WorldWideScience

Sample records for enesekaitseballett hiina moodi

  1. Hiina fenomen / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2002-01-01

    Hiina nüüdiskultuuri avastamisest 1990-ndatel, traditsioonide püsimisest. Hiina praeguse maalikunsti väljapanek 1994. a. Sao Paulo biennaalil, näitus "Pariis-Peking" Pariisis 2002. a. Eesti-Hiina kultuurialane koostöö. Hiina maalikunsti näitus Eesti Rahvusraamatukogus. 2003. a. eesti ehtekunsti näitus Pekingis ja Guangzhou Guangdongi kunstimuuseumis.

  2. Tõusev Hiina / Abdul Turay

    Index Scriptorium Estoniae

    Turay, Abdul, 1967-

    2011-01-01

    Hiina on suur riik suure majandusega ja eestlasedki võiksid sealsele turule minna, kuid Eestis on Idamaad äraunustatud ja Hiinat tundma õppida on raske. Mais teatasid hiinlased, et neil on kavas avada eestikeelne telekanal. Hiina ühiskonna eripäradest. Hiinlaste ja eestlaste sarnasustest ning erinevustest

  3. Aasia: missioon "Hiina" / Xiaotian Zhang

    Index Scriptorium Estoniae

    Zhang, Xiaotian

    2011-01-01

    Hiina ja Põhjamaade ärisuhete pikk ajalugu. Eesti, Soome, Rootsi ja Hiina koostööprogramm BENCH (Beneficial Business Relations between the Central Baltic Region and China, 2007-2013). Diagramm "Soome, Rootsi ja Eesti Kaubavahetus Hiinaga"

  4. Kultuurisild : eesti muinasjutud ilmusid hiina keeles

    Index Scriptorium Estoniae

    2010-01-01

    18. okt. esitleti maailmanäitusel EXPO Hiinas Shanghais esimest eesti keelest hiina keelde tõlgitud raamatut, kogumikku August Jakobsoni ja Friedrich Reinhold Kreutzwaldi muinasjuttudest Jüri Mildebergi illustratsioonidega. Proua Evelin Ilves osales raamatu esitlusel Shanghai Lasteraamatukogus

  5. USA pelgab Hiina tehnoloogialuuret / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2005-01-01

    Hiina Ameerika-vastasest majandusluurest. USA luureameti andmetel on USA-s loodud üle kolme tuhande Hiina firma, kelle ülesandeks on tööstusliku või sõjalise tehnoloogia hankimine. Vt. samas: Hiina firmad ostavad üha suuremaid USA ettevõtteid

  6. Aeg taas Hiina investeerida / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2008-01-01

    Jim Rogers leiab, et Hiina ettevõtete aktsiad on tasemel, kust tasub neid jälle ostma hakata. Diagramm: USA aktsiaturul kaubeldud Hiina indeksaktsia FXI on asunud üles rühkima. Vt. samas: USA börsil on Hiina aktsiaid Eesti investoritel lihtne osta-müüa; Taust

  7. Park World Tour Hiinas / Timo Sild

    Index Scriptorium Estoniae

    Sild, Timo, 1988-

    2012-01-01

    Reisikiri Eesti sportlaste osalemisest septembris Hiinas korraldatud Park World Tour orienteerumisvõistlustel - Changchunis toimunud kahepäevasel Vasa orienteerumisfestivalil, Chongqingi lähistel toimunud Hiina meistrivõistlustel orienteerumissprindis ja Wanshengis toimunud lühiraja Hiina meistrivõistlustel ning Bekingi botaanikaaias toimunud keskkooli ja ülikooli meistrivõistlustel

  8. Kus suitsu, seal tuld : [suitsetamisest Hiinas] / Daniel Stone

    Index Scriptorium Estoniae

    Stone, Daniel

    2016-01-01

    Hiinas elab kolmandik maailma suitsetajatest, kes tõmbavad päevas seitse miljardit sigaretti. Maailma Terviseorganisatsioon prognoosib 2050. aastaks Hiinas kolm miljonit tubakaga seotud surmajuhtumit

  9. The Moody Mask Model

    DEFF Research Database (Denmark)

    Larsen, Bjarke Alexander; Andkjær, Kasper Ingdahl; Schoenau-Fog, Henrik

    2015-01-01

    This paper proposes a new relation model, called "The Moody Mask model", for Interactive Digital Storytelling (IDS), based on Franceso Osborne's "Mask Model" from 2011. This, mixed with some elements from Chris Crawford's Personality Models, is a system designed for dynamic interaction between ch...

  10. Hiina haridusinnovatsioon neljaks tunniks Eestis / Mikk Kasesalk

    Index Scriptorium Estoniae

    Kasesalk, Mikk

    2016-01-01

    Shanghai on Hiina haridussüsteemi edulugu. Sealsete õppeasutuste esindajatega on võimalik kohtuda 13. mail Tallinna ülikoolis toimuval Shanghai haridusmessil. Tallinna ülikoolis on võimalik õppida Aasia uuringute eriala

  11. Hiina õudusunenägu / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2006-01-01

    Kumus on 14. mail dokumentaalfilm Hiina Rahvavabariigi Tiibeti rahvast ja kultuuri hävitavast poliitikast "Tibet : Cray of the Snow Lion" : režissöör Tom Peosay (peaks olema Piozet) : Ameerika Ühendriigid 2002

  12. Hiina tehaste kurb saatus / Dexter Roberts

    Index Scriptorium Estoniae

    Roberts, Dexter

    2008-01-01

    Hiina tootmisettevõtted on tootmiskulude hüppelise kasvu tõttu läbi elamas restruktureerimisfaasi, mille tagajärjel on mitmed ettevõtted sunnitud oma tootmise viima madalama tootmiskuluga piirkondadesse, tootmismahte suurendama efektiivsuse tõstmise ja kaadrivoolavuse peatamise kaudu või tegevuse lõpetama. Tabel: Tootmiskulude hüppeline kasv Hiinas. Lisa: Viited. Vt. samas: Keskklass pihtide vahel

  13. Hiina kunstnikud kaebavad Veneetsia biennaali kohtusse / Maria-Kristiina Soomre

    Index Scriptorium Estoniae

    Soomre, Maria-Kristiina, 1978-

    2000-01-01

    1999. a. Veneetsia biennaalil auhinna võitnud hiina kunstniku Cai Guo Qiangi teos "Veneetsia maksukoguja hoov" on Hiinas tekitanud diskussiooni autoriõiguste teemal. Kaalutakse kohtuasja algatamist Cai Guo Qiangi, Harald Szeemanni ja Veneetsia biennaali vastu

  14. Hiina laste kunstiansambel külastab Eestit / Annika Nigul

    Index Scriptorium Estoniae

    Nigul, Annika

    2004-01-01

    Saku Vallavalitsus ja Saku Muusikakooli ansambel võtsid vastu Hiina laste rahvakunstikollektiivi "Hiina tulevik" Tianjin'i linnast; kontsertidest Tallinna Raekojas 14. aug., Rocca al Mare Vabaõhumuuseumis 15. aug. ja Saku mõisas 17. augustil

  15. Marat otsib Hiinas oma tehast / Alo Lepp ; interv. Mikk Salu

    Index Scriptorium Estoniae

    Lepp, Alo

    2006-01-01

    Marat avas Hiinas kontori ja teeb koostööd 2000 töötajaga tehasega. Marati juhatuse liige vastab küsimustele, mis puudutavad hiinlaste palku, tööpäeva pikkust, ametiühinguid, maksutaset, kontori- ja transpordikulusid, töö- ja elamistingimusi Hiinas. Lisad: Wendre Hiinas; Ligi pool palgast läheb maksudeks

  16. 14. ja 15. X viibivad Hiina kunstiakadeemia kutsel...

    Index Scriptorium Estoniae

    2005-01-01

    Hangzhou rahvusvahelisel moedisainiharidust analüüsival konverentsil viibivad Tartu Kõrgema Kunstikooli rektor Vallo Nuust, tekstiiliosakonna juhataja Aet Ollisaar ja tekstiiliosakonna meister Signe Vilde. TKK delegatsiooni üks eesmärke Hiinas on TKK ja Hiina kunstiakadeemia või mõne teise Hiina kunstikõrgkooli õppejõudude vahetuse programmi algatamine

  17. Ameerika pitser Hiina arhitektuuril / Mid Bungers

    Index Scriptorium Estoniae

    Bungers, Mid

    2005-01-01

    Hiina nüüdisarhitektuurist, terasarhitektuurist, linnaplaneerimisest, arhitektuuribüroodest, koostööst välismaiste arhitektuuribüroodega, Pekingi suurimast arhitektuuribüroost China Architecture Design & Research Group, büroo olümpiaprojektidest. 1 värv. ill

  18. Hiina linna uued ilmed / Katja Koort

    Index Scriptorium Estoniae

    Koort, Katja

    2007-01-01

    Hiina nüüdiskunsti näitus "Linnailmed / City Expressions" Tallinna Kunstihoones kuni 28. I. Osalevad Guangzhou ja Guangzhouga seotud kunstnikud. Kuraatorid Reet Varblane ja Zuo Zhengyao, kujundaja Rosita Raud. Pikemalt Feng Fengi, Yu Xudongi, Zuo Zhengyao, Weng Feni, Li Bangyao ja Hu Xiangqiani töödest

  19. Hiina löögijõud sunnib USAd staatust kaitsma

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2011-01-01

    Hiina on soovitud mõjupiirkonnas ehk Vaikse ookeani regioonis oma riiklikke, majanduslikke ja julgeolekuhuve kaitstes hakanud käituma aktiivse suurriigina. Hiina tugevnemisega kaasnevast julgeolekuriskist. Territooriaaltüli Lõuna-Hiina meres

  20. Tallinna loodetud Hiina terminal kerkib Ust-Luugas / Andres Reimer

    Index Scriptorium Estoniae

    Reimer, Andres

    2006-01-01

    Väidetavalt on Hiina transiidiettevõtjad jõudnud Ust-Luuga sadamas terminalipinda omava konteinervedude firmaga Pervõi Konteinernõi Terminal PKT kavatsuste protokollini. President Vladimir Putin on lubanud rajada Ust-Luuga sadamasse vabatsooni, mis tõenäoliselt annab võimaluse Hiina kaubanduskeskuse rajamisele. Lisa: Kaubatee Hiinasse

  1. Hiina: Euroopa andis kõrvakiilu / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    Väidetavalt esitas Hiina Euroopa Liidule kolm soovi, mille täitmisel oleks Hiina panustanud päästefondi või sellega seotud mehhanismi umbes 100 mld. dollarit. Euroopa olevat need soovid tagasi lükanud

  2. Hiina tervendus / kommenteerivad Anne, Julia, Weihong Song, Fagang Ren

    Index Scriptorium Estoniae

    2013-01-01

    Tallinnas Tulika 19 asuvast Bai Lan Hiina massaažisalongist, kus ravitakse kuputeraapia, gua sha kraapimisplaatide, moksa, nõelravi ja punktmassaaži abil. Tui na massaaži ja hiina loodusteraapia protseduure kommenteerivad spetsialistid ning patsiendid Anne ja Julia

  3. Kas Hiina draakon õpib ka lendama? / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2011-01-01

    Uuringust, mille käigus püüti välja selgitada Hiina patendistrateegiat. (Markus Eberhardt, Christian Helmers, Zhihong Yu. Is the dragon learning to fly? An analysis of the Chinese patent explosion. (CSAE Working Paper WPS/2011-15). Tabel: USA-s enim patente registreerinud Hiina ettevõtted (1985-2006)

  4. Sugawara's construction for Kac-Moody-Malcev algebras

    Science.gov (United States)

    Osipov, Edward P.

    1988-11-01

    We give a construction of the Virasoro algebra in terms of bilinear combinations of currents. The currents satisfy the Kac-Moody-Malcev commutation relations. The Kac-Moody-Malcev algebras are the generalization of Lie algebras of Kac-Moody type to the Malcev algebras. Thus, we give the generalization of the Sugawara construction to the case of Kac-Moody-Malcev algebras.

  5. Hiina mänguasjavabrikud vallutavad mobiilimaailma / Kaido Einama

    Index Scriptorium Estoniae

    Einama, Kaido, 1971-

    2008-01-01

    Ülevaade visiidist Hiina moodsa suurlinna Shanghai elektroonikakauplustesse, kus puututi kokku tuntud kaubamärkide Nokia, Apple ning HTC toodete koopiatega - Nokla, HiPhone, MTC ja ZTC telefonidega. Lisa: Shanghai poodleja spikker

  6. Kac-Moody-Malcev and super-Kac-Moody-Malcev algebras

    Science.gov (United States)

    Osipov, Edward P.

    1992-01-01

    We define infinite-dimensional Malcev algebras generalizing infinite-dimensional Kac-Moody type algebras and consider their central extensions. The Kac-Moody-Malcev algebras, associated with the simple non-Lie Malcev algebras, have trivial central extensions only and super-Kac-Moody-Malcev algebras, associated with the simple non-Lie Malcev algebras, have nontrivial central extensions for Grassmann generators only.

  7. "Jade Warrior" kupatab Soome sampo Hiina / Kätlin Kaldmaa

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola. Lisatud Ave Randviiru, Elle Kulli ja Antti-Jussi Annila "Esimesed muljed"

  8. USA seab tõkkeid odavatele Hiinas toodetud kaupadele / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2003-01-01

    USA kaubandusdefitsiit Hiinaga kasvab, USA Kongress süüdistab Hiinat ebaausas konkurentsis ja on seadmas Hiina kaupadele impordipiiranguid. Hiina kaalub vastusanktsioone. Diagramm: Kaubandusdefitsiit Hiinaga süveneb

  9. Rüütlit saadab Hiinas hiigelvõlgades firma juht / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli, 1978-

    2005-01-01

    President Arnold Rüütli 23. augustil alanud Hiina-visiidi ärimeeste delegatsiooni juhib AS-i Olexela Oil üks omanikest Juhan Kolk, kelle firmal on riigi ees ligi 40 miljoni krooni suurune maksuvõlg. Lisa: President Rüütel Hiinas. Riigivisiit Hiina Rahvavabariiki 23.-30.08.2005

  10. USA-Hiina luurelennukitüli ähvardab suureks paisuda / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2001-01-01

    USA-Hiina tüli luurelennuki pärast võib kahjustada Hiina pääsu WTO-sse. Analüütikute arvates näitavad mitmed hiljutised intsidendid USA huvi Hiina sõjasaladuste vastu. Vt. samas "Eesti rannikut seirab Vene lennuk"

  11. The central extension of Kac-Moody-Malcev algebras

    Science.gov (United States)

    Osipov, Edward P.

    1989-07-01

    We introduce a class of infinite-dimensional Kac-Moody-Malcev algebras. These algebras are the generalization of Lie algebras of the Kac-Moody type to Malcev algebras. We demonstrate that the central extensions of the Kac-Moody-Malcev algebras are given by the same cocycles as in the case of Lie algebras. Analogues of Kac-Moody-Malcev algebras may be also introduced in the case of an arbitrary Riemann surface.

  12. Extended Kac-Moody algebras and applications

    International Nuclear Information System (INIS)

    Ragoucy, E.; Sorba, P.

    1991-04-01

    The notion of a Kac-Moody algebra defined on the S 1 circle is extended to super Kac-Moody algebras defined on MxG N , M being a smooth closed compact manifold of dimension greater than one, and G N the Grassman algebra with N generators. All the central extensions of these algebras are computed. Then, for each such algebra the derivation algebra constructed from the MxG N diffeomorphism is determined. The twists of such super Kac-Moody algebras as well as the generalization to non-compact surfaces are partially studied. Finally, the general construction is applied to the study of conformal and superconformal algebras, as well as area-preserving diffeomorphisms algebra and its supersymmetric extension. (author) 65 refs

  13. Veneetsias võitis Hiina üllataja

    Index Scriptorium Estoniae

    2006-01-01

    Veneetsia filmifestivali parima filmi peaauhind Kuldlõvi läks Hiina režissööri Jia Zhang-Ke filmile "Vaikelu" ("Dong"). Hõbelõvi said Alain Resnais' "Isiklikud hirmud avalikes kohtades" ("Coeurs") ja Emanuele Crialese "Kuldne uks" ("Nuodomondo"). Parima näitleja Coppa Volpi said Helen Mirren ja Ben Affleck

  14. Moody, Suicide and Survival: A Critical Appraisal.

    Science.gov (United States)

    Vicchio, Stephen

    1980-01-01

    The purpose of this paper is to: (1) define suicide; (2) explicate Raymond Moody's position on suicide and survival after death; (3) analyze logical connections between divine commands and moral judgments; and (4) offer constructive comments on suicide and suicide prevention. (Author/RC)

  15. Wŏ shuō hànyŭ, nĭne? ehk Mina räägin hiina keelt, aga sina? / Piret Lakson

    Index Scriptorium Estoniae

    Lakson, Piret, 1989-

    2012-01-01

    Hiina keele õpetamisest Eestis ja Mustamäe gümnaasiumi noorest hiina keele õpetajast Wang Weist. Eesti koolidesse hiina keele õpetajate hankimine käib Tallinna ülikooli juurde loodud Konfutsiuse instituudi kaudu

  16. Hiina naise lugu võitis Kuldkaru / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2007-01-01

    57. Berliini filmifestivali peaauhind Kuldkaru - hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"), parima režissööri Hõbekaru - iisraellane Joseph Cedar ("Beafort"), parim meesnäitleja - Julio Chavez (Ariel Rotteri "Teine"), parim naisnäitleja - Nina Hossa (Christian Petzoldi "Yella"), väljapaistev kunstiline saavutus - Robert De Niro lavastajatöö ("Hea karjane")

  17. Võidurelvastumise tagasitulek : USA kiiluvees Venemaa ja Hiina / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    USA eelarvekavas on ette nähtud kaitsekulutuste jätkuv suurenemine, suureneda võib ka relvajõudude isikkoosseis. Relvajõududele kulub USA-s ligi 4% SKT-st. Globaalselt liidetuna tõusid kõikide riikide kulutused relvajõududele 1990. aasta tasemele. Hiina ja Venemaa kaitsekulutustest. Lisad: Aasia riigid kasvatavad sõjalisi kulutusi; 25 riigil pole oma sõjaväge. Graafik: USA sõjalised kulutused

  18. Hiina äri eripärad eestlase pilgu läbi / Meelis Koik ; intervjueerinud Villu Zirnask

    Index Scriptorium Estoniae

    Koik, Meelis

    2010-01-01

    Hiina ettevõtetega koostööd tegeva AS-i Fors MW juht räägib Hiina ettevõtluse eripäradest ja Eesti võimalustest Hiina turul. Ta leiab, et jüaani kurss ongi kõige suurem oht Hiinast kauba toomise kasulikkusele, praegu ei saa Hiina jüaani dollarist vabaks lasta, kuna see samm toob endaga kaasa ekspordi hääbumise

  19. Comments on two-loop Kac-Moody algebras

    International Nuclear Information System (INIS)

    Ferreira, L.A.; Gomes, J.F.; Zimerman, A.H.; Schwimmer, A.

    1991-10-01

    It is shown that the two-loop Kac-Moody algebra is equivalent to a two variable loop algebra and a decouple β-γ system. Similarly WZNW and CSW models having as algebraic structure the Kac-Moody algebra are equivalent to an infinity to versions of the corresponding ordinary models and decoupled Abelian fields. (author). 15 refs

  20. Harmooniat otsiv hiina aed / Jaan Mettik, Meeli Müüripeal

    Index Scriptorium Estoniae

    Mettik, Jaan

    2005-01-01

    Hiina aiakunstist: lühidalt ajaloost, aiatüüpidest, maastikumaalist, lahutamatult seotud kividest ja veest, aiaehitistest, surematute saarest jm. Hiina aedadest mujal: "Tagasivõidetud Kuu" aiast (2000) Berliinis, aiast "Kolm Sõpra Talvel" (1993) Zürichis, "Virguvate Orhideede" aiast USAs Portlandis. 9 värv. ill

  1. Sugawara's construction for Kac-Moody-Malcev algebras

    Energy Technology Data Exchange (ETDEWEB)

    Osipov, E.P.

    1988-11-24

    We give a construction of the Virasoro algebra in terms of bilinear combinations of currents. The currents satisfy the Kac-Moody-Malcev commutation relations. The Kac-Moody-Malcev algebras are the generalization of Lie algebras of Kac-Moody type to the Malcev algebras. Thus, we give the generalization of the Sugawara construction to the case of Kac-Moody-Malcev algebras.

  2. Aids ähvardab Venemaa, Hiina ja India tulevikku / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2002-01-01

    Ameerika analüütik Nicholas Eberstadt prognoosib, et Hiina, India ja Venemaa võivad järgmise veerandsaja jooksul seista silmitsi suurema arvu HIV-i nakatanute ja aidsi surnutega kui kogu maailm seni tervikuna

  3. Gigantide kokkupõrge: Google lahkub Hiina tsensuuri alt / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2010-01-01

    Google teatas, et Pekingi tsensuurile alistatud veebilehe Google.cn kasutajad juhitakse automaatselt Hongkongi tsenseerimata saidile Google.com.hk. Hiina reageeringust. Teabest, mida hiinlased internetist leida ei tohi

  4. Plaanitav tollimaks viiks Hiina jalatsite hinna üles / Kaire Uusen

    Index Scriptorium Estoniae

    Uusen, Kaire

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 2. okt. lk. 8. Euroopa Liidu riigid peavad otsustama, kas Hiina ja Vietnami odavatele nahkjalatsitele tuleks kehtestada kõrged tollimaksud. Majandusministeeriumi teatel ei toeta Eesti tollimaksu kehtestamist

  5. Hiina kompartei pole NLKP-ga võrreldav / Henri Kaselo

    Index Scriptorium Estoniae

    Kaselo, Henri

    2005-01-01

    20.-26. novembril Hiinas Pekingis ja sadamalinnas Tianjinis peetud Euroopa ja Aasia noorte kohtumisest, kus Eestit esindasid Keskerakonna noortekogu esimees Henri Kaselo ja Euroopa Noorte Sotsiaaldemokraatide aseesimees ning Toomas Hendrik Ilvese nõunik Rander Läntsi

  6. Kac-Moody algebras and string theory

    International Nuclear Information System (INIS)

    Cleaver, G.B.

    1993-01-01

    The focus of this thesis is on (1) the role of Kac-Moody algebras in string theory and the development of techniques for systematically building string theory models based on a higher level (K ≥ 2) KM algebras and (2) fractional superstrings, a new class of solutions based on SU(2) K /U(1) conformal field theories. The content of this thesis is as follows. In chapter two they review KM algebras and their role in string theory. In the next chapter they present two results concerning the construction of modular invariant partition functions for conformal field theories build by tensoring together other conformal field theories. First they show how the possible modular invariants for the tensor product theory are constrained if the allowed modular invariants of the individuals conformal field theory factors have been classified. They illustrate the use of these constraints for theories of the type SU(2) KA direct-product SU(2) KB , finding all consistent theories for K A and K B odd. Second they show how known diagonal modular invariants can be used to construct inherently asymmetric invariants where the holomorphic and anti-holomorphic theories do not share the same chiral algebra. Explicit examples are given. Next, in chapter four they investigate some issues relating to recently proposed fractional superstring theories with D critical K/4 K/4 , as source of spacetime fermions, is demonstrated

  7. Environmental Assessment Addressing the Expansion of Sortie-Operations at Moody Air Force Base, Georgia

    Science.gov (United States)

    2012-08-01

    Homerville 2,681 Georgia Moody 1 and Moody 2 North MOAs Blakely 5,176 Georgia Moody 3 MOA Live Oak 7,169 Florida Live Oak MOA Louisville 2,711 Georgia...Wildlife Management Area Newton George T. Bagby State Park Fort Gaines Kolomoki Mounds State Park Blakely Georgia Moody 3 MOA Lake Walter F. George...emphasizes the prevention of pollution of groundwater. The Superfund Amendments and Reauthorization Act ( SARA ) of 1986 mandates strong clean-up standards

  8. Maakasutuse legaalsed ja moraalsed aspektid : Hiina juhtum = Laws and moralaty of land use : the case of China / Anne Haila

    Index Scriptorium Estoniae

    Haila, Anne

    2008-01-01

    Vaadeldakse, millised muutused on toimunud Hiina maahaldussüsteemis ja maakasutuses. Tagasivaade maareformide ajaloole, ülevaade Hiina kaasaegsetest reformidest ning seda toetavatest rahvusvahelistest nõustajatest. Mõningatest probleemidest, mida institutsionaalne muutus ja uus turujaotus on kaasa toonud, ebaselgetest omandiõigustest. Bibliograafia lk. 83

  9. Reinforcement Learning Explains Conditional Cooperation and Its Moody Cousin.

    Directory of Open Access Journals (Sweden)

    Takahiro Ezaki

    2016-07-01

    Full Text Available Direct reciprocity, or repeated interaction, is a main mechanism to sustain cooperation under social dilemmas involving two individuals. For larger groups and networks, which are probably more relevant to understanding and engineering our society, experiments employing repeated multiplayer social dilemma games have suggested that humans often show conditional cooperation behavior and its moody variant. Mechanisms underlying these behaviors largely remain unclear. Here we provide a proximate account for this behavior by showing that individuals adopting a type of reinforcement learning, called aspiration learning, phenomenologically behave as conditional cooperator. By definition, individuals are satisfied if and only if the obtained payoff is larger than a fixed aspiration level. They reinforce actions that have resulted in satisfactory outcomes and anti-reinforce those yielding unsatisfactory outcomes. The results obtained in the present study are general in that they explain extant experimental results obtained for both so-called moody and non-moody conditional cooperation, prisoner's dilemma and public goods games, and well-mixed groups and networks. Different from the previous theory, individuals are assumed to have no access to information about what other individuals are doing such that they cannot explicitly use conditional cooperation rules. In this sense, myopic aspiration learning in which the unconditional propensity of cooperation is modulated in every discrete time step explains conditional behavior of humans. Aspiration learners showing (moody conditional cooperation obeyed a noisy GRIM-like strategy. This is different from the Pavlov, a reinforcement learning strategy promoting mutual cooperation in two-player situations.

  10. An exact realization of the Kac-Moody algebra

    International Nuclear Information System (INIS)

    Baaquie, B.E.

    1986-06-01

    The Kac-Moody generators are explicitly realized as functional differential operators expressed in terms of the co-ordinates of the (infinite dimensional) group manifold. As an application of this realization, the two-dimensional Wess-Zumino chiral action is derived from the Hamiltonian formulation. (author)

  11. Affine Kac-Moody algebras and their representations

    International Nuclear Information System (INIS)

    Slansky, R.

    1988-01-01

    Highest weight representation theory of finite dimensional and affine Kac-Moody algebras is summarized from a unified point of view. Lattices of discrete additive quantum numbers and the presentation of Lie algebras on Cartan matrices are the central points of departure for the analysis. (author)

  12. Reinforcement Learning Explains Conditional Cooperation and Its Moody Cousin.

    Science.gov (United States)

    Ezaki, Takahiro; Horita, Yutaka; Takezawa, Masanori; Masuda, Naoki

    2016-07-01

    Direct reciprocity, or repeated interaction, is a main mechanism to sustain cooperation under social dilemmas involving two individuals. For larger groups and networks, which are probably more relevant to understanding and engineering our society, experiments employing repeated multiplayer social dilemma games have suggested that humans often show conditional cooperation behavior and its moody variant. Mechanisms underlying these behaviors largely remain unclear. Here we provide a proximate account for this behavior by showing that individuals adopting a type of reinforcement learning, called aspiration learning, phenomenologically behave as conditional cooperator. By definition, individuals are satisfied if and only if the obtained payoff is larger than a fixed aspiration level. They reinforce actions that have resulted in satisfactory outcomes and anti-reinforce those yielding unsatisfactory outcomes. The results obtained in the present study are general in that they explain extant experimental results obtained for both so-called moody and non-moody conditional cooperation, prisoner's dilemma and public goods games, and well-mixed groups and networks. Different from the previous theory, individuals are assumed to have no access to information about what other individuals are doing such that they cannot explicitly use conditional cooperation rules. In this sense, myopic aspiration learning in which the unconditional propensity of cooperation is modulated in every discrete time step explains conditional behavior of humans. Aspiration learners showing (moody) conditional cooperation obeyed a noisy GRIM-like strategy. This is different from the Pavlov, a reinforcement learning strategy promoting mutual cooperation in two-player situations.

  13. Hiina tänapäeva arhitektuur - karmiilmeline, aga põnev / Zhang Ke, Zhang Hong, Xiaodu Liu ; interv. Hanna Läkk ja Ene Läkk

    Index Scriptorium Estoniae

    Zhang Ke

    2006-01-01

    Intervjuu Hiina arhitektuuribüroo Standardarchitecture arhitektide Zhang Ke ja Zhang Hongiga ning arhitektuuribüroo Urbanus arhitekti Xiaodu Liuga Hollandis Hiina tänapäeva tutvustaval näitusel. Hiina arhitektide haridusest, oma arhitektuuribüroode töödest, tänapäeva hiina arhitektuurist, põhiprobleemidest

  14. Hiina mull on lõhkemas. USA on soosingus / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2011-01-01

    USA investeerimisveterani Richard Bernsteini väitel on Hiinas võrreldes USA-ga suur laenumull. USA väikese turuväärtusega ettevõtete aktsiaid peab ta suure turuväärtusega ettevõtete aktsiatest aktraktiivsemaks. Euroopa aktsiatesse suhtub ta positiivselt. Autor viitab Bernsteini vaadete muutumisele

  15. Kuldlõvi võitis üllatusena Hiina film tammi ehitamisest / A. L.

    Index Scriptorium Estoniae

    A. L.

    2006-01-01

    Veneetsia filmifestivali parima filmi peaauhind Kuldlõvi läks Hiina režissööri Jia Zhang-Ke filmile "Vaikelu" ("Dong"). Parima näitleja Coppa Volpi said Helen Mirren ja Ben Affleck, elutööauhinna sai režissöör David Lynch

  16. Hiina : olümpiakahjum ettevõtetele / Dexter Roberts, Chi-Chu Tshang

    Index Scriptorium Estoniae

    Roberts, Dexter

    2008-01-01

    Hiina valitsus on kehtestanud paljudele tööstusettevõtetele nii olümpiamängude kui paraolümpia toimumise ajaks suurt majanduslikku kahju tekitavad ranged tootmispiirangud, mis võivad mõjutada isegi välisriikide tarbijaid

  17. 21. sajandi hiina laine ja minimalistlik interjöör / Leila Pärtelpoeg

    Index Scriptorium Estoniae

    Pärtelpoeg, Leila, 1927-

    2006-01-01

    Nüüdisaegne minimalism ja Hiina Ming dünastia aegadest pärinev materjalikäsitlus ühilduvad moodsas hiinalikus interjööris. Sisekujundus: Leila Pärtelpoeg. Stilist Madis Liplap. 6 ill, 5 värv.

  18. Läti tehnoloogiafirma SAF Tehnika on Hiina turgu hülgamas / Lauri Matsulevitsh

    Index Scriptorium Estoniae

    Matsulevitsh, Lauri

    2005-01-01

    Läti ettevõtte SAF Tehnika kasum kahanes enam kui kahekordselt seoses tootmise vähendamisega Hiina turule. Diagramm: SAFi aktsia taas aasta madalamatel tasemetel. Vt. samas: Analüütikud soovitavad SAFi aktsiat osta; Eesti fondid on SAFi aktsiatest suuresti loobunud

  19. India on edukas selles, milles Hiina ei ole. Ja vastupidi / Ülle Pihlak

    Index Scriptorium Estoniae

    Pihlak, Ülle

    2010-01-01

    India majanduskasvu põhjustest ja tööstusharudest, kus areng on olnud kiirem: autotööstus, ravimitööstus, tarkvaraarendus. Lühidalt ka India riiklikust innovatsiooni toetamise süsteemist ning uudsetest haridus- ja majandusprogrammidest vaesuse vähendamiseks. Hiina ja India ärikeskkonna võrdlus

  20. USA surus Brüsseli taanduma Hiina relvamüügi küsimuses / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Saksa välisministri Joschka Fischeri sõnul ei suutnud Euroopa Liidu välisministrid mitteametlikul kohtumisel Luksemburgis saavutada konsensust Hiina-vastase relvaembargo tühistamises. Lisa: Keeld Hiinale relvastust müüa

  1. Naiste nappus kasvatab India ja Hiina ühiskondades vägivaldset käitumist / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2006-01-01

    Poisslapsi eelistav traditsioon on viinud meeste suure ülekaaluni Hiina ja India rahvastikus ning toidab kuritegevuse ja terrorismi kasvu. Ühe lapse poliitika. Lisa: Kas teate. Naiste osakaal rahvastikus

  2. Kehra tudengil Karel Jõelehel on võimalus õppida Hiina ülikoolis / Külli Koppelmaa

    Index Scriptorium Estoniae

    Koppelmaa, Külli, 1970-

    2016-01-01

    Tallinna Ülikoolis Aasia uuringute erialal õppiv Karel Jõeleht osales üliõpilaste talendivõistluse "Chinese Bridge" Eesti eelvoorus. Selle võit tagas talle pääsu lõppvõistlusele Hiinas. Kõiki võistluse lõppvooru pääsenuid premeeriti võimalusega õppida 2017. aastal üks semester vabalt valitud Hiina ülikoolis

  3. Soome-Hollandi-Hiina-Eesti ühisfilmi "Armuvalus sõdalane" ("Jade Warrior", rezh Antti-Juhani Annila) filmivõtted algavad 2.VIII Soomes

    Index Scriptorium Estoniae

    2005-01-01

    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve 39 milj. krooni) tootjad on Soome, Holland, Hiina ja Eesti (3,9 milj. krooni). Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  4. Contraction of broken symmetries via Kac-Moody formalism

    International Nuclear Information System (INIS)

    Daboul, Jamil

    2006-01-01

    I investigate contractions via Kac-Moody formalism. In particular, I show how the symmetry algebra of the standard two-dimensional Kepler system, which was identified by Daboul and Slodowy as an infinite-dimensional Kac-Moody loop algebra, and was denoted by H 2 , gets reduced by the symmetry breaking term, defined by the Hamiltonian H(β)=(1/2m)(p 1 2 +p 2 2 )-α/r-βr -1/2 cos((φ-γ)/2). For this H(β) I define two symmetry loop algebras L i (β), i=1,2, by choosing the 'basic generators' differently. These L i (β) can be mapped isomorphically onto subalgebras of H 2 , of codimension two or three, revealing the reduction of symmetry. Both factor algebras L i (β)/I i (E,β), relative to the corresponding energy-dependent ideals I i (E,β), are isomorphic to so(3) and so(2,1) for E 0, respectively, just as for the pure Kepler case. However, they yield two different nonstandard contractions as E→0, namely to the Heisenberg-Weyl algebra h 3 =w 1 or to an Abelian Lie algebra, instead of the Euclidean algebra e(2) for the pure Kepler case. The above-noted example suggests a general procedure for defining generalized contractions, and also illustrates the 'deformation contraction hysteresis', where contraction which involves two contraction parameters can yield different contracted algebras, if the limits are carried out in different order

  5. Non-linear realization of the Virasoro-Kac-Moody algebra and the anomalies

    International Nuclear Information System (INIS)

    Aoyama, S.

    1988-01-01

    The non-linear realization of the Virasoro algebra x Kac-Moody algebra will be studied. We will calculate the Ricci tensor of the relevant Kaehler manifold to show a new vacuum structure for this coupled algebra. (orig.)

  6. A basin on an unstable ground: Correlation of the Middle Archaean Moodies Basin, Barberton Greenstone Belt, South Africa

    Science.gov (United States)

    Ohnemueller, Frank; Heubeck, Christoph; Kirstein, Jens; Gamper, Antonia

    2010-05-01

    The 3.22 Ga-old Moodies Group, representing the uppermost part of the Barberton Supergroup of the Barberton Greenstone Belt (BGB), is the oldest well-exposed, relatively unmetamorphosed, quartz-rich sedimentary unit on Earth. Moodies facies (north of the Inyoka Fault) were thought to be largely of alluvial, fluvial, deltaic or shallow-marine origin (Anhaeusser, 1976; Eriksson, 1980; Heubeck and Lowe, 1994) and in its upper part syndeformational. However, units can only locally be correlated, and the understanding of the interplay between Moodies sedimentation and deformation is thus limited. We mapped and measured Moodies units in the northern BGB. They partly consist of extensive turbiditic deepwater deposits, including graded bedding, flame structures, and slumped beds, interbedded with jaspilites. These contrast with shallow-water environments, south-facing progressive unconformities and overlying alluvial-fan conglomerates along the northern margin of the Saddleback Syncline further south. The palaeogeographic setting in which late BGB deformation was initiated therefore appears complex and cannot be readily explained by a simple southward-directed shortening event. In order to constrain Moodies basin setting before and during late-Moodies basin collapse, we correlated ~15 measured sections in the northern and central BGB. Most units below the Moodies Lava (MdL, ca. 3230.6+-6 Ma) can be correlated throughout although facies variations are apparent. Above the Moodies Lava, coarse-grained units can only be correlated through the Eureka Syncline and the Moodies Hills Block but not with the Saddleback Syncline. Fine-grained and jaspilitic units can be correlated throughout the northern BGB. Moodies below-wavebase deposition occurred largely north of the Saddleback Fault. The observations are consistent with a pronounced basin compartmentalization event following the eruption of the MdL which appeared to have blanketed most of the Moodies basin(s) in middle Moodies

  7. Conservation Laws Related to the Kac-Moody-Virasoro Structure of the Potential Nizhnik-Novikov-Veselov Equation

    Science.gov (United States)

    Liu, Xi-Zhong

    2011-05-01

    We derive the symmetry group by the standard Lie symmetry method and prove it constitutes to the Kac-Moody-Virasoro algebra. Then we construct the conservation laws corresponding to the Kac- Moody-Virasoro symmetry algebra up to second-order group invariants

  8. Kac-Moody symmetries of ten-dimensional non-maximal supergravity theories

    International Nuclear Information System (INIS)

    Schnakenburg, Igor; West, Peter

    2004-01-01

    A description of the bosonic sector of ten-dimensional N=1 supergravity as a non-linear realisation is given. We show that if a suitable extension of this theory were invariant under a Kac-Moody algebra, then this algebra would have to contain a rank eleven Kac-Moody algebra, that can be identified to be a particular real form of very-extended D 8 . We also describe the extension of N=1 supergravity coupled to an abelian vector gauge field as a non-linear realisation, and find the Kac-Moody algebra governing the symmetries of this theory to be very-extended B 8 . Finally, we discuss the related points for the N=1 supergravity coupled to an arbitrary number of abelian vector gauge fields. (author)

  9. BRST analysis of super Kac-Moody and superconformal current algebras

    International Nuclear Information System (INIS)

    Bilal, A.; Gervais, J.L.

    1986-01-01

    The BRST charges are constructed for the supersymmetric extension of affine Kac-Moody algebras and for their semidirect sum with the superconformal algebra. In both cases, the BRST charge can be nilpotent only if the central charge of the super-Kac-Moody algebra representation vanishes. For general values of the central charge, it is shown by separating the positive and negative root contributions, that nilpotent operators can still be constructed. The associated cohomology is similar to the one introduced by Banks and Peskin for the Virasoro algebra. (orig.)

  10. Kac-Moody Eisenstein series in string theory

    International Nuclear Information System (INIS)

    Fleig, Philipp

    2013-01-01

    dimensional) symmetry groups, known as Kac-Moody groups. While a large part of this thesis is dedicated to the mathematical problem of calculating the Fourier expansion of these series, our results are also explained within the relevant physical context.

  11. Kac-Moody algebra is not hidden symmetry of chiral models

    International Nuclear Information System (INIS)

    Devchand, C.; Schiff, J.

    1997-01-01

    A detailed examination of the infinite dimensional loop algebra of hidden symmetry transformations of the Principal Chiral Model reveals it to have a structure differing from a standard centreless Kac-Moody algebra. A new infinite dimensional Abelian symmetry algebra is shown to preserve a symplectic form on the space of solutions. (author). 15 refs

  12. q-deformation of ''W3'', Virasoro and U(1)-Kac-Moody algebras

    International Nuclear Information System (INIS)

    El Hassouni, A.; Tahri, E.H.; Zakkari, M.

    1995-07-01

    A deformation of the algebra of infinite matrices gl(∞, C) is given. We show that this operation leads to the realization of a deformed ''W 3 '' like algebra. The central extension of the q-U(1) Kac-Moody and the q-Virasoro algebra is performed. (author). 10 refs

  13. Kac--Moody current algebras of D = 2 massless gauge theories, their representations and applications

    International Nuclear Information System (INIS)

    Craigie, N.S.; Nahm, W.; Narain, K.S.

    1987-01-01

    We give a classification of the Kac--Moody current algebras of all the possible massless fermion-gauge theories in two dimensions. It is shown that only Kac--Moody algebras based on A/sub N/, B/sub N/, C/sub N/, and D/sub N/ in the Cartan classification with all possible central charge occur.The representation of local fermion fields and simply laced Kac--Moody algebras with minimal central charge in terms of free boson fields on a compactified space is discussed in detail, where stress is laid on the role played by the boundary conditions on the various collective modes. Fractional solitons and the possible soliton representation of certain nonsimply laced algebras is also analysed. We briefly discuss the relationship between the massless bound state sector of these two-dimensional gauge theories and the critically coupled two-dimensional nonlinear sigma model, which share the same current algebra. Finally we briefly discuss the relevance of Sp(n) Kac--Moody algebras to the physics of monopole-fermion systems. copyright 1987 Academic Press, Inc

  14. S&P ja Moody's : euro edasilükkumisest pole häda

    Index Scriptorium Estoniae

    2006-01-01

    Ilmunud ka: Finansovõi Menedzhment : infovõpusk nr. 7 sept. lk. 9. Reitinguagentuurid Standard & Poor's ning Moody's Investors Service ei pea probleemiks Eestis euro kasutuselevõtmise edasilükkumist, kuid märgivad, et euroliiduga ühinemine võib vähendada kiire majandusarenguga kaasnevaid riske

  15. A realisation of q-deformed of U(1)-Kac Moody and Virasoro algebras through the a-bar∞ algebra

    International Nuclear Information System (INIS)

    El Hassouni, A.; Zakkari, M.

    1995-11-01

    A representation of one parameter deformation of U(1)-Kac Moody and Virasoro algebras is obtained through the infinite matrix algebra a-bar ∞ . Their central extensions are also investigated. (author). 19 refs

  16. A differential-difference Kadomtsev-Petviashvili family possesses a common Kac-Moody-Virasoro symmetry algebra

    International Nuclear Information System (INIS)

    Tang Xiaoyan; Qian Xianmin; Ding Wei

    2005-01-01

    Starting from the Kac-Moody-Virasoro symmetry algebra of the differential-difference Kadomtsev-Petviashvili equation, a differential-difference Kadomtsev-Petviashvili family is constructed and the corresponding invariant solutions are obtained

  17. On the completeness of the canonical reductions from Kac-Moody to W-algebras

    International Nuclear Information System (INIS)

    McGlinn, W.

    1997-01-01

    We study the question as to whether the canonical reductions of Kac-Moody (KM) algebras to W-algebras are exhaustive. We first review and consolidate previous results. In particular we show that, apart from the two lowest grades, the canonical reductions are the only ones that respect the physically reasonable requirement that the W-algebra have no negative conformal weights. We then break new ground by formulating a condition that the W-algebra be differential polynomial. We apply the condition that the W-algebra be polynomial (in a particular gauge) and primary to the groups SL(N,R) with integral SL(2,R) embeddings. We find that, subject to some reasonable technical assumptions, the canonical reductions are exhaustive (except possibly at grade one). The derivation suggests that similar results hold for the other classes of simple groups. (orig.)

  18. High but balanced sedimentation and subsidence rates (Moodies Group, Barberton Greenstone Belt), followed by basin collapse: Implication for Archaean tectonics

    Science.gov (United States)

    Heubeck, Christoph; Lowe, Donald R.; Byerly, Gary R.

    2010-05-01

    Archaean tectonophysical models distinguish between thick, rigid and thin, mobile crust; from these the major mechanisms and rates for continental growth are derived. Archaean sedimentary rocks, preserved in metamorphosed and highly deformed greenstone belts, can contribute to constrain these models by estimating subsidence rates, derived from the combination of facies changes and precise age dates. Largely siliciclastic strata of the Moodies Group form the topmost unit of the Barberton Supergroup of the Barberton Greenstone Belt (BGB), South Africa, represent one of the world's oldest unmetamorphosed quartz-rich sedimentary sequences, and reach ca. 3500m thick (Lowe and Byerly, 2007). Large parts of the Moodies Group were deposited in apparent sedimentary continuity in alluvial, fluvial, shoreline and shallow-marine environments (e.g., Eriksson, 1979; Heubeck and Lowe, 1994). Distinctive sources and variations in facies indicate that Moodies deposition occurred at times in several basins. In several now tectonically separated regions, a regional basaltic lava (unit MdL of Anhaeusser, 1968) separates a lower unit (ca. 2000m thick and possibly representing an extensional setting) from an upper unit (ca. 1500m thick and characterized by progressive unconformities, rapidly changing facies, thicknesses, and sandstone petrographic composition). Single zircons separated from a felsic air-fall tuff of the middle Moodies Group and immediately overlying the basaltic lava in the Saddleback Syncline were dated on the Stanford-USGS SHRIMP RG. Out of 24 dated grains, two near-concordant groups have mean ages of 3230,6+-6,1Ma (2σ; n=9) and 3519+-7 Ma (2σ; n=9), respectively. We interpret the former age as representing the depositional age of the tuff, the latter as representing inherited zircons from underlying Onverwacht-age basement. The interpreted depositional age of the Moodies tuff is indistinguishable from numerous similar ages from felsic and dacitic volcanics at the

  19. Environmental Assessment for Implementation of Expanded Bird-Aircraft Strike Hazard (BASH) Program for Moody Air Force Base and Private and Public Lands Surrounding Moody Air Force Base, Georgia

    Science.gov (United States)

    2003-09-01

    Christmas Bird Count , administered by the Audubon Society in early winter. Breeding Bird Survey trend data from 1966-2000 indicate that turkey... Christmas Bird Count data from 1959- 1988 shows a slight decline in Georgia for black vultures and an increasing trend in turkey vultures for Georgia...based on historical bird sightings from Moody AFB personnel, Breeding Bird Surveys (BBSs), and Christmas Bird Counts ( CBCs )

  20. Rotordynamic analysis for stepped-labyrinth gas seals using moody's friction-factor model

    International Nuclear Information System (INIS)

    Ha, Tae Woong

    2001-01-01

    The governing equations are derived for the analysis of a stepped labyrinth gas seal generally used in high performance compressors, gas turbines, and steam turbines. The bulk-flow is assumed for a single cavity control volume set up in a stepped labyrinth cavity and the flow is assumed to be completely turbulent in the circumferential direction. The Moody's wall-friction-factor model is used for the calculation of wall shear stresses in the single cavity control volume. For the reaction force developed by the stepped labyrinth gas seal, linearized zeroth-order and first-order perturbation equations are developed for small motion about a centered position. Integration of the resultant first-order pressure distribution along and around the seal defines the rotordynamic coefficients of the stepped labyrinth gas seal. The resulting leakage and rotordynamic characteristics of the stepped labyrinth gas seal are presented and compared with Scharrer's theoretical analysis using Blasius' wall-friction-factor model. The present analysis shows a good qualitative agreement of leakage characteristics with Scharrer's analysis, but underpredicts by about 20 %. For the rotordynamic coefficients, the present analysis generally yields smaller predicted values compared with Scharrer's analysis

  1. Causing a Ruckus: Complicity and Performance in Stories of Port Moody

    Directory of Open Access Journals (Sweden)

    Matthew Hayes

    2018-01-01

    Full Text Available This article is about the suicide of the chief of police of a small Canadian town, which - according to some - did not actually happen. While employed as a researcher and writer with a museum in Port Moody, British Columbia, the author heard this story as one of many told by the ‘old-timers’ who assisted with the writing of a history book. The controversy over the potential suicide provided the means by which this article reflects on issues of ethics, advocacy, and performance when doing public history. The main request of the old-timers was to ‘put the good stories in’ when writing the book. This expectation caused tension between the author and the museum, reflecting the divide between doing ‘history’ and ‘heritage’. This article draws on Anthropological theories of ‘complicity’ and performance in storytelling to make sense of the author’s role within the context of a museum working to record the stories of long-time residents. The stories of the old-timers were filtered through the lens of early 20th century ideas about gender, race, and class, and affected by a lingering frontier mentality. As such, they wished to see their town’s history told in a very specific way. The story of the police chief’s suicide betrayed this intent, allowing for an analysis of how these expectations can affect the way in which public history is done.

  2. Hiinas tutvustatakse Eesti graafikat

    Index Scriptorium Estoniae

    2010-01-01

    Shanghais EXPO 2010 maailmanäitusel Eesti paviljonis näeb kuu aega väljapanekut 37 eesti graafiku töödest. Peale Tallinna Kunstihoonest pärit tippgraafika esitletakse Eestis kasutusel olevaid traditsioonilisi ja eksperimentaalseid trükitehnikaid

  3. Hiina minimaastikud / Jaan Mettik

    Index Scriptorium Estoniae

    Mettik, Jaan

    2007-01-01

    Hiinlaste minimaastike kunstist pen jing (maastik potis). Tavaliselt jaotatakse pen jing kolmeks: puukujuline, maastikku imiteeriv ning vee ja maa oma. Minimaastikele võib lisada tillukesi pagoode, inimkujukesi jm. Soositud on ohtralt dekoreeritud potid. 7 värv. ill

  4. Algebraic proofs for shallow water bi-Hamiltonian systems for three cocycle of the semi-direct product of Kac-Moody and Virasoro Lie algebras

    Czech Academy of Sciences Publication Activity Database

    Zuevsky, Alexander

    2018-01-01

    Roč. 16, č. 1 (2018), s. 1-8 ISSN 2391-5455 Institutional support: RVO:67985840 Keywords : Kac-Moody Lie algebras * cocycles Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.682, year: 2016 https://www.degruyter.com/view/j/math.2018.16.issue-1/math-2018-0002/math-2018-0002. xml

  5. Algebraic proofs for shallow water bi-Hamiltonian systems for three cocycle of the semi-direct product of Kac-Moody and Virasoro Lie algebras

    Czech Academy of Sciences Publication Activity Database

    Zuevsky, Alexander

    2018-01-01

    Roč. 16, č. 1 (2018), s. 1-8 ISSN 2391-5455 Institutional support: RVO:67985840 Keywords : Kac-Moody Lie algebras * cocycles Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.682, year: 2016 https://www.degruyter.com/view/j/math.2018.16.issue-1/math-2018-0002/math-2018-0002.xml

  6. Final Environmental Assessment (EA) for Modification of Airspace Units R-3008A/B/C from Visual Flight Rules (VFR) to VFR-Instrument Flight Rules (IFR) at Moody Air Force Base, Georgia

    Science.gov (United States)

    2015-09-30

    moody-afb.htm on August 28, 2014. Intergovernmental Panel on Climate Change , 2007. Climate Change 2007 The Physical Science Basis. IPCC Geneva...Proposed Action would change or affect current land use designations and usage. There would be no change in land use designations or effects on usage...human health or environmental effects under certain conditions. 3.4.2 Existing Conditions Climate Moody AFB is located within the interior climate

  7. Nicole Matthews & Nickianne Moody, eds., Judging a Book by Its Cover: Fans, Publishers, Designers, and the Marketing of Fiction.

    Directory of Open Access Journals (Sweden)

    Thomas Van Parys

    2010-01-01

    Full Text Available

     

    Judging a Book by Its Cover: Fans, Publishers, Designers, and the Marketing of Fiction

    Nicole Matthews & Nickianne Moody, eds.,

     

    Judging a Book by Its Cover: Fans, Publishers, Designers, and the Marketing of Fiction. Aldershot/Burlington: Ashgate, 2007.

    ISBN: 978-0-7546-5731-6

  8. Improvement of production layout based on optimum production balancing scale results by using Moodie Young and Comsoal method

    Science.gov (United States)

    Ikhsan, Siregar; Ulina Anastasia Sipangkar, Tri; Prasetio, Aji

    2017-09-01

    This research was conducted at a make to order production system company which is engaged in the car body of the vehicle. One of the products produced is dump truck which is one kind of transportation for the transport of goods equipped with hydraulics to facilitate goods’ loading and unloading process. The company has 7 work stations with different cycle times. Companies often experience delays in order delivery. The production process on the production floor has not been done optimally where there is a build up of work in process in some work centres. The build up of work in process (WIP) products is seen in the welding and painting stations. Stacking that occurs on the production line may cause the company to be liable for damages due to delays in product completion. The WIP occurs due to unbalanced paths can be seen from the variance of cycle time of each station is very diverse. The time difference of each work element is due to the allocation of work elements to each work centre unevenly. On the basis of the allocation of uneven work elements, the dump truck assembly line is made. The analysis is done by using Moodie Young and Comsoal method to do the balancing of production line. The result of layout improvement by using systematic layout planning (SLP) method is change the composition of the work centre from 7 into 4 work centre which enables the movement of material to be more effective and efficient so that it can get an efficient and effective production trajectory and can solve existing problems. The result of the track balancing is then used as a guide in constructing a new layout based on the balancing result with the most optimum method.

  9. Uut moodi / Anne Vetik

    Index Scriptorium Estoniae

    Vetik, Anne

    2010-01-01

    Eesti moebrändidest, mis püüavad käivitada korrapärast tootmist ja haarata laiemat turgu. Lähemalt Mari Martini loodud kaubamärkidest Tallinn Dolls ja ReUse Republic, Kristina Viirpalu moeärist, Baltmani peadisaineri Antonio tegevusest

  10. Abielu hiina tundmatuga / Allar Tankler

    Index Scriptorium Estoniae

    Tankler, Allar, 1981-

    2000-01-01

    Vt. ka Moldojozh Estonii : Subbota Mar/18 lk. 13. Messias Koreast, pastor Sun Myung Moon laulatas eesti mehe Peter Ljashevitshi ja hiinlanna Gui Zhen Yuani 1995. aastal Valgevenes, kus noorpaar nägi teineteist esimest korda elus Ühinemise liikumise massilaulatusel

  11. Origins of chromite and magnetite in sedimentary rocks deposited in a shallow water environment in the 3.2 Ga Moodies Group, South Africa

    Science.gov (United States)

    Otake, T.; Sakamoto, Y.; Itoh, S.; Yurimoto, H.; Kakegawa, T.

    2012-12-01

    *Otake, T. totake@eng.hokudai.ac.jp Div. of Sustainable Resources Engineering, Hokkaido Univ., Sapporo, Japan Sakamoto, Y. yu.sakamoto12@gmail.com Dep. of Earth Science, Tohoku Univ., Sendai, Japan Itoh, S. sitoh@ep.sci.hokudai.ac.jp Dep. of Natural History Sciences, Hokkaido Univ., Sapporo, Japan Yurimoto. H. yuri@ep.sci.hokudai.ac.jp Dep. of Natural History Sciences, Hokkaido Univ., Sapporo, Japan Kakegawa, T. kakegawa@m.tohoku.ac.jp Dep. of Earth Science, Tohoku Univ., Sendai, Japan Geochemical data from ferruginous chemical sedimentary rocks (e.g., Banded Iron Formation: BIF) have been used to reconstruct the surface environments of early Earth. However, only a few studies have investigated the geochemical characteristics of BIFs deposited in a shallow water environment during the Archean, which may have differed from those deposited in a deep water environment. Therefore, we investigated geological, petrographic and geochemical characteristics of ferruginous rocks deposited in a shallow water environment in the Moodies group, in the Barberton Greenstone Belt, South Africa. We obtained ferruginous rock samples in the Moodies group from both an outcrop and underground gold mine, and compared the characteristics of these samples. The 70 sedimentary rock samples were divided into groups based on the dominant Fe minerals they contain: Hematite-rich jaspilite (HM group), Magnetite-rich iron formation/shale/sandstone (MT group), and Siderite-rich sandstone (SD group). Samples in the HM group are predominantly composed of fine-grained quartz (SIMS showed that magnetite in the Moodies group has similar δ18O values to those in the least metamorphosed BIFs. All chromite observed in the MT group is overgrown by magnetite. Samples in the SD group contain quartz, siderite, chlorite, biotite, and chromite; the chromite is included in Mg-rich siderite or silicate minerals (e.g., chlorite and biotite). Oxygen isotope compositions indicate that chromite in both the MT and SD

  12. The recommendation of line-balancing improvement on MCM product line 1 using genetics algorithm and moodie young at XYZ Company, Co.

    Science.gov (United States)

    Sriwana, I. K.; Marie, I. A.; Mangala, D.

    2017-12-01

    Kencana Gemilang, Co. is one electronics industry engaging in the manufacture sector. This company manufactures and assembles household electronic products, such as rice cooker, fan, iron, blender, etc. The company deals with an issue of underachievement of an established production target on MCM products line 1. This study aimed to calculate line efficiencies, delay times, and initial line smoothness indexes. The research was carried out by means of depicting a precedence diagram and gathering time data of each work element followed by examination and calculation of standard time as well as line balancing using methods of Moodie Young and Generics Algorithm. Based on results of calculation, better line balancing than the existing initial conditions, i.e. improvement in the line efficiency by 18.39%, deterioration in balanced delay by 28.39%, and deterioration of a smoothness index by 23.85% was obtained.

  13. "Demokratiseerimine" Guatemala moodi / Tõnu Prei

    Index Scriptorium Estoniae

    Prei, Tõnu, 1950-

    2004-01-01

    Guatemala ajaloost, Ameerika Ühendriikide poolt Guatemalas toime pandud riigipööretest ja kodusõjas toimunud maia-indiaanlaste genotsiidist, mille eest vastutavaid isikuid on nüüd hakatud kohtu alla andma

  14. Profile Interview: Prof. Rob Moodie

    African Journals Online (AJOL)

    I became really interested in tobacco control and the problems of tobacco globally, as well as alcohol, drugs, poor diet, lack of physical activity, and poor mental health. I was very interested in ensuring the effectiveness of our investments in research, good health promotion, and upstream interventions. Our aim was to invest ...

  15. Ulmekas Eesti moodi / Dagne Hanschmidt

    Index Scriptorium Estoniae

    Hanschmidt, Dagne

    2005-01-01

    Ulmelise lühimängufilmi "Kärbseudu" võtted Põlvamaal Ottenis. Režissöör, üks stsenariste ja produtsent on Tallinna Ülikooli filmi ja video eriala viimase kursuse tudeng Janek Karakatsh, näitlejaiks Raine Loo, Aapo Ilves, Igor Maasik (Onu Bella)

  16. "Klass" prantsuse moodi / Jaan Ruus

    Index Scriptorium Estoniae

    Ruus, Jaan, 1938-2017

    2009-01-01

    Laurent Cantet ja Françoise Begaudeau filmist "Seinte vahel", mis on pooldokumentaalne lugu probleemsest klassikollektiivist Prantsusmaa ühes riigikoolis. Filmi aluseks on kooliõpetaja Françoise Begaudeau romaan

  17. Seebikad vanakreeka moodi / Kadri Novikov

    Index Scriptorium Estoniae

    Novikov, Kadri

    2009-01-01

    Kreeka romaanist ehk 1. saj. eKr kuni 4. saj. pKr kirjutatud mahukatest proosafiktsioonidest, mis oma olemuselt on segu armastus- ja seiklusromaanidest. Pikemalt on vaatluse all Charitoni "Chaireas ja Kallirhoe", Xenophoni "Ephesose lood", Achilleus Tatiose "Leukippe ja Kleitophon", Longose "Daphnis ja Chloe" ning Heliodorose "Aithiopika"

  18. Mõistulood ungari moodi / Andres Allpere

    Index Scriptorium Estoniae

    Allpere, Andres

    2000-01-01

    Ungari mängufilmidest : "Mulle andis Vanajumal Pestis laterna kätte" ("Nekem lámpást adott kezembe az Úr Pesten"), režisöör Miklós Jancsó; "Nägija Simon" ("Simon mágus"), režisöör Ildikó Enyedi; "Süüdistus" ("A vád"), režisöör Sándor Sára ja "6 : 3", režisöör Péter Tímár

  19. Salatoimikud Eesti moodi / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2005-01-01

    Animafilmist "Frank ja Wendy", mis tehtud töökollektiivis koondnimega David Snowman = Priit Pärn, Ülo Pikkov, Priit Tender ja Kaspar Jancis : Eesti Joonisfilm 2004. Lisatud lühiintervjuu Piit Pärnaga

  20. Disneyland inglise moodi / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    2000-01-01

    Kuppelehitisest Millennium Dome Londonis. Avati 1. I 2000 ajutise ehitisena jäädes lahti 31. detsembrini. Ehitamist alustati 1997. a. Richard Rogersi (1933) büroo projekti järgi. Millenniumikuplil on 14 tsooni. Zaha Hadidi büroo disainis "Mind Zone'i". Inglise kunstnike töid paviljonides

  1. 8. detsembrini Hiina Vabariigi Taiwani pealinnas...

    Index Scriptorium Estoniae

    2002-01-01

    Taipei X rahvusvahelisel graafika ja joonistuste biennaalil esindab Eestit Benjamin Vasserman tööga "Haripunkt". Peapreemiad: Vara Chaiyanitaya (Tai), Rensong Pan (joonistuste kategooria, Taiwan). B. Vasserman sai septembris Rumeenias Cluj III rahvusvahelisel väikegraafika biennaalil žürii kiituse. Peapreemia: Vladimir Gazovic (Slovakkia)

  2. Eesti põrsad Hiinas / Janno Roos

    Index Scriptorium Estoniae

    Roos, Janno, 1976-

    2009-01-01

    Shanghai EXPO Eesti paviljoni konkursi võidutööst "Savecity.org". Võidutöö autorid Illimar Truverk AET-Arhitektid, Priit Hamer AET-Arhitektid, Janno Roos Ruumilabor, Andres Labi Ruumilabor, Ionel Lehari Identity, Kristian Paljasma Identity, Meelis Opmann Identity ja Maret Põldre Identity

  3. Aedniku uut moodi aasta / Peeter Laurits

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2008-01-01

    2008. a. kirjastuselt Maalehe Raamat ilmunud Karel Capeki raamatu "Aedniku aasta" kujunduspõhimõtetest. Kujundajad: Peeter Laurits, Tiina Ubar. Korrektuur: Leelo Laurits. Samas: Siim, Signe "Raamatu taassünnilugu", Mettik, Jaan "Unuma kippuva taastulek"

  4. Kahevõitlus Rooma moodi / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2006-01-01

    Ajalooline kostüümidraama - seriaal Rooma impeeriumi ajast "Rooma" : tootjad Ameerika Home Box Office (HBO), inglaste BBC ja itaallaste RAI ning ameerika ABC toodang - 6-osaline "Impeerium", mis filmiti Roomas samal ajal - 2004.aastal. Sama ka Teleleht nr. 45, lk. 38 : ill

  5. Gorecki: Euntes Ibant et Flebant / Ivan Moody

    Index Scriptorium Estoniae

    Moody, Ivan

    1994-01-01

    Uuest heliplaadist "Gorecki: Euntes Ibant et Flebant, Op. 32. Totus tuus, Op. 60. Amen, Op. 35; Pärt, Arvo: Magnificat. Summa; Travener, John: The Annunciation a. o. Oxford Musica Singers / Michael Smedley" Proud Sound CD PROUCD 136

  6. Rituaalid Ando Keskküla moodi

    Index Scriptorium Estoniae

    2000-01-01

    Tallinna Kunstihoones näitus "Rituaalide mehaanika", millega Ando Keskküla tähistab oma 50. sünnipäeva. Näituse külalised Marko Laimre, Zoe Beloff, Bea de Visser, Fiddian Warman ja Julian Saunderson.

  7. Rahvuslik kokkulepe Moldova moodi / Mart Rannut

    Index Scriptorium Estoniae

    Rannut, Mart

    2003-01-01

    Probleemidest Moldovas emakeele õpetamisel ja õppimisel, kus moldova keele madala ja vene keele ülikõrge staatuse tõttu õpib osa etnilisi moldovlasi ja peaaegu kõik vähemuskeelsed lapsed venekeelsetes koolides ning valdav osa venekeelse kooli õpilastest omandab küll riigikeele hindele hea ja väga hea, ilma seda tegelikult omandamata

  8. 451° Fahrenheiti Eesti moodi / Tiina Tammer

    Index Scriptorium Estoniae

    Tammer, Tiina, 1960-

    2013-01-01

    451° Fahrenheiti on temperatuur, mille juures paber süttib ja põleb. Eestis üle aasta toimunud klaperjaht raamatute, raamatukogude ja kirjastajate ümber paneb küsima: kes tõmbab lõpuks tikku ja süütab esimese raamatu? Autor otsib küsimusele vastuseid

  9. Noort moodi / Kätlin Karik

    Index Scriptorium Estoniae

    Karik, Kätlin

    2011-01-01

    ERKI Moeshow Volta tehases 4. juunil 2011. Loetletud lavale pääsenud kollektsioonid. Pikemalt kollektsioonidest "All that money" (Madis Luik, Karen Milistver, Nele Aunap), "Satellite orchids" (Olga Jazepova), "Vaktsiin" (Triinu Jõhve, Diana Tombak, Katrina Kaubi, Maarja Siim, Piret Mägi, Elina Peippo), "I love you...me neither" (Olga Rattik), "Haute sport couture" (Kristina Tatarinova). Kollektsioonide autorid vastavad kolmele küsimusele

  10. Esimene : elutoamuusikal Soome moodi / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2006-01-01

    Artiklisari B, mis tutvustab Baltoscandalile saabuvaid truppe ja esinejaid. Esimesena trupp Houkka Bros. Soomest, kes eelmisel festivalil näitas oma lavastust "Rändaja". 2006.a. festivalile tullakse omil sõnul elutoamuusikaliga "Lapsi, linde ja lillekesi"

  11. Kahtlaste provokaatorite paraad Moskva moodi / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 9. okt. lk. 10. Katari pealinnas Dohas 2004. aastal toimunud Tšetšeenia endise presidendi Zelimhan Janbarbijevi pommiplahvatusega tapmise tagamaadest ja Venemaa luureagentide arreteerimisest. Gruusias lahvatanud spiooniskandaali ja Doha plahvatuse puhul toimunud sarnased reageeringud Venemaal. Gruusia võimud seostavad Vene luureorganisatsiooni grusiinide grupiga, kes olevat valmistunud riigipöördeks

  12. Eesti etnostiil Hiinas moenäitusel / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2010-01-01

    Eesti EXPO paviljonis Shanghais 26. juulini avatud moenäitusest "Eestlane olla...", mille läbivaks ideeks on eesti rahvakunst, mida oma isikupärases võtmes on tõlgendanud 23 autorit. Kuraator Anu Hint

  13. Eesti ilmumine Hiina rahvale - EXPO 2010 paviljon Shanghais / Anneliis Aunapuu

    Index Scriptorium Estoniae

    Aunapuu, Anneliis

    2009-01-01

    Shanghai EXPO Eesti paviljoni konkursi võidutööst "Savecity.org", autorid Ionel Lehari, Kristian Paljasma, Illimar Truverk, Priit Hamer, Janno Roos, Andres Labi. Premeeritud tööd. Žürii koosseis. Konkursitöödest on avatud näitus Eesti Arhitektuurimuuseumis 24. maini

  14. USA investor loodab raha teenida Brasiilias ja Hiinas / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 14. juuni lk. 25. USA investeerimisfirma Cumberland Advisors juht David Kotok osales Äripäeva korraldatud majanduskollokviumil. Tema investeerimisfirma on paigutanud raha Ida-Euroopasse, Hiinasse ja Lõuna-Ameerikasse. Vt. samas: Väikeinvestoril tuleb aktsiaid ostes kodutööd teha

  15. Effects of a robotic storyteller's moody gestures on storytelling perception

    NARCIS (Netherlands)

    Xu, J.; Broekens, J.; Hindriks, K.; Neerincx, M.A.

    2015-01-01

    A parameterized behavior model was developed for robots to show mood during task execution. In this study, we applied the model to the coverbal gestures of a robotic storyteller. This study investigated whether parameterized mood expression can 1) show mood that is changing over time; 2) reinforce

  16. Taska teeb Venezuela seebi eesti moodi / Verni Leivak

    Index Scriptorium Estoniae

    Leivak, Verni, 1966-

    2008-01-01

    Produtsent Kristian Taska ostis ära Venezuela seebiooperi "Lorenzo naine", et valmistada Kanal Spordis näitamiseks Eesti oludele mugandatud "Kalevi naised" (lavastaja Ingomar Vihmar, osades Maria Avdjuško, Andrus Vaarik, Jan Uuspõld, Anne Reemann)

  17. Uut moodi Teine maailmasõda / Kaisa Karu

    Index Scriptorium Estoniae

    Karu, Kaisa

    2009-01-01

    Teise maailmasõja 70. aastapäevaks valminud kuueosalise doksarja "Apokalüpsis: WWII", (National Geographic, režissöör Isabelle Clarke, stsenaristid Henri de Turenne ja Daniel Costelle) filmimispaikades

  18. Papa Carlo teater filmitudengite moodi / Kairit Tsäro

    Index Scriptorium Estoniae

    Tsäro, Kairit, 1974-

    2002-01-01

    Concordia ülikooli ja TPÜ tudengid lõpetasid õppejõudude Ilmar Raagi ja Ian M. Fraseri juhendamisel kõmumeediat parodeeriva lühimängufilmi "Meie lemmikud". Stsenarist ja režissöör on Hanna Shein

  19. Sõnavabaduse dogma Hollandi moodi / Kaspar Näf

    Index Scriptorium Estoniae

    Näf, Kaspar

    2008-01-01

    Šveitsi ajaloolane ja ajakirjanik leiab Hollandi parlamendisaadiku Geert Wildersi islami-vastase filmi ja ENPA endise presidendi Rene van der Lindeni arvamusavaldustega seoses, et kui sõnavabadus ja arvamuse väljendamine on eesmärk iseenesest, siis on see eriti neil juhtudel absurdne, kui seab teisi inimesi ohtu

  20. The Jordan structure of lie and Kac-Moody algebras

    International Nuclear Information System (INIS)

    Ferreira, L.A.; Gomes, J.F.; Teotonio Sobrinho, P.; Zimerman, A.H.

    1989-01-01

    A precise relation between the structures of Lie and Jordan algebras by presenting a method of constructing one type of algebra from the other is established. The method differs in some aspects of the Tits construction and Jordan pairs. The examples of the Lie algebras associated to simple Jordan algebras M m (n ) and Clifford algebras are discussed in detail. This approach will shed light on the role of the realizations of Jordan algebras through some types of Fermi fields used in the construction of Kac-Moodey and Virasoro algebras as well as its relevance in the study of some aspects of conformal fields theories. (author)

  1. Grammatika läti moodi / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    1999-01-01

    Läti nüüdiskunsti näitus "Grammatika" Rotermanni soolalaos. Kuraator Solvita Krese. Eriks Bozhise, rühmituse F5, Renars Kruminshi, Martinsh Ratniksi, Ieva Rubeze, Armins Ozolinshi, Barbara Gaile, Gints Gabransi, Monika I. Pormale, Izolde Cesniece töödest.

  2. Mõtlemine Borge Ouslandi moodi - julge, avar ja loov / Andrus Hiiepuu

    Index Scriptorium Estoniae

    Hiiepuu, Andrus, 1966-

    2005-01-01

    Mobiilsideoperaatori Elisa juhatuse liikme mõtisklus Borge Ouslandi esinemisest Pärnu Finantskonverentsil. Ettekandes rõhutas polaarrändur eesmärkide seadmise, pühendumise, põhjaliku ettevalmistuse ja sihikindluse tähtsust tulemuse saavutamisel

  3. Moody experts --- How mood and expertise influence judgmental anchoring

    Directory of Open Access Journals (Sweden)

    Birte Englich

    2009-02-01

    Full Text Available Anchoring effects, the assimilation of numerical estimates to previously considered standards, are highly robust. Two studies examined whether mood and expertise jointly moderate the magnitude of anchoring. Previous research has demonstrated that happy mood induces judges to process information in a less thorough manner than sad mood, which means that happy judges tend to be more susceptible to unwanted influences. However, this may not be true for anchoring effects. Because anchoring results from an elaborate process of selective knowledge activation, more thorough processing should lead to more anchoring; as a result, sad judges should show stronger anchoring effects than happy judges and happy judges may even remain uninfluenced by the given anchors. Because information processing of experts may be relatively independent of their mood, however, mood may influence anchoring only in non-experts. Results of two studies on legal decision-making (Study 1 and numeric estimates (Study 2 are consistent with these expectations. These findings suggest that, at least for non-experts, positive mood may eliminate the otherwise robust anchoring effect.

  4. Moody Music Generator: Characterising Control Parameters Using Crowdsourcing

    DEFF Research Database (Denmark)

    Scirea, Marco; Togelius, Julian; Nelson, Mark

    2015-01-01

    We characterise the expressive effects of a music generator capable of varying its moods through two control parameters. The two control parameters were constructed on the basis of existing work on valence and arousal in music, and intended to provide control over those two mood factors. In this ......We characterise the expressive effects of a music generator capable of varying its moods through two control parameters. The two control parameters were constructed on the basis of existing work on valence and arousal in music, and intended to provide control over those two mood factors...... of generated music over the Internet, and to describe the moods with free-text labels. We find that the arousal parameter does roughly map to perceived arousal, but that the nominal “valence” parameter has strong interaction with the arousal parameter, and produces different effects in different parts...

  5. Kalevipoeg ja Mumm-Summ VAT Teatri moodi

    Index Scriptorium Estoniae

    2003-01-01

    VAT Teatris esietendub 5. dets. M. Kampuse lavastatud jõuluetendus "Lihtsalt ... Mesilane" C. Vogli lugude "Väike mesilane Mumm-Summ" ainetel. VAT Teatri ja Markus Zohneri koostööprojektina esietendus 30. nov. Tallinna Linnateatris rahvuseepose "Kalevipoeg" motiividel loodud M. Zohneri lavaversioon

  6. Tundekausatiivikonstruktsioon eesti moodi / Liina Lindström

    Index Scriptorium Estoniae

    Lindström, Liina, 1973-

    2012-01-01

    Käsitletakse kogejakonstruktsiooni, milles kogeja on markeeritud nagu grammatiline objekt ja stiimul nagu grammatiline subjekt. Konstruktsiooni vaadeldakse teiste keelte taustal, et välja selgitada eesti keeles toimunud muutusi

  7. Kirg prantsuse, sakslased austraalia ja huumor briti moodi / Tiit Merisalu

    Index Scriptorium Estoniae

    Merisalu, Tiit

    1997-01-01

    Seriaalid "Punane ja must" ("Le rouge et le noir"), režissöör Jean-Daniel Verhaeghe : Prantsusmaa 1997; "Päike kõrrepõllu kohal" ("The Valley Between"), režissöör Robert Marchand : Austraalia 1996 ja "Smith ja Jones" ("Smith and Jones"), režissöörid John Kilby jt. : Inglismaa

  8. Teatri moodi kunst paneb publiku uude rolli / Liina Luhats

    Index Scriptorium Estoniae

    Luhats, Liina

    2011-01-01

    Taani osalusteatri SIGNA etenduslik installatsioon "Bleier Research Inc" Tallinnas Standardi majas. Piireületavat eksperimenti mängivad avalikul konkursil Eestist valitud näitlejad. Intervjuu Signa Sørenseniga taani-austria kunstnikeduost SIGNA. Eesti teatritegijate arvamusi

  9. "Salatoimikud" Indiana Jonesi moodi / Inna-Katrin Hein

    Index Scriptorium Estoniae

    Hein, Inna-Katrin

    2008-01-01

    Steven Spielbergi neljas Indiana Jones'i film Harrison Fordiga nimiosas "Indiana Jones ja kristallpealuu kuningriik" ("Indiana Jones and the Kingdom of the Crystal Skull") : Ameerika Ühendriigid 2008

  10. Rukkileib tuleb jälle moodi / Madli Kents

    Index Scriptorium Estoniae

    Kents, Madli

    2003-01-01

    Ilmunud ka: Delovõje Vedomosti : Desjatiletnije firmõ 12. veebruar lk. 13. Pagaritööstuste arengust: Leibur, ETK Leib, Fazer Pagarid, Pere Leib, Cibus. Vt. samas: Fakte 10 aasta tagusest perioodist

  11. The challenges of energy - response to Moody-Stuart

    Directory of Open Access Journals (Sweden)

    John Houghton

    2002-09-01

    Full Text Available Sir Mark has lucidly addressed the growing demand for accessible energy throughout the world, the need for basic provision of energy to one third of the world's population and the conflicts that arise between the ways in which energy is supplised and used and the constraints of sustainability. It is, of course, the innovation, creativity and activity of industry that will provide solutions to the problems we face. It is therefore appropriate and helpful to hear form one of the leaders of the energy industry. The vision he presents i one of a vibrant, innovation, market-driven industry operating within a regulatory framework that gives the maximum flexibility for creative solutions. The greatest challenges faced by the world energy sector are concerned with environmental sustainability. Because the emissions of greenhouse gases such as carbon dioxide spread rapidly around the globe, sustainability has to be considered on a global basis and global solutions are rquired. International agreements concerning action, for instance the Framework Convention on Climate Change (FCCC, need to be based on sound science and on four widely accepted principles, namely the Precautionary Principle, the Polluter Pays Principles and the Principles of Sustainable Development and Equity. The challenge to the FCCC is to devise mechanisms and arragements that will bring about substantial reductions in greenhouse gas concentrations in the atmosphere and that also satisfy there principles. A recent Energy Review from the Policy Innovation Unit of the UK Government's Cabinet Office has considered in detail how a sustainable energy strategy can be developed. Finally, reasons are given for optimism that, given the necessary commitment by the world community, a sustainable energy strategy for the world can be developed and realised during the 21st century.

  12. Clinton: USA kaotab infosõjas Hiina, Venemaa ja Al Jazeeraga / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    USA välisministri Hillary Clintoni hinnangul on USA propaganda nõrgenenud ning USA mõjuvõim väheneb pidevalt. H. Clintoni vastusest Senati väliskomisjonis senaator Richard Lugari küsimusele USA pingutustest diplomaatilise kommunikatsiooni vallas

  13. Hiina põlevkivikeemikud uurisid VKG tootmist / Peeter Lilleväli

    Index Scriptorium Estoniae

    Lilleväli, Peeter

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 26. aug. 2004, lk. 1. Fushun Mining Group Co. Ltd juht Yin Liangi sõnul on nende firma tegelenud põlevkivist õli tootmisega üle 40 aasta, kuid kuna Eesti kogemus on sellel alal kaks korda pikem, huvituvad nad siin kasutatavast tehnoloogiast

  14. Riskikapitalist : "Uus Euroopa on meie Hiina ja India" / Danny Rimer ; interv. Kristjan Otsmann

    Index Scriptorium Estoniae

    Rimer, Danny

    2006-01-01

    Euroopa suurimate riskikapitalide hulka kuuluva Index Venturesi partner Danny Rimer otsib kõikjalt Euroopast, ka Eestist, ettevõtteid, mis suudavad luua uut läbilöögivõimelist tehnoloogiat. Kuumad teemad riskikapitali maailmas, ettevõtete valik, kuhu investeerida. Lisa: Index Ventures

  15. Razgovor za tshashkoi kitaiskogo tshaja / Mingo Liu ; interv. Vitali Andrejev

    Index Scriptorium Estoniae

    Liu, Mingo

    2005-01-01

    Hiina kaubandusesinduse nõunik Eestis vastab küsimustele, mis puudutavad Eesti ja Hiina kaubanduskontakte, Hiina ettevõtja huvi Eesti turu vastu ja Eesti ettevõtja huvi Hiina vastu, võimalikke tõkkeid Eesti-Hiina kaubandussuhetes

  16. Perbaikan Layout Produksi Berdasarkan Hasil Penyeimbangan Lintasan Produksi Optimum Dengan Menggunakan Metode Moodie Young dan Comsoal

    OpenAIRE

    Sipangkar, Tri Ulina Anastasia

    2016-01-01

    PT Mahakarya Jaya Sinergi adalah salah satu perusahaan pembuat karoseri dump truck. Dump truck merupakan alat transportasi pemindahan barang yang dilengkapi dengan hidrolik untuk mempermudah proses bongkar muat. Perusahaan memiliki 7 stasiun kerja yang memiliki waktu siklus berbeda-beda danmasih mengalami keterlambatan order delivery. Proses produksi belum terlaksana secara optimal karena masih terdapat penumpukan work in process pada beberapa work center. Penumpukan produk work in process (W...

  17. Baltoscandalistide massiline meeleavaldus : Hitler inglise moodi ja tantsuteater spordikirikus / Marko Mägi

    Index Scriptorium Estoniae

    Mägi, Marko

    2000-01-01

    Meeldejäävaimaid "teatripärleid" Rakvere teatrifestivalilt "Baltoscandal 2000" : ameerika New York Wyoming Dance Theatre Projecti all tegutseva Pat Creminsi tantsuõhtu ja inglase Pit Upponi kehastatud Hitler monotükis "Adolf"

  18. Kosmiline all-in-one-köök prantsuse moodi / Maris Podekrat

    Index Scriptorium Estoniae

    Podekrat, Maris

    2007-01-01

    Prantsuse disaineri Sebastien Poupeau' köögid ühendavad endas traditsioonilisi ja multimeedialahendusi. Töölaud on varustatud mitme LCD-ekraaniga, söögitegija võib internetist retsepte otsida, muusikat valida ja ahju kuumust reguleerida

  19. Tolstoi "Sõda ja rahu" eesti moodi / Peeter Volkonski, Karin Tammaru ; interv. Jaanika Juhanson

    Index Scriptorium Estoniae

    Volkonski, Peeter, 1954-

    1999-01-01

    Mikk Mikiveri lavaversioon Lev Tolstoi suurromaanist "Sõda ja rahu" Vanemuises, lavastaja Mikk Mikiver, kunstnik Ervin Õunapuu. Peaosades Peeter Volkonski, Karin Tammaru, Jüri Lumiste. Esietendus 13. nov

  20. "Allakäigu" Adolf Hitler paistab päris inimese moodi / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2004-01-01

    Mängufilm, kus peategelaseks on Adolf Hitler - "Allakäik" ("Der Untergang") : stsenarist ja produtsent Bernd Eichinger : režissöör Oliver Hirschbiegel : Saksamaa 2004. Lisa "Pimedad Ööd tahavad Hitlerit"

  1. Ilma tahtmata ja teadmata paradiisi ehk Arhetüüp eesti moodi / Rein Tootma

    Index Scriptorium Estoniae

    Tootma, Rein

    2006-01-01

    Lühimängufilm "Vanameeste paradiis" : stsenaristid Ove Musting (ka idee autor), Urmas Lennuk : režissöör Ove Musting : operaator Mait Mäekivi : helilooja Arian Levin : kunstnik Eva-Marina Gramanovski : näitlejad Tõnu Aav, Aleksander Eelmaa, Tõnu Oja, Ants Ander, Henry Kõrvits : Downtown Pictures 2005

  2. Ehedus mitut moodi : rahvamuusika ahtusest pärimusmuusika avarustesse / Taive Särg

    Index Scriptorium Estoniae

    Särg, Taive, 1962-

    2010-01-01

    Käsitletakse rahvamuusika osa Eesti lähimineviku kultuuriprotsessis ja folkloristika rolli selle suunajana. Antakse ülevaade rahvamuusika kontseptsioonist 1970.-1980. aastate folklooriliikumise tõusulaines ilmunud kirjutiste põhjal, mil peetakse oluliseks ehedust, ehtsust ja autentsust, samuti vaadeldakse eelnevaid ja järgnevaid arenguid rahvamuusikas

  3. Unes saab mitut moodi kõndida / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2002-01-01

    Pimedate Ööde Filmifestivali raames toimuva tudengifilmide festivali programmist "Vanad ja väärikad", kus näidati maailmakuulsate režissööride esimesi katsetusi ning kuulsate eksperimentaalfilmide autorite underground-filmide kavast

  4. Civil Engineer Contingency Training Moody Air Force Base, Georgia Environmental Assessment

    Science.gov (United States)

    2007-03-01

    Trees are not as tall as in the low latitude rainforest, leaves usually are smaller and more leathery, and the leaf canopy is less dense. The...and midstory vegetation consists of blackberries , grapevines, 21 blueberries, sparkleberries, sassafras, and other shrubs. Scattered water oaks

  5. Environment Assessment for Grand Bay Range, Bemiss Field, and Moody Explosive Ordnance Disposal Range Operations

    Science.gov (United States)

    2013-06-01

    stormwater runoff. One strategy for reducing stormwater runoff is the implementation of LID technologies. As it pertains to this Proposed Action, EO...have reported primary and secondary effects including reduced milk production and rate of milk release, increased glucose concentrations, decreased...concerns about overflight effects on pregnant cattle, milk production, and cattle safety, the U.S. Air Force prepared a handbook for environmental

  6. DEDEMAN CAMPAIGNS: THE COMPENSATION OF BEING A MAN DOMINATED BY A MOODY WOMAN

    Directory of Open Access Journals (Sweden)

    MADALINA MORARU (BUGA

    2012-05-01

    Full Text Available Advertising seems to be the perfect field for playing gender games, either as a relationship between authority and subordination or as a conflict. Dedeman campaigns are very well-known for targeting men by using their family background, especially women, considering product specificity. The company focuses on retail construction for home design, and is the brainchild of two Romanian owners. Basically, this company offers all the consumer needs to build a house on the outside and the inside as he or she wishes, or to modernize an existing construction. Dedeman advertising is very rich and distributed on diverse media channels, even if the company is still young. The following research aims to highlight the relationship between masculinity and femininity in promoting brand values and service quality by analyzing print and outdoor advertisements. Therefore, we are very interested in establishing the role of the product in this difficult relationship of communication, given it is equally designed for men and for women, but establishes a different connection with them. The main purpose here is to discover the involvement of the brand and products in family life, and to identify the male and female target profile. This research relies on the visual and linguistic sample of Dedeman print campaigns and the method approach is the analysis of the advertising discourse in texts created for billboards and print advertisements. We are very interested in the types of advertising texts (argumentative, narrative, descriptive, the linguistic representations of femininity and masculinity, and syntactic relationship between product and gender. At the end of this research, we expect to reveal a Dedeman advertising strategy applied in promoting brand’s values which may involve the gender roles in a creative way.

  7. The moody chameleon: The effect of mood on non-consious mimicry

    NARCIS (Netherlands)

    van Baaren, Rick B.; Fockenberg, Daniel A.; Holland, Rob W.; Janssen, L.; van Knippenberg, Ad

    2006-01-01

    Whereas previous findings suggest that mood alters information processing style judgment and strategic behavior, in the present article, the hypothesis is tested that moods influence our non–conscious behavior. In the first study, we observed a correlation between participants’ mood and their

  8. Töölepingu seadus : kuhu edasi ehk turvalisus ja paindlikkus Eesti moodi? / Gaabriel Tavits

    Index Scriptorium Estoniae

    Tavits, Gaabriel, 1972-

    2008-01-01

    Töölepingu seaduse eelnõust: töölepingu sõlmimisest, täitmisest, lubatavusest ja ülesütlemisest. Töölepingu kirjaliku vormi nõuetest, alaealiste tööle võtmisest, töötaja ja tööandja kohustustest

  9. From the Frozen Wilderness to the Moody Sea: Rural Space, Girlhood and Popular Pedagogy

    Science.gov (United States)

    Gottschall, Kristina

    2014-01-01

    This paper turns to debates in post-critical public pedagogy to focus on how a small body of films might potentially work as vehicles for teaching and learning about youth, gender and space. It is argued that representations of the rural shape what is possible for girlhood, being both enabling and constraining for the subject. Framed by discourses…

  10. Mosaiigitükid vajavad uut moodi kokkupanekut / Martin Klöker ; intervjueerinud Katrin Kaugver

    Index Scriptorium Estoniae

    Klöker, Martin, 1966-

    2012-01-01

    Intervjuu kirjandus- ja kultuuriloolase Martin Klökeriga, kes viibis TLÜAR-i kutsel 2012. a märtsis Tallinnas ning pidas avaliku loengu "Ebatäielik pilt: trükitud raamat ja käsikiri kultuuride uurimises" ning kokkuvõte loengust

  11. Moody microbes or fecal phrenology: what do we know about the microbiota-gut-brain axis?

    Science.gov (United States)

    Forsythe, Paul; Kunze, Wolfgang; Bienenstock, John

    2016-04-19

    The microbiota-gut-brain axis is a term that is commonly used and covers a broad set of functions and interactions between the gut microbiome, endocrine, immune and nervous systems and the brain. The field is not much more than a decade old and so large holes exist in our knowledge. At first sight it appears gut microbes are largely responsible for the development, maturation and adult function of the enteric nervous system as well as the blood brain barrier, microglia and many aspects of the central nervous system structure and function. Given the state of the art in this exploding field and the hopes, as well as the skepticism, which have been engendered by its popular appeal, we explore recent examples of evidence in rodents and data derived from studies in humans, which offer insights as to pathways involved. Communication between gut and brain depends on both humoral and nervous connections. Since these are bi-directional and occur through complex communication pathways, it is perhaps not surprising that while striking observations have been reported, they have often either not yet been reproduced or their replication by others has not been successful. We offer critical and cautionary commentary on the available evidence, and identify gaps in our knowledge that need to be filled so as to achieve translation, where possible, into beneficial application in the clinical setting.

  12. Environmental Assessment for Management of South End of Runway Wetlands, Moody AFB, Georgia

    Science.gov (United States)

    2010-11-01

    Review of Selected Airport Noise Analysis Issues. August 1992. Finegold et. al 1994 Finegold, S. Lawrence, C. Stanley Harris, and Henning E. von Gierke ...mishaps result in total damage that costs in excess of $20,000 (but less than $200,000), or any injury or occupational illness or disease that causes

  13. Junāgadhi raidkiri: kommunaalpropaganda Vana-India moodi / Martti Kalda

    Index Scriptorium Estoniae

    Kalda, Martti, 1973-

    2016-01-01

    Rudradāmani raidkirjast. Raidkiri on rajatud Sudarśana veehoidla parandamise ja renoveerimise auks. Raidkirja ajaloolisest taustast. Raidkirja teksti tõlge ja kommentaarid. Tegemist on (peale müntide) ainsa säilinud tekstiga vürst Rudradāmani ajast

  14. Final Environmental Assessment for the Military Housing Privatization Initiative (MHPI), Moody Air Force Base, Georgia

    Science.gov (United States)

    2014-03-01

    7-"~- ~ ... .!;a-!~~ ~~::~~-at...~= .. F1~ ~~ ~;.~ ~~: =&>: cr-.f.k:di(hl fo:ut a-. td setld !t lO Zt~J ~- ~~caa be abtaiaffi-l:t.r.iY.;gt cu...UI\\tolt Tal .. f.gn• g! M#fh’h -- -"--- ... -··---ucw~- - ,._,. ___ ..... _ -"-’-- .,. ~ fAC.U oc- cSM .!!!-.. • 4. -- --- ···---<:Ww!Tollk...jurisdictional walt111 on lhe silc. If you h111~ not alrt’ady 6one 50. I R!’CO!flmtnd tb:tt )’Ou pla~.-e 11. $1UI(!ITl(!llt on the fin:tl surve)’ td J’lt’(lp

  15. Moody AFB, Georgia. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.

    Science.gov (United States)

    1982-05-21

    626 626 3oo ŕ 8IlL AL3 3 16 . 4o 8.4 84,] 89.1 841. - 100 21. .1 86 0 6S 7. So0 $S .O S .1 08.0 ISO 6S.? S . 8 6350 ? $S0 2 00 21. 57. 66. jT Ii &Tel...0 71. 762 72@ . 72. 72.. 72a 72a 72C 72, 72. 72, m 8000 32. 75 75. 75. 75o 75. 76. 76o 76. 2 76. 2 76.2 76. Z 76.2 76.2 76.2 7a. 27000 327 -76J 760b...79 7,. Ti 76.• I .7.7 76.7 76. 76. 6.7 76T.7 76. >1o4000 15.1 72.1 77.1 78. 74. 78 78.5 78.5 78.5 78.* 78.5 78.5 78.5 78.5 78.5 78.5>2000o Iso 73+ 781

  16. Raivo Vare : "Medvedevi ajal muutub Venemaa Tšiili-Hiina-Korea segamudeliks" / Raivo Vare ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Vare, Raivo, 1958-

    2008-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 8. märts, lk. 3. Transpordieksperdina tuntud Raivo Vare sõnul paari lähema aasta jooksul poliitilisel tasandil Venemaal suurt midagi ei muutu. Arvamust avaldab Tiit Vähi. Lisa: Raivo Vare CV

  17. UniCredit Bank Eesti juht: Meie võimalused on Venemaal ja Euroopas, mitte Hiinas / Taavi Laur

    Index Scriptorium Estoniae

    Laur, Taavi

    2010-01-01

    UniCredit Bank Eesti juht vastab küsimustele, kas kriis tõi Eesti majanduses kaasa struktuurimuutuse, mis on praegu ettevõtjatele suurim väljakutse, kas Eesti võiks olla Euroopa ja Venemaa vaheline transiidimaa

  18. Esimene Eesti maja Hiinas = The first Estonian house in China / Andres Põime, Lauri Vaimel ; interv. Triin Ojari

    Index Scriptorium Estoniae

    Põime, Andres

    2008-01-01

    Vestlus Pekingi Eesti saatkonna arhitektuurikonkursi võidutöö autoritega. Tulemused: I preemia - Andres Põime, Lauri Vaimel, II - Erik Nobel, Christian Jensen, Kristen Herup Sovang, Soren Andersson, Pille Kivihall, Dan Ljungar, Hans Willadsen (Taani), III - Kalle Vellevoog, Velle Kadalipp, Tiiu Truus, Martin Prommik

  19. Euroopa ja Hiina pehme tasakaalustumine Ida-Aasia ning Ameerika Ühendriikide suhtes : arvustus / Jaanika Erne

    Index Scriptorium Estoniae

    Erne, Jaanika 1967-

    2013-01-01

    Arvustus: Nicola Casarini. Remaking Global Order: The Evolution of Europe-China Realtions and its Implications for East Asia and the United States. Oxford: Oxford University Press, 2010. (Oxford Scholarship Online.) 344 pp

  20. Draakon teritab küüniseid / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2005-01-01

    Hiina-USA viimaste aastakümnete tõsisem konflikt, mis sai alguse Hainani intsidendist. Hiina suhtes 1989. a. kehtestatud relvaemargo kaotamisest. USA julgeoleku- ja Euroopa Liidu majandushuvid. Tabel: Hiina sõjaliste kulutuste ametlikud andmed

  1. Китай наращивает свою военную мощь / Юрген Тамме

    Index Scriptorium Estoniae

    Тамме, Юрген

    2011-01-01

    Hiina on soovitud mõjupiirkonnas ehk Vaikse ookeani regioonis oma riiklikke, majanduslikke ja julgeolekuhuve kaitstes hakanud käituma aktiivse suurriigina. Hiina tugevnemisega kaasnevast julgeolekuriskist. Territooriaaltüli Lõuna-Hiina meres

  2. Kuidas hiinlastega filmi teha / Margus Õunapuu ; interv. Jüri Laulik

    Index Scriptorium Estoniae

    Õunapuu, Margus

    2006-01-01

    Eestipoolne produtsent jagab muljeid, kuidas toimus Hiinas Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Igavese armastuse sõdalane - Jade Warrior" filmimine. Film on Soome, Hiina, Hollandi ja Eesti ühistöö

  3. Estonian-Chinese cohesion / Liina Lelmi

    Index Scriptorium Estoniae

    Lelmi, Liina

    2009-01-01

    Eesti-Hiina majandussuhetest. Hiina asepeaministri Zhang Dejiangi Eesti visiidist ja kohtumisest peaminister Andrus Ansipi, välisminister Urmas Paeti ning majandus- ja kommunikatsiooniminister Juhan Partsiga

  4. Отношения Китая и Японии обострились / Юрген Тамме

    Index Scriptorium Estoniae

    Тамме, Юрген

    2010-01-01

    Hiina ja Jaapani suhete teravnemisest seoses Hiina traaleri ja kahe Jaapani patrull-laeva kokkupõrkega 8. septembril 2010. a. Ida-Hiina meres asustamata saarestiku lähistel. Puhkenud tülis nähakse ka Hiina väljakutset Ameerika Ühendriikidele, kelle liitlaste hulka kuulub ka Jaapan

  5. Implementation of a Dynamic Mooring Solver (MOODY) into a wave to wire model of a simple WEC

    DEFF Research Database (Denmark)

    Ferri, Francesco; Palm, Johannes

    This report forms the deliverable D4.6 of the Structural Design of Wave Energy Devices (SDWED) project. The main objective of the report is to shed light on the implementation of a simple floating wave energy converter (fWEC) numerical model coupled with a dynamic model of the reaction system. Th....... The model will be validated with results based on physical model tests. Focus of the analysis is the definition of pros and cons of the implementation....

  6. Construction of Open Burning Facility Moody Air Force Base, Georgia Environmental Assessment and Finding of No Significant Impact

    Science.gov (United States)

    2009-01-01

    temperate rainforest , also called temperate evergreen forest and laurel forest. It differs from the equatorial and tropical rainforest by having...fewer species of trees and hence, large populations of individual species. Trees are not as tall as in the low latitude rainforest , leaves usually...effects that may result from construction activities include habitat destruction or alteration during the construction process. 3.7.2.1 Proposed

  7. Final Environmental Assessment for Implementation of Proposed Actions in the Moody Air Force Base Integrated Natural Resources Management Plan (INRMP)

    Science.gov (United States)

    2015-09-01

    resource requirements, efforts were focused on managing for the habitat needs of the keystone and RTE species . A keystone species is a plant or animal...that plays a unique and crucial role in the way an ecosystem functions. Without keystone species , the ecosystem would be dramatically different or...providing realistic areas for military training. Additionally, by ensuring that populations of keystone and RTE species are not declining, military trainers

  8. Final Environmental Assessment for Continued Personnel Recovery Training Operations Within the Gulf of Mexico WTA Moody Air Force Base, Georgia

    Science.gov (United States)

    2010-06-01

    the Galapagos Islands ; and the green turtle (C. mydas,) in the remainder of the global range. Current threats include loss of nesting habitat, death...key nesting -----populations: Michoacan, Mexico; Galapagos Islands , Ecuador; and Islas Revillagigedos, Mexico (Dutton 2003). The number of nesting...that it is an extensive area, with no offshore barrier islands , where a number of rivers, creeks, and marshes discharge directly into the Gulf of

  9. Rahvasaadikute palgavaidlus Tšehhi moodi : tasuta sõit või parem palk / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2008-01-01

    Tšehhis on arutelu rahvasaadikute palkade üle jõudnud kompromissettepanekuni. Sügavas miinuses riigieelarve tasakaalu viimiseks on saadikute ja kohtunike palgad kolmeks aastaks külmutatud, ühe rahvaesindaja palk ulatub ilma lisatasudeta Eesti rahas umbes 30 000 kroonini

  10. Implementation of a Dynamic Mooring Solver (MOODY) into a wave to wire model of a simple WEC

    DEFF Research Database (Denmark)

    Ferri, Francesco; Palm, Johannes

    This report forms the deliverable D4.6 of the Structural Design of Wave Energy Devices (SDWED) project. The main objective of the report is to shed light on the implementation of a simple floating wave energy converter (fWEC) numerical model coupled with a dynamic model of the reaction system. Th....... The model will be validated with results based on physical model tests. Focus of the analysis is the definition of pros and cons of the implementation.......This report forms the deliverable D4.6 of the Structural Design of Wave Energy Devices (SDWED) project. The main objective of the report is to shed light on the implementation of a simple floating wave energy converter (fWEC) numerical model coupled with a dynamic model of the reaction system...

  11. "Romeo ja Julia" Liivimaa moodi? Barbara von Tiesenhauseni legend : ajalooline tagapõhi ja kirjanduslikud variatsioonid / Juhan Kreem, Liina Lukas

    Index Scriptorium Estoniae

    Kreem, Juhan

    2008-01-01

    Käsitletakse järgnevaid ilukirjanduslikke teoseid: Fr. R. Kreutzwaldi ballaadi "Das Fräulein von Borkholm", Th. H. Panteniuse romaani "Die von Kelles" (e.k. "Kelleste omad. Romaan Liivimaa minevikust"), Marie Underi ballaadi "Porkuni preili", Aino Kallase novelli "Barbara von Tiesenhusen" ja Maimu Bergi romaani "Kirjutajad"

  12. AcEST: DK955006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available carotov... 32 3.0 sp|Q9W534|MOODY_DROME G-protein coupled receptor moody OS=Dros...AM 302 >sp|Q9W534|MOODY_DROME G-protein coupled receptor moody OS=Drosophila melanogaster GN=moody PE=2 SV=2

  13. Pikal väraval kevadine rohi : [luuletused] / Ikkyū Sōjun ; klassikalisest hiina keelest tõlkinud Rein Raud

    Index Scriptorium Estoniae

    Ikkyū Sōjun, 1394-1481

    2003-01-01

    Sisu: Pikal väraval kevadine rohi ; Haiguse ajal ; Tsüklist "Murtud vanded" 2-3 ; Armuvanne ; Buddha sünd ; Asjade üleandmiskiri Nyoiani templist lahkudes. Lisa ; Läkitus meister Yõsõle lahkudes Nyoiani templist ; Elan mägedes ; Enesehinnang ; Kaks luuletust pildile "Arhat lõbumajas" 1-2 ; Lõbumajas ; Naiste juurest tulles jäin kloostrisse hiljaks ; Kireneste ; Kaunitari kirenestet rüübates ; Lõpu eel nirvaanasaalis 1-2 ; Siit ilmast lahkudes

  14. Gromkaja ataka v Tihhom okeane / Ruslan Kadrmatov

    Index Scriptorium Estoniae

    Kadrmatov, Ruslan

    2006-01-01

    Hiina allveelaev lähenes 26. oktoobril Vaikses ookeanis USA lennukikandjale Kitty Hawk ja tõusis enne avastamist oma rakettide ja torpeedode tegevusraadiuses pinnale. Eksperdid usuvad, et aastaks 2025 hakkab Vaikse ookeani regioonis oma allveelaevastikuga domineerima Hiina

  15. Implementation of Organizational Changes in Chinese Companies / Wei Sun, Ruth Alas

    Index Scriptorium Estoniae

    Sun, Wei

    2007-01-01

    Põhja-Hiina 160 ettevõttes läbi viidud uuringu alusel analüüsitakse organisatsioonilisi muutusi, nende mõju ja vastumõju, taustaks institutsionaliseerumise olulised etapid Hiina ajaloos. Lisa: Tabelid

  16. Eesti filmi "Jade Warrior" esilinastus Torontos / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina ja Eesti ühistöö) esilinastus eile Toronto filmifestivalil. Andmed filmi tootmise ja levitamise kohta

  17. Starshina Vaskov i utshitel Konfutsi

    Index Scriptorium Estoniae

    2005-01-01

    Boris Vassiljevi romaani "Aga koidikud on siin vaiksed" järgi valmis Hiina Kesktelevisiooni tellimusel 19-jaoline samanimeline teleseriaal. Peaosades vene näitlejad, režissöör Mao Weinin : Hiina 2003-2005

  18. Raamat sõja seadustest / Linnart Mäll

    Index Scriptorium Estoniae

    Mäll, Linnart

    2001-01-01

    Vana-Hiina sõjateoreetikute Sun Zi ja Sun Bini raamatust: Sun, Zi ; Sun, Bin. Sõja seadused / klassikalisest hiina keelest tõlkinud ja kommenteerinud Märt Läänemets. Tln. : Eesti Keele Sihtasutus, 2001. (Sõjandusvaramu. Klassika)

  19. Kung fu-film alustas 15 000 vaatajaga

    Index Scriptorium Estoniae

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina ja Eesti ühistöö) kogus Soome kinolevis avanädalavahetusel suhteliselt tagasihoidliku kassa

  20. Suur päästmisoperatsioon: Volvo päästetud, Saab mitte / Raivo Murde

    Index Scriptorium Estoniae

    Murde, Raivo

    2011-01-01

    2010. a. sai Volvo uueks omanikuks Hiina firma Geely, sel aastal loodetakse Volvosid müüa 20% rohkem kui mullu. Volvot juhitakse nagu eraldiseisvat firmat, juhatus koosneb peamiselt rootslastest. Saab loodab, et Hiina valitsus kiidab heaks lepingu kahe Hiina firmaga, et müüa ja kohapeal kokku panna autosid sealse turu jaoks

  1. Miks Põhja-Korea on Hiinale ebamugav teema / Christopher Hill ; tõlkinud Villu Zirnask

    Index Scriptorium Estoniae

    Hill, Christopher

    2011-01-01

    Hiina suhtumisest oma naaberriiki. Hiina mõistab, et Põhja-Korea ei saa oma praegusel kujul püsima jääda ja on püüdnud julgustada sealseid juhte viima majandusreformi ellu poliitiliste muutusteta, sest Põhja-Korea lõpp tähendaks USA võitu ja Hiina kaotust

  2. "Külm sõda" Ida-Aasias / Märt Läänemets

    Index Scriptorium Estoniae

    Läänemets, Märt, 1962-

    2005-01-01

    Ameerika Ühendriikide "jätkusõda" Aasia-Vaikse ookeani poliitilises ruumis, kus peavastaseks ambitsioonikas Euraasia kommunistlik suurvõim Hiina. Kommunistlik diktatuuririik Hiina Taiwani-poliitika, relvamüügi embargo tühistamise nõudmisest. Vt. samas: Hiina relvastushanked Venemaalt

  3. Vigurtuled sügisöös / Jaan Mettik

    Index Scriptorium Estoniae

    Mettik, Jaan

    2008-01-01

    Montreali Botaanikaaia hiina aia hiina laternate festivalist "Tuhat ja üks tähte". 1991. a. avatud hiina aia arhitekt on Le Weizhong. Laternate joonised saadetakse Hiinasse, kus Shangai ja selle ümbruse meistrid laternad kunstkäsitööna valmis teevad. 17 värv. ill

  4. Kirjad vallutatud Hiinast / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    1937. a. alanud Hiina-Jaapani sõjast, poliitlistest oludest ja revolutsioonist Hiinas, hiinlastest ja Hiina suhetest teiste riikidega. Varem ilmunud: Uus Eesti 19.-20. aug, 1938, nr. 226-227; 12.-13., 16. sept. 1938, nr. 250-251, 254

  5. Üllatav seiklusfantaasia Soomest / Alar Niineväli

    Index Scriptorium Estoniae

    Niineväli, Alar

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Elle Kull. Lisa "Soome film sai Hiinas hea lepingu

  6. Tiibeti välispoliitika 20. sajandi alul / Maret Kark

    Index Scriptorium Estoniae

    Kark, Maret

    2005-01-01

    Tiibeti ajaloolistest suhetest Hiina, Suurbritannia, Venemaa ja Mongooliaga, 1907. aasta Inglise-Vene konventsioonist, Mandzhu-Hiina poliitikast Tiibetis aastatel 1904-1913, Tiibeti iseseisvuse väljakuulutamisest seoses 1911. a. Hiina revolutsiooniga, 1912. aasta Mongoolia-Tiibeti lepingust, 1914. aasta Simla konventsioonist ning Tiibeti poliitilisest staatusest tänapäeval

  7. Ida-igatsuse põhjapiir / Raivo Paltser

    Index Scriptorium Estoniae

    Paltser, Raivo

    2006-01-01

    Hiina traditsiooni järgija R. Paltseri nägemus Lääne inimese ihalusest Vana-Hiina kultuuri järele, kung-fust. Toodud mõningaid näiteid Soome ja Hiina mütoloogiat ühendavast fantaasiafilmist "Igavese armastuse sõdalane - Jade Warrior"

  8. Harta 77 ja Läänemere Liit - kaks ilmekat näidet "vastupanust Tšehhi moodi" / Iivi Zajedova

    Index Scriptorium Estoniae

    Zájedová, Iivi, 1955-

    2007-01-01

    Tšehhoslovakkias tekkis 1970. aastatel mitu opositsioonilist rühmitust. Artiklis käsitletakse neist kahte - Harta 77 ja Läänemere Liit, nende eripära ja mõju Tšehhi sisepoliitilisele arengule ning toetust Eesti, Läti ja Leedu rahvastele

  9. Hiinlased õõnestavad ameeriklaste positsiooni maailma edukamate seas / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2008-01-01

    Maailma kümne väärtuslikuma börsiettevõtte hulgas on neli Hiina ettevõtet, ka suurima turuväärtusega on Hiina ettevõte Petro China. Ernst & Youngi andmeil on suuremate börsiettevõtete esisajasse kuuluvate Hiina firmade koguväärtus kasvanud võrreldes 2006. aasta lõpuga 123%, USA ettevõtete oma aga vähenenud 10%. Lisa: Uus IPO-rekord. Tabelid

  10. Mark Leonard : Venemaal on kinnisidee kontrollida ümbruskonda / Mark Leonard ; interv. Liisa Past

    Index Scriptorium Estoniae

    Leonard, Mark

    2007-01-01

    Euroopa välissuhete nõukogu juht vastab küsimustele, kas praeguse Euroopa konfliktid ja vastuolud ei õõnesta tema võimalust olla maailmas oluline jõud, kas Venemaast saab kunagi EL-i liige ja mille poolest ta Euroopast erineb, kas Hiina hakkab ka poliitikas silma paistmiseks jõudu koguma, milline on Hiina ja Venemaa tegelik eesmärk, miks on Hiina inimõiguste küsimus Euroopa aruteludest kadunud

  11. Aasia Reini ääres / Kaire Nurk

    Index Scriptorium Estoniae

    Nurk, Kaire, 1960-

    2002-01-01

    Näitusest CHINaRT" Duisburgis Küppersmühle muuseumis. Eksponeeritud 40 hiina kunstniku peamiselt 2002. a. valminud teosed. Kuraatorid Walter Smerling, Fan Di. Oberhauseni lossis näitus "Hiina - traditsioon ja modernsus", kus on väljas tööd Kölni kunstikogujate Peter ja Irene Ludwigi kogust, Hiina rahvusmuuseumist Pekingis, Uli Siggi erakogust Luzernist jm

  12. Muusikamaailm / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    Sibeliuse kogutud teostest, Ashkenazy lahkumisest Lääne-Berliini Raadio Sümfooniaorkestri juurest, Natonal Symphony Orcestra kontsertidest Hiinas ja Jaapanis, Viini klassikutele orienteeritud kammerorkestri tegevusest

  13. Rogers : Hiinat ootab suur tulevik, Venemaad lagunemine / Jim Rogers ; interv. Villu Zirnask

    Index Scriptorium Estoniae

    Rogers, Jim

    2005-01-01

    Investeerimisguru-maailmarändur Jim Rogers toorainetesse investeerimisest, Venemaa ja Hiina majanduslikust arengust, uue Euroopa aktsiaturgudest ning elustandardist, Türgi võimalikust liitumisest Euroopa Liiduga

  14. AcEST: BP912804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available E G-protein coupled receptor moody OS=Drosop... 30 5.6 sp|Q2NEW2|RLA0_METST Acidic ribosomal protein P0 homo...+DQC Sbjct: 43 RNPAPFLTSDCSDESSFIDAANKSAKTCVSDPVGLDQC 80 >sp|Q9W534|MOODY_DROME G-protein coupled receptor mood...y OS=Drosophila melanogaster GN=moody PE=2 SV=2 Length = 670 Score = 29.6 bits (65), Expect = 5.6 Identit

  15. AcEST: BP915378 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -protein coupled receptor moody OS=Drosop... 30 7.1 sp|Q75AW4|LCMT2_ASHGO Leucine carboxyl methyltransferase...PALAAGSDPAALLDALRGVDNVLYAPPVPGELLDIESA 1027 >sp|Q9W534|MOODY_DROME G-protein coupled receptor moody OS=Drosophila melanogaster GN=moo

  16. Department of Defense Expenditure Plans

    Science.gov (United States)

    2009-03-20

    Maint Shop #8 Upgrade Building Systems 11 E 742 Montgomery JFHQ AFRC/Combined Support Maintenance Shop 01 AL Replace Comm Fiber /Copper Cable 750 U...Controls 211 E 568 Moody AFB GA Repair Roof Linen Exchange, B319 211 R 569 Moody AFB GA Const Age Yard, C-130 Ramp 370 P 570 Moody AFB GA Repair Elect

  17. Vilkuv punane / Thomas Easton

    Index Scriptorium Estoniae

    Easton, Thomas

    2007-01-01

    Rahavoog aktsiatesse on tõuganud aktsiahinnad nii kõrgele, et isegi Hiina silmapaistev majanduskasv ei põhjenda seda: 65-kordseks tõusnud sissetulekud Shanghai börsil ja 75-kordseks kerkinud teenistus Shenzheni börsil. Hiina turg vajaks erihuvidest vabu autsaidereid ja insaidereid, kes oleksid vabad uurima, ostma ja müüma

  18. Kaks uut näitust 24 tunni galeriis

    Index Scriptorium Estoniae

    2003-01-01

    Aadressil www.kunstikeskus.ee väljapanekud "Suur Hiina naeratus" hiina kunstnike - Song Haizeng, Du Xinjian, Xue Jiye, Wang Jing, Wu Meng Chun, Zhong Biao - töödest ja "Raffa oma galerii" kunstilehekülge külastanud inimeste online-joonistusmasina abiga joonistatud piltidest

  19. Põhja-Korea viibutas taas lõuna poole sõjarusikat / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Põhja-Korea rannikul toimusid suurtükiplahvatused, Lõuna-Korea teatel oli tõenäoliselt tegemist põhjakorealaste õppusega. Hiina hoiatas, et riigid hoiduksid ilma tema loata sõjalisest tegevusest Hiina majandusvetes. Lõuna-Korea ja USA alustavad mereväemanöövreid

  20. "Made In China" päästmine / Andrei Hvostov

    Index Scriptorium Estoniae

    Hvostov, Andrei, 1963-

    2007-01-01

    Kaubandussõjast USA ja Hiina vahel. Kui USA poliitikud süüdistavad Hiinat tervistkahjustava toidu ja ohtlike mänguasjade ekspordis, siis Peking süüdistab USA-d ebakindlate turbiinide tarnimises. Oma kaupade paremaks tutvustamiseks on Hiina ostnud nõustamisteenuse PR-firmalt Ogilvy & Mather

  1. Soome kaudu Hiinasse / Jaan Ruus

    Index Scriptorium Estoniae

    Ruus, Jaan, 1938-2017

    2005-01-01

    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve 39 milj. krooni) tootjad on Soome, Holland, Hiina ja Eesti (3,9 milj. krooni). Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  2. Välispartnerid viivad Eesti filmi maailma kuulsust koguma / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) edukast levitamisest maailma kinodes. Ka teiste koostööfilmide ("Ruudi", "Leiutajateküla Lotte") levitamisest

  3. Экспортеры нефти намерены отказаться от доллара

    Index Scriptorium Estoniae

    2009-01-01

    Pärsia lahe riigid plaanivad koos Venemaa, Hiina, Jaapani ja Prantsusmaaga lõpetada nafta kauplemise dollarites ning võtta kasutusele erinevad valuutad, näiteks Jaapani jeeni, Hiina jüaani, euro, kulla ning Pärsia Lahe Koostöönõukogu riikide, kaasa arvatud Saudi Araabia, Abu Dhabi, Kuveidi ja Katari uue ühisvaluuta

  4. Kolga koolis andsid tunde hiinlased / Ülle Tamm

    Index Scriptorium Estoniae

    Tamm, Ülle

    2016-01-01

    Tallinna Ülikooli Konfutsiuse Instituudi neli õppejõudu - Zhuoya Wu, Xiuping Huang, Sandra Sainio ja Kristiina Kraft viisid Kolga koolis toimunud Hiina päeval läbi töötubasid ja loenguid hiina keelest ja kultuurist

  5. Deputat Riigikogu v bojevike v stilje kung-fu / Alina Zelimhanova

    Index Scriptorium Estoniae

    Zelimhanova, Alina

    2005-01-01

    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve ca 40 milj. krooni, tootjad Soome, Holland, Hiina ja Eesti) võtted algavad täna Vihterpalu rabas. Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  6. Eestis algasid kung-fu-filmi võtted / Andri Maimets

    Index Scriptorium Estoniae

    Maimets, Andri, 1979-

    2005-01-01

    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve ca 40 milj. krooni, tootjad Soome, Holland, Hiina ja Eesti) võtted algavad täna Vihterpalu rabas. Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  7. Eesti teeb koos soomlaste ja hiinlastega kung-fu filmi / Mari Rebane

    Index Scriptorium Estoniae

    Rebane, Mari

    2005-01-01

    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve 39 milj. krooni) tootjad on Soome, Holland, Hiina ja Eesti (3,9 milj. krooni). Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  8. Soome-ugri kung fu / Jüri Laulik

    Index Scriptorium Estoniae

    Laulik, Jüri, 1959-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila. Eestipoole produtsent Margus Õunapuu Eesti osast filmis

  9. Ai Weiwei - 21. sajandi märter? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

  10. ASEAN rühib mööda USAst ja Euroopast

    Index Scriptorium Estoniae

    2004-01-01

    Vientianis toimunud ASEAN-i ja Hiina tippkohtumisel kirjutati alla ASEAN-i ja Hiina koostööleppele, mille siht on kõikide nendevaheliste tollipiiride kaotamine aastaks 2010. ASEAN-i ja USA ning ASEAN-i ja Euroopa vahelise kaubanduse mahust

  11. Igavese armastuse sõdalane : mitte just klassika, aga ajaloo verstapost küll / Ilmar Raag

    Index Scriptorium Estoniae

    Raag, Ilmar, 1968-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendavast fantaasiafilmist "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi, Eesti ühistöö) : stsenarist Iiro Küttner, režissöör Antti-Jussi Annila, võitluskunstide koreograaf Yu Yan Kai, osades - Tommi Eronen, Zhang Jingchu, Markku Peltola, Elle Kull

  12. DVD. Alar Niineväli soovitab / Alar Niineväli

    Index Scriptorium Estoniae

    Niineväli, Alar

    2007-01-01

    Soome ja Hiina mütoloogiat ühendav 2006.a. fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : režissöör Antti-Jussi Annila : osades Tommi Eronen, Zhang Jingchu, Markku Peltola

  13. Fassaadikunstist ja teesklusest / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola

  14. Soomlaste Sampo jahvatab eestlaste ja hiinlaste jõul / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior". Film valmis Soome, Hiina, Hollandi ja Eesti ühistöös 2006, režissöör Antti-Jussi Annila. Esilinastus Eestis 20. X kobarkinos

  15. Investigations on the genesis of syngenetic gold-uranium deposits in conglomerates of the Precambrian Pongola Supergroup and Moodies Group including a contribution on the genesis of the epigenetic gold deposits of Klipwal, Kaapvaal Kraton, South Africa

    International Nuclear Information System (INIS)

    Stupp, H.D.

    1984-01-01

    The terrain diagnostics and the results of mineralogical and geochemical investigations are presented and discussed. The gold and uranium deposits in the Pongola rocks are described extensively. The orogeneses are characterized and their enrichment processes interpreted. The obtained results imply application possibilities for the exploration of gold-uranium placers and hydrothermal gold orogenesis. (DG) [de

  16. Final Environmental Assessment for Implementation of Defense BRAC Commission Recommendations for Dyess AFB, Texas

    Science.gov (United States)

    2007-05-01

    Page 10 of 30 Lindbergh d and rode with Mrs. Moody through the town to Federal lawn. balked at a "throne" rigged for him in an open Nash...automobile, t Charles William Bacon (1871-1947). The young pilot reportedly presiden Mayor Thomas Edward Hayden (1891-1949); and Chamber of Commerce (1897...1983), wife of Governor Dan Moody and an Abilene native; untless officials. Lindbergh was escorted by Mrs. Mildred Moody seventy-one mayors and co plane

  17. Hiinlased upitavad Venezuelat kosmosesse / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2005-01-01

    Mullu kirjutasid Venezuela ja Hiina on alla kirjutanud kosmosekokkuleppele, lisaks sõlmiti veel kümmekond lepingut kahepoolsete sidemete tihendamiseks põllumajanduses, mäetööstuses, transpordis, energeetikas, telekommunikatsioonis ja turismis

  18. Myanmari aitab üksnes aeg / Mihkel Mutt

    Index Scriptorium Estoniae

    Mutt, Mihkel, 1953-

    2007-01-01

    Myanmaris (Birmas) toimunud buda munkade meeleavaldusest, hunta tegevusest ja suhetest Hiinaga. Autori hinnangul võib valitsev diktatuur aru saada muutuste paratamatusest ja hakata riiki Hiina kombel ülaltpoolt reformima

  19. Autoritaarse kapitalismi pealetung / Timothy Garton Ash ; tõlk. Priit Simson

    Index Scriptorium Estoniae

    Garton Ash, Timothy, 1955-

    2008-01-01

    Autor on seisukohal, et 8. augustil teatasid oma naasmisest ajalooareenile kaks suurriiki: Venemaa ja Hiina. Nad on esitanud väljakutse läänele ning esindavad alternatiivseid versioone autoritaarsest kapitalismist või kapitalistlikust autoritarismist

  20. Eesti saadab EXPO-le hoiupõrsad / Vahur Koorits

    Index Scriptorium Estoniae

    Koorits, Vahur, 1981-

    2009-01-01

    2010. aasta EXPO toimub Hiinas Shanghais, teemaks "Parem linn, parem elu". Eesti paviljoni ideekonkursi võitis Illimar Truverki, Andres Labi, Janno Roosi, Ionel Lehari, Priit Hameri ja Kristian Paljasma töö "Savecity.org"

  1. Aasia transiit kipub Eestisse. Sadamad endiselt rekordkursil / Jaana Pikalev

    Index Scriptorium Estoniae

    Pikalev, Jaana

    2011-01-01

    Korea suurim transpordifirma Hanjin Group on huvitatud mitmest Eestist Kesk-Aasiasse liikuva konteinerirongi kasutamise võimalusest. Hiina Fuzhou sadamast väljuvad riikliku firma Sinotransi ekspedeeritavad konteinerid hakkavad liikuma Eesti kaudu

  2. Bomba za pazuhhoi

    Index Scriptorium Estoniae

    2006-01-01

    Nn tuuma klubi liikmed USA, Venemaa (NSVL järglane), Suurbritannia, Prantsusmaa ja Hiina, tuumarelva leviku piiramise leping, strateegiliste ja taktikaliste tuumalõhkepeade omanikud, riigid, kus tegeldakse tuumarelvade väljatöötamisega

  3. Uued videod ja DVD-d / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2007-01-01

    Hiina võitluskunstide film "Seitse mõõka" (režii Tsui Hark), USA õudusfilm "100 laiba maja" (Rob Zombie), Suurbritannia - Prantsusmaa komöödiafilm "Olla Stanley Kubrick" (Alan Conway, peaosas John Malkovich)

  4. Lithuania : a democracy? / Geoffrey Vasiliauskas

    Index Scriptorium Estoniae

    Vasiliauskas, Geoffrey

    2002-01-01

    Hiina presidendi Leedu-visiidi ajal ajas politsei laiali Tiibeti toetajate protestiavalduse. Autor püüab selgusele jõuda, kes andis politseile loa vägivallaks ja kas Leedus ikka valitseb demokraatia

  5. Hiinlane, kes leidis Tallinnast linnahalli / Eda Post

    Index Scriptorium Estoniae

    Post, Eda, 1983-

    2007-01-01

    Tallinna Tehnikakõrgkooli konverentsi "Linn kui elukeskkond" peaesineja Hiina arhitekt Chi Ti-Nan (s. 1957) korraldas üliõpilastega töötoa, et leida uusi ideid Tallinna Linnahalli elavdamiseks ja rakenduseks

  6. Hiinlased seljatasid Bank of America / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2007-01-01

    Hiina suurpanga Industrial & Commercial Bank of China (ICBC) aktsia hind kerkis Shangai börsil 5,5 protsendi võrra. Diagramm: ICBC aktsia hind; Tabel: 10 suurimat panka maailmas. Kommenteerib Romet Kreek

  7. Oodatud terminal lubab transiidiärile häid aegu / Lauri Linnamäe

    Index Scriptorium Estoniae

    Linnamäe, Lauri

    2008-01-01

    Muugale rajatavast konteinervedude terminalist saaks rahvusvahelise kaubanduse sõlmpunkt, mis elavdab kaubandust Läänemere äärsetes sadamates, uus terminal avaks läbi Eesti Hiina kaupade transiidi Venemaale. Kaart: Otsetee Hiinast Eestisse

  8. Tunda ära korratamatut = Recognizing the unrepeatable / Kaja Pae

    Index Scriptorium Estoniae

    Pae, Kaja

    2011-01-01

    Ruumiplaneerimisest. Linnaplaneerimisest 20. sajandil. Fredric Jamesoni düstoopia kontseptsioonist. Ehitusbuumiaegsest ehitusest Hiina näitel. Monumentaalsetest linnaehitusprogrammidest. Ehitusbuumiaegses Eestis tekkinud ruumilisest situatsioonist. Linna tihedusest, spontaansest ruumist. Avaliku ruumi kasutamisest. Kirjeldamatuse ilmingust

  9. Changing world, changing security / Jüri Kadak

    Index Scriptorium Estoniae

    Kadak, Jüri, 1941-

    2004-01-01

    Maailma majanduse ja julgeoleku aktuaalsetest probleemidest 21. sajandil. Hiina majanduslikust edust, tuumarelva arengust kolmanda maailma riikides. Terrorismi levikust. Venemaa geograafilis-strateegilise ülemvõimu vähenemisest, riigi partnerlusest Euroopa Liidu ning NATO-ga. Tabelid. Skeemid

  10. Bagatellid : maailm / Mirjam Tally

    Index Scriptorium Estoniae

    Tally, Mirjam, 1976-

    2007-01-01

    New Yorgi Filharmoonikute hooaeg jätkub hiina solistidega. Heliplaadid mehhiko tenorilt Rolando Villazonilt. Skandaalid Soome Rahvusooperis. Philip Glass leidis tunnustust kodulinnas Baltimore'is. Rõõmurohke Grammyde aasta 2007

  11. Keskkonnaajaloo teemal

    Index Scriptorium Estoniae

    2015-01-01

    Küsimusele, mis on põhilised teemad, mis pakuvad keskkonnaajaloolastele huvi ja millised on peamised väljakutsed, vastavad keskkonnaajaloolased Austria, Aafrika, Hiina, Austraalia, USA,Colombia, Iisraeli ja India ülikoolidest

  12. Restoran Cha Dao = Restaurant Cha Dao

    Index Scriptorium Estoniae

    2012-01-01

    Tallinnas Suur-Patarei 2 asuva Hiina restorani Cha Dao sisekujundusest. Restorani mööbel, v.a toolid, projekteeriti eritellimusena. Sisearhitekt Dmitri Pisarenko (DM3 OÜ), loetletud tema töid. Arhitekt Meeli Truu

  13. Mees, kes mängis head natsi / Ulrich Tukur ; intervjueerinud Maria Ulfsak-Šeripova

    Index Scriptorium Estoniae

    Tukur, Ulrich, 1957-

    2010-01-01

    Festivali "Uus saksa kino" raames on oodata Eestisse saksa kino elavat klassikut, kel kandev roll Michael Haneke auhinnatud filmis "Valge pael" ja nimosa filmis "John Rabe" (Saksamaa-Hiina-Prantsusmaa 2009)

  14. Oligarhi karistus / Raul Ranne

    Index Scriptorium Estoniae

    Ranne, Raul

    2005-01-01

    Hiljutine Venemaa rikkaim mees Mihhail Hodorkovski saadeti karistust kandma Hiina piirist 50 km kaugusel asuvasse Krasnoznamenski linna, tema ärikaaslane Platon Lebed veedab järgnevad kuus aastat Tjumeni oblasti linnas Harp

  15. Moskva kunstibiennaal reaktsiooni teenistuses? / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-

    2007-01-01

    Moskva II rahvusvahelisest nüüdiskunsti biennaalist. Näitustest "Sotsart. Poliitiline kunst Venemaal" (kuraator Andrei Jerofejev), "Sotsart. Poliitiline kunst Hiinas" (kuraator Xin Don Chen), "Mõtlev realism" (kuraator Jekaterina Djegot) ja "Mina usun" (kuraator Oleg Kulik)

  16. Muusikauudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2016-01-01

    Lühisõnumeid maailmast: Suri Pierre Boulez. Lahkus Kurt Masur. Hiinas uhiuus ooperimaja. Suri David Bowie. Bachtracki edetabelid aastast 2015. Nikolaus Harnoncourt lahkub lavaelust. Beethoveni autogramm oksjonil jne.

  17. Kui nuustakulased Berliinis käisid / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2007-01-01

    57. Berliini filmifestivali peaauhinna Kuldkaru sai Hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"). Ka teistest auhinnasaajatest. Kokkuvõte festivalist ja eestlastest festivalil

  18. Loomade kohtlemine kui tsiviliseerituse mõõdupuu / Peter Singer ; tõlkinud Priit Simson

    Index Scriptorium Estoniae

    Singer, Peter, 1946-

    2011-01-01

    Loomakaitseseadustest Suurbritannias (loomadest tsirkuses), Hollandis (loomade uimastamisest enne tapmist), Hiinas (loomade väärkohtlemisest loomaaedades), Euroopa Liidus (kariloomade ja kanade liikumisruumi piiratusest), Ameerika Ühendriikides (kariloomade kohtlemisest)

  19. Indiast saab maailma rahvarohkeim riik / Tõnu Prei

    Index Scriptorium Estoniae

    Prei, Tõnu, 1950-

    2005-01-01

    ÜRO rahvastikuraporti andmeil on maakera elanike arv 2050. a. 9,1 miljardit, kusjuures poole 2,6-miljardilisest juurdekasvust annavad vaid 9 riiki - India, Pakistan, Nigeeria, Kongo, Bangladesh, Uganda, USA, Etioopia ja Hiina

  20. Kaevandajate aktsiad hoos / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2009-01-01

    Maailma suured kaevandusgigandid leidsid taas üksmeele, kuna Rio Tinto leidis, et parem on ühendada jõud rivaaliga BHP Billiton ja lükkas tagasi suurinvesteeringu Hiina suurima alumiiniumitootjaga

  1. Leedu päritolu kasiinoärimees püsib rikkuselt kolmanda ameeriklasena / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2006-01-01

    Väidetavalt Leedu päritolu kasiinoärimehest Sheldon Adelsonist, tema rivaliteedist Steve Wynniga, nende tegevus Hiina Rahvavabariigi territooriumil Macaos. Lisa: Las Vegas kolib Aasiasse. Tabel : Las Vegas Sands Corporation

  2. Kirjad Jaapanist / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Kommetest, ettevalmistusest abieluks, perekonnaelust, ilukultuurist Jaapanis. 1937. a. alanud Hiina-Jaapani sõjast. Varem ilmunud: Uus Eesti 1.-3. juuli 1938, nr. 177-179; 1., 6. august 1938, nr. 208, 213

  3. Eesti saab Euroopa rahaliidu 17. liikmeks / Andrus Karnau ; kommenteerinud Marek Belka, Angela Merkel, Taavi Veskimägi ja Andrus Ansip

    Index Scriptorium Estoniae

    Karnau, Andrus

    2010-01-01

    1. jaanuaril liitub Eesti euroga. Eesti majandusest. Maailmas on käimas kolm valuutasõda: Hiina jeeni ümber, maailma rikkamate riikide keskpankade ümber ja arenevate riikide valitsuste valuutainterventsioonide ümber

  4. Stuart Johnson: NATO on Eesti julgeolekugarantii / intervjueerinud Margus Kolga

    Index Scriptorium Estoniae

    Johnson, Stuart

    2008-01-01

    USA julgeolekuanalüütik tutvustab Ühendriikide kaitsepoliitika dokumenti "Quadrennial Defence Review 2006" (QDR). Ettevalmistus reeglitega sõjaks. Venemaa, Hiina ja India tulevik. Soovitused Eestile

  5. Мярт Исраэль: Цель на чемпионат мира – войти в восьмерку! : Эстонский дискобол Мярт Исраэль завоевал золотую медаль на Всемирной летней �

    Index Scriptorium Estoniae

    Исраэль, Мярт, 1983-

    2011-01-01

    Hiinas Shenzhenis toimunud universiaadil võitis kettaheitja Märt Israel kuldmedali. M. Israel on Eesti suurimaid lootusi augusti lõpus Lõuna-Koreas algavatel kergejõustiku maailmameistrivõistlustel

  6. Kuidas jääda hiinlaseks / Ülle Dreifeldt

    Index Scriptorium Estoniae

    Dreifeldt, Ülle

    2001-01-01

    Pariisi 8. Ülikooli teatrikateedri tudeng National Taiwan Junior College of Performing Arts'i hiina klassikalise ooperi intensiivkursustest - ooperi koolist, õppetöö korraldusest, pekingi ooperist

  7. The influence of the development potential of China's economy on the logistics of the East and the West / Ho Jianmin = Влияние потенциала развития китайской экономики на логистику Востока �

    Index Scriptorium Estoniae

    Jianmin, Ho

    2003-01-01

    Ettekanne 3.-4. detsembrini 2003 Tallinnas toimunud rahvusvahelisel konverents-näitusel "Logistics and transport in international trade" teeb ülevaate Hiina majanduslikust arengust, väliskaubanduse olukorrast ning arenguprogrammist logistika ja transpordi valdkonnas.Tabelid

  8. Kevadet tervitavad suupisted / Agnes Männe

    Index Scriptorium Estoniae

    Männe, Agnes

    2016-01-01

    Hiina idapiirkonnast pärit kevadrullide valmistamise õpetus: värsked vegan kevadrullid riisipaberiga (kuumtöötluseta), banaani kevadrull filotainaga (ahjus küpsetatud), vürtsikad kanaliha kevadrullid filotaignas (friteeritud)

  9. Maailma kõige populaarsemad kirjanikud 2008

    Index Scriptorium Estoniae

    2009-01-01

    2008. a. igakuiste ilukirjanduse müügiedetabelite analüüsist 9 riigis - USA, Hiina, Hispaania, Holland, Itaalia, Prantsusmaa, Rootsi, Saksamaaa ja Inglismaa (koost. The Bookseller,Publishers Weekly, Livres Hebdo)

  10. Võrus valmistatakse ameeriklastele erilist delikatessjuustu / Siiri Erala

    Index Scriptorium Estoniae

    Erala, Siiri

    2010-01-01

    Valiole kuuluvas Võru tehases valmistatakse Lacey Swiss juustu, mida eksporditakse Ameerika Ühendriikidesse ja mida peetakse seal konkureerivatest toodetest paremaks. Valio loodab ka Hiina turule pääseda

  11. Eros / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2006-01-01

    Kolmest iseseisvast armastusloost koosnev episoodfilm "Eros" : režissöörid Wong Kar-Wai ("Käsi"), Steven Soderbergh ("Tasakaal" / "Equilibrium"), Michelangelo Antonioni ("Asjade ohtlik käik") : Hongkong - Hiina - USA - Prantsuse - Itaalia 2004

  12. Iraani president tuli raevunud New Yorki / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2007-01-01

    New Yorgis toimusid ägedad Iraani presidendi Mahmoud Ahmadinejadi vastased meeleavaldused. USA tahaks suurendada Iraani-vastaseid sanktsioone, kuid selle vastu on olnud Venemaa ja Hiina. Lisa: Inimsööjad ja revolutsiooni juhid USA-s

  13. Investeerija märksõnad : USA ning tervishoiu- ja IT-sektor / Uwe Zöllner

    Index Scriptorium Estoniae

    Zöllner, Uwe

    2008-01-01

    USA elanike tarbimise mõjust globaalsele majandusruumile. Aktsiainvesteeringuid plaanides tasuks silmas pidada tervishoiu- ja infotehnoloogiasektori ettevõtteid ning vaadata USA poole. Lisa: Hiina eksport võrreldes riigisisese tarbimisega

  14. Small turnout for show-of-support for Tibet

    Index Scriptorium Estoniae

    2008-01-01

    Paljud leedulased protesteerid Hiina saatkonna ees 17. - 21. märtsini inimõiguste rikkumiste vastu Tiibetis. Ka Leedu välisministeerium tegi avalduse. Sportlased ei plaani boikoteerida Pekingi olümpiamänge

  15. USA rahatrükkimine tõstab ka Eestis hindu / Adele Pao

    Index Scriptorium Estoniae

    Pao, Adele

    2010-01-01

    USA Keskpanga otsus majanduse turgutamiseks lisaraha trükkida annab analüütikute hinnangul Eestis tunda eelkõige hinnatõusuna. USA keskpanga otsuse mõjust Saksamaa, Brasiilia, Hiina ja arenevate riikide majandusele

  16. Taiwan püüab arendada suhteid Aafrika maadega / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2007-01-01

    Taibeis toimus Aafrika maade ja Taiwani esimene tippkohtumine ning tööstus- ja kaubandusringkondade Taiwani-Aafrika progressiivse partnerluse foorum, põhiteemaks "Heaolu ja säästev areng". Hiina pahameel

  17. Klein : üleilmastumiseks pole kütust / Naomi Klein ; interv. Nathan Gardels, tõlk. Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Klein, Naomi

    2008-01-01

    Energia kallinemise ja veokulude suurenemisega aeglustub globaliseerumine, Hiina muutub tarbimiskapitalismi omaksvõtuga sarnasemaks läänega ning lääs sarnaneb üha enam Hiinaga seoses kodanike vabaduse ohverdamisega jälgimistegevusele

  18. Stuart Johnson: NATO on eesti julgeolekugarantii / Stuart Johnson ; interv. Margus Kolga

    Index Scriptorium Estoniae

    Johnson, Stuart

    2006-01-01

    Mõjukas USA julgeolekuanalüütik tutvustab Ühendriikide kaitsepoliitika dokumenti "Quadrennial Defence Review 2006" (QDR). Ettevalmistus reeglitega sõjaks. Venemaa, Hiina ja India tulevik. Soovitused Eestile

  19. Eestlased tõid universiaadilt kaks neljandat kohta / Annes Aus

    Index Scriptorium Estoniae

    Aus, Annes

    2009-01-01

    Hiinas, Harbinis 18.-28. veebruaril toimunud üliõpilaste taliuniversiaadist, kus kõige paremini esinesid Eesti sportlastest Tallinna Ülikooli Kunstide Instituudis õppiv Jelena Glebova ja Kunstiakadeemias tudeeriv Mark Duubas

  20. Suurlinnaelu ilu ja valu : uus millennium - linnastumise ajajärk / Ragne Nukk

    Index Scriptorium Estoniae

    Nukk, Ragne, 1984-

    2011-01-01

    Rahvusvaheline fotonäitus "Metropol - suurlinnaelu linnaajastul" Eesti Arhitektuurimuuseumis 11. detsembrini 2011. Lühidalt Marcus Koppeni, Yang Yongliangi (Hiina), Ivan Mihhailovi (Venemaa), Hans Wilschuti, Christoph Gieleni (Ameerika) töödest. Globaliseerumisest ja linnastumisest

  1. Ühinemise ja iseolemise vastuseis. Ideaalid ja reaalsus / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2001-01-01

    Mängufilmid "Keiser ja palgamõrtsukas" ("Jing ke ci qin wang") : režissöör Chen Kaige : Jaapan-Hiina-Prantsusmaa 1999 ja "Tiiger ja draakon" ("Wo hu chang long") : režissöör Ang Lee : Hiina-Hongkong-Ameerika Ühendriigid 2000. Lisa : Aare Ermeli koostatud Chen Kaige ja Ang Lee loomingu lühikokkuvõtted. Kokkuvõte inglise keeles lk. 128

  2. First Person Past: American Autobiographies, Volume 2

    DEFF Research Database (Denmark)

    American literature, biography, Tunis Campbell, Black Elk, Andrew Carnegie, Booker T. Washington, Mary Antin, Mary Jones, Frederic Howe, Anna Howard Shaw, Woody Guthrie, Monica Sone, Anne Moody, Ron Kovic......American literature, biography, Tunis Campbell, Black Elk, Andrew Carnegie, Booker T. Washington, Mary Antin, Mary Jones, Frederic Howe, Anna Howard Shaw, Woody Guthrie, Monica Sone, Anne Moody, Ron Kovic...

  3. 722-IJBCS-Article-S A Aboaba

    African Journals Online (AJOL)

    DR GATSING

    The plant yielded several isoquinoline alkaloids, including palmatine and columbamine (Iwu, 1993). It also contains bitter-tasting diterpenes like members of the ..... phytochemical extracts of the roots of S. jollyanum have also demonstrated antiviral. (Moody et al., 2002), antioxidant and anti- inflammatory activities (Moody et ...

  4. The Lie algebra of the N=2-string

    International Nuclear Information System (INIS)

    Kugel, K.

    2006-01-01

    The theory of generalized Kac-Moody algebras is a generalization of the theory of finite dimensional simple Lie algebras. The physical states of some compactified strings give realizations of generalized Kac-Moody algebras. For example the physical states of a bosonic string moving on a 26 dimensional torus form a generalized Kac-Moody algebra and the physical states of a N=1 string moving on a 10 dimensional torus form a generalized Kac-Moody superalgebra. A natural question is whether the physical states of the compactified N=2-string also realize such an algebra. In this thesis we construct the Lie algebra of the compactified N=2-string, study its properties and show that it is not a generalized Kac-Moody algebra. The Fock space of a N=2-string moving on a 4 dimensional torus can be described by a vertex algebra constructed from a rational lattice of signature (8,4). Here 6 coordinates with signature (4,2) come from the matter part and 6 coordinates with signature (4,2) come from the ghost part. The physical states are represented by the cohomology of the BRST-operator. The vertex algebra induces a product on the vector space of physical states that defines the structure of a Lie algebra on this space. This Lie algebra shares many properties with generalized Kac-Moody algebra but we will show that it is not a generalized Kac-Moody algebra. (orig.)

  5. The Lie algebra of the N=2-string

    Energy Technology Data Exchange (ETDEWEB)

    Kugel, K.

    2006-07-01

    The theory of generalized Kac-Moody algebras is a generalization of the theory of finite dimensional simple Lie algebras. The physical states of some compactified strings give realizations of generalized Kac-Moody algebras. For example the physical states of a bosonic string moving on a 26 dimensional torus form a generalized Kac-Moody algebra and the physical states of a N=1 string moving on a 10 dimensional torus form a generalized Kac-Moody superalgebra. A natural question is whether the physical states of the compactified N=2-string also realize such an algebra. In this thesis we construct the Lie algebra of the compactified N=2-string, study its properties and show that it is not a generalized Kac-Moody algebra. The Fock space of a N=2-string moving on a 4 dimensional torus can be described by a vertex algebra constructed from a rational lattice of signature (8,4). Here 6 coordinates with signature (4,2) come from the matter part and 6 coordinates with signature (4,2) come from the ghost part. The physical states are represented by the cohomology of the BRST-operator. The vertex algebra induces a product on the vector space of physical states that defines the structure of a Lie algebra on this space. This Lie algebra shares many properties with generalized Kac-Moody algebra but we will show that it is not a generalized Kac-Moody algebra. (orig.)

  6. Pikad varjud Taevase Rahu väljakul / Paul A. Goble

    Index Scriptorium Estoniae

    Goble, Paul Alan, 1949-

    2005-01-01

    Saksamaa ja Prantsusmaa tahtsid tühistada Hiina suhtes kehtestatud relvaembargo, kuid Suurbritannia, Taani, Rootsi ja Holland olid keelu tühistamise vastu. Autor meenutab eestlastele, et Lääne otsus sanktsioneerida Hiinat pärast sündmusi Taevase Rahu väljakul aitas kaasa ka Eesti taasiseseisvumisele, seepärast võiks ka Eesti toetada embargo jätkamist senikaua, kuni Hiina tunnistab tollaste sündmuste ajal demonstrantide kallal sooritatud kuritegusid ja alustab riigi demokratiseerimist

  7. Vene telekanal näitas Läti-vaenulikku propagandafilmi

    Index Scriptorium Estoniae

    2006-01-01

    Vene filmistuudio Treti Rim on tootnud lätivastase ajaloolise dokumentaali-propagandafilmi Teisest Maailmasõjast "Natslus Balti moodi" ("Natsizm po pribaltiski"). Filmi näidati 16. märtsil Vene telekanal TVT

  8. Läti-vaenulik film jõuab siiski Vene televaatajateni

    Index Scriptorium Estoniae

    2006-01-01

    Vene filmistuudio Treti Rim on tootnud lätivastase ajaloolise dokumentaali-propagandafilmi Teisest Maailmasõjast "Natslus Balti moodi" ("Natsizm po pribaltiski"). Filmi näitab täna Vene telekanal TVT

  9. Viljandimaal läheb kaitse alla viis kanakulli pesa / Renno Nellis ; interv. Liisi Seil

    Index Scriptorium Estoniae

    Nellis, Renno, 1982-

    2005-01-01

    Vestlus Kotkaklubi eksperdi Renno Nellisega, kes aitab organiseerida kanakulli püsielupaikade kaitse alla võtmist. Vt. samas ka artiklit: Seil, Liisi "Metsaülemad suhtuvad pesade kaitsmisse mitut moodi"

  10. Maximal supergravities and the E10 model

    International Nuclear Information System (INIS)

    Kleinschmidt, Axel; Nicolai, Hermann

    2006-01-01

    The maximal rank hyperbolic Kac-Moody algebra e 10 has been conjectured to play a prominent role in the unification of duality symmetries in string and M theory. We review some recent developments supporting this conjecture

  11. Abiks algajale ärimehele : Kuidas lüpsta riiki? / Tarmo Vahter

    Index Scriptorium Estoniae

    Vahter, Tarmo, 1970-

    2004-01-01

    Soomes paljastatud asfaldikartell pakub Eesti ettevõtjatele õppetundi, arvab autor. Vaata samas intervjuu Soome konkurentsiameti uurija Kirsi Olaga. Lisa: Konkurents Eesti moodi: vähesed tahtsid Tallinnas ehitada

  12. Kui neid kapitulatsioone ees ei oleks...? : ehk õiguse moderniseerimise takistused Vene impeeriumi Läänemere-provintsides 19. sajandil / Marju Luts

    Index Scriptorium Estoniae

    Luts, Marju, 1966-

    2006-01-01

    Tartu Keiserliku Ülikooli õigusteaduse õppejõudude iseloomustusi 19. sajandi esimesel poolel kehtinud kohaliku õiguse kohta, kodifikatsioonitülist Balti moodi. Õigusteaduse ärkamisajast 1838-1851, kodifikatsioonidest 1854-1864

  13. Book Review: J. Kelly. Rethinking Industrial Relations: Mobilization ...

    African Journals Online (AJOL)

    Book Review: J. Kelly. Rethinking Industrial Relations: Mobilization, Collectivism and Long Waves. K. Moody. Workers in a Lean World: Unions in the International Economy. B. Nissen. Which Direction for Organized Labour? Essays on Organizing, Outreach and Internal Transformation.

  14. No rate, no date / Oleg Bozhko

    Index Scriptorium Estoniae

    Bozhko, Oleg

    2001-01-01

    Ilmunud ka: Baltiiskii Kurss, nr. 18, 2001, lk. 10-11. Välisinvesteeringud Baltimaadesse. Riigireitingud reitinguagentuuridelt Standard & Poor's, Moody's Investor Service ja Fitch IBCA välisinvesteeringute stimuleerijatena

  15. Рейтинговые фирмы правят миром / Сандер Сыырумаа

    Index Scriptorium Estoniae

    Сыырумаа, Сандер

    2010-01-01

    Moody's, Standard & Poor's ja Fitch on reitinguagentuuride turu liidrid, kelle hinnagutest sõltub riikide, ettevõtete ja võlakirjade usaldusväärsus. Praeguse majanduskriisi soodustajaks peetakse reitinguagentuuride ebapädevaid hinnanguid

  16. Kolm reitinguagentuuri täidavad finantsmaailmas kohtumõistja rolli / Sander Sõõrumaa

    Index Scriptorium Estoniae

    Sõõrumaa, Sander

    2010-01-01

    Moody's, Standard & Poor's ja Fitch on reitinguagentuuride turu liidrid, kelle hinnagutest sõltub riikide, ettevõtete ja võlakirjade usaldusväärsus. Praeguse majanduskriisi soodustajaks peetakse reitinguagentuuride ebapädevaid hinnanguid

  17. Veneetsia festivali avab Frida Kahlo eluloofilm / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2002-01-01

    Kuu aja pärast algavast Veneetsia 59. filmifestivalist, mille direktor on endine Berliini festivali korraldaja Moritz De Hadeln ja žüriid juhib hiina staar Gong Li. Pikemalt võistlusprogrammi avafilmist "Frida", mille režissööriks on Julie Taymor

  18. Autoritaarsete kapitalistide tagasitulek / Azar Gat ; tõlk. Kajar Pruul

    Index Scriptorium Estoniae

    Gat, Azar

    2008-01-01

    Mittedemokraatlike suurriikide Venemaa ja Hiina esilekerkimine võib ohustada liberaalse demokraatia juhtivat rolli maailmas. Autor nendib, et nii, nagu kogu 20. sajandi kestel, on ka edaspidi Ameerika Ühendriigid tähtsaim tagatis sellele, et liberaalset demokraatiat ei surutaks kaitseseisundisse ega pagendataks kergesti rünnatavale positsioonile rahvusvahelise süsteemi perifeerias

  19. Snezhnõi gorod i ognennõi kaban / Viktoria Jürmann

    Index Scriptorium Estoniae

    Jürmann, Viktoria

    2007-01-01

    Lumelinna rajamisest Tallinnas. Valgusfestivali raames avatakse Kumu siseõues jääskulptuuride näitus "Kumu pliiatsid ". Autorid Jaak Soans ja Lembit Palm. Hiina kalendri sea aasta tähistamine Tallinnas. Pikal tänaval avatakse Raoul Kurvitza valmistatud metssiga kujutav jääskulptuur

  20. Biennaalitsirkus, biennaalileib / Katrin Kivimaa

    Index Scriptorium Estoniae

    Kivimaa, Katrin, 1969-

    2007-01-01

    52. Veneetsia biennaalist. Eesti paviljonis esineb Marko Mäetamm näitusega "I love my family". Lähemalt prantsuse kunstniku Sophie Calle ja inglise kunstniku Tracey Emini töödest. Hiina kunstnike Yang Fudongi filmist "Seitse intellektuaali bambusmetsas" ja Yang Zhenzhongi videoinstallatsioonist "I Will Die"

  1. Berlinalel hõrku kinokunsti maitsmas / Annika Koppel

    Index Scriptorium Estoniae

    Koppel, Annika

    2007-01-01

    57. Berliini filmifestivali auhinnatud filmidest. Peaauhind Kuldkaru - hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"), parima režissööri Hõbekaru - iisraellane Joseph Cedar ("Beafort"), parim meesnäitleja - Julio Chavez (Ariel Rotteri "Teine"), parim naisnäitleja - Nina Hossa (Christian Petzoldi "Yella")

  2. Lõuna-Korea teatel võib Kim peagi surra / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2009-01-01

    Viidates Lõuna-Korea ja Hiina luureandmetele, väidab Lõuna-Korea meedia, et Põhja-Korea liidril Kim Jong-ilil on kõhunäärmevähk ja talle pole antud elada rohkem kui 5 aastat. Põhja-Korea valitsejadünastia

  3. Vanad müürid / Semjon Pavljuk

    Index Scriptorium Estoniae

    Pavljuk, Semjon

    2013-01-01

    Lühitutvustus ja soovitusi Pekingi põhiliste vaatamisväärsuste külastamiseks - Tian'anmeni (Taevase Rahu) väljak, Keelatud linn, Suur Hiina müür, Suvepalee, restoran Peking Duck, olümpiapark, öine turg ja rahvustoit bāozi

  4. Koputa end terveks! / Ursula Zimmermann

    Index Scriptorium Estoniae

    Zimmermann, Ursula

    2015-01-01

    Emotsionaalse vabaduse tehnikast (EFT) ehk koputusmeetodist, mis kasutab väga lihtsale eneseanalüüsile ja sisendusele lisaks aastatuhandeid tagasi väljatöötatud traditsioonilisi Hiina akupunktuuri punkte, et keha energiaväljas energia liikuma saada

  5. Kopenhaagen 2009 - kohtumine, mis peaks päästma maailma / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2009-01-01

    Põhjustest, miks ei ole häid väljavaateid saavutada Kopenhaagenis uus kliimamuutusi pidurdav kokkulepe. Hiina on kasvatanud CO₂ emissiooni võrreldes 1990. a. seisuga 153%, kuid kavatseb vähendada vaid heitgaaside koguse suhet oma SKT-sse, samas on plaanis tööstustoodangut kahekordistada

  6. Helen Mirren krooniti Veneetsias kuningannaks / Triin Tael

    Index Scriptorium Estoniae

    Tael, Triin

    2006-01-01

    Näitleja võitis parima naisnäitleja auhinna Elizabet II rolliga Stephen Frears'i filmis "Kuninganna" ("The Queen"). Parima filmi peaauhind Kuldlõvi läks Hiina režissööri Jia Zhang-Ke filmile "Vaikelu" ("Dong"). Ka teistest Veneetsia 63. filmifestivali võitjatest

  7. Kõik ei ole päris nii, nagu paistab / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2007-01-01

    Hiina nüüdiskunsti näitus "Linnailmed / City Expressions" (koostööprojekt Guangzhou kunstiakadeemia muuseumiga) Tallinna Kunstihoones kuni 28. I ja aafrika nüüdiskunsti näitus "Aafrika. Taassegu / Africa. Remix" Stockholmi Moderna Museet'is kuni 14. I

  8. Eksootilised maitsed / Sergo Sarapuu

    Index Scriptorium Estoniae

    Sarapuu, Sergo

    2016-01-01

    Eksootilistest taimedest ja viljadest: laimkinkan, sõrmlaim (finger lime), draakonivili, granadill, okra, aed-harakputk, enoki ja Shimeji seened, kurkum, kalgan, lehtkapsas e kale, lootose juur, lilla porgand, kartul `Blue Congo`, roosa-valgetriibuline peet, soolarohi ja paksoi e hiina lehtnaeris ning mini-paksoi

  9. Taustast. "Muumia" sündis vaarao hauakambris / Kristiina Davidjants

    Index Scriptorium Estoniae

    Davidjants, Kristiina, 1974-

    2008-01-01

    Mängufilm "Muumia: draakonkeisri hauakamber" ("The Mummy: Tomg of the Drago Emperor") : režissöör Rob Cohen : Ameerika Ühendriigid - Kanada - Saksamaa - Hiina 2008. Esimesest samateemalisest filmist "Muumia" : produtsent Carl Laemmle : režissöör Karl Freund : peaosas Boris Karloff : Ameerika Ühendriigid 1932

  10. S&P: meie kohus oli USA riigireitingut alandada / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    Standard & Poor´s langetas USA reitingut tasemelt AAA tasemeni AA+. Agentuuri esindaja sõnul oli reitingu alandamine nende kohustus, sest nende arvates oli USA senine reiting liiga kõrge. Hiina nõuab, et USA hakkaks oma võlaprobleemiga tegelema. AAA reiting on nüüd vaid 15 riigil või territooriumil maailmas

  11. USA investeerimisguru Jim Rogers : ärge kartke investeerida tooraineturule / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 9. märts lk. 25. Varajane huvi tooraineturule investeerimise vastu mängis suurt rolli Jim Rogersi edus hedge fond'i Quantum kaasjuhina. Lisa: Lõigake kasu Hiina kasvust; Kuue aasta eest külastas Eestit

  12. Premium Motorsi priimad päevad / Raigo Neudorf

    Index Scriptorium Estoniae

    Neudorf, Raigo

    2007-01-01

    Automüüja Premium Motors on edu saavutanud luksusmaasturi Hummer ning teiste USA eksklusiivsete automarkide müügiõigusega. Tabel: Rentaabel äri. Vt. samas: Palun kaks roosat Hummerit; Premium Motors hakkab sügisel Hiina maastureid müüma.

  13. Double Coffee opens in China

    Index Scriptorium Estoniae

    2009-01-01

    Läti suursaadik Ingrida Levrence avas esimese Double Coffee kohviku Hiina pealinnas Pekingi südames. Rahvusvaheline kohvikukett kavatseb laieneda mõne kohviku võrra igal aastal. Seni tegutsetakse Lätis, Eestis, Leedus, Ukrainas ja Valgevenes

  14. Põhja-Korea tuumasoovi üle räägitakse jälle läbi / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 9. veebr, 2007, lk. 13. 8. veebruaril jätkusid pärast pikka pausi Põhja-Korea, Lõuna-Korea, USA, Jaapani, Hiina ja Venemaa läbirääkimised, sundimaks Põhja-Koread loobuma tuumaprogrammist. Lisa: Tuumarelvaga paariariik

  15. В Южной Корее вновь пишут о болезни Ким Чен Ира / Эвелин Калдоя

    Index Scriptorium Estoniae

    Калдоя, Эвелин, 1980-

    2009-01-01

    Viidates Lõuna-Korea ja Hiina luureandmetele, väidab Lõuna-Korea meedia, et Põhja-Korea liidril Kim Jong-ilil on kõhunäärmevähk ja talle pole antud elada rohkem kui 5 aastat. Põhja-Korea valitsejadünastia

  16. USA-ga kokku leppinud Põhja-Korea lubas lõpetada tuumarelvastumise / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2005-01-01

    Põhja-Korea nõustus peale kaht aastat kestnud läbirääkimisi loobuma oma tuumaprogrammist ja -relvadest. Läbirääkimiste ülejäänud osalised - Hiina, USA, Lõuna-Korea, Venemaa ja Jaapan - lubasid Põhja-Koreale vastutasuks energiaabi ja julgeolekutagatisi

  17. Iraanis on soovi korral diplomaatiale ruumi lahedalt / Gwynne Dyer

    Index Scriptorium Estoniae

    Dyer, Gwynne

    2006-01-01

    USA, Suurbritannia ja Prantsusmaa poolt ÜRO Julgeolekunõukogule esitatud resolutsiooniprojekt Iraani tuumaaktsioonide kohta kukutas läbi edasiste läbirääkimiste võimaluse, Venemaa ja Hiina panevad resolutsioonile vältimatult veto

  18. Kividraakonid ja kuuvärav / Tiina Tammet

    Index Scriptorium Estoniae

    Tammet, Tiina, 1971-

    2004-01-01

    Hiina aiast. Filosoofilisest tagamaast, aiast kui maailmamudelist, majast ja aiast, kividraakonitest ning igavese elu taimedest. Illustratsiooniks 13 fotot Austraalias Sydneys asuvast Sõpruse aiast (Chinese Garden of Friendship), mis on üks suuremaid hiinlaste poolt loodud aedu väljaspool Hiinat

  19. Kinolevi filme tutvustab Tiit Tuumalu / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2008-01-01

    Põnevusfilm "Eela orus" ("In the Valley of Elah") : režissöör Paul Haggis : Ameerika Ühendriigid 2007 ja Wong Kar-Wai mängufilm "Minu mustikakarva ööd" ("My Blueberry Nights") : Hiina - Hongkong - Prantsusmaa 2007

  20. Eesti Vabariigi paviljon : EXPO 2010 Shanghai = Pavilion of the Republic of Estonia, EXPO 2010 in Shanghai / Illimar Truverk

    Index Scriptorium Estoniae

    Truverk, Illimar, 1967-

    2010-01-01

    Üks autoreid Eesti paviljonist 1.05.-31.10. 2010 avatud maailmanäitusel EXPO 2010 teemal "Better city, better life". Eesti projekti "Savecity.org" autorid: Illimar Truverk, Ionel Lehari, Janno Roos, Andres Labi, kaasautorid: Priit Hamer, Kristian Paljasmaa, projekteerijad, sisekujundus: Agabus, Endjärv & Truverk Arhitektid, Ruumilabor, Identity. Konstruktor (Hiina): CCI Engineering Design & Consultant Co. Ltd. Projekt: 2009

  1. Appi! Mida ette võtta? / Siret Seeder

    Index Scriptorium Estoniae

    Seeder, Siret

    2009-01-01

    Harmooniaõpetus feng shui on Hiina filosoofia haru, mille kohaselt on võimalik inimest ümbritsevate ja temas toimivale energiate harmoniseerimise abil luua selline elutee nagu soovime. Ühe abivahendina kasutatakse ruumi. Spetsialist Siret Seeder tutvustab intuitiivse e vormikoolkonna bagua 8 tsooni teooriat

  2. Levitajad väldivad uiguuriteemalist dokfilmi

    Index Scriptorium Estoniae

    2009-01-01

    Dokumentaalfilmi "Armastuse kümme tingimust" (produtsent John Lewis, režissöör Jeff Daniels) ülemaailmse uiguuride kongressi juhist Rebiya Kadeer'ist kohtab Hiina terava reaktsiooni tõttu maailma filmilevis tõsist vastuseisu

  3. Otto von Habsburg : III maailmasõda on läbi / Otto von Habsburg ; interv. Marianne Mikko

    Index Scriptorium Estoniae

    Habsburg, Otto von, 1912-2011

    2002-01-01

    Otto von Habsburg vastab küsimustele, mis puudutavad Euroopa konvendi presidendi teadet, et Türgi koht ei ole EL-is, Iraagi võimalikku ründamist, Hiina ja Venemaa suhteid, Tšetšeeniat, tshetsheene ja terrorismi, Venemaa, EL-i ja USA suhteid, III maailmasõda, Eesti Vabariigi tulevikku

  4. Tallinna Ülikooli Balti Filmi- ja Meediakool vaatab itta

    Index Scriptorium Estoniae

    2007-01-01

    Täna antakse Kinomajas avalöök Tallinna Ülikooli Balti Filmi- ja Meediakooli koostööle filmi- ja telekooliga Pekingist. Näha saab Hiina režissööride Xie Fei ja Wu Lani filmi "Hunani tüdruk"

  5. Connections between corporate social responsibility and innovation climate / Ülle Übius, Ruth Alas

    Index Scriptorium Estoniae

    Übius, Ülle

    2009-01-01

    Innovatsioonikeskkonna ja korporatiivse sotsiaalse vastutuse kahe aspekti vaheliste seoste uuringust, mis viidi läbi Eesti, Hiina, Saksamaa, Soome, Tšehhi, Slovakkia ja Jaapani elektrilis-elektrooniliste masinate jaemüügi ning masinaehitusega tegelevates ettevõtetes. Tabelid, skeem

  6. Berlinale karunahk "Tuya abielu" turvamas / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2007-01-01

    57. Berliini filmifestivali peaauhinna Kuldkaru sai Hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"). Autor oma eelistusest - Sam Garbarski mängufilmist "Irina Palm". Lisatud tähtsamaid auhindu saanute nimekiri

  7. Medvezhja shkura dostalas kitaiskim kinematografistam / Lauri Kärk

    Index Scriptorium Estoniae

    Kärk, Lauri, 1954-

    2007-01-01

    57. Berliini filmifestivali peaauhinna Kuldkaru sai Hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"). Autor oma eelistusest - Sam Garbarski mängufilmist "Irina Palm". Lisatud tähtsamaid auhindu saanute nimekiri

  8. O'Neill: majanduse uut tõusu hakkavad vedama 15 riiki

    Index Scriptorium Estoniae

    2010-01-01

    Goldman Sachsi varahalduse juhi Jim O'Neilli hinnangul kujuneb keskmise ja suure tulu saajate arvu dramaatiline kasv BRIC-riikides (Brasiilia, Venemaa, India, Hiina) ja N-11 riikides (Mehhiko, Türgi, Korea, Iraan, Egiptus, Nigeeria, Pakistan, Filipiinid, Bangladesh, Vietnam) suurimaks tarbimist vedavaks jõuks maailmas lähema 10 aasta jooksul ja sealt edasi

  9. Bagatellid : maailm / Mirjam Tally

    Index Scriptorium Estoniae

    Tally, Mirjam, 1976-

    2008-01-01

    Helilooja Judith Weir sai Briti maineka autasu. Daniel Barenboim võttis Palestiina kodakondsuse. Portos keskendutakse sel aastal Põhjamaade muusikale. Wigmore Halli resideerivaks heliloojaks sai Luke Bedford. Sony Classics annab välja Glenn Gouldi eksklusiivse "Kogutud teosed". Tõusev täht - hiina naisdirigent Xian Zhang

  10. Nädalavahetusel tasub Pimedate Ööde filmifestivalil vaadata neid filme / Maris Meiessaar, Dannar Leitmaa, Andres Laasik, Mart Niineste

    Index Scriptorium Estoniae

    Meiessaar, Maris

    2009-01-01

    PÖff-i filmidest - "Merehädaline kuul" (rež. Lee Hey-Jun; Lõuna-Korea), "Nanjing: Elu ja surma linn" (rež. Lu Chuan; Hiina), "Kuu" (rež. Duncan Jones; Suurbritannia), "Rip! A Remix Manifesto" (rež. Brett Gaylor; Kanada)

  11. Cubamoda / Ell-Maaja Randküla

    Index Scriptorium Estoniae

    Randküla, Ell-Maaja, 1939-2016

    1989-01-01

    5. rahvusvahelisest Moesalongist "Cubamoda", kus osalesid peamiselt Ladina-Ameerika maad, Prantsusmaa, Itaalia, Poola, Ungari, Bulgaaria, India, Hiina, Lõuna-Korea, NSVL-ist "Silueti" kollektsioon, millest said soojema vastuvõtu Irene Truutsi ja Kai Saare puhkuse ja suverõivad; Kuuba moekunstist

  12. Külalisena üle-aasialisel sümpoosionil / Leida Talts

    Index Scriptorium Estoniae

    Talts, Leida

    1999-01-01

    Hiinas Macao linnas peetud IV rahvusvahelisest Aasia noorsoouuringute sümpoosionist, mille eesmärgiks oli analüüsida muutusi, mis 1990. aastatel on Aasia regiooni sotsiaalmajanduslikus arengus toimunud, pöörates erilist tähelepanu noortele

  13. WTO kõnelused on noateral / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2008-01-01

    Maailma Kaubandusorganisatsiooni vabakaubanduse kõnelustel Genfis on Euroopa Liidu ja USA kõrval üha häälekamad ka arenevad riigid eesotsas Brasiilia, Hiina ja Indiaga. USA ja Euroopa Liit tahavad lõpetada igasugused järeleandmised

  14. Armastuse feng shui / Peeter Rüberg

    Index Scriptorium Estoniae

    Rüberg, Peeter

    2000-01-01

    Järg Jan/13;20;27/Feb/3;10;17;23/Mar/2;9;16 ;30/Apr/13/May/4;11 lk. 22;38;56;70;87;102;118;134;150;166;198;230;278 ;296Vanal hiina kodu- ja elukunstil on igaks armuelu juhtumiks varuks praktilisi nõuandeid ja võtteid

  15. Inetu pardipoja juubel / Tõnu Ojala

    Index Scriptorium Estoniae

    Ojala, Tõnu, 1969-

    2008-01-01

    Oktoober tehnika ajaloos: 7. oktoobril 1948 tegi oma debüüdi Pariisi autonäitusel Citroën 2CV. 15. oktoobril 2003. aastal saatis Hiina kosmosesse sõjaväelenduri Yang Liwei. 11. oktoobril 1968. a startis esimene mehitatud Apollo-missioon. 1. oktoobril 1908. aastal jõudis Ameerikas turule Ford-T

  16. Venetsija portit otnoshenija

    Index Scriptorium Estoniae

    2005-01-01

    Veneetsia filmifestivali võistlusprogrammist. Avafilmiks on Hiina "Seitse mõõka" (režissöör Tsui Hark). Festivalidirektori Marco Mülleri poolt sisse viidud uuendustest ja mõningatest probleemidest, mis seeläbi tekkinud

  17. Hiinaga rinnapistmiseks läheb meil tarvis uutmoodi kapitalismi / Anatole Kaletsky ; inglise keelest tõlkinud Märt Väljataga

    Index Scriptorium Estoniae

    Kaletsky, Anatole

    2010-01-01

    Davosi majandusfoorumil väljaütlemata jäänud seisukohast, mille järgi Lääs seisab väljakutse ees luua uus kapitalismiversioon, mis oleks kohastunud 21. sajandi vajadustega ning eriti võitlusega Hiina dünaamilise ja enesekindla autoritaarse süsteemiga

  18. Eesti tahab Aasia paisuvast pirukast oma osa haugata / Adele Pao

    Index Scriptorium Estoniae

    Pao, Adele

    2011-01-01

    Majandus- ja kommunikatsiooniministeeriumis on valmimas programm, mille sihiks on suurendada eksporti Aasia riikidesse ja suurendada Eesti atraktiivsust sealsete investorite silmis. Arengufond töötab Eesti ja India majandusssuhete kallal, Kaubandus-Tööstuskoda püüab Hiina turu suhtes leida ühist keelt Rootsi ja Soome partneritega. Diagramm: Aasia riikide kasvuootused Europast suuremad

  19. Muusikamaailm : Nelisada aastat ooperi sünnist. Ooperi sünni puhul Varssavis. Festival Macaus. Washingtoni Ooper rahvusooperiks / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2000-01-01

    6. okt. saab 400 aastat ooperi sünnist. Varssavis tähistatakse ooperi 400. sünnipäeva ooperifestivalide ja -etendustega. Lõuna-Hiinas Macaus toimuvast XIV rahvusvahelisest muusikafestivalist. USA kongressi otsusega nimetati Washingtoni Ooper rahvusooperiks

  20. Õnnitlused Vabariigi Presidendile ja eesti rahvale Eesti Vabariigi 75. aastapäeva puhul

    Index Scriptorium Estoniae

    1993-01-01

    Boriss Jeltsin, kuninganna Elisabeth, kuninganna Margrethe, kuningas Carl Gustaf, M. Koivisto, Th. Klestil (Austria Vabariigi Liidupresident), Yang Shangkun (Hiina Rahvavabariigi President), Shanker Daval Sharma, kuningas Baudouin, A. Ogi (Šveitsi Konföderatsiooni President), kuningas Harald, patriarh Aleksius. Ilmunud ka: Päevaleht 26. veebr. lk. 1

  1. Tsaari-Venemaa spioon sajanditagusel Siiditeel tuletab meelde ajaloo tähtsust / Marje Aksli

    Index Scriptorium Estoniae

    Aksli, Marje

    2010-01-01

    Kanadas elavast väliseesti päritolu ajakirjanikust, kirjanikust ja analüütikust Eric Enno Tammest ja tema raamatust "The Horse that leaps through clouds", milles on juttu spionaažist, Siiditeest ja tänapäeva Hiina tõusust

  2. Tartu- ja Viljandimaa 2025 : Nobeli preemia, tuumajaam ja laevaühendus Peterburiga / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2014-01-01

    Milline võiks olla elu peaga Eestis ehk Tartu ja Viljandi maakondades aastal 2025? Kas Võrtsjärve veerde tuleb tuumajaam? Kas Tartust saab laevaga Peterburi? Kas Viljandi folk püsib või kaob? Kas Salvest murrab Hiina turule? Küsimustele vastasid 14 asjatundjat

  3. Logistikaärimeeste uues huviorbiidis on Vietnam / Jaana Pikalev

    Index Scriptorium Estoniae

    Pikalev, Jaana

    2010-01-01

    Eesti Logistikaklastri delegatsioon läheb visiidile Vietnami ja Hiinasse. Eesmärk on tutvuda Vietnami turu võimalustega ning luua suhteid Vietnami klientide ja arvamusliidritega. Hiinas külastatakse logistika- ja transpordimessi. Kavas on alla kirjutada koostöömemorandumid

  4. Suur jalutuskäik / Harry Liivrand

    Index Scriptorium Estoniae

    Liivrand, Harry, 1961-

    1999-01-01

    Pariisis Champs-⁹lyseés'l 14. nov.-ni avatud rahvusvahelisest skulptuuride vabaõhunäitusest 'Les Champs de la Sculpture 1970-2000'. Esineb 52 kunstnikku viielt kontinendilt, peamiselt eksponeeritud Lääne-Euroopa, Ameerika ja Hiina päritolu kunstnike tööd.

  5. Sigaretitootmine koondub aina väiksema hulga suurfirmade kätte / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2007-01-01

    Lääne suurimad sigaretitootjad ei pääse Hiina turule, kus tarbitakse umbes 30% maailma toodangust. Maailma neljas sigaretitootja Briti Imperial Tobacco kavandab tööstusharu kuuenda numbri, Altadise omandamist. Sigarettide levik Euroopas 19. ja 20. sajandil. Lisa: Läänemaailma suurimad

  6. Hallipäiste leegionid tulevad / Carolyn Moynihan ; tõlk. Ingrid Vooglaid

    Index Scriptorium Estoniae

    Moynihan, Carolyn

    2007-01-01

    Globaalsest vananemisest, Jaapani elanikkonna vananemisest ja vähenemisest. Autor leiab, et Lääs vajab üha rohkem tööjõudu teiste rahvaste hulgast ning õigus võib olla neil, kelle arvates võib Euroopa muutuda "Euraabiaks". Hiina ees seisvast vananemiskriisist

  7. Tiibeti viimane võimalus / Roy Strider

    Index Scriptorium Estoniae

    Strider, Roy, 1974-

    2008-01-01

    Tiibeti väljaõppeta vabadusvõitlejate-meeleavaldajate piinamistest hiinlaste poolt, Hiina võimude taktikast konflikti lahendamisel. Tiibeti ülestõusu peaeesmärgiks on oma jõuriismeid kokku võttes tõmmata maailma tähelepanu kultuurilisele ja füüsilisele genotsiidile, kirjutab autor

  8. Muuseumis näeb saksa ohvitseri trofeesid / Katrin Nielsen

    Index Scriptorium Estoniae

    Nielsen, Katrin

    2001-01-01

    Pärnu Uue Kunsti Muuseumis avati 9. veebr. avati Bruno Sõmeri kogust pärit akvarelli ja temperaga riisipaberile värvitud hiina tushijoonistuste näitus. Hiinakeelsed tekstid piltidelt tõlkis Mark Soosaare poeg Tumur-Ochir Erdenbileg

  9. Tarkvarahiid Microsoft kergitas kogu aasta kasumiootust / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2006-01-01

    Tarkvaratootja Microsoft tõstis pärast kvartalikasumi kasvu kogu jooksva majandusaasta kasumiprognoosi. Diagramm. Vt. samas: Euroopa Liit võib monopoliseisuses Microsofti trahvida kahe miljoni euroga päevas; Hiina ja India võivad piraatlusest loobuda 10 aasta pärast

  10. Seadused, mis ajavad naerma / Mariliis Jõras, Riivo Riismaa

    Index Scriptorium Estoniae

    Jõras, Mariliis

    2008-01-01

    Eestis ja teistes riikides kehtinud ja kehtivatest kummalistest liikluseeskirjadest ja -määrustest. Lisatud: Eesti liikluseeskirjad ; Kanada, Ameerika Ühendriigid, Inglismaa, Tšehhi, Luxembourg, Belgia, Sloveenia, Korea, Hispaania, Saudi Araabia, Portugal, Albaania, Hiina, Austraalia, Taani, Horvaatia, Šveits

  11. Erna kostitas Jakobi malevkonna kaitseliitlasi muda, vee ja villidega / Urmas Hännile

    Index Scriptorium Estoniae

    Hännile, Urmas

    2003-01-01

    Pärnumaa maleva liikmete muljeid Erna retkest. Vt. samas intervjuud Erna retke staabiülema, Rootsi Kuningriigi kaitseväe kolonelleitnanti Jaak Kallaku ja Hiina Rahvavabariigi Soome saatkonna sõjaväeatashee, brigaadikindrali Liu Mengiga. Tabel: "Erna Retk 2003"

  12. Mida mäletati eelmisel aastalõpul? / Riho Laurisaar

    Index Scriptorium Estoniae

    Laurisaar, Riho

    2006-01-01

    Autor annab ülevaate, millest kirjutati New York Times'i aastalõpuväljaandes Turning Points 2005. aasta lõpul ning sündmusest, mis jäi suurema tähelepanuta - USA naftakompanii UNOCAL ülevõtmisest Hiina riigi poolt

  13. Miks me peame Hiinaga hästi läbi saama? / Mart Nutt

    Index Scriptorium Estoniae

    Nutt, Mart, 1962-

    2011-01-01

    Autor märgib, et iseseisvunud Eesti võttis viivitamatult omaks pragmaatilise reaalpoliitika, 1991. a. septembris tunnustas Eesti ühe Hiina poliitikat. Pragmatismi ja väärtuste dilemmas jääb riikide puhul alati peale pragmatism

  14. "Jade Warrior" sai Hispaanias kolm preemiat

    Index Scriptorium Estoniae

    2007-01-01

    Eesti osalusega Soome-Hiina kung fu film "Igavese armastuse sõdalane - Jade Warrior" võitis 1. Ibiza ja Formentera filmifestivalil kolm Falco d'Ori auhinda (AJ Annila - parim debüüt-lavastaja, Jukka Uusitalo - filmikunstniku töö eest, Henri Blomberg - operaatritöö eest)

  15. Мао без головы / Мэлор Стуруа

    Index Scriptorium Estoniae

    Стуруа, Мэлор, 1928-

    2010-01-01

    Hiina skulptoritest Gao Zhenist ja Gao Qiangist, kes esinevad kunstnikunime Gao Vennad (Gao Brothers) all. Vendade dissidentlikust loomingust, nende skulptuurist "Mao süü" (Mao's Guilt), mis kujutab diktaator Mao Zedongi põlvili ja eemaldatava-külgekruvitava peaga

  16. Sukeldumine oma ununenud ellu / Aita Kivi

    Index Scriptorium Estoniae

    Kivi, Aita, 1954-

    2000-01-01

    Sisu : Margaret Atwood. Pinnaletõus; Christine Bückner. Pärast lahutust; Danielle Steel. Kingitus; Judith Michael. Valede võrgus; Salvador DalÍ. Geeniuse päevik; Danielle Steel. Kurjus; Vladimir Megre. Anastasia; Theodora Lau. Hiina horoskoop

  17. Ameerika jääb number üheks / Robert Kagan ; interv. Eric Follath

    Index Scriptorium Estoniae

    Kagan, Robert

    2008-01-01

    Intervjuus ajakirjale Der Spiegel kõneleb Ameerika neokonservatiivist õpetlane ja John McCaini nõunik Bushi-Cheney aastate pärandist, Ameerika ja selle tulevase presidendi ees seisvatest ülesannetest ning Hiina ja Venemaa kasvavast agressiivsusest

  18. 2008. aasta menukaimad / Udo Uibo

    Index Scriptorium Estoniae

    Uibo, Udo, 1956-

    2009-01-01

    2008. aasta raamatumüügi tulemustest, mulluste menukamate kirjanike nimestikust, mis põhineb USA, Suurbritannia, Prantsusmaa, Saksamaa, Itaalia, Hollandi, Hiina, Hispaania ja Rootsi igakuistel ilukirjanduslike bestsellerite edetabelitel. Esikümnesse kuuluvad: Khaled Hossein, Stieg Larsson, Ken Follett, Stephenie Meyer, Muriel Barbery, Carlos Ruiz Zafón, Anna Gavalda, John Grisham, J. K. Rowling, Henning Mankell

  19. "Me kõik jääme vanaks, tead ükskord, seistes peegli ees..." / Evelin Ilves

    Index Scriptorium Estoniae

    Ilves, Evelin, 1968-

    2012-01-01

    Autor soovib, et me oskaksime väärtustada ning paremini ära kasutada eakate inimeste teadmisi, oskusi ja elutarkust. Ta toob näite ühest Hiina koolist, kus huvitegevus oli lastele tasuta ja ringe viisid läbi vabatahtlikud pensionärid

  20. Suur kera väikese sees / Kalju Kruusa

    Index Scriptorium Estoniae

    Kruusa, Kalju, pseud., 1973-

    2010-01-01

    Tutvustus: Hullunud pilv / Ikkyū Sōjun ; klassikalisest hiina keelest tõlkinud ja kommenteerinud Rein Raud. Tallinn : TLU Press, 2010 ; Lind tulemäe kohal : valik XX sajandi teise poole türgi luulet / tõlkinud Andres Ehin ja Ly Seppel. Tallinn : Kultuurileht, 2010 ; Narain, Kunwar. See ainuke maailm : valitud luuletused. Lelle : Allikaääre, 2010

  1. Goethe loob väljendi : maailmakirjanduse kultuuripoliitika / David Damrosch ; tõlkinud Ene-Reet Soovik

    Index Scriptorium Estoniae

    Damrosch, David

    2007-01-01

    Johann Wolfgang von Goethe erasekretäri Peter Eckermanni teosest "Vestlused Goethega tema elu viimastel aastatel", Goethe vaadetest kirjandusele, maailmakirjanduse mõisest. Ka kirjanduse tõlkimisest tänapäeval, sinoloog Stephen Oweni vaadetest ja hiina luuletaja Bei Dao luulest. Artikkel sisaldab ka Bei Dao luuletuste näiteid

  2. Aasia tiigrid on tagasi jalul / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2007-01-01

    Aasia on 1997. aastal puhkenud majanduskriisist toibunud ning valitsemas on uus buum, kus majanduskasv on maailma kõige kiiremaid, kuid kasvu keskmes on uued riigid - India, Hiina ja Vietnam. Diagramm: Aasia kriis kukutas valuutasid ja börse. Vt. samas: Balti tiigrid Euroopa Liidu kaitsva vihmavarju all

  3. Suvemuusika kontserdisari Nissis

    Index Scriptorium Estoniae

    2007-01-01

    Kontsertidest Nissi kirikus: Peterburi mungakloostri koor Optina Pustõn 23. juunil, poola organist Andrezy Chorosinski 7. juulil, ansambel Tallinn Baroque 14. juulil, tšehhi organist Pavel Czerny 28. juulil, hiina kontratenor Ka Bo Chan ja kitarrist Heiki Mätlik 11. augustil, Eesti Televisiooni tütarlastekoor Aarne Saluveeri dirigeerimisel 25. augustil/Optina Pustõn - vene koor

  4. Usmirenije Severnoi Korei / Joseph S. Nye ; tõlk. Nikolai Zhdanovitsh

    Index Scriptorium Estoniae

    Nye, Joseph S.

    2006-01-01

    USA president George Bush lootis, et tal õnnestub Põhja-Korea tuumaprobleemi lahendada režiimi vahetamisega. Arvestati, et isolatsioon ja sanktsioonid viivad Kim Jong Il'i diktatuuri kukutamiseni. Kuna režiim osutus vastupidavaks, nõustuti kuuepoolsete läbirääkimistega Hiina, Venemaa, Jaapani ja mõlema Koreaga

  5. Algas jaht Veneetsia Kuldlõvile / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2002-01-01

    Täna algavast Veneetsia 59. filmifestivalist, mille direktor on endine Berliini festivali korraldaja Moritz De Hadeln ja žüriid juhib hiina staar Gong Li. Pikemalt võistlusprogrammist ja programmist "Vastuvoolu", kus linastub ka rootslase Lukas Moodyssoni "Lilja 4-Ever", mis filmitud peaasjalikult Paldiskis, suurtes rollides Tallinna Vene Draamateatri näitlejad ja episoodis Tõnu Kark

  6. PÖFF käib vaikselt edasi / Margit Adorf

    Index Scriptorium Estoniae

    Adorf, Margit, 1974-

    2007-01-01

    PÖFFi filme: Wong Kar-Wai mängufilm "Mu mustikakarva ööd" ("My Blueberry Nights") : Hongkong - Hiina - Prantsusmaa 2007 ja loodusfilm "Arktika lugu" ("Arctic Tale") : režissöörid Sarah Robertson, Adam Ravetch : Ameerika Ühendriigid 2007

  7. Igas riigis omad probleemid ja omad lahendused / Herb Brody ; tõlk. Peeter Peetersoo

    Index Scriptorium Estoniae

    Brody, Herb

    2005-01-01

    Brasiilia, Hiina, Tšiili, Saksamaa, Lõuna-Aafrika Vabariigi, Hollandi ja Ameerika Ühendriikide ajakirjanikud ning Technology Review toimetajad annavad ülevaate nimetatud riikides arendatavatest tehnoloogilistest projektidest, mis on kohalikele majandustele olulisimad. Lisatud statistilised lühiülevaaded tähtsamatest tehnoloogiasektoritest. Lisa: Ülemaailmne tehnoloogia arvudes

  8. Infinite dimension algebra and conformal symmetry

    International Nuclear Information System (INIS)

    Ragoucy-Aubezon, E.

    1991-04-01

    A generalisation of Kac-Moody algebras (current algebras defined on a circle) to algebras defined on a compact supermanifold of any dimension and with any number of supersymmetries is presented. For such a purpose, we compute all the central extensions of loop algebras defined on this supermanifold, i.e. all the cohomology classes of these loop algebras. Then, we try to extend the relation (i.e. semi-direct sum) that exists between the two dimensional conformal algebras (called Virasoro algebra) and the usual Kac-Moody algebras, by considering the derivation algebra of our extended Kac-Moody algebras. The case of superconformal algebras (used in superstrings theories) is treated, as well as the cases of area-preserving diffeomorphisms (used in membranes theories), and Krichever-Novikov algebras (used for interacting strings). Finally, we present some generalizations of the Sugawara construction to the cases of extended Kac-Moody algebras, and Kac-Moody of superalgebras. These constructions allow us to get new realizations of the Virasoro, and Ramond, Neveu-Schwarz algebras

  9. Integral dimension in the string theory based on a group manifold

    International Nuclear Information System (INIS)

    Toyota, N.

    1990-01-01

    We study string models on a group manifold with Kac-Moody symmetry where the critical dimension d is integer. In particular the possibility of four-dimensional models is investigated. We find that only nine group manifolds with a relevant k level can have four as the critical dimension among an infinite number of compact Lie groups. They are all listed. The models with minimal conformal sectors adding to the Kac-Moody sector are investigated. In the cases with minimal conformal sector, there are only two groups, SU(5) and SO(43), that can give d=4. Among the cases with some tensoring products of minimal conformal sectors we discuss a few special cases with k=0 and k=1. The cases based on N=1 super Kac-Moody algebra are also studied. Finally we discuss the possibility of the enlargement of gauge symmetry. (orig.)

  10. Rare Gas Halide (RGH) Kinetics.

    Science.gov (United States)

    1988-02-01

    In particular, it was determined that careful calculation of the electron energy distribution is necessary in order to predict the observed electron...Phys. Lett., 50, 60 (1987). 3. D.R. Guyer, W.D. Kimura, and S.E. Moody, "HC1 Burnup and Electron Densities in E-Beam Pumped XeC1," in Proceedings of the...1986, Paper N-2. 3. D.R. Guyer, W.D. Kimura, and S.E. Moody, "HC1 Burnup and Electron Densities in E-Beam Pumped XeCl," International Conference on

  11. N=2 current algebra and coset models

    International Nuclear Information System (INIS)

    Hull, C.M.; Spence, B.

    1990-01-01

    The N=2 supersymmetric extension of the Kac-Moody algebra and the corresponding Sugawara construction of the N=2 superconformal algebra are discussed both in components and in N=1 superspace. A formulation of the Kac-Moody algebra and Sugawara construction is given in N=2 superspace in terms of supercurrents satisfying a non-linear chiral constraint. The operator product of two supercurrents includes terms that are non-linear in the supercurrents. The N=2 generalization of the GKO coset construction is then given and the conditions found by Kazama and Suzuki are seen to arise from the non-linearity of the algebra. (orig.)

  12. Lattice Boltzmann equation calculation of internal, pressure-driven turbulent flow

    International Nuclear Information System (INIS)

    Hammond, L A; Halliday, I; Care, C M; Stevens, A

    2002-01-01

    We describe a mixing-length extension of the lattice Boltzmann approach to the simulation of an incompressible liquid in turbulent flow. The method uses a simple, adaptable, closure algorithm to bound the lattice Boltzmann fluid incorporating a law-of-the-wall. The test application, of an internal, pressure-driven and smooth duct flow, recovers correct velocity profiles for Reynolds number to 1.25 x 10 5 . In addition, the Reynolds number dependence of the friction factor in the smooth-wall branch of the Moody chart is correctly recovered. The method promises a straightforward extension to other curves of the Moody chart and to cylindrical pipe flow

  13. Reliable Real-time Calculation of Heart-rate Complexity in Critically Ill Patients Using Multiple Noisy Waveform Sources

    Science.gov (United States)

    2014-01-01

    We would like to thank Mr. George B. Moody and Mr. Ken Pierce of PhysioNet for converting a rare printed copy of an MGH/MF Waveform Database patient...and PhysioNet : components of a new research resource for complex physiologic signals. Circulation. 2000;101:215–20. 28. Moody GB, Mark RG, Goldberger...AL. PhysioNet : a web based resource for the study of physiologic signals. IEEE Eng in Med and Biol. 2001;20:70–5. 29. Liu NT, Batchinsky AI, Cancio

  14. Baidu.com ajas investorid hulluks / Raivo Sormunen

    Index Scriptorium Estoniae

    Sormunen, Raivo, 1976-

    2005-01-01

    Maailma kasutatavuse poolest kuuenda Hiina Interneti otsingumootori aktsia tõusis kohe peale avalikku esmaemissiooni päevaga 354%, mis on suurim hinnatõus mitte-USA aktsiate hulgas läbi ajaloo. Diagramm: Baidu.com aktsia meeletus kõikumises. Lisa: Baidu.com - väike hiiglasuur ettevõte. Vt. samas: Baidu on ülisuure riski otsijale

  15. "Water Cube" ehk Pekingi Rahvuslik veekeskus

    Index Scriptorium Estoniae

    2005-01-01

    2003. a. rahvusvahelise arhitektuurivõistluse võitnud projektis osalesid inseneribüroo Arup, arhitektuurifirma PTW, CSCEC - Hiina riiklik ehitus- ja projekteerimiskorporatsioon ning CSCEC Shenzheni Disainiinstituut. Projektis rakendati ja koordineeriti kaastöid 12-st erinevast teadusharust ja neljast riigist pärit 80 Arupi insenerilt ja spetsialistilt. Konstruktsioonist, tehnoloogiast, tuleohutusest, energia taastootmise süsteemidest. Inseneriteaduse artiklit kommenteerivad arhitekt Kalle Komissarov ja insener Heiki Meos. Kuivõrd saavad eesti arhitektid inseneridelt innovaatilisust oodata. 7 ill

  16. Eesti kirjab EXPO paviljoni rahvamustritega / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2009-01-01

    Eesti paviljoni projekteerimine Hiinas Shanghais 1. maist 31. oktoobrini 2010 toimuvaks maailmanäituseks EXPO 2010 on lõppemas. Oktoobris algavast paviljoni ehitamisest ja sisustamisest ning Eestist EXPO-l osaleda soovijatest. Eesti osalemise peasõnum: "Me elame siin ja meil on siin hea elada". Eesti paviljoni konkursi võidutöö "Savecity.org" autoritest nimetatud: Illimar Truverk, Andres Labi, Janno Roos, Ionel Lehari

  17. Hiinlasest Shakespeare'ks. Eestlasest Shakespeare / Udo Uibo

    Index Scriptorium Estoniae

    Uibo, Udo, 1956-

    2011-01-01

    Ajalehe "Shanghai Daily" (21.04 2011) teatel kavatsevat hiina kirjanik Zhang Yiyi oma viimase menuk aromaaniga teenitud 1, 2 miljonit jüaani (u. 153 00 dollarit) kulutada iluoperatsioonile, mille eesmärgiks on muuta nägu William Shakespeare'i sarnaseks. Nii olla artikli autor okupatsiooni ajal näinud Ain Kaalepil ainult Shakespeare'i sonettidest koosnevat käsikirja, mida kaunistas tema portree soenguga à la Shakespeare'i

  18. PÖFFil võidutses Aasia / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2005-01-01

    Auhinnad IX PÖFFi Euraasia võistlusprogrammi filmidele. Grand prix läks hiina filmile "Shanghai unistus" (režii Wang Xiaoshuai). Žürii liikmed Eva Isaksen, Thomas Mauch, Jaak Allik, Sven Grünberg avaldavad lühiarvamusi. Lisatud nimekiri "9. Pimedate Ööde filmifestival andis välja järgmised auhinnad"

  19. Serviti, Eesti, serviti! / Toomas Tiivel ; intervjueerinud Urve Eslas

    Index Scriptorium Estoniae

    Tiivel, Toomas, 1952-

    2009-01-01

    EXPO 2010 teemal "Parem linn, parem elu" toimub 1. maist 31. oktoobrini 2010 Hiinas Shanghais. Eesti paviljoni ideekonkursist. Žürii koosseis. Loetletud neli lõppvalikusse jõudnud tööd. Võitis töö "Savecity.org" (Illimar Truverk, Andres Labi, Janno Roos, Ionel Lehari, Priit Hamer, Kristian Paljasma). Paviljoni püstitamisest Shanghaisse. Heale paviljonile iseloomulikest joontest

  20. Kuhu küll raha kasvama panna? / Silvia Viidik

    Index Scriptorium Estoniae

    Viidik, Silvia, 1972-

    2010-01-01

    Bloomberg korraldas oma kõige professionaalsemate klientide küsitluse parimate ja halvimate investeerimisvõimaluste väljaselgitamiseks. Küsitluse kohaselt on parimad investeerimise sihtkohad Brasiilia, Hiina ja India, mõnevõrra vähem eelistatakse USA-d. Kehvemateks piirkondadeks peeti Euroopa Liitu, Jaapanit, Suurbritanniat ja ka USA-d. Enim võib teenida aktsiaturgudel ja toorainetes

  1. Berlinale tõstab kilbile "Teekonna Guatanamosse" / Grete Nootre

    Index Scriptorium Estoniae

    Nootre, Grete

    2006-01-01

    56. Berliini filmifestivali programmidest ja filmidest - Suurbritannia poliitiline mängufilm "Teekond Guatanamosse" ("The Road to Guatanamo") : režissöörid Michael Winterbottom, Mat Whitecross, Hiina mängufilm "Lubadus" ("Wu ji") : režissöör Chen Kaige, Suurbritannia - Saksamaa "V nagu vendette" ("V for Vendette") : režissöör James McTeigue

  2. Eesti transiit : müüt ja tegelikkus / Urmas Klaas

    Index Scriptorium Estoniae

    Klaas, Urmas, 1971-

    2008-01-01

    Ilmunud ka: Molodjozh Estonii 20. veebr. lk. 8. Eesti transiitveod on seni toimunud peamiselt vaid ida- ja läänesuunal, veetud on enamjaolt energiakandjaid, Eestit läbivad transiitveod on hakanud oluliselt vähenema. Autor soovitab Eesti transiidi riske hajutada ning leida juurde uusi partnereid, sealjuures kutsub ta ka üles mitte näitama üleliigset optimismi Hiina suhtes

  3. Euroopa kaks tulevikku / Joschka Fischer

    Index Scriptorium Estoniae

    Fischer, Joschka, 1948-

    2007-01-01

    Autor analüüsib Euroopa Liidu tulevikku, põhiseaduse lepingu väljavaateid ja rõhutab EL-i vajadust toime tulla üleilmsete väljakutsetega, sest 21. sajandil jätkub suurte riikide nagu Hiina, India, USA ja Jaapani tõus. EL-il on kaks võimalust: kas maailmaga kaasa minna või hääbuda, kirjutab autor

  4. Katrin Denev pokazala harakter

    Index Scriptorium Estoniae

    2006-01-01

    Veneetsia 63. filmifestivali auhinnatutest, kellest vaid Stephen Frears'i filmis "Kuninganna" ("The Queen") peaosa kehastanud Helen Mirren oli üks favoriitidest. Parima filmi peaauhind Kuldlõvi läks üllatuslikult Hiina režissööri Jia Zhang-Ke filmile "Vaikelu" ("Dong"). Ka teistest Veneetsia 63. filmifestivali võitjatest. Festivali žüriid juhatas Catherine Deneuve

  5. Kui palju on vaja ohvreid / Silver Meikar

    Index Scriptorium Estoniae

    Meikar, Silver, 1978-

    2008-01-01

    Ilmunud ka: Sakala 27. märts lk. 2, Keskus apr. nr. 4 lk. 56-57, Pärnu Postimees 2. mai lk. 15. Parlamendiliikme sõnul peab maailma üldsus Hiina suhtes otsustavalt käituma ning ta kutsub Eesti sportlasi ja poliitikuid üles Pekingi olümpiamängude avatseremoonial mitte osalema. Ajalehes Keskus kommenteerib Urmas Pappel

  6. Mälupuutuja puudutus / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    1998-01-01

    Ando Keskküla kuraatornäitus "Puutujad" Tallinna Kunstihoones, näituse lähtekohtadest. Moskvalaste AESi rühmituse (Tatjana Arzamazova, Lev Jevzotovitch, Jevgeni Svjatski), hiina kunstniku Zhang¡Dali, Teemu Mäki, vene kunstniku Juri Alberti, Izabella Gustowska, Saara Ekströmi, Mart Viljuse töödest, poola kunstniku Maciej Toporowiczi videost "Kinnisidee".

  7. Uued filmitiigrid oriendist üllatavad vaatajat ootamatu modernismiga / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2005-01-01

    IX Pimedate Ööde Filmifestivali filme Aasiast - "Troopikahaigus" : režissöör Apichatpong Weerasethakul : Tai - Prantsusmaa 2004, "Massöör" : režissöör Brillante Mendoza : Filipiinid 2005, "Päevalill" : režissöör Zhang Yang : Hiina 2005. Lisatud "Euroopasse pürib ka Türgi film" Yesim Ustaoglu filmist "Oodates pilvi"

  8. Kuidas möödus majandusaasta 2006 / Lembo Tanning, Toivo Tanning

    Index Scriptorium Estoniae

    Tanning, Lembo

    2007-01-01

    Ilmunud ka: Buhgalterskije Novosti, nr. 4, 2007, lk. 36-40. Ülevaade viimase kümne aasta maailmamajanduse arengutest sisemajanduse kogutoodangu ja väliskaubanduse põhjal. Tabelid: G-7 SKP 2000. aasta hindades ja rahavahetuskursiga, mld USD; USA väliskaubandus ja -teenused, mld USD-d, 2004-2006. Graafik: Hiina RV SKP, triljon jüaani, 1990-2006. Diagramm: Maailma suurimad eksportöörid, mld USD, 2004-2006

  9. Bagatellid : maailm / Nele-Eva Steinfeld, Ivo Heinloo

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2011-01-01

    Muusikasõnumeid maailmast: Hollandi kultuurielu kriis. Toetus Londoni Filharmooniaorkestrist vallandatud muusikutele. Veebilehest: arkivmusic.eu. Lahkus Kurt Sanderling. Hiinas keelustati ajaloolise sisuga ooper. Dirigent Mark Gorenstein vallandati ametist. Beethoveni kvarteti taastatud osa. Värskeid plaadilepinguid. Bostoni sümfooniaorkester otsib muusikalist juhti. Fabio Luisil probleem kodumaiste ooperimajadega. Itaalia jazzi pevad New Yorgis. Värskeid plaate jazzimaailmast. Tony Bennett purustas rekordi. DownBeati aasta jazzmuusik on Jason Moran

  10. Teist aastat järjest edestasid Euroopa kapitaliturud IPO-de arvult ja kogumahult USA omi

    Index Scriptorium Estoniae

    2007-01-01

    Ilmunud ka: Finansovõi Menedzhment : infovõpusk nr. 14 mai lk. 10-11. PricewaterhouseCoopersi väljaande IPO Watch Europe 2006 järgi jätkub Euroopa edu USA ja Suur-Hiina ees IPO-de pakkumise arvu ja kapitali kaasamise osas. Tabelid: Euroopa suurimad IPO-d 2006; Euroopa suurimad IPO-d 2005; Euroopa IPO-de jagunemine börside lõikes, 2005-2006

  11. Võistluskavade parimad said eile pärjatud / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2011-01-01

    15. Pimedate Ööde Filmifestivali võitjatest. Parim Euraasia film "Lihtne elu" (režissöör Ann Hui, Hiina), parim režissöör Lynne Ramsay ("Me peame Kevinist rääkima", Suurbritannia). Balti filmide konkursil parim Eesti film "Surnuaiavahi tütar", parim operaator Mart Taniel ("Idioot", Eesti). Auhindade võitjad loetletud

  12. Maailma publikurohkeima filmifestivali esikoht Poola

    Index Scriptorium Estoniae

    2002-01-01

    Pärnu rahvusvahelisest dokumentaal- ja antropoloogiafilmide festivalist. Peapreemia sai poola režissööri Maciej Adameki "Olen sinuga surmani", parima eesti filmi preemia Dorian Supini "24 prelüüdi ühele fuugale" helilooja Arvo Pärdist ning lastežürii valis oma lemmikuks hiina režissööri Leng Shani filmi "Talv 3000 meetri kõrgusel". Auhinnasaajate nimekiri

  13. Piebalgs : põlevkivist toodetud elekter jääb / Andris Piebalgs ; interv. Ahto Lobjakas

    Index Scriptorium Estoniae

    Piebalgs, Andris, 1957-

    2008-01-01

    Euroopa Komisjoni energiapoliitika volinik vastab küsimustele, mis puudutavad kasvuhooneefekti pidurdamiseks Euroopa Komisjoni poolt väljapakutud meetmete tegelikku mõju maailmas, kus suurimad saastajad USA, Hiina ja India ei seo end sarnaste kohustustega, teiste riikide valmisolekut EL-i eesmärkidega kaasa minna, Eesti valikuid elektritootmises energiajulgeoleku seisukohalt, Vene-Saksa gaasijuhet ja Musta mere gaasijuhet South Sream. Diagramm: Eesti elanik on Euroopa suuremaid saastajaid

  14. FIAT-i juht : maailma jääb alles vaid kuus suurt autotootjat / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2008-01-01

    FIAT-i tegevjuhi Sergio Marchionne hinnangul jääb kriisi lõpuks alles üks Ameerika, üks Saksa, üks Prantsuse, üks Hiina ja üks võimalik üleeuroopaline autotootja. Analüütik Jürgen Pieperi hinnangul on kõige haavatavamad FIAT, BMW ja PSA/Peugeot-Citroen, alles jäävad VW, Renault-Nissan ja Daimler

  15. Pobedili prosteishije

    Index Scriptorium Estoniae

    2002-01-01

    San Sebastiani 50. rahvusvaheliselt filmifestivalilt, kus parima filmi Kuldse Merikarbi sai hispaania režissööri Fernando Leon de Aranoa "Esmaspäevad päikese all" ("Los lunes al sol") ja venelase Valeri Todorovski "Armuke" ("Ljubovnik") sai parima stsenaariumi auhinna (Gennadi Ostrovski) ning parima operaatori auhinna (Sergei Mihhaltshuk). Hiina režissöör Chen Kaige sai režiipreemia filmi "Üheskoos" eest

  16. Arhitektuuribiennaalil arhitektuurile mõeldes / Karin Hallas-Murula

    Index Scriptorium Estoniae

    Hallas-Murula, Karin, 1957-

    2008-01-01

    Veneetsia arhitektuuribiennaalist teemal "Out there : Architecture Beyond Buildings". Biennaali üldkuraator Aaron Betsky. Eestlaste gaasitoruinstallatsioonist (autorid Maarja Kask, Ralf Lõoke, Neeme Külm). Lühidalt Hispaania, Inglismaa, Prantsusmaa, Hollandi, Taani, Saksamaa, Hiina ja Poola ekspositsioonidest, pikemalt Venemaa paviljonist. Nigel Coatsi, Zaha Hadidi, Frank Gehry, Herzog & de Meuroni ja Ai Weiwei töödest biennaalil, filmist Rem Koolhaasi Bordeaux' villast. Vt. repliik: Ruudi, Ingrid. Hea Sirbi toimetus! (Sirp, 2009, 30. jaan., lk. 8)

  17. Euroopa tunnustab inimõiguste eest võitlejaid / Tõnu Prei

    Index Scriptorium Estoniae

    Prei, Tõnu, 1950-

    2007-01-01

    Euroopa Parlamendi täiskogu istungil tehakse parlamendikomisjoni esimeeste konverentsil teatavaks otsus Sahharaovi auhinna tänavuse laureaadi kohta. Auhinna kandidaadid on Sudaani inimõiguste küsimustega tegelev advokaat Salih Mahmud Osman, Hiina inimõiguste eest võitlejad Zeng Jinyan ja Hu Jia ning Tšetšeenias inimõiguste rikkumisi ja piinamisjuhtumeid uurinud vene ajakirjanik Anna Politkovskaja

  18. Peavalu tekitavad valuutakursid / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2007-01-01

    Dollari nõrkus teeb muret nii eurooplastele kui ka Pärsia lahe naftariikidele. Eurogrupi esimees Jean-Claude Junker, Euroopa rahandusvolinik Joaquin Almunia ja Euroopa Keskpanga president Jean-Claude Trichet püüavad oma visiidil Hiinasse sealseid juhte veenda, et Hiina laseks jüaani kursil vabamalt kõikuda. Ken Fisheri arvates tuleks nõrga dollari asemel karta hoopis tugevat jeeni. Lisa: Miks Aasia riigid reserve koguvad

  19. Seks korraks kõik: 15. PÖFF sai läbi, "Eesti film 100" ootab ees

    Index Scriptorium Estoniae

    2011-01-01

    15. Pimedate Ööde Filmifestivali võitjatest. Parim Euraasia film "Lihtne elu" (režissöör Ann Hui, Hiina), parim režissöör Lynne Ramsay "Me peame Kevinist rääkima" (Suurbritannia), parim meeesnäitleja Sven Nordin filmist "Norra pojad", parim naisnäitleja Deanie Ip filmist "Lihne elu". Elutööauhinnad said Rein Raamat, Rein Maran, Fridrik Thor Fridriksson ja Aleksandr Sokurov

  20. Mark Soosaar : Pärnus toimuv Eesti filmifestival tahab kaasa rääkida poliitilistes protsessides, mis viivad maailma suuremale mõistmisele ja sallivusele / Mark Soosaar ; interv. Karin Klaus, Karol Kallas

    Index Scriptorium Estoniae

    Soosaar, Mark, 1946-

    2007-01-01

    XXI Rahvusvaheline Pärnu filmifestivalist. Varasematest festivalidest. Selle festivali üritustest, filmidest : tähelepanuväärsed on Aleksei Nekrassovi film Aleksander Litvinenkost "Minu sõber Sasha. Mõrv vene moodi" ja Marianna Jarovskaja, Olesja Bondareva film vene vaimulikest "Püha sõda". Lisatud M. Soosaare loomingulise tegevuse lühikokkuvõte

  1. Eesti oma idamaa kunstnik / Mark Soosaar

    Index Scriptorium Estoniae

    Soosaar, Mark, 1946-

    1999-01-01

    8. apr.-st Pärnu Uue Kunsti Muuseumis veebruaris Soulis idamaise maalikunsti alal magistrikraadi kaitsnud Kati Kalda (sünd. 1971) maalinäitus "Elu korea moodi", Kalev Mark Kostabi maalide väljapanek ning loodusfoto konkursi parimate tööde näitus.

  2. Po kanalu TBTs pokazhut film o "Vaffen-SS"

    Index Scriptorium Estoniae

    2006-01-01

    Vene filmistuudio Treti Rim on tootnud lätivastase ajaloolise dokumentaali-propagandafilmi Teisest Maailmasõjast "Natslus Balti moodi" ("Natsizm po pribaltiski"). Filmi näitab täna Vene telekanal TVT, andes siiski võimaluse eetris esineda Läti Venemaa suursaadikule Andris Teikmanisele

  3. An Air Force Guide for Effective Meeting Management

    Science.gov (United States)

    2011-05-01

    Boise, Olmsted, Muniz, Hickam, Kulis, Puerto Rico , Willow Grove • ACC: Moody, Pope • J models arrive on Tuesdays • AMP mod aircraft arrive on...limits work time available or leave schedules over the holidays affect available manning (Romero, 2010). Future research could identify manning

  4. On the unitarity of string propagation on SU(1,1)

    International Nuclear Information System (INIS)

    Mohammedi, N.

    1989-12-01

    We discuss the consistency (unitarity) of string propagation on the non-compact group SU(1,1) x G c and find the restrictions on the level of the Kac-Moody algebra for this propagation to be unitary. We also suggest some modifications to the Virasoro generators and obtain a manifestly unitary string theory. (author). 10 refs

  5. different meanings a text may acquire: the case of malachi 1:11 1 ...

    African Journals Online (AJOL)

    KRIEG M. 1993. Mutmassungen über Maleachi. Eine Monographie. Zürich: Theologischer Verlag. AThANT 80. MERRILL E H. 1994. An exegetical commentary. Haggai, Zechariah, Malachi. Chicago: Moody Press. PETERSEN D L. 1995. Zechariah 9-14 and Malachi. A commentary. Louisville: Westminster John. Knox Press.

  6. AFRREV IJAH, Vol.3 (1) January, 2014

    African Journals Online (AJOL)

    Toshiba

    2014-01-09

    Jan 9, 2014 ... plummeting of the prices of real estate in the USA as the remote cause of the recession and the drying up of loanable funds in the money market as the main .... development, good governance, respect for human rights, peace and conflict resolution, enabling environment and trade development. (Moodie ...

  7. Optimizing growth conditions for electroless deposition of Au films ...

    Indian Academy of Sciences (India)

    Unknown

    Tangyunyong P, Thomas R C, Houston J E, Michalske T A,. Crooks R M and Howard A J 1993 Phys. Rev. Lett. 71 3319. Tsunoyama H, Sakurai H, Ichikuni N, Negishi Y and Tsukuda. T 2004 Langmuir 20 11293. Volinsky A A, Moody N R and Gerberich W W 2004 J. Mater. Res. 19 2650. Warren S et al 2002 Surf. Sci.

  8. Competitive Strategies and Financial Performance of Small Colleges

    Science.gov (United States)

    Barron, Thomas A., Jr.

    2017-01-01

    Many institutions of higher education are facing significant financial challenges, resulting in diminished economic viability and, in the worst cases, the threat of closure (Moody's Investor Services, 2015). The study was designed to explore the effectiveness of competitive strategies for small colleges in terms of financial performance. Five…

  9. Tailored Behavioral Intervention for Insomnia in Children with Autism Spectrum Disorder

    Science.gov (United States)

    2015-09-01

    Cow Activities ..................................................................... 13 7. Worry Box/Worry Doll...best. You can pair the tension-relaxation cycle with your breath, squeezing the muscle as you breathe in and hold the breath for a moment, and...2008). Mindful movements: Ten exercises for well-being. Berkley, CA: Parallax Press. 12 6. Moody Cow Activities Children with ASD are often visual

  10. 40 CFR 280.104 - Local government bond rating test.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Local government bond rating test. 280... STORAGE TANKS (UST) Financial Responsibility § 280.104 Local government bond rating test. (a) A general... million or more, excluding refunded obligations, with a Moody's rating of Aaa, Aa, A, or Baa, or a...

  11. Cohomology of line bundles on Schubert varieties: The rank two case

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Math. 33 (1976) 271–272. [3] Jantzen J C, Representations of algebraic groups, Pure Appl. Math. (Florida: Academic. Press) (1987) vol. 131. [4] Paramasamy K, Thesis, Cohomology of line bundles on Schubert varieties (submitted to the University of Madras) (2004). [5] Sai-Ping Li, Moody R V, Nicolescu M and Patera J, ...

  12. Dryden: A Collection of Critical Essays. Twentieth Century Views Series.

    Science.gov (United States)

    Schilling, Bernard N., Ed.

    One of a series of works aimed at presenting contemporary critical opinion on major authors, this collection includes essays by Bernard Schilling, T. S. Eliot, Louis I. Bredvold, James M. Osborn, Reuben A. Brower, Edwin Morgan, Earl Wasserman, R. J. Kaufmann, Moody E. Prior, Earl W. Miner, Edward N. Hooker, E. M. W. Tillyard, John Hollander,…

  13. Edu ja raskused käsikäes / Kenneth Orchard

    Index Scriptorium Estoniae

    Orchard, Kenneth

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti 11. juuli lk. 8. Reitinguagentuur Moody's analüütik näeb Eesti seni edukas majandusarengus tasakaalustamatuse ning ülekuumenemise märke ning peab euro kasutuselevõttu aastal 2011 ebatõenäoliseks

  14. English Communication Skills: How Are They Taught at Schools and Universities in Oman?

    Science.gov (United States)

    Al-Mahrooqi, Rahma

    2012-01-01

    The aim of this paper is to investigate, from a student perspective, how English communication skills are taught in Oman's schools and higher education institutions. Previous research has documented the lack of communicative ability in English among school and higher education graduates in Oman (Al-Issa, 2007; Moody, 2009). However, the reasons…

  15. Aging changes in the female reproductive system

    Science.gov (United States)

    ... and thins, and can become irritated. Other common changes include: Menopause symptoms such as hot flashes, moodiness, headaches, and ... process go more smoothly. OTHER CHANGES Other aging changes to expect: Hormone production Organs, tissues, and ... Menopause References Grady D, Barrett-Connor E. Menopause. In: ...

  16. Asia: The Global Telecom Dynamo.

    Science.gov (United States)

    McClelland, Stephen; Weiss, Edward; Sujarto, P. J.; Nakorn, Pria; Kim, B. A.; Chan, Lily; Bromby, Robin

    1997-01-01

    In a 1995 study, Moody's Investors Research found that companies and governments in the Pacific Rim would require $363 billion for essential telecom infrastructure by the end of the decade. Examines the state of communications in Hong Kong, Indonesia, Malaysia, the Philippines, Singapore, South Korea, Taiwan, Thailand, Australia, and New Zealand.…

  17. Ruum keha ja kanga vahel / Kati Künsar

    Index Scriptorium Estoniae

    Künsar, Kati

    2011-01-01

    Näitus "Future Beauty : 30 Years of Japanese Fashion" ("Tulevikuilu - 30 aastat jaapani moodi") Londoni Barbicani kunstigaleriis 15.10.2010-6.02.2011, Müncheni Kunstimajas 4.03.-19.06.2011, kuraatorid Fukai Akiko ja Kate Bush

  18. NJP VOLUME 42 NO 1

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-08-07

    Aug 7, 2014 ... malities with cardiac impulse conduction disorder in adult pa- tients: experience from a tertiary center in Kosovo. Heart Int. 2011; 6: 11- 5. 8. Eronen M. Long-term outcome of children with complete heart block diagnosed after the new- born period. Pediatr Cardiol. 2001; 22: 133-7. 9. Pordon CM, Moodie DS.

  19. Высокая мода по карману

    Index Scriptorium Estoniae

    2009-01-01

    Moodi ja taaskasutust propageeriva projekti ReUse Republic disainiturg Tallinna Kristiine Keskuses. Seismajäänud brändirõivaid disainivad ümber moekunstnikud Kadri Bussov, Mari Martin, Kirill Safonov, Britt Samoson. Projekti looja on Mari Martin

  20. Non-abelian bosonization in higher genus Riemann surfaces

    International Nuclear Information System (INIS)

    Koh, I.G.; Yu, M.

    1987-08-01

    We propose a generalization of the character formulas of the SU(2) Kac-Moody algebra to higher genus Riemann surfaces. With this construction, we show that the modular invariant partition function of the SO(4) κ = 1 Wess-Zumino model is equivalent, in arbitrary genus Riemann surfaces, to that of free fermion theory. (orig.)

  1. Suigu lapsed poseerivad Inglismaa pereajakirjas / Veste Roosaar

    Index Scriptorium Estoniae

    Roosaar, Veste, 1960-

    2009-01-01

    Inglismaal Bornemouthi kunstiinstituudi lõpetanud fotograaf Katrina Tang tegi koos stilisti Natalie Chestermaniga pildiseeria "Tagasi kooli", mis tutvustas Inglismaa moodi eesti laste seljas. Tang pildistas Suigu lapsi, kellede pilte võib näha Inglismaa ajakirja Junior septembrinumbris

  2. Efficacy and economics of different herbicides in aerobic rice system

    African Journals Online (AJOL)

    Jane

    2011-08-03

    Aug 3, 2011 ... technological and economic factors (Moody, 1991). Herbicide has become an attractive alternative to manual weeding due to its high efficacy and low cost. Most farmers in Malaysia are presently using herbicides as an effective tool in controlling weeds in wet direct seeded or transplanted rice (Karim et al., ...

  3. Employee no-shows: managing library absenteeism.

    OpenAIRE

    Wygant, L J

    1988-01-01

    Employee absenteeism is a problem faced by all library administrators. This paper describes the development, implementation, and results of a program to discourage absenteeism at the Moody Medical Library of the University of Texas Medical Branch at Galveston. The important role of library administrators and supervisors in controlling absenteeism is emphasized.

  4. 78 FR 2295 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Filing of Proposed Rule...

    Science.gov (United States)

    2013-01-10

    ... listing and trading of WisdomTree Dreyfus Australia and New Zealand Debt Fund); 66342 (February 7, 2012... administrator, accounting agent, custodian and transfer agent to the Fund.\\5\\ \\5\\ The Commission has issued an... rating of at least A by Standard & Poor's Ratings Group (``S&P Ratings''), Moody's Investors Service, Inc...

  5. Arhitektuur kohtub moega

    Index Scriptorium Estoniae

    2011-01-01

    Eesti moekunstniku Britt Samosoni koostöös Valgusfestivaliga valminud arhitektuuri ja moodi ühendav 3D-installatsioon "Flat Cut 3D - Architecture" Rotermanni kvartali väljakul 14.-18. septembrini. Britt Samosoni moekollektsiooni "Square Cut" näeb Eesti Nuku- ja Noorsooteatris 15. septembril

  6. Non-abelian bosonization in higher genus Riemann surfaces

    International Nuclear Information System (INIS)

    Koh, I.G.; Yu, M.

    1988-01-01

    We propose a generalization of the character formulas of the SU(2) Kac-Moody algebra to higher genus Riemann surfaces. With this construction, we show that the modular invariant partition funciton of the SO(4) k = 1 Wess-Zumino model is equivalent, in arbitrary genus Riemann surfaces, to that of free fermion theory. (orig.)

  7. Extended KN algebras and extended conformal field theories over higher genus Riemann surfaces

    International Nuclear Information System (INIS)

    Ceresole, A.; Huang Chaoshang

    1990-01-01

    A global operator formalism for extended conformal field theories over higher genus Riemann surfaces is introduced and extended KN algebra are obtained by means of the KN bases. The BBSS construction of the spin-3 operator is carried out for Kac-Moody algebra A 2 over a Riemann surface of arbitrary genus. (orig.)

  8. 78 FR 54715 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2013-09-05

    ..., Moody's Investors Service, Inc.), or is unrated but considered to be of comparable quality by the... non-rated). The word ``leveraged'' refers to the credit quality of the borrower--a non- investment... securities, automated quotation systems, published or other public sources, or on-line information services...

  9. Mägiaed ehk alpi aed / Svetlana Polonskaja

    Index Scriptorium Estoniae

    Polonskaja, Svetlana

    2014-01-01

    Autor tutvustab nn Tšehhi mägiaeda. Tšehhi alpinaariumid on tehtud täiesti "uut moodi" - kivid on asetatud vertikaalselt üksteise kõrvale, nii et nende vahele jäävad kitsad praod taimede istutamiseks

  10. Lectures on Lie algebras and their representations: 1

    International Nuclear Information System (INIS)

    Dobrev, V.K.

    1988-05-01

    The paper is based on sixteen lectures given by the author in April-June 1988 at the International Centre for Theoretical Physics, Trieste. It covers the basic material on the structure, classification and representations of Lie algebras G associated with a (generalized) Cartan matrix, or Kac-Moody algebras for short. 16 refs, tabs

  11. Muusika DVD-d / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2006-01-01

    Uutest DVD-dest Moody Blues "Lovely to See You - Live", Nick Cave and The Bad Seeds "Road to God Knows Wherw", Thin Lizzy "Thunder and Lightning Tour", Eels "Eels With Strings - Live at Town Hall", Moby "Live. Hotel Tour 2005", Corvus Corax "Cantus Buranus", Destiny's Child "Live in Atlanta"

  12. Psychological impact of infertility: identifying issues and needs.

    Science.gov (United States)

    Valentine, D P

    1986-01-01

    During interviews, married couples experiencing infertility reported emotional reactions such as sadness, depression, anger, confusion, desperation, hurt, embarrassment, and humiliation. Behavioral reactions to infertility included disorganization, distractability, exhaustion, moodiness and obsessive thoughts and behaviors. Participants also described multiple sources of stress and utilized a variety of coping strategies. Implications for social work clinical and research practitioners are discussed.

  13. Author Details

    African Journals Online (AJOL)

    Details · Vol 4, No 2 (2000) - Articles Book Review: J. Kelly. Rethinking Industrial Relations: Mobilization, Collectivism and Long Waves. K. Moody. Workers in a Lean World: Unions in the International Economy. B. Nissen. Which Direction for Organized Labour? Essays on Organizing, Outreach and Internal Transformation

  14. 16 moeõppetundi itaalia stiilis / Nicole Picart, Richard Gianorio, Marie Varvoux

    Index Scriptorium Estoniae

    Picart, Nicole

    2007-01-01

    Itaalia moekunstnikud Gianfranco Ferre, Frida Giannini (Gucci), Graeme Black (Ferragamo), Angela Missioni (Missioni), Laura Lusuardi (Max Mara), Roberto Cavalli, Donatella Versace, Silvia Venturini (Fendi), Gaia Trussardi, Tomas Maier (Bottega Veneta), Dolce & Gabbana, Cristina Ortiz (Brioni), Rossella Jardini (Moschino), Alberta Ferretti, Giorgio Armani, Dean ja Dan Caten (Dsquared 2) iseloomustavad ideaalset naist, itaalia stiili, ajatut moodi ja kommenteerivad oma moekunstnikuks saamist. Lisatud fotod moekunstnikest

  15. V tshom võiti na Pikadilli

    Index Scriptorium Estoniae

    2008-01-01

    Näitus "Kaks sajandit briti moodi" Kremli Muuseumis Moskvas. Eksponeeritakse kostüüme, aksessuaare ja kanganäiteid 17.-19. sajandi Inglismaalt. Eksponaadid on Londoni Victoria ja Alberti Muuseumist. Kangamustrite näidete autor on Londoni 18. sajandi tekstiilikunstnik Anna Maria Garthwaite

  16. Generalized Feature Extraction for Structural Pattern Recognition in Time-Series Data

    Science.gov (United States)

    2001-02-01

    PhysioNet [34]. The SVDB contains 78 Holter ECG recordings where each electrocardiogram was recorded from a single patient for a duration of...Joseph E. Mietus, George B. Moody, Chung-Kang Peng, and H. Eugene Stanley. PhysioBank, PhysioToolkit, and PhysioNet : Components of a New Research

  17. Cell lineage and fate determination

    National Research Council Canada - National Science Library

    Moody, Sally A

    1999-01-01

    ... Washington University. Cell Lineage and Fate DeterminationEdited by SALLYA. MOODY Department of Anatomy and Cell Biology Institute for Biomedical Sciences The George Washington University Washington, D.C. 20037 San Diego London Boston ACADEMIC PRESS New York Sydney Tokyo Toronto Copyright PageCover photograph: Wild-type embryonic central nervous system ...

  18. Preschool development of coloured children in Cape Town ...

    African Journals Online (AJOL)

    Preschool development of coloured children in Cape Town. C.D. Molteno, J Hollingshead, A.D. Moodie, D Bradshaw, M.D. Bowie, W Willoughby. Abstract. Developmental screening was applied during infancy to a birth cohort of 1 000 coloured infants born consecutively in Cape Town. The developmental progress of a ...

  19. Rill erosion rates in burned forests

    Science.gov (United States)

    Joseph W. Wagenbrenner; Peter R. Robichaud

    2011-01-01

    Introduction Wildfires often produce large increases in runoff and erosion rates (e.g., Moody and Martin, 2009), and land managers need to predict the frequency and magnitude of postfire erosion to determine the needs for hazard response and possible erosion mitigation to reduce the impacts of increased erosion on public safety and valued resources. The Water Erosion...

  20. Creole remedies : case studies of ethnoveterinary medicine in Trinidad and Tobago

    NARCIS (Netherlands)

    Lans, C.

    2001-01-01

    Context

    The popular pharmacopoeia of Trinidad and Tobago is the result of a Creole pan-Caribbean culture, closely linked to history, and the result of a South American Indian, African, European and Asian heritage (Lans, 1996; Moodie-Kublalsingh, 1994; Littlewood, 1988;

  1. Piercing the sovereign ceiling: Issues in oil and gas project financing

    International Nuclear Information System (INIS)

    Coleman, T.S.

    1998-01-01

    In the oil and gas sector, corporations and governments face huge capital spending requirements in order to transform large resource discoveries into producing, cash-generating assets. A significant portion of this funding is expected to be done on a project finance basis, where bank lenders or bond investors take a secured position in financing a discrete project, with the expectation of being paid back by the cash flows from that project after completion. This trend is increasing demand for crediting rating services to provide credit ratings for these project financings. A key challenge is to analyze and rate credit-worthy projects in countries that have relatively low foreign currency sovereign ceilings due to economic, political, and financial risks. In most cases, the credit ratings for projects financed in currencies outside the host country are capped at the country''s foreign currency ceiling. However, in a few instances, mainly in the oil and gas sector, Moody''s has pierced the foreign currency ceiling or rated certain projects above the sovereign ratings of the countries where they are domiciled. The purpose of this article is to briefly explain some of the qualitative factors and considerations that have allowed Moody''s to pierce the ceiling in the oil and gas sector, with a focus on two recent and noteworthy projects: Ras Laffan Liquefied Natural Gas in Qatar and Petrozuata in Venezuela

  2. Miks infarkt armastab eestlast? / Peeter Ernits, Allen Kaasik

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2000-01-01

    Neljast tähtsamast südame seisundit mõjutavast riskitegurist - sotsiaalsest keskkonnast, toitumistavadest, kehalisest aktiivsusest ja tubakapoliitikast. Tartlaste ja stockholmlaste tervisenäitajate võrdlus. Diagrammid : Ainult Lätis on hullem, Suremus südamehaigustesse, Elu Eesti moodi

  3. Integrable lattice models, graphs and modular invariant conformal field theories

    International Nuclear Information System (INIS)

    Francesco, P.

    1992-01-01

    This paper reviews the construction of integrable height models attached to graphs in connection with compact Lie groups. The continuum limit of these models yields conformally invariant field theories. A direct relation between graphs and (Kac-Moody or coset) modular invariants is proposed

  4. Ühekülgne ja tasakaalust väljas Eesti majandus / Andres Reimer

    Index Scriptorium Estoniae

    Reimer, Andres

    2009-01-01

    Eesti kaubandusbilanss on tervikuna kõikide riikide arvestuses juba peaaegu tasakaalus, kuid tasakaalustumine Eesti moodi on autori väitel käinud välisfinantseerimise peatumise, impordi kollapsi ja sisenõudluse vähenemise kaudu. Professor Richard Baldwini ja Euroopa Keskpanga ökonomisti Daria Taglioni artiklist majandusportaalis VoxEu

  5. Children‟s Attachment Styles, Academic Achievement and Social ...

    African Journals Online (AJOL)

    First Lady

    2012-10-27

    Oct 27, 2012 ... their children (Melgosa, 1997), include:- Authoritarian parenting - in which the parents are harsh, .... rude, moody, depressed, violent and aggressive with little or low self-esteem. They display no physical or ..... Infant–mother attachment classification: Risk and protection in relation to changing maternal.

  6. Maailmade loomine ja rahvuspaviljonid Veneetsias / Kati Ilves

    Index Scriptorium Estoniae

    Ilves, Kati, 1984-

    2009-01-01

    53. Veneetsia biennaal "Making Worlds / Fare Mondi / Maailmu luues" 7. VI-22. XI, kuraator Daniel Birnbaum. Hiina kunstniku Chu Yuni tööst "Constellation / Tähtkuju" kuraatorinäitusel. Lühidalt USA (Bruce Nauman) ja Hispaania (Miquel Barcelo) paviljonidest, pikemalt Taani ja Põhjamaade (kunstnike-kuraatorite Michael Elmgreeni ja Ingar Dragseti projekt "The Collectors / Kogujad"), Prantsuse (Claude Lévèque'i "Le Grand Soir / Suur öö", kuraator Christian Bernard) ja Egiptuse (Adel El Siwi ja Ahmad Askalany "Leggermente monumentale / Kergelt monumentaalne") paviljonidest

  7. Väljavalituse tunne / Jaak Kilmi

    Index Scriptorium Estoniae

    Kilmi, Jaak, 1973-

    2005-01-01

    Lühihinnang IX Pimedate Ööde Filmifestivali mängufilmidele - "Garpastum" : režissöör Aleksei German jun : Venemaa 2005, "Kohe paradiisi" ("Paradise Now") : režissöör Hany Abu-Assad : Holland - Saksamaa - Prantsusmaa 2005, "Maavärinate klaverihäälestaja" (Piano Tuner of the Earthquakes") : režissöörid Stephen ja Timothy Quay : Suurbritannia - Saksamaa - Prantsusmaa 2005, "Kolmel ajal" ("Three Times") : režissöör Hou Hsiao-hsien : Taiwan - Hiina 2005

  8. Näitused / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-

    1998-01-01

    Rotermanni soolaladu: Mark Raidpere ja Ene-Liis Semper "Mäng 4. käel"; Kunstihoone: Tony Craggi skulptuurid; Adamson-Ericu muuseum: Eduard Ole 100. sünniaastapäevale pühendatud näitus; Kastellaanimaja galerii: "Tee Raamat": Anu Purre kirjutus-kunstistuudio EKSTEKST GRUPP ja stuudio sõprade näitus (T-särkidest raamat-installatsioonid); Tervishoiumuuseum: "In vino..."; Tammsaare muuseum:"Tiibeti muistne kultuur. Hiina maastikud"; Kullo galerii: Huvikeskuse Kullo aastanäitus.

  9. Bagatellid : maailm / Nele-Eva Steinfeld, Ivo Heinloo

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2011-01-01

    Muusikasõnumeid maailmast: Helsingis avati uus kultuurikeskus Helsingi Musiikkitalo. Montrealis sain endale uue kontserdimaja La Maison Symphonique de Montreal. Lahkus tenor Salvatore Licitra. James Levine loobus Metropolitan Opera sügishooaja etenduste dirigeerimisest. Iisraeli Filharmoonikute kontsert BBC Promsil häiritud. Deutsche Grammophon kolis Berliini. Siemens loobub Bayereuthi festivali spondeerimisest. Kultuurivahetus Viini Riigiooperi ja La Scala ooperiteatrite vahel. MTV premeeris popimaailma tippe. Hiina tsenseerib Lääne popmuusikuid. uus Grammyde jagamise kord põhjustab pahameelt. Return to Forever taas koos. Chick Corea juubel

  10. Eesti läheb Pekingisse / Karin Hallas-Murula

    Index Scriptorium Estoniae

    Hallas-Murula, Karin, 1957-

    2008-01-01

    Pekingi Eesti saatkonnahoone konkursist žüriiliikme pilguga. Premeeritud ja esiletõstetud töödest. Võidutöö autorid - Lauri Vaimel, Andres Põime, Liisa Põime; II koht - Erik Nobel ja Nobel Arkitekten, Taani-Eesti; III koht - Kalle Vellevoog, Velle Kadalipp, Tiiu Truus, Martin Prommik; ostudega esiletõstetud tööde autorid - Priit Pent ja Raul Järg Bucoma OÜ-st ning Jan Skolimowski, Peeter Loo, Kaspar Kruuse ja Li Vene KAMP Arhitektide OÜ-st. Hiina ja Pekingi uusehitistest, arhitektidest

  11. Eesti tekstiilitööstus pöördub Šveitsi suunas / Mikk Salu

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2005-01-01

    Autor toob näiteid, kuidas Šveitsi tekstiilitööstusettevõtted on suutnud konkurentsis püsima jääda, ning võrdleb Šveitsi tekstiili- ja rõivatööstuse kogueksporti Eesti omaga. Euroopas ja USA-s on tekstiili- ja rõivatööstuses probleem suur tööjõukulu, Euroopa Komisjon otsib võimalusi rakendada Hiina importtoodangu suhtes kaitsemeetmeid. Lisad: Õmblusmasina küsimus; Võitjad ja kaotajad. Diagramm: Tekstiili- ja rõivatoodang 2004

  12. Lapiku maailma haprus / Joseph S. Nye ; tõlk. Liis Auväärt

    Index Scriptorium Estoniae

    Nye, Joseph S.

    2006-01-01

    Ilmunud ka: Molodjozh Estonii 28. aug. lk. 6-7. Käsitledes globaliseerumist ja Thomas Friedmani lapiku maa metafoori, ütleb autor, et ka 1914. oli maailmamajandus äärmiselt integreeritud, kuid vastastikune majanduslik sõltuvus vähenes järgmise 30 aasta jooksul, muutudes ühtseks alles 70-ndatel. Mõnede arvates mängib Hiina tänapäeval sama rolli, mida mängis Saksamaa XX sajandil. Oht lapikule maale tuleb mitteriiklikelt jõududelt

  13. A comparative analysis of spatial Prisoner's Dilemma experiments: Conditional cooperation and payoff irrelevance

    Science.gov (United States)

    Grujić, Jelena; Gracia-Lázaro, Carlos; Milinski, Manfred; Semmann, Dirk; Traulsen, Arne; Cuesta, José A.; Moreno, Yamir; Sánchez, Angel

    2014-04-01

    We have carried out a comparative analysis of data collected in three experiments on Prisoner's Dilemmas on lattices available in the literature. We focus on the different ways in which the behavior of human subjects can be interpreted, in order to empirically narrow down the possibilities for behavioral rules. Among the proposed update dynamics, we find that the experiments do not provide significant evidence for non-innovative game dynamics such as imitate-the-best or pairwise comparison rules, whereas moody conditional cooperation is supported by the data from all three experiments. This conclusion questions the applicability of many theoretical models that have been proposed to understand human behavior in spatial Prisoner's Dilemmas. A rule compatible with all our experiments, moody conditional cooperation, suggests that there is no detectable influence of interaction networks on the emergence of cooperation in behavioral experiments.

  14. Root systems from Toric Calabi-Yau Geometry. Towards new algebraic structures and symmetries in physics?

    CERN Document Server

    Torrente-Lujan, E

    2004-01-01

    The algebraic approach to the construction of the reflexive polyhedra that yield Calabi-Yau spaces in three or more complex dimensions with K3 fibres reveals graphs that include and generalize the Dynkin diagrams associated with gauge symmetries. In this work we continue to study the structure of graphs obtained from $CY_3$ reflexive polyhedra. We show how some particularly defined integral matrices can be assigned to these diagrams. This family of matrices and its associated graphs may be obtained by relaxing the restrictions on the individual entries of the generalized Cartan matrices associated with the Dynkin diagrams that characterize Cartan-Lie and affine Kac-Moody algebras. These graphs keep however the affine structure, as it was in Kac-Moody Dynkin diagrams. We presented a possible root structure for some simple cases. We conjecture that these generalized graphs and associated link matrices may characterize generalizations of these algebras.

  15. Evaluation des pratiques de gestion des adventices en riziculture

    African Journals Online (AJOL)

    to evaluate different management techniques of weeds on irrigated rice in from Daloa, Central-West of Côte d'Ivoire. To do a control plot and 3 ...... 2009, Garoua (Cameroun), 10 p. Gogoi A.K., Upadhyay U.C. and Roy A.K. 1995. Status of weed management in wet seeded rice in Assam, India. In K. Moody (Ed.) Constraints ...

  16. A MODEL OF RATING FOR BANKS IN ROMANIA

    Directory of Open Access Journals (Sweden)

    POPA ANAMARIA

    2012-07-01

    Full Text Available Abstract.In the paper the authors present a model of rating for the banking system. Thus we took into account the records of 11 banks in Romania, based on annual financial reports. The model classified the banks in seven categories according with notes used by Standard Poor’s and Moody’s rating Agencies.

  17. Extended nonabelian symmetries for free fermionic model

    International Nuclear Information System (INIS)

    Zaikov, R.P.

    1993-08-01

    The higher spin symmetry for both Dirac and Majorana massless free fermionic field models are considered. An infinite Lie algebra which is a linear realization of the higher spin extension of the cross products of the Virasoro and affine Kac-Moody algebras is obtained. The corresponding current algebra is closed which is not the case of analogous current algebra in the WZNW model. The gauging procedure for the higher spin symmetry is also given. (author). 12 refs

  18. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    C46, 1939 (1992). [31] M Balasubramaniam and R K Gupta, Phys. Rev. C60, 064316 (1999). [32] D N Basu, Phys. Rev. C66, 027601 (2002). [33] P Moller, J R Nix, W D Myers and W Swiatecki, At. Data Nucl. Data Tables 59, 185. (1995). [34] S Wang, D Snowden-Ifft, P B Price, K J Moody and E K Hulet, Phys Rev. C39, 1647.

  19. The algebra of non-local charges in non-linear sigma models

    International Nuclear Information System (INIS)

    Abdalla, E.; Abdalla, M.C.B.; Brunelli, J.C.; Zadra, A.

    1994-01-01

    It is derived the complete Dirac algebra satisfied by non-local charges conserved in non-linear sigma models. Some examples of calculation are given for the O(N) symmetry group. The resulting algebra corresponds to a saturated cubic deformation (with only maximum order terms) of the Kac-Moody algebra. The results are generalized for when a Wess-Zumino term be present. In that case the algebra contains a minor order correction (sub-saturation). (author). 1 ref

  20. [Experimental and theoretical high energy physics program]. [Purdue Univ. , West Lafayette, Indiana

    Energy Technology Data Exchange (ETDEWEB)

    Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.

    1993-04-01

    Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac[endash]Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e[sup +]e[sup [minus

  1. New phases of D≥2 current and diffeomorphism algebras in particle physics

    International Nuclear Information System (INIS)

    Tze, Chia-Hsiung.

    1990-09-01

    We survey some global results and open issues of current algebras and their canonical field theoretical realization in D ≥ 2 dimensional spacetime. We assess the status of the representation theory of their generalized Kac-Moody and diffeomorphism algebras. Particular emphasis is put on higher dimensional analogs of fermi-bose correspondence, complex analyticity and the phase entanglements of anyonic solitons with exotic spin and statistics. 101 refs

  2. Stability of 244−260Fm isotopes against alpha and cluster radioactivity

    Indian Academy of Sciences (India)

    Theor. Phys. 113, 305 (2005). [46] G Royer, J. Phys. G: Nucl. Part. Phys. 26, 1149 (2000). [47] R K Gupta and W Greiner, Int. J. Mod. Phys. E3, 335 (1994). [48] P Moller, J R Nix, W D Myers and W J Swiatecki, At. Data Nucl. Data Tables 59,. 185 (1995). [49] S Wang, D Snowden-Ifft, P B Price, K J Moody and E K Hulet, Phys.

  3. On the BRST charge over infinite-dimensional algebras

    International Nuclear Information System (INIS)

    Hlousek, Zvonimir.

    1988-01-01

    The author studies the BRST charge defined over an infinite algebra of gauged local symmetries. This is of great importance to string theories. The BRST charge of the gauge symmetry must be nilpotent. In string theories this implies the cancellation of conformal anomalies in critical dimension; 26 for bosonic string, 10 for superstring, and 2 for O(2) string. Furthermore, the O(2) symmetry of the O(2) string (a string theory with two, two-dimensional supersymmetries) is realized as a Kac-Moody symmetry. In general, the BRST quantization of the local, gauged KAC-Moody symmetry requires special care due to chiral anomaly. The chiral anomaly breaks the chiral gauge invariance, and the corresponding BRST charge is not nilpotent. To arrive at the nilpotent BRST charge for the gauged Kac-Moody symmetry, one has to modify the theory by adding a one-cocycle over the gauge group. A similar problem and its solution exist in the case of supersymmetric Kac-Moody algebras. The BRST charge of the first quantized string theory is a building block of the covariant string field theory. The BRST invariance of the first quantized theory generalizes to gauge invariance of string field theory. In Witten's open string field theory the BRST charge plays a role of exterior derivation on the space of string field functionals. The Fock space realization of the theory was given by Gross and Jevicki. For the consistency of the theory it is crucial that all the vertex operators are BRST invariant. The ghost part of the vertex comes in few varieties. The author has shown that all the versions of the ghost vertex are equivalent, as long as the total vertex is BRST invariant

  4. Department of Defense Facilities Sustainment, Restoration, & Modernization Program Plan

    Science.gov (United States)

    2009-05-15

    742 Montgomery JFHQ AFRC/Combined Support Maintenance Shop 01 AL Replace Comm Fiber /Copper Cable $750 U 0108049 Mar-09 May-09 Jun-09 Jul-09 Apr-10...Seals and Heating Controls $211 E QSEU080121 N/A N/A Apr-09 May-09 Nov-09 568 Moody AFB GA Repair Roof Linen Exchange, B319 $211 R QSEU080226 Apr-09

  5. New examples of continuum graded Lie algebras

    International Nuclear Information System (INIS)

    Savel'ev, M.V.

    1989-01-01

    Several new examples of continuum graded Lie algebras which provide an additional elucidation of these algebras are given. Here, in particular, the Kac-Moody algebras, the algebra S 0 Diff T 2 of infinitesimal area-preserving diffeomorphisms of the torus T 2 , the Fairlie, Fletcher and Zachos sine-algebras, etc., are described as special cases of the cross product Lie algebras. 8 refs

  6. A Yang--Mills Theory in Loop Space and Chapline--Manton Coupling

    OpenAIRE

    Deguchi, Shinichi; Nakajima, Tadahito

    1996-01-01

    We consider a Yang--Mills theory in loop space whose gauge group is a Kac--Moody group with the central extension. From this theory, we derive a local field theory constructed of Yang--Mills fields and abelian antisymmetric and symmetric tensor fields of the second rank. The Chapline--Manton coupling, that is, coupling of Yang--Mills fields and a second-rank antisymmetric tensor field via the Chern--Simons 3-form is obtained in a systematic manner.

  7. Genus-two characters of the Ising model

    International Nuclear Information System (INIS)

    Choi, J.H.; Koh, I.G.

    1989-01-01

    As a first step in studying conformal theories on a higher-genus Riemann surface, we construct genus-two characters of the Ising model from their behavior in zero- and nonzero-homology pinching limits, the Goddard-Kent-Oliveco set-space construction, and the branching coefficients in the level-two A 1 /sup (1)/ Kac-Moody characters on the higher-genus Riemann surface

  8. Lasing and Longitudinal Cavity Modes in Photo-Pumped Deep Ultraviolet AlGaN Heterostructures

    Science.gov (United States)

    2013-04-29

    NC 27709-2211 15. SUBJECT TERMS AlGaN lasers, optical pumping, longitudinal cavity modes Jinqiao Xie, Seiji Mita , Zachary Bryan, Wei Guo, Lindsay...Lasing and longitudinal cavity modes in photo-pumped deep ultraviolet AlGaN heterostructures Jinqiao Xie,1,a) Seiji Mita ,1 Zachary Bryan,2 Wei Guo,2...Dalmau, B. Moody, R. Schlesser, S. Mita , M. Feneberg, B. Neuschl, K. Thonke, R. Collazo, A. Rice, J. Tweedie, and Z. Sitar, J. Electrochem. Soc. 158

  9. Blow.MOD2: a program for blowdown transient calculations

    International Nuclear Information System (INIS)

    Doval, A.

    1990-01-01

    The BLOW.MOD2 program has been developed to calculate the blowdown phase in a pressurized vessel after a break/valve is opened. It is a one volume model where break height and flow area are specified. Moody critical flow model was adopted under saturation conditions for flow calculation through the break. Heat transfer from structures and internals have been taken into account. Long term depressurization results and a more complex model are compared satisfactorily. (Author)

  10. Types of two-dimensional N = 4 superconformal field theories

    Indian Academy of Sciences (India)

    Abstract. Various types of N = 4 superconformal symmetries in two dimensions are considered. It is proposed that apart from the well-known cases of SU(2) and SU(2)¢SU(2)¢U(1), their Kac–. Moody symmetry can also be SU(2) ¢(U(1))4. Operator product expansions for the last case are derived. A complete free field ...

  11. The Role of Oxygen Radicals in Biology and Medicine 7-11 February 1983, Ventura, California,

    Science.gov (United States)

    1983-02-11

    thiolate catalytic site of the correspon- ding isomerases . Measurement of and antioxidant protection from in vivo lipid peroxidation. Al Tappel Measurements...Hassan and Carmella S. Moody. Departments Of Food Science and Micro- .. biology, North Carolina State University, Raleigh, NC 27650. Paraquat augmented...Na and glucose - 6-P (G6P) as markers lyse when exposed to the xanthine/xanthine oxidase/iron system. In the absence of EDTA, marker release

  12. Sleep Habits of Elementary and Middle School Children in South Texas

    OpenAIRE

    Surani, Salim; Hesselbacher, Sean; Surani, Saherish; Sadasiva, Sreevidya; Surani, Zoya; Surani, Sara S.; Khimani, Amina; Subramanian, Shyam

    2015-01-01

    Background. Sleep difficulties, including insufficient sleep and inadequate sleep hygiene, have been prevalent among children. Sleep deprivation can lead to poor grades, sleepiness, and moodiness. We undertook this study to assess the prevalence of sleep abnormalities among elementary and middle school students in South Texas and how the groups compare with one another. Method. After approval from the appropriate school district for a sleep education program, a baseline survey was taken of el...

  13. The Application of Dividend Yield Based Investment Strategy in Indonesian Stock Exchange

    OpenAIRE

    Ekaputra, Adriansyah; Sukarno, Subiakto

    2012-01-01

    Stock market development in Indonesia is growing rapidly, coupled with the increase of Indonesia's investment rating by investment research and rating companies such as Moody's and S&P, it makes Indonesian stock market look sexy in the eyes of investors from various countries. The investment strategy that simple and applicable is often sought by investors to maximize the investors' portfolio. One investment strategy is evolving but still not widely used in Indonesia is an investment strat...

  14. Discussion of CoSA: Clustering of Sparse Approximations

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, Derek Elswick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-07

    The purpose of this talk is to discuss the possible applications of CoSA (Clustering of Sparse Approximations) to the exploitation of HSI (HyperSpectral Imagery) data. CoSA is presented by Moody et al. in the Journal of Applied Remote Sensing (“Land cover classification in multispectral imagery using clustering of sparse approximations over learned feature dictionaries”, Vol. 8, 2014) and is based on machine learning techniques.

  15. New phases of D ge 2 current and diffeomorphism algebras in particle physics

    Energy Technology Data Exchange (ETDEWEB)

    Tze, Chia-Hsiung.

    1990-09-01

    We survey some global results and open issues of current algebras and their canonical field theoretical realization in D {ge} 2 dimensional spacetime. We assess the status of the representation theory of their generalized Kac-Moody and diffeomorphism algebras. Particular emphasis is put on higher dimensional analogs of fermi-bose correspondence, complex analyticity and the phase entanglements of anyonic solitons with exotic spin and statistics. 101 refs.

  16. Bosonization methods in string theory

    International Nuclear Information System (INIS)

    Abdalla, E.

    1988-02-01

    The use of bosonization/fermionization techniques to convert non-linear operators of the dual, is discussed. Non abelian bosonization to the case where the central charge of the Kac-Moody algebra is not unity, is generalized. In particular, using this generalization of non-abelian bosonization, the bosonic string vertex of the compactified theory; turns out to be fundamental field of thre fermionic theory, or bound states of it thus permiting explicit computations easily. (author) [pt

  17. Next Steps in Syria

    Science.gov (United States)

    2014-01-01

    as the civil war in Syria expands, with al-Qaeda in Mesopotamia and militia elements loyal to Iran, Muqtada al- Sadr, or Sunni tribal leaders now...and weapons crossing into Syria and Syria launching retaliatory attacks on their sites in Lebanon. Al‑Qaeda in Mesopotamia was once encouraged by...al-Assad is described as moody, unpredictable, irrational, and Janus-faced. One scholar stated, Al–Qaeda in Mesopotamia was once encouraged by

  18. E10 Orbifolds

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Jeffrey; Ganguli, Surya; Ganor, Ori J.; Helfgott, Craig

    2005-04-28

    We study Z2 orbifolds of M-theory in terms of E10. We find a simple relation between the Z2 action on E10 and the imaginary root that corresponds [hep-th/0401053]to the"twisted sector" branes. We discuss the connection between the Kac-Moody algebra DE10 and the"untwisted" sector, and we demonstrate how DE18 can describe both the untwisted and twisted sectors simultaneously.

  19. Monoidal Supercategories

    Science.gov (United States)

    Brundan, Jonathan; Ellis, Alexander P.

    2017-05-01

    This work is a companion to our article "Super Kac-Moody 2-categories," which introduces super analogs of the Kac-Moody 2-categories of Khovanov-Lauda and Rouquier. In the case of sl_2, the super Kac-Moody 2-category was constructed already in [A. Ellis and A. Lauda, "An odd categorification of {U_q(sl_2)"], but we found that the formalism adopted there became too cumbersome in the general case. Instead, it is better to work with 2-supercategories (roughly, 2-categories enriched in vector superspaces). Then the Ellis-Lauda 2-category, which we call here a Π- 2-category (roughly, a 2-category equipped with a distinguished involution in its Drinfeld center), can be recovered by taking the superadditive envelope then passing to the underlying 2-category. The main goal of this article is to develop this language and the related formal constructions in the hope that these foundations may prove useful in other contexts.

  20. Affine field theories

    International Nuclear Information System (INIS)

    Cadavid, A.C.

    1989-01-01

    The author constructs a non-Abelian field theory by gauging a Kac-Moody algebra, obtaining an infinite tower of interacting vector fields and associated ghosts, that obey slightly modified Feynman rules. She discusses the spontaneous symmetry breaking of such theory via the Higgs mechanism. If the Higgs particle lies in the Cartan subalgebra of the Kac-Moody algebra, the previously massless vectors acquire a mass spectrum that is linear in the Kac-Moody index and has additional fine structure depending on the associated Lie algebra. She proceeds to show that there is no obstacle in implementing the affine extension of supersymmetric Yang-Mills theories. The result is valid in four, six and ten space-time dimensions. Then the affine extension of supergravity is investigated. She discusses only the loop algebra since the affine extension of the super-Poincare algebra appears inconsistent. The construction of the affine supergravity theory is carried out by the group manifold method and leads to an action describing infinite towers of spin 2 and spin 3/2 fields that interact subject to the symmetries of the loop algebra. The equations of motion satisfy the usual consistency check. Finally, she postulates a theory in which both the vector and scalar fields lie in the loop algebra of SO(3). This theory has an expanded soliton sector, and corresponding to the original 't Hooft-Polyakov solitonic solutions she now finds an infinite family of exact, special solutions of the new equations. She also proposes a perturbation method for obtaining an arbitrary solution of those equations for each level of the affine index

  1. Two career couple

    Science.gov (United States)

    Sancetta, Constance

    1984-04-01

    Over 150 members of AGU attended a panel session on “The Two Career Couple: Balancing Personal and Professional Life” at the 1983 AGU Fall Meeting in San Francisco. The panel was sponsored by the Education and Human Resources Committee and was chaired by Constance Sancetta. On the panel were Alice Newman, of The Aerospace Corporation; Mark Zoback and Mary Lou Zoback of U.S. Geological Survey, Menlo Park; and Judith Moody of ONWI-Battelle and her husband, Thomas Worsley of Ohio University. The audience included many students but was composed primarily of professionals 30-40, with men and women equally represented.

  2. The Emergence of Fermions and the E11 Content

    Science.gov (United States)

    Englert, François; Houart, Laurent

    Claudio's warm and endearing personality adds to our admiration for his achievements in physics a sense of friendliness. His constant interest in fundamental questions motivated the following presentation of our attempt to understand the nature of fermions. This problem is an essential element of the quantum world and might be related to the quest for quantum gravity. We shall review how space-time fermions can emerge out of bosons in string theory and how this fact affects the extended Kac-Moody approach to the M-theory project.

  3. Risco de crédito : propostas de medidas de inadimplencia para o mercado brasileiro

    OpenAIRE

    Cia, Josilmar Cordenonssi

    2010-01-01

    O objetivo desta dissertação é apresentar propostas de medidas de inadimplência para o mercado de crédito brasileiro. Estas medidas foram desenvolvidas levando em consideração as várias formas de registro da inadimplência, tais como título protestado, cheque devolvido por falta de fundo, pedido de falência, concordata, etc. Para tanto foram aplicados os conceitos fundamentais de metodologias de taxa de inadimplência, especialmente a da Moody¿s e do Prof. Edward Altman. A partir da implementaç...

  4. S{sup 7} and S{sup 7}

    Energy Technology Data Exchange (ETDEWEB)

    Cederwall, M. [Chalmers Univ. of Tech., Goeteborg (Sweden). Inst. of Theoretical Physics; Preitschopf, C.R. [Chalmers Univ. of Tech., Goeteborg (Sweden). Inst. of Theoretical Physics

    1995-02-01

    We investigate the seven-sphere as a group-like manifold and its extension to a Kac-Moody-like algebra. Covariance properties and tensorial composition of spinors under S{sup 7} are defined. The relation to Malcev algebras is established. The consequences for octonionic projective spaces are examined. Current algebras are formulated and their anomalies are derived, and shown to be unique (even regarding numerical coefficients) up to redefinitions of the currents. Nilpotency of the BRST operator is consistent with one particular expression in the class of (field-dependent) anomalies. A Sugawara construction is given. (orig.)

  5. A geometrical interpretation for the symmetries of the free Green-Schwarz heterotic superstring

    Energy Technology Data Exchange (ETDEWEB)

    Berkovits, N. (Rutgers - the State Univ., Piscataway, NJ (USA). Dept. of Physics)

    1990-05-24

    By using twistor-like fields similar to those of Sorokin, Tkach, Volkov and Zheltukin, it is shown that the local symmetry transformations of the free covariant spacetime-supersymmetric Green-Schwarz heterotic superstring can be interpreted geometrically as superconformal reparameterizations of an N=(8,0) superworldsheet. The structure constants of the resulting N=(8,0) super-Virasoro algebra are field-dependent, and for certain values of the fields, the symmetry transformations form a superversion of the non-associative Kac-Moody-Malcev algebra recently studied by Osipov. (orig.).

  6. S 7 and Š 7

    Science.gov (United States)

    Cederwall, Martin; Preitschopf, Christian R.

    1995-02-01

    We investigate the seven-sphere as a group-like manifold and its extension to a Kac-Moody-like algebra. Covariance properties and tensorial composition of spinors under S 7 are defined. The relation to Malcev algebras is established. The consequences for octonionic projective spaces are examined. Current algebras are formulated and their anomalies are derived, and shown to be unique (even regarding numerical coefficients) up to redefinitions of the currents. Nilpotency of the BRST operator is consistent with one particular expression in the class of (field-dependent) anomalies. A Sugawara construction is given.

  7. A geometrical interpretation for the symmetries of the free Green-Schwarz heterotic superstring

    Science.gov (United States)

    Berkovits, Nathan

    1990-05-01

    By using twistor-like fields similar to those of Sorokin, Tkach, Volkov and Zheltukin, it is shown that the local symmetry transformations of the free covariant spacetime-supersymmetric Green-Schwarz heterotic superstring can be interpreted geometrically as superconformal reparameterizations of an N = (8, 0) superworldsheet. The structure constants of the resulting N = (8, 0) super-Virasoro algebra are field-dependent, and for certain values of the fields, the symmetry transformations form a superversion of the non-associative Kac-Moody-Malcev algebra recently studied by Osipov.

  8. Maxwell-Chern-Simons theory with a boundary

    Energy Technology Data Exchange (ETDEWEB)

    Blasi, A; Maggiore, N; Magnoli, N [Dipartimento di Fisica, Universita di Genova-via Dodecaneso 33, I-16146 Genova (Italy); Storace, S, E-mail: alberto.blasi@ge.infn.g, E-mail: nicola.maggiore@ge.infn.i, E-mail: nicodemo.magnoli@ge.infn.i, E-mail: stefano.storace@nyu.ed [Department of Physics, New York University, 4 Washington Place, New York, NY 10003 (United States)

    2010-08-21

    The Maxwell-Chern-Simons (MCS) theory with a planar boundary is considered. The boundary is introduced according to Symanzik's basic principles of locality and separability. A method of investigation is proposed, which, avoiding the straight computation of correlators, is appealing for situations where the computation of propagators, modified by the boundary, becomes quite complex. For the MCS theory, the outcome is that a unique solution exists, in the form of chiral conserved currents, satisfying a Kac-Moody algebra, whose central charge does not depend on the Maxwell term.

  9. Supergauge Field Theory of Covariant Heterotic Strings

    OpenAIRE

    Michio, KAKU; Physics Department, Osaka University : Physics Department, City College of the City University of New York

    1986-01-01

    We present the gauge covariant second quantized field theory for free heterotic strings, which is leading candidate for a unified theory of all known particles. Our action is invariant under the semi-direct product of the super Virasoro and the Kac-Moody E_8×E_8 or Spin(32)/Z_2 group. We derive the covariant action by path integrals in the same way that Feynman originally derived the Schrodinger equation. By adding an infinite number of auxiliary fields, we can also make the action explicitly...

  10. [Experimental and theoretical high energy physics program

    Energy Technology Data Exchange (ETDEWEB)

    Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.

    1993-04-01

    Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac{endash}Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e{sup +}e{sup {minus}} collisions at CERN; {bar p}{endash}p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab. (RWR)

  11. The infinite-dimensional gauge structure of Kaluza-Klein theories I: D=1+4

    International Nuclear Information System (INIS)

    Aulakh, C.S.; Sahdev, D.

    1985-08-01

    We show that the untruncated four-dimensional theory obtained by reducing the (D=5) Einstein action, is a gauge theory of the Virasoro and the Kac-Moody extended Lorentz algebras (deltasub(theta)+SO(1,3)xS 1 (theta)). We write the effective four-dimensional action in closed form and show how its four-dimensional symmetries guarantee its consistency as a system of interacting spin-2 particles which are massless for the unbroken theory and massive for the spontaneously broken one. Finally, we discuss how the Kaluza-Klein prescription circumvents the problems encountered in previous attempts to obtain consistent spin-2-gravity couplings. (author)

  12. Non-Abelian monopole in the parameter space of point-like interactions

    International Nuclear Information System (INIS)

    Ohya, Satoshi

    2014-01-01

    We study non-Abelian geometric phase in N=2 supersymmetric quantum mechanics for a free particle on a circle with two point-like interactions at antipodal points. We show that non-Abelian Berry’s connection is that of SU(2) magnetic monopole discovered by Moody, Shapere and Wilczek in the context of adiabatic decoupling limit of diatomic molecule. - Highlights: • Supersymmetric quantum mechanics is an ideal playground for studying geometric phase. • We determine the parameter space of supersymmetric point-like interactions. • Berry’s connection is given by a Wu–Yang-like magnetic monopole in SU(2) Yang–Mills

  13. Conformal theories, integrable models and coadjoint orbits

    International Nuclear Information System (INIS)

    Aratyn, H.; Ferreira, L.A.; Gomes, J.F.; Zimerman, A.H.

    1991-01-01

    We discuss the Kirillov-Kostant method of coadjoint orbits and its applications to the construction of actions invariant under the infinite dimensional Lie groups. The use of these techniques to the study of integrable models is discussed, with the case of the Toda field theories receiving a special attention. As an illustration we derive, using these methods, a geometric WZWN action based on the extended two-loop Kac-Moody algebra. We show that under a Hamiltonian reduction procedure, which respects conformal invariance, we obtain a hierarchy of Toda type field theories, which contain as submodels the Toda Molecule and periodic Toda Lattice theories. (author)

  14. Disciplining Disability under Danish Active Labour Market Policy

    DEFF Research Database (Denmark)

    Møller, Marie Østergaard; Stone, Deborah

    2013-01-01

    This article explores how caseworkers are re-constructing disability in the Danish welfare system and disciplining themselves and clients according to the active labour policy paradigm. Combining Foucault’s ideas about discipline with Maynard-Moody and Musheno’s method of interpreting street...... administer social welfare and sick leave benefits based on disability as the primary eligibility criterion. We selected stories told by caseworkers that exemplify archetypes of good and bad citizens, good and bad clients, and good and bad caseworkers. Through interpretative analysis, we elucidate how...

  15. Supersymmetric Yang-Mills fields as an integrable system and connections with other non-linear systems

    International Nuclear Information System (INIS)

    Chau, L.L.

    1983-01-01

    Integrable properties, i.e., existence of linear systems, infinite number of conservation laws, Reimann-Hilbert transforms, affine Lie algebra of Kac-Moody, and Bianchi-Baecklund transformation, are discussed for the constraint equations of the supersymmetric Yang-Mills fields. For N greater than or equal to 3 these constraint equations give equations of motion of the fields. These equations of motion reduce to the ordinary Yang-Mills equations as the spinor and scalar fields are eliminated. These understandings provide a possible method to solve the full Yang-Mills equations. Connections with other non-linear systems are also discussed. 53 references

  16. Neljatunnine teatrietendus Haimres / Kaupo Suuster, Tõnis Blank

    Index Scriptorium Estoniae

    Suuster, Kaupo

    2008-01-01

    Raplamaa harrastusteatrite festivalil Haimre kultuurimajas nähtud etendustest. Hageri näitering : A. Kivirähk "Atendaat", Valgu näitetrupp M.O.T.T. : A. Kitzbergi ainetel "Kosjasõit Valgu moodi", Kivi-Vigala näitering Sõbra-vägi : A. Liives "Need kauged ajad", Kodila näitetrupp : E. Bornhöhe "Tasuja", Rapla Teatritegemise Selts : "Lastejutt inetutele", Vana-Vigala näitetrupp Topelt-Kiiks : A. Kivirähk "Kalevipoeg", Kuimetsa näitetrupp : J. Orgussaar "Suured vaimud", Varbola näitetrupp V90 : "Eesti läbi aja"

  17. On the toroidal compactifications of bosonic strings in higher genus

    International Nuclear Information System (INIS)

    Semikhatov, A.M.

    1989-01-01

    For the bosonic string in a higher genus, compactified on the maximal torus of a simply laced Lie group, we discuss a possibility to construct an operator formalism involving only those operators that are well-defined globally over the whole Riemann surface. We find, in particular, higher genus extensions of (some combinations of) the vertex operators for the Kac-Moody algebra. This allows us to derive the relation between the Sugawara and Virasoro constructions of the energy-momentum tensor on Riemann surfaces, and to propose an operator mechanism underlying the construction of group current correlation functions in higher genus. (orig.)

  18. The relationship between sleep quality and fibromyalgia symptoms.

    Science.gov (United States)

    Andrade, Alexandro; Vilarino, Guilherme Torres; Sieczkowska, Sofia Mendes; Coimbra, Danilo Reis; Bevilacqua, Guilherme Guimarães; Steffens, Ricardo de Azevedo Klumb

    2018-01-01

    This study investigated the relationship between sleep quality and fibromyalgia symptoms in 326 patients. The Pittsburgh Sleep Quality Index was used to assess the presence of sleep disorders. Multivariate analysis of variance was performed to determine the influence of fibromyalgia symptoms on sleep quality. The prevalence of sleep disorders was 92.9 percent. Patients reported generalized pain (88.3%), memory failure (78.5%), moodiness (59%), excessive anxiety (77.5%), and concentration difficulties (69.1%). Patients with more symptoms reported poor sleep quality ( p Sleep Quality Index score correlated with the number of symptoms ( p Sleep quality has an important association with fibromyalgia symptoms.

  19. Full Symmetry Groups and Similar Reductions of a (2+1)-Dimensional Resonant Davey—Stewartson System

    Science.gov (United States)

    Hu, Xiao-Rui; Chen, Yong; Qian, Long-Jiang

    2011-05-01

    Applying the classical Lie symmetry method to the (2+1)-dimensional resonant Davey—Stewartson system introduced by Tang [X.Y. Tang et al., Chaos, Solitons and Fractals 42 (2007) 2707], a more general infinite dimensional Lie symmetry with Kac-Moody-Virasoro type Lie algebra is obtained, which involves four arbitrary functions of t. Alternatively, by a simple direct method, the full symmetry groups including Lie symmetry group and non-Lie symmetry group are gained straightly. In this way, the related Lie algebra can be easily found by a more simple limiting procedure. Lastly, via solving the characteristic equations, three types of the general similar reductions are derived.

  20. On Kaup-Kupershchmidt-type equations and their soliton solutions

    Science.gov (United States)

    Gerdjikov, V. S.

    2016-09-01

    We start with the Lax representation for the Kaup-Kupersschmidt equation (KKE). We outline the deep relation between the scalar Lax operator and the matrix Lax operators related to Kac-Moody algebras. Then we derive the MKdV equations gauge equivalent to the KKE. Next we outline the symmetry and the spectral properties of the relevant Lax operator. Using the dressing Zakharov-Shabat method we demonstrate that the MKdV and KKE have two types of one-soliton solutions and briefly comment on their properties.

  1. Current algebra of WZNW models at and away from criticality

    International Nuclear Information System (INIS)

    Abdalla, E.; Forger, M.

    1992-01-01

    In this paper, the authors derive the current algebra of principal chiral models with a Wess-Zumino term. At the critical coupling where the model becomes conformally invariant (Wess-Zumino-Novikov-Witten theory), this algebra reduces to two commuting Kac-Moody algebras, while in the limit where the coupling constant is taken to zero (ordinary chiral model), we recover the current algebra of that model. In this way, the latter is explicitly realized as a deformation of the former, with the coupling constant as the deformation parameter

  2. [Experimental and theoretical high energy physics program

    International Nuclear Information System (INIS)

    Finley, J.; Gaidos, J.A.; Loeffler, F.J.; McIlwain, R.L.; Miller, D.H.; Palfrey, T.R.; Shibata, E.I.; Shipsey, I.P.

    1993-04-01

    Experimental and theoretical high-energy physics research at Purdue is summarized in a number of reports. Subjects treated include the following: the CLEO experiment for the study of heavy flavor physics; gas microstrip detectors; particle astrophysics; affine Kac endash Moody algebra; nonperturbative mass bounds on scalar and fermion systems due to triviality and vacuum stability constraints; resonance neutrino oscillations; e + e - collisions at CERN; bar p endash p collisions at FNAL; accelerator physics at Fermilab; development work for the SDC detector at SSC; TOPAZ; D-zero physics; physics beyond the standard model; and the Collider Detector at Fermilab

  3. Quantum Geometry and Quiver Gauge Theories

    Science.gov (United States)

    Nekrasov, Nikita; Pestun, Vasily; Shatashvili, Samson

    2018-01-01

    We study macroscopically two dimensional N}=(2,2)} supersymmetric gauge theories constructed by compactifying the quiver gauge theories with eight supercharges on a product T}d × R2_{ɛ of a d-dimensional torus and a two dimensional cigar with {Ω} -deformation. We compute the universal part of the effective twisted superpotential. In doing so we establish the correspondence between the gauge theories and the Yangian Y_{ɛ}(g_{Γ}), quantum affine algebra U^{aff_q(g_{Γ}), or the quantum elliptic algebra U^{ell}_{q,p}(g_{Γ}) associated to Kac-Moody algebra g_{Γ} for quiver Γ.

  4. Vabariigi aastapäevaks annab president 97 ordenit

    Index Scriptorium Estoniae

    2009-01-01

    President Toomas Hendrik Ilves kirjutas alla otsusele anda seoses iseseisvuspäevaga ja Eesti riigile osutatud teenete tunnustamiseks 97 Eesti Vabariigi kodanikule või välismaalasele riiklikud autasud. Teenetemärgi pälvinute nimekiri. Vt. samas: Ernits, Peeter. Kohupiim tõi Valgetähe. Nopri talumeierei peremees Tiit Niilo pälvis Valgetähe V klassi teenetemärgi; Viire Valdma: Olen õnnelik mitut moodi. Jüri Aarma intervjuu Eesti Draamateatri näitlejaga, kes pälvis Valgetähe IV klassi teenetemärgi

  5. Superfield realizations of N=2 super-W3

    International Nuclear Information System (INIS)

    Ivanov, E.; Krivonos, S.

    1992-04-01

    We present a manifestly N=2 supersymmetric formulation of N=2 super-W 3 algebra (its classical version) in terms of the spin 1 and spin 2 supercurrents. Two closely related types of the Feigin-Fuchs representation for these supercurrents are found: via two chiral spin 1/2 superfields generating N=2 extended U(1) Kac-Moody algebras and via two free chiral spin 0 superfields. We also construct a one-parameter family of N=2 super Boussinesq equations for which N=2 super-W 3 provides the second Hamiltonian structure. (author). 17 refs

  6. Canonical formulation of the self-dual Yang-Mills system: Algebras and hierarchies

    International Nuclear Information System (INIS)

    Chau, L.; Yamanaka, I.

    1992-01-01

    We construct a canonical formulation of the self-dual Yang-Mills system formulated in the gauge-invariant group-valued J fields and derive their Hamiltonian and the quadratic algebras of the fundamental Dirac brackets. We also show that the quadratic algebras satisfy Jacobi identities and their structure matrices satisfy modified Yang-Baxter equations. From these quadratic algebras, we construct Kac-Moody-like and Virasoro-like algebras. We also discuss their related symmetries, involutive conserved quantities, and hierarchies of nonlinear and linear equations

  7. Integrability properties of supersymmetric Yang-Mills fields and relations with other non-linear systems

    International Nuclear Information System (INIS)

    Chau, L.L.

    1984-01-01

    Integrable properties, i.e., existence of linear systems, infinite number of conservation laws, Riemann-Hilbert transforms, affine Lie algebra of Kac-Moody, and Bianchi-Backlund transformation, are discussed for the constraint equations of the supersymmetric Yang-Mills fields. For N ≥ 3 these constraint equations give equations of motion of the fields. These equations of motion reduce to the ordinary Yang-Mills equations as the spinor and scalar fields are eliminated. These understandings provide a possible method to solve the full Yang-Mills equations. Connections with other non-linear systems are also discussed

  8. The algebra of non-local charges in non-linear sigma models

    CERN Document Server

    Abdalla, Elcio; Brunelli, J C; Zadra, Ayrton

    1994-01-01

    We obtain the exact Dirac algebra obeyed by the conserved non-local charges in bosonic non-linear sigma models. Part of the computation is specialized for a symmetry group $O(N)$. As it turns out the algebra corresponds to a cubic deformation of the Kac-Moody algebra. The non-linear terms are computed in closed form. In each Dirac bracket we only find highest order terms (as explained in the paper), defining a saturated algebra. We generalize the results for the presence of a Wess-Zumino term. The algebra is very similar to the previous one, containing now a calculable correction of order one unit lower.

  9. Fricke Lie algebras and the genus zero property in Moonshine

    Science.gov (United States)

    Carnahan, Scott

    2017-10-01

    We give a new, simpler proof that the canonical actions of finite groups on Fricke-type Monstrous Lie algebras yield genus zero functions in generalized Monstrous Moonshine, using a Borcherds-Kac-Moody Lie algebra decomposition due to Jurisich. We describe a compatibility condition, arising from the no-ghost theorem in bosonic string theory, that yields the genus zero property. We give evidence for and against the conjecture that such a compatibility for symmetries of the Monster Lie algebra gives a characterization of the Monster group.

  10. Introduction to conformal field theory. With applications to string theory

    International Nuclear Information System (INIS)

    Blumenhagen, Ralph; Plauschinn, Erik

    2009-01-01

    Based on class-tested notes, this text offers an introduction to Conformal Field Theory with a special emphasis on computational techniques of relevance for String Theory. It introduces Conformal Field Theory at a basic level, Kac-Moody algebras, one-loop partition functions, Superconformal Field Theories, Gepner Models and Boundary Conformal Field Theory. Eventually, the concept of orientifold constructions is explained in detail for the example of the bosonic string. In providing many detailed CFT calculations, this book is ideal for students and scientists intending to become acquainted with CFT techniques relevant for string theory but also for students and non-specialists from related fields. (orig.)

  11. Volvo ja Ikea endine tegevjuht Göran Carstedt : Tänapäevane (personali)juhtimine peab sisaldama eeskätt looduslähedast mõtteviisi / Göran Carstedt ; interv. Tiina Saar

    Index Scriptorium Estoniae

    Carstedt, Göran

    2008-01-01

    Juhtimiskonsultant ning Organisatsioonilise Õppimise Ühingu eestvedaja ja arendaja Göran Carsedt vastab küsimustele, mis puudutavad ettevõtte tegevust personali tööle pühendumise parendamiseks, ettevõtte jätkusuutlikku juhtimist ja tootlikkust, majanduslanguse mõju ettevõtete personalipoliitikale, talendijuhtimist, väikeste ettevõttete ellujäämist majanduslanguse ajal, IKEA kui hea tööandja mainet ning jätkusuutlikku personaliarendajat. Lisa: Jätkusuutlik juhtimine Rootsi moodi

  12. Dependence of the Gauss-law constraints on the regularization scheme in non-Abelian chiral gauge theory

    International Nuclear Information System (INIS)

    Zhou, J.; Li, S.; Liu, Y.

    1993-01-01

    Mitra's regularization of the masslike term, which was originally discussed in an Abelian model, is used to calculate the anomaly in the commutator of the Gauss-law operators for anomalous d=2 non-Abelian chiral theory. The Schwinger term in the commutator of the different Gauss-law operator is shifted, because of regularization ambiguities, to the commutator of the Gauss-law operators with themselves. The Poisson brackets of the Gauss-law constraints correspond to the Kac-Moody algebra, and the Gauss-law constraints are similar to the chiral constraints. In a sense, this kind of Gauss-law constraint structure differs from what Faddeev suggested

  13. Workshop on Lie Algebras

    CERN Document Server

    Osborn, J

    1989-01-01

    During the academic year 1987-1988 the University of Wisconsin in Madison hosted a Special Year of Lie Algebras. A Workshop on Lie Algebras, of which these are the proceedings, inaugurated the special year. The principal focus of the year and of the workshop was the long-standing problem of classifying the simple finite-dimensional Lie algebras over algebraically closed field of prime characteristic. However, other lectures at the workshop dealt with the related areas of algebraic groups, representation theory, and Kac-Moody Lie algebras. Fourteen papers were presented and nine of these (eight research articles and one expository article) make up this volume.

  14. Curve fitting of the corporate recovery rates: the comparison of Beta distribution estimation and kernel density estimation.

    Directory of Open Access Journals (Sweden)

    Rongda Chen

    Full Text Available Recovery rate is essential to the estimation of the portfolio's loss and economic capital. Neglecting the randomness of the distribution of recovery rate may underestimate the risk. The study introduces two kinds of models of distribution, Beta distribution estimation and kernel density distribution estimation, to simulate the distribution of recovery rates of corporate loans and bonds. As is known, models based on Beta distribution are common in daily usage, such as CreditMetrics by J.P. Morgan, Portfolio Manager by KMV and Losscalc by Moody's. However, it has a fatal defect that it can't fit the bimodal or multimodal distributions such as recovery rates of corporate loans and bonds as Moody's new data show. In order to overcome this flaw, the kernel density estimation is introduced and we compare the simulation results by histogram, Beta distribution estimation and kernel density estimation to reach the conclusion that the Gaussian kernel density distribution really better imitates the distribution of the bimodal or multimodal data samples of corporate loans and bonds. Finally, a Chi-square test of the Gaussian kernel density estimation proves that it can fit the curve of recovery rates of loans and bonds. So using the kernel density distribution to precisely delineate the bimodal recovery rates of bonds is optimal in credit risk management.

  15. Curve fitting of the corporate recovery rates: the comparison of Beta distribution estimation and kernel density estimation.

    Science.gov (United States)

    Chen, Rongda; Wang, Ze

    2013-01-01

    Recovery rate is essential to the estimation of the portfolio's loss and economic capital. Neglecting the randomness of the distribution of recovery rate may underestimate the risk. The study introduces two kinds of models of distribution, Beta distribution estimation and kernel density distribution estimation, to simulate the distribution of recovery rates of corporate loans and bonds. As is known, models based on Beta distribution are common in daily usage, such as CreditMetrics by J.P. Morgan, Portfolio Manager by KMV and Losscalc by Moody's. However, it has a fatal defect that it can't fit the bimodal or multimodal distributions such as recovery rates of corporate loans and bonds as Moody's new data show. In order to overcome this flaw, the kernel density estimation is introduced and we compare the simulation results by histogram, Beta distribution estimation and kernel density estimation to reach the conclusion that the Gaussian kernel density distribution really better imitates the distribution of the bimodal or multimodal data samples of corporate loans and bonds. Finally, a Chi-square test of the Gaussian kernel density estimation proves that it can fit the curve of recovery rates of loans and bonds. So using the kernel density distribution to precisely delineate the bimodal recovery rates of bonds is optimal in credit risk management.

  16. Trans-Colonial Collaboration and Slave Narrative: Mary Prince Revisited

    Directory of Open Access Journals (Sweden)

    Michelle Gadpaille

    2011-10-01

    Full Text Available In 1831 in London, two formidable women met: Mary Prince, an ex-slave from Bermuda, who had crossed the Atlantic to a qualified freedom, and Susanna Strickland, an English writer. The narrative that emerged from this meeting was The History of Mary Prince, which played a role in the fight for slave emancipation in the British Empire. Prince disappeared once the battle was won, while Strickland emigrated to Upper Canada and, as Susanna Moodie, became an often quoted 19th century Canadian writer. Prince dictated, Strickland copied, and the whole was lightly edited by Thomas Pringle, the anti-slavery publisher at whose house the meeting took place. This is the standard account. In contesting this version, the paper aims to reinstate Moodie as co-creator of the collaborative Mary Prince text by considering multiple accounts of the meeting with Prince and to place the work in the context of Moodie’s pre- and post-emigration oeuvre on both sides of the Atlantic.

  17. Nitration of naphthalene and remarks on the mechanism of electrophilic aromatic nitration.

    Science.gov (United States)

    Olah, G A; Narang, S C; Olah, J A

    1981-06-01

    Naphthalene was nitrated with a variety of nitrating agents. Comparison of data with Perrin's electrochemical nitration [Perrin, C. L. (1977) J. Am. Chem. Soc. 99, 5516-5518] shows that nitration of naphthalene gives an alpha-nitronaphthalene to beta-nitronaphthalene ratio that varies between 9 and 29 and is thus not constant. Perrin's data, therefore, are considered to be inconclusive evidence for the proposed one-electron transfer mechanism for the nitration of naphthalene and other reactive aromatics. Moodie and Schoefield [Hoggett, J. G., Moodie, R. B., Penton, J. R. & Schoefield, K. (1971) Nitration and Aromatic Reactivity (Cambridge Univ. Press, London)], as well as Perrin, independently concluded that, in the general scheme of nitration of reactive aromatics, there is the necessity to introduce into the classical Ingold mechanism an additional step involving a distinct intermediate preceding the formation of the Wheland intermediate (sigma complexes). This view coincides with our two-step mechanistic picture [Kuhn, S. J. & Olah, G. A. (1961) J. Am. Chem. Soc. 83, 4564-4571] of the nitronium salt nitration of aromatic hydrocarbons (including benzene and toluene), in which low substrate selectivity but high positional selectivity was found, indicating the independence of substrate from positional selectivity.

  18. Nitration of naphthalene and remarks on the mechanism of electrophilic aromatic nitration*

    Science.gov (United States)

    Olah, George A.; Narang, Subhash C.; Olah, Judith A.

    1981-01-01

    Naphthalene was nitrated with a variety of nitrating agents. Comparison of data with Perrin's electrochemical nitration [Perrin, C. L. (1977) J. Am. Chem. Soc. 99, 5516-5518] shows that nitration of naphthalene gives an α-nitronaphthalene to β-nitronaphthalene ratio that varies between 9 and 29 and is thus not constant. Perrin's data, therefore, are considered to be inconclusive evidence for the proposed one-electron transfer mechanism for the nitration of naphthalene and other reactive aromatics. Moodie and Schoefield [Hoggett, J. G., Moodie, R. B., Penton, J. R. & Schoefield, K. (1971) Nitration and Aromatic Reactivity (Cambridge Univ. Press, London)], as well as Perrin, independently concluded that, in the general scheme of nitration of reactive aromatics, there is the necessity to introduce into the classical Ingold mechanism an additional step involving a distinct intermediate preceding the formation of the Wheland intermediate (σ complexes). This view coincides with our two-step mechanistic picture [Kuhn, S. J. & Olah, G. A. (1961) J. Am. Chem. Soc. 83, 4564-4571] of the nitronium salt nitration of aromatic hydrocarbons (including benzene and toluene), in which low substrate selectivity but high positional selectivity was found, indicating the independence of substrate from positional selectivity. PMID:16593026

  19. Dynamically Scaled Model Experiment of a Mooring Cable

    Directory of Open Access Journals (Sweden)

    Lars Bergdahl

    2016-01-01

    Full Text Available The dynamic response of mooring cables for marine structures is scale-dependent, and perfect dynamic similitude between full-scale prototypes and small-scale physical model tests is difficult to achieve. The best possible scaling is here sought by means of a specific set of dimensionless parameters, and the model accuracy is also evaluated by two alternative sets of dimensionless parameters. A special feature of the presented experiment is that a chain was scaled to have correct propagation celerity for longitudinal elastic waves, thus providing perfect geometrical and dynamic scaling in vacuum, which is unique. The scaling error due to incorrect Reynolds number seemed to be of minor importance. The 33 m experimental chain could then be considered a scaled 76 mm stud chain with the length 1240 m, i.e., at the length scale of 1:37.6. Due to the correct elastic scale, the physical model was able to reproduce the effect of snatch loads giving rise to tensional shock waves propagating along the cable. The results from the experiment were used to validate the newly developed cable-dynamics code, MooDy, which utilises a discontinuous Galerkin FEM formulation. The validation of MooDy proved to be successful for the presented experiments. The experimental data is made available here for validation of other numerical codes by publishing digitised time series of two of the experiments.

  20. Quiver representations and quiver varieties

    CERN Document Server

    Jr, Alexander Kirillov

    2016-01-01

    This book is an introduction to the theory of quiver representations and quiver varieties, starting with basic definitions and ending with Nakajima's work on quiver varieties and the geometric realization of Kac-Moody Lie algebras. The first part of the book is devoted to the classical theory of quivers of finite type. Here the exposition is mostly self-contained and all important proofs are presented in detail. The second part contains the more recent topics of quiver theory that are related to quivers of infinite type: Coxeter functor, tame and wild quivers, McKay correspondence, and representations of Euclidean quivers. In the third part, topics related to geometric aspects of quiver theory are discussed, such as quiver varieties, Hilbert schemes, and the geometric realization of Kac-Moody algebras. Here some of the more technical proofs are omitted; instead only the statements and some ideas of the proofs are given, and the reader is referred to original papers for details. The exposition in the book requ...