers l'est de la steppe. Ces conditions ont conduit à une deuxième période très active d'occupation humaine, qui est attestée par le nombre considérable de sites hallstattiens, auxquels se rattachent les artefacts de la culture Basarabi découverts dans l'horizon supérieur humique du site archéologique Girişu de Criş. Leur présence indique une nouvelle phase de relative stabilité environnementale correspondant à la première moitié du dernier millénaire avant J.C..Le site de Râpa est situé en rive droite de la rivière Crişul Negru, non loin de la localité de Tinca, dans le secteur de transition entre les terrasses et les glacis. Le lit de la rivière Crişul Negru se trouve au niveau de dépôts alluviaux, formés par des sables, des argiles et des graviers grossiers (Fig. 4, qui contiennent de nombreux troncs d'arbres de diverses dimensions. Ce niveau alluvial est le résultat d'une crise climatique qui pourrait correspondre à celle qui a fossilisé l'horizon BFS

Movement and habitat use of Sika and White-tailed Deer on Assateague Island national seashore, Maryland

Science.gov (United States)

Diefenbach, Duane R.; Christensen, Sonja

2009-01-01

This research project was conducted to describe habitat use of sika deer (Cervus nippon) and white-tailed deer (Odocoileus virginianus) and possibly attribute the effects of ungulate herbivory to specific deer species, if spatial separation in habitat use could be identified. Sturm (2007) conducted an exclosure study to document the effect of feral horse (Equus caballus) herbivory, deer herbivory, and horse and deer herbivory combined on plant communities. Sturm (2007) found that ungulate herbivory reduced plant species richness, evenness, and diversity in the maritime forest and affected species composition in all habitats studied. Sturm (2007) also found that herbivory on some species could be directly attributable to either horse or deer. However, the effects of sika and white-tailed deer herbivory could not be separated via an exclosure study design because of the difficulty of passively excluding one deer species but not the other. We captured white-tailed deer and sika deer in January–March of 2006 and 2007 throughout the Maryland portion of Assateague Island. Deer were fitted with radio-collars and their survival and locations monitored via ground telemetry. Up to four locations were acquired per deer each week during early (May–June) and late (August–September) growth periods for vegetation on the island. Also, we estimated deer locations during a dormant vegetation period (November– December 2006). We used these data to estimate survival and harvest rates, document movements, and model habitat use. We captured and fitted 50 deer with radio-collars over the course of the study. Of these 50 deer, 36 were sika and 14 were white-tailed deer. Of the 36 sika deer, 10 were harvested, three were likely killed by hunters but not recovered, and one died of natural causes while giving birth. Of the 14 white-tailed deer, three were harvested, one was illegally killed, and two were censored because of study-related mortality. Annual survival was 0.48 (95% CI

Ecological Monitoring and Compliance Program 2014 Report

Energy Technology Data Exchange (ETDEWEB)

Hall, Derek B. [National Security Technologies, LLC, Las Vegas, Nevada (United States); Anderson, David C. [National Security Technologies, LLC, Las Vegas, Nevada (United States); Greger, Paul D. [National Security Technologies, LLC, Las Vegas, Nevada (United States); Ostler, W. Kent [National Security Technologies, LLC, Las Vegas, Nevada (United States)

2015-05-12

statewide database. No field surveys were conducted this year for sensitive plants on the NNSS due to poor growing conditions. Surveys of sensitive and protected/regulated animals during 2014 focused on winter raptors, bats, wild horses (Equus caballus), mule deer (Odocoileus hemionus), desert bighorn sheep (Ovis Canadensis nelsoni), and mountain lions (Puma concolor). Two permanent, long-term winter raptor survey routes were established and sampled in January and February. A total of 27 raptors representing 4 species were observed. The wild horse population increased from 30 to 41, with several yearlings recruiting into the population, possibly due to the death of a mountain lion known to prey on horse foals. Mule deer abundance and density measured with standardized deer surveys was similar to 2013 and appears to be stable. Desert bighorn sheep, including rams, ewes, and lambs, were detected using motion-activated cameras at four water sources. There are plans to conduct helicopter surveys to census the population during September 2015 and then capture and radio-collar up to 20 sheep during November 2015. Over 150 sheep scat samples have been collected for genetic analysis to try to determine how sheep on the NNSS are related to surrounding sheep populations. Information is presented about bird mortalities, Migratory Bird Treaty Act compliance, and a summary of nuisance animals and their control on the NNSS. A total of 93 mountain lion images (i.e., photographs or video clips) were taken during 220,379 camera hours at 16 of 32 sites sampled and another 11,946 images of at least 29 species other than mountain lions were taken as well. A mountain lion telemetry study continued in 2014. NNSS7 was tracked from January 1 to November 15 using a global positioning system satellite transmitter. He consumed 21 mule deer, 17 desert bighorn sheep, 1 juvenile bobcat, and 3 coyotes. Mule deer were primarily taken in the summer and fall. No new mountain lions were captured. A minimum