WorldWideScience

Sample records for empirisk studie av

  1. Hvor moralsk tenker fotballspillere? – en empirisk studie av toppfotball

    Directory of Open Access Journals (Sweden)

    Lars Tore Ødegård

    2015-11-01

    Full Text Available Det er en utbredt oppfatning at det økende prestasjonskravet i toppfotball fører til en svekkelse av moral og fair play-holdninger. Men hvordan tenker toppfotballspillere i forhold til ulike dilemmaer som oppstår på banen, og er det forskjeller mellom toppfotballspillere og spillere på lavere nivå?  For å avklare dette gjennomførte vi en empirisk undersøkelse der vi intervjuet spillere og trener i én toppklubb og én breddeklubb. Vi var interessert i to hovedproblemstillinger:  1 Hva tenker fotballspillere på ulike prestasjonsnivå om etikk og moralske dilemmaer i fotball? 2 Hvilke faktorer påvirker spillerne, direkte og indirekte, i deres vurderinger og handlinger? Resultatene fra undersøkelsen viser at det er store forskjeller mellom de to prestasjonsnivåene. Spillerne på breddenivået føler generelt et større ansvar for å opptre ærlig på banen enn hva som er tilfelle på toppnivået. Vi fant 4 spesifikke faktorer i toppfotballen som bidrar til umoralsk opptreden. For det første opplever spillerne en forventning om at de prioriterer resultat foran fair play. For det andre bidrar tilstedeværelsen av supportere på kamper til en slik prioritering. For det tredje vil handlinger som er i strid med fair play signaliseres som akseptable internt i miljøet, selv om de ofte signaliseres som uakseptable overfor media og omverdenen. For det fjerde kan spillere oppleve det som vanskelig å gå i mot trenerens oppfordringer til en pragmatisk og resultatfokusert opptreden.Nøkkelord: moral, etikk, fair play, footballEnglish summary: How morally do football players think? – an empirical study of moral dilemmas in elite footballIt is a common view that the increasing focus on achievement and success in elite football leads to a weakening of moral and fair play attitudes. But how do elite players think and what do they think about different dilemmas that appear on the field, and is there a difference between elite players and lower

  2. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  3. Hva vet vi (ikke om elevers opplevelser med friluftsliv i norsk skole – en gjennomgang av empiriske studier 1974–2014

    Directory of Open Access Journals (Sweden)

    Kristian Abelsen

    2017-09-01

    Full Text Available Artikkelen presenterer en kunnskapsoversikt basert på en systematisk gjennomgang av empiriske studier om friluftsliv i norsk skole der elevers opplevelser eller stemmer kommer til uttrykk. En slik oversikt er ikke tidligere sammenfattet, selv om det er over 40 år siden ordet friluftsliv kom inn i fagplanformuleringene med Mønsterplanen av 1974. 1974 ble derfor valgt som utgangspunkt for studiens søkeperiode, selv om det kan hevdes at opplæring og undervisning som omfatter aktivitet, læring og opphold i natur allerede fra tidlig 1900-tall har vært en del av norsk skoles oppdrag og virke. For søkeperioden fram til 2014 avdekkes 24 studier som møter inklusjonskriteriene, hvorav 18 er master- og hovedfagsoppgaver. Resultatet forteller at foreliggende empirisk basert kunnskap om elevers opplevelser med friluftsliv i skolen er begrenset og ikke tillater å trekke syntetiserte slutninger. Med den reservasjonen som hovedkonklusjon drøfter artikkelen hvilken kunnskap de inkluderte studier kan gi om friluftsliv i skolen ut fra elevers perspektiv.

  4. En empirisk studie av ansattes samarbeidsinnstilling hos to norske konsern.

    OpenAIRE

    Faanes, Arne

    2015-01-01

    Studien hadde som formål å se om det var sammenheng mellom kvaliteten i det profesjonelle forholdet mellom leder – ansatt og samarbeidsinnstilling. I tillegg til dette skulle studien se om samarbeidsinnstilling hadde sammenheng med opplevd tillit til samarbeidspartnere og rettferdighet i forbindelse med samarbeid. Studien er forankret i teori om Leader Member Exchange (LMX), samt tillit og rettferdighet i forbindelse med samarbeid. Hypotesene tar utgangspunkt i at det er en sammenheng mell...

  5. En empirisk studie av ansattes samarbeidsinnstilling hos to norske konsern.

    OpenAIRE

    Faanes, Arne

    2015-01-01

    Master's thesis in Service management Studien hadde som formål å se om det var sammenheng mellom kvaliteten i det profesjonelle forholdet mellom leder – ansatt og samarbeidsinnstilling. I tillegg til dette skulle studien se om samarbeidsinnstilling hadde sammenheng med opplevd tillit til samarbeidspartnere og rettferdighet i forbindelse med samarbeid. Studien er forankret i teori om Leader Member Exchange (LMX), samt tillit og rettferdighet i forbindelse med samarbeid. Hypotesene tar ut...

  6. Konkurranseutsetting av pleie- og omsorgstjenester : en studie av Oslo kommune

    OpenAIRE

    Seim, Karianne

    2006-01-01

    Sammendrag Siden konkurranseutsetting av pleie- og omsorgstjenester har vært, og er, et omstridt tema, synes jeg at det er spennende å studere hvorfor noen kommuner likevel bestemmer seg for å ta i bruk denne formen for produksjon av sine tjenester, og hvordan de går frem for å gjennomføre dette. For å kunne dekke alle sider ved konkurranseutsetting, valgte jeg derfor å konsentrere meg om å se på innføringen av konkurranseutsetting av pleie- og omsorgstjenester i Oslo kommune. Jeg har...

  7. Fokus på informationskompetence i et tværfagligt læringsmiljø - et empirisk studie af læringseffekter og studenterperspektiver

    Directory of Open Access Journals (Sweden)

    Charlotte Overgaard

    2014-03-01

    Full Text Available Der har i en årrække indenfor de videregående uddannelser været fokus på, at studerendes udvikling af informationskompetence og læring igennem problemorienteret projektarbejde er tæt forbundet, og at et nært samarbejde mellem bibliotek og uddannelsesmiljø er en væsentlig forudsætning for studerendes læring. I praksis er der dog en række forhold, som kan hindre et effektivt samarbejde mellem bibliotek og uddannelse og bevirke, at de pædagogiske intentioner ikke indfries. I et tværfagligt samarbejde mellem universitetsbibliotek og fagmiljø blev der i 2012 i forbindelse med opstarten af en ny 2-årig kandidatuddannelse i Folkesundhedsvidenskab ved Aalborg Universitet udviklet et undervisningsforløb og en række læringsunderstøttende tiltag som obligatorisk anvendelse af søgebilag i projekter og tværfaglige søgeworkshops, baseret på teorier om problembaseret læring og tilrettelæggelse af søge-læreprocesser. På baggrund af empiriske data fra informationssøgningstest, studenterprojektrapporter og gruppeinterviews undersøges effekten af undervisningen på de studerendes udvikling af informationskompetence samt deres perspektiver på læringsunderstøttende tiltag. Der identificeres fremmende og hæmmende faktorer ift. udvikling af informationskompetence og afslutningsvis diskuteres styrker og svagheder samt hvilke forhold, som er centrale – og også relevante i en bredere universitetspædagogisk sammenhæng – hvis informationskompetence skal integreres som del af de studerendes grundlæggende faglighed.     Learning through problem-based project-work and the development of information literacy skills has become increasingly common in higher education programmes in recent years. It is also generally acknowledged that these learning experiences benefit from close collaboration between university libraries and their educational environments. There is evidence to suggest, however, that a number of conditions can hamper

  8. Empiriske data fra PUIN-processen

    DEFF Research Database (Denmark)

    Bohn, Kim Rene; Lindgren, Peter; Sørensen, Steffen

    2002-01-01

    Kapitlet præsenterer de empiriske data og resultater, som er indsamlet under PUIN-projektet. Præsentationen er delt op i to dele. Først præsenteres resultaterne af møderækken i fokusgruppen. Derefter reflekteres der over den øvrige indsamlede empiri under projektforlø- bet, der har bestået af en...

  9. Exponerade hatkommentarer : En studie av svensk hatkommentarsklassificering

    OpenAIRE

    Johansson, Kim

    2016-01-01

    I detta arbete presenteras hatfulla kommentarer på internet som ett sam- hällsproblem som vi bör göra något åt. Webbplatsen Exponerat.net presenteras som en källa till hatfulla kommentarer. Med hjälp av ett förenklande antagande om att de kommentarer som finns på Exponerat kan utgöra en god representation för hatfulla kommentarer på internet konstruerar vi en klassificerare. Klassificeraren utvärderas i två steg; det ena med hjälp av tiofaldig korsvalidering och det andra manu...

  10. Kan retsvidenskaben være empirisk?

    DEFF Research Database (Denmark)

    Holtermann, Jakob von Holderstein; Christensen, Mikkel Jarle; Madsen, Mikael Rask

    2013-01-01

    Med udgangspunkt i Alf Ross’ retsrealistiske projekt beskæftiger denne artikel sig med, om retsvidenskaben er en disciplin i sin egen ret, eller om den i sidste ende er en del af samfundsvidenskaben særligt sociologien. Konkret undersøges dette skisma hos Ross gennem hans kritik af Theodor Geigers...... retssociologiske arbejder, hvor Ross imod Geiger argumenterer for, at retsvidenskaben uanset ambitionen om at blive empirisk stadig må være principielt forskellig fra retssociologien. I artiklen argumenteres der for, at denne påstand er uholdbar, og at den bl.a. hviler på en vilkårlig afgrænsning af sociologien...

  11. Implementeringsstudie : en studie av lederroller ved implementering av LUS ved Berg skole

    OpenAIRE

    Michalsen, Anne Berit; Owren, Laila

    2010-01-01

    I denne masteroppgaven studerer vi en implementeringsprosess. I 2008-2009 skulle Leseutviklingsskjema (LUS) implementeres ved Berg skole, og vi ble bedt om å følge denne prosessen på nært hold. Vi mener at vi gjennom denne oppgaven gir kunnskap om en implementeringsprosess der en ekstern veileder har en sentral rolle i prosessen. Hvordan skolens ledelse og den eksterne veilederen inntar ulike roller gjennom implementeringen er en sentral del av vår studie. Formålet med oppgaven er dels å b...

  12. Läs med flyt! : - en studie av elevers tidiga utveckling av avkodning

    OpenAIRE

    Bryne, Camilla

    2013-01-01

    Syftet med detta arbete är att studera elevers tidiga utveckling av förmågan att avkoda text och attbeskriva huvudtyper av olika utvecklingsvägar. Frågor som besvaras är vilka steg som kanidentifieras i utvecklingen av förmågan av avkoda text i den tidiga läsutvecklingen i årskurs ettoch två samt vilka huvudtyper av utvecklingsvägar som kan identifieras. För att svara på dessafrågor har 46 elevers tidiga läsning analyserats vid tre tillfällen under ett år. Vid läsningenanalyseras fyra olika a...

  13. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  14. Når kontakter betyr alt : En studie av bruken av nettverksmediet LinkedIn

    OpenAIRE

    Blaalid, Maren Hyvang

    2012-01-01

    LinkedIn er et av de mest populære sosiale mediene i Norge og tiltrekker seg stadig flere medlemmer. I denne masteroppgaven studerer jeg bruken av LinkedIn for å undersøke hva som er det særegne ved dette nettverksmediet. Jeg har utført en spørreundersøkelse blant 280 brukere for å få innsikt i hvem de er, hvorfor de bruker LinkedIn og hvordan de gjør det. Funnene fra analysen viser at brukerne kjennetegnes ved at de er selvstendige og formålsrasjonelle, som bruker LinkedIn strategisk for å n...

  15. En kvalitativ studie av sykepleiestudenters opplevelser av nye læringsaktiviteter i kritisk vurdering av kvantitative forskningsartikler

    Directory of Open Access Journals (Sweden)

    Cecilie Katrine Utheim Grønvik

    2015-01-01

    Full Text Available A qualitative study of nursing students' experience of new learning activities in critical evaluation of quantitative research articles Evidence-Based Practice is a vital part of professional health care and nurses need to have knowledge of research. This article presents nursing students' experience with new learning activities in critical evaluation of quantitative research articles. This experience was studied in focus group interviews with second-year nursing students. The students described it as challenging to understand the various quantitative designs and statistical methods. Specific requirements in the learning activities, constructive feedback, relevance and conformity between learning activities and assessments seem to promote the targeted learning outcome. How students' knowledge and skills are received in practice seems to affect students' attitudes and behavior in relation to the application of research results. To increase evidence-based practice there appears to be a need for innovative processes that can strengthen the cooperation between the nursing education and the field of practice.

  16. Showrooming. -Kvalitativt studie av mindre, uavhengige butikker i klesbransjen.

    OpenAIRE

    Hoel, Beathe

    2016-01-01

    Denne oppgaven har som hensikt å undersøke hvordan showrooming atferd hos kundene påvirker de mindre klesbutikkene som ikke er tilknyttet en kjede. Problemstillingen i denne oppgaven er: Hvordan vurderer mindre, uavhengige butikker i klesbransjen de utfordringene som knyttes til trenden showrooming og hva gjør de for å motvirke eventuelle negative virkninger av slik forbrukeratferd? Studien har som formål å undersøke hyppigheten av showrooming atferd og om dette har noen negativer konsekv...

  17. Forskere i norske avisers dekning av skole

    Directory of Open Access Journals (Sweden)

    Emilia Andersson-Bakken

    2015-10-01

    Full Text Available Skolen er stadig i medienes søkelys, og i denne artikkelen ser vi nærmere på hvordan forskere bidrar med sine fagkunnskaper i skoledebatten i mediene. Den problemstillingen vi ønsker å besvare, er: Hvilken rolle har forskere i norske avisers dekning av skole? For å svare på dette har vi gjort en analyse av samtlige artikler om skole i VG, Bergens Tidende og Aftenposten i 2013. Resultatene viser at det forekommer en navngitt forsker i ca. 12 % av avisenes artikler om skole (209 av 1712 artikler. Det er imidlertid forskjell mellom avisene, og i VG opptrer det forskere i ca. 24 % av artiklene om skole, mens andelen både i Aftenposten og BT er ca. 11 %. Undersøkelsen viser videre at det er mange forskere som får mulighet til å uttale seg om skole i disse tre avisene, men det store flertallet av disse uttaler seg kun én gang. Vi fant også at forskere ofte uttaler seg om rammene for skolens undervisningsvirksomhet, og sjelden om det som foregår i klasserommene. Resultatene av vår empiriske undersøkelse stemmer i stor grad overens med hovedtendensene i tidligere studier av forskere i media, noe som indikerer at forskernes rolle i norske avisers skoledekning ikke skiller seg markant ut fra den rollen forskere har i media generelt. Våre resultater peker imidlertid på én viktig forskjell: Forskere ser ut til å være uvanlig godt synlige i norske avisers dekning av skole.Nøkkelord: skoleforskning, media, forskningsformidlingAbstractSchool is a frequently debated topic in the media, and this article investigates how researchers contribute with their knowledge in this media debate. The research question is: What characterizes researcher participation in Norwegian newspaper coverage of school? To answer this question we have analyzed all articles about school in the Norwegian newspapers VG, Bergens Tidende and Aftenposten during 2013. The results show that there is a named researcher in about 12 % of the newspaper articles about school

  18. Konstruktionen av hälsa på Instagram : En studie av unga människors uppfattning av hälsa genom bild och text

    OpenAIRE

    Danielsson, Jennifer

    2014-01-01

    Unga människor är idag väl insatta användare av olika former av sociala medier - det är ofta en självklar del i deras vardag. Det sociala mediet Instagram har blivit oerhört populärt bland såväl barn som vuxna och används dagligen via mobilen för att förmedla ögonblicksbilder till omvärlden. I den här studien kommer Instagram - utifrån begrepp som hälsa, träning och konsumtion - analyseras med hjälp av teorier om makt och genus. Hälsomedvetenheten bland unga har genom spridningen på Instagram...

  19. Emotionell intelligens : En studie av den dskursiva produktionen av begreppet emotionell intelligens i ett organisationssammanhang

    OpenAIRE

    Pitkänen, Jenny; Sandén, Hanna

    2013-01-01

    Emotional Intelligence (EI) is a highly used concept in contemporary organizations, especially in the recruitment process or education of employees and managers. The aim of this study was to examine the discursive production of the concept emotional intelligence and how it, linked to an organizational context, is expressed in web-based articles and course homepages. In total 11 texts related to emotional intelligence and organizational contexts were used as the object of study. A three-stage ...

  20. Bruk av pedagogisk app til formativ vurdering : en studie av GeoQuiz

    OpenAIRE

    Græsli, Hans

    2015-01-01

    Digital technology and assessment for learning are two important subjects in educational research, and this study is a contribution to both fields. The study is about GeoQuiz, an application for mobile phones, which I have made together with a student of informatics at Norwegian University of Science and Technology. GeoQuiz is a test-application built on pedagogical principles and made as a tool for geography students at High School. Through an action research design, GeoQuiz was introduced t...

  1. Bilder av Internet - en studie av IT som verktyg för meningsskapande

    Directory of Open Access Journals (Sweden)

    Jonas Almqvist

    2001-01-01

    Full Text Available There are many ways of using Information Technology in educational settings. In this article the use of the Internet is in focus. It is shown that the Internet might be used in different ways, each represented by a metaphor, an image of its use. The result of a classroom study in the Swedish compulsary school, where the students’ communication creates an image of the Internet as a source of information, is presented. Inspired by the socio-cultural perspective on learning, pragmatic curriculum theory and the theory of social construction of technology, this image, together with other possible ones, are discussed in terms of learning and democracy. It is argued that, from a democratic point of view, it is important to continue to discuss different possible ways of using the Internet in education.

  2. Eye-tracking studie av vektoranalys på LTH

    DEFF Research Database (Denmark)

    Ögren, Magnus; Nyström, Marcus

    detaljerad inblick i hur studenterna tänkte medan de löste problemet. Vi använder modern eye-tracking teknik för att mäta hur LTH-studenters visuella uppmärksamhet fördelar sig mellan texter, matematiska formler och figurer när de löser problem inom vektoranalys. Genom att filma studenters ögonrörelser med...... en höghastighetskamera ger eye-tracking data information om var man tittar med väldigt hög spatial och temporal upplösning. Detta gör att man kan följa lösningsprocessen millisekund för millisekund från problempresentation till svar. Med eye-tracking kan man alltså skilja på process och produkt....... Vektoranalys är ett mycket visuellt ämne där matematiska formler ofta har en konkret grafisk tolkning. Detta gör vektoranalysen till ett speciellt lämpligt ämne att studera med eye-tracking teknologin, då försökspersonens byte av fokus mellan formler och figurer kan utvärderas. Vi kommer att presentera...

  3. Arbeidsformer i faglærerutdanningen i formgiving kunst og håndverk – en introduserende og kvantitativ studie av studentenes erfaringer

    Directory of Open Access Journals (Sweden)

    Marte Sørebø Gulliksen

    2010-12-01

    Full Text Available Denne artikkelen presenterer fase 1 i et større fagdidaktisk forskningsprosjekt om arbeidsformer og innhold i faglærerutdanningen i formgiving, kunst og håndverk. Artikkelen har som mål både å introdusere problematikken på et mer gjennomgripende nivå, og å utforske kvantitativt studentbesvarelser innhentet i forbindelse med StudDataundersøkelsen. Problemstillingene er ”Hvilke arbeidsformer er representert i planverket for faglærerutdanningen i formgiving, kunst og håndverk?” og ”Hvilke arbeidsformer er empirisk sett tilstede i institusjonens studium i følge studentenes vurderinger slik det kan leses ut av deres responser i StudDataundersøkelsen?”. Analysene av materialet tyder på at fagplanene ser ut til å ha en vektlegging på studentenes individuelle kompetansebygging og et fokus på individuelle arbeidsformer. I utdanningen, derimot, står arbeidsformer som har et hovedfokus på det kollektive, sterkere, slik studentene rapporterer at de opplever det.

  4. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  5. Sydafrika : En studie av två sydafrikanska skolors arbete mot rasism

    OpenAIRE

    Süttenbach, Emma

    2008-01-01

    Examensarbete på lärarprogrammet av Emma Süttenbach, höstterminen 2007. Handledare: Susanne Hansson. ”Sydafrika – En studie av två sydafrikanska skolors arbete mot rasism” Uppsatsens syfte är att undersöka om två sydafrikanska skolor arbetar mot rasism. För att svara på syftet har en forskningsfråga skapats: 1.Hur arbetar lärarna i två sydafrikanska skolor mot rasism? För att besvara på min forskningsfråga utförde jag fem kvalitativa intervjuer med öppna frågor till lärare som representerade ...

  6. Experimentell studie av sensationen hos färger

    OpenAIRE

    Li, Elin

    2009-01-01

    There are a large number of studies on colour and its influence on human feelings, but there are only a few studies on the association between feelings and colour combinations. This studie investigates the association between colour combinations consisting of three equally sized colours and the feelings they convey. The methodology used in this studie follows the instructions from the Nippon Colour & Design Research Institute (NCD) in Japan, NCD have studied consumer psychology towards co...

  7. Terrorismens uppkomst : En studie av terroruppkomsten i Israel/Palestinakonflikten

    OpenAIRE

    Stenekvist, Andrea

    2016-01-01

    The main purpose of this study was to develop an analytical framework for the study of terrorism, and secondly to apply it on the Israel/Palestine conflict. To achieve the first purpose, I examined the history and background of the conflict. The purpose of the study has been achieved by using a qualitative text analysis. The questions that were requested answers in this study are: - What are the main reasons that might trigger terrorism?- What are the main reasons that might triggered the ter...

  8. Comparative study of atrial fibrillation and AV conduction in mammals

    NARCIS (Netherlands)

    Meijler, F.L.; Tweel, I. van der

    1987-01-01

    Atrial fibrillation is one ofthe most common cardiac arrhythmias in humans. It a1so occurs quite frequent1y in dogs and horses. Comparative study of this arrhythmia may contribute to better understanding of the pathophysiologica1 mechanisms involved. In this study, we present a quantitative

  9. ELLE & CAFÉ : – en studie av modemagasins omslag

    OpenAIRE

    Simonsson, Greta

    2008-01-01

    ABSTRACT Title: Elle & Café – a study of fashion magazines cover pages. Number of pages: 38 Author: Greta Simonsson Tutor: Amelie Hössjer Course: Media and Communication Studies D Period: Spring Semester 2008 University: Division of Media and Communication, Department of Information Science, Uppsala University Aim: The purpose of this essay is to:  Analyze the cover images from the 2007 editions of the magazines Elles and Café, using semiotic analysis.  Analyzes eventual resemblances or...

  10. Comparative study of atrial fibrillation and AV conduction in mammals

    OpenAIRE

    Meijler, F L; van der Tweel, I

    1987-01-01

    Atrial fibrillation is one ofthe most common cardiac arrhythmias in humans. It a1so occurs quite frequent1y in dogs and horses. Comparative study of this arrhythmia may contribute to better understanding of the pathophysiologica1 mechanisms involved. In this study, we present a quantitative analysis of atrial fibrillation in humans, dogs, horses, and in a kangaroo, making use of histograms and serial autocorrelograms of the ventricular rhythm with and without digitalis medication. Increase in...

  11. Ljudrum : En studie av ljud och lyssnande som kulturell praktik

    OpenAIRE

    Eriksson-Aras, Karin

    2017-01-01

    The purpose of the thesis is to investigate how sound creates distinct, cognitive and spatial entities, sound spaces, and to find out how sound spaces constitute forms of human interaction. A further aim is to establish concepts used when studying sound spaces, thus contributing to a Swedish terminology for describing and analysing sound and sound spaces.   The analysis follows a hermeneutic spiral, alternating between inductive and deductive methodology, between the individual and the genera...

  12. Ett komplext hemland : En kvalitativ studie av televisionsprogrammet Homeland

    OpenAIRE

    Andersson, Alexandra

    2013-01-01

    After 9/11 and the following War on Terror, Muslims are often understood as global enemies. However, the idea of an international, Islamic enemy is in some circumstances criticized, not least after the actions of Anders Behring Breivik in Norway in 2011. This study analyses the North American, Emmy Award-winning television series Homeland. It centres on the War on Terror and the following social and political climate, and there are opposing understandings regarding how religion and ethnicity...

  13. Biopellets - Quality assurance - prestudy; Kvalitetssaekring av pellets - inledande studie

    Energy Technology Data Exchange (ETDEWEB)

    Wiklund, S.E.; Cronholm, L.Aa. [AaF Energikonsult AB, Stockholm (Sweden)

    2000-05-01

    The purpose of this summary is to specify the quality demands imposed by pellet users on the manufacturers of pellets, the testing methods that are used for manufacturing inspection at factories, and the type of acceptance inspection that is conducted at district heating plants and combined heat and power plants. A further task of the study has been to provide advice and guidelines to pellet users on how to carry out their acceptance inspection. During the course of the study, we have contacted and interviewed 8 Swedish users and 7 Swedish producers of pellets and asked them what type of quality control they employ at their heating plants and factories. The study shows that the users impose relatively stringent demands on pellet producers with regard to pellet quality. The parameters checked include energy content, moisture content, ash content, grain size, grain size distribution, the origin of the raw materials, resistance, weight, chemical bonding, sulphur content, chlorine content and analysis of metal content. Most of the above parameters are checked at various intervals, some every other hour or on each delivery and others several times every year. In the case of those users who only have one fuel supplier, we recommend limited acceptance inspection on the assumption that the supplier conducts the inspection that he has undertaken to perform under the terms of his agreement with the users. Users should, however, check the information and at some time during the year visit the pellet producer to make sure that the agreed procedures are being followed. In the case of those users with many different fuel suppliers, we recommend fairly extensive acceptance inspection. Those parameters that should be checked, but at different intervals, are energy content, moisture content, ash content, grain size, grain size distribution, the origin of raw materials, resistance, weight, chemical bonding, sulphur content, chlorine content and analysis of metal content. As a

  14. Hormoners betydning for kognitiv utvikling : en studie av jenter med adrenogenitalt syndrom (AGS)

    OpenAIRE

    Schjølberg, Katrine Luisa Fernanda

    2010-01-01

    Bakgrunn: Studier av både mennesker og dyr som har vært utsatt for unormale mengder hormonkonsentrasjoner har vist endringer i utviklingen av kognitive ferdigheter. Andrenogenitalt syndrom(AGS) er en tilstand som fører til økt produksjon av androgener i fosterlivet. Denne tilstanden har vist klar sammenheng mellom dennes atypiske hormonnivå og atferd i form av både lekepreferanse og valg av lekepartner. I motsetning er litteraturen uklar på forholdet mellom deres hormonelle miljø og utvikling...

  15. … en perser och resten flygvärdinnor… : En kvalitativ studie av tågmästarnas upplevelser av företagskultur och yrkesroll i omorganiseringen 2003/2004 vid SJ AB, Stockholm

    OpenAIRE

    Ackelman Thunholm, Josefina; Sobat, Virginia

    2009-01-01

    Denna studie behandlar tågmästarnas upplevelser av företagskultur och yrkesroll i omorganiseringen 2003/2004, vid SJ AB Stockholm. Det empiriska materialet bygger på kvalitativa forskningsintervjuer med sju tågmästare, som arbetade ombord på x2000 under omorganiseringen.I analys av empirin har vi kunnat se indikatorer på att företagskulturen påverkar tågmästarnas upplevelser av omorganisering. Utifrån deras syn på den aktuella omorganiseringen, tolkar vi det som att förändringar som inte över...

  16. En ansträngande aktivitet : En studie om individers upplevelser av att nätdejta

    OpenAIRE

    Johansson, Rebecka; Holmer, Lovisa

    2015-01-01

    I alla tider har människor inlett relationer med varandra men sättet att göra det på har kommit att förändras. Idag har nätdejting vuxit fram som ett internetbaserat forum speciellt designat för att man där skall kunna hitta och kontakta partners. Denna studie undersöker användarnas upplevelser av nätdejtingsprocessen. Den syftar till att beskriva och förstå användarnas upplevelser av att interagera med individer via nätbaserade forum i syfte att utveckla någon form av relation. Det metodolog...

  17. Norsk fiskeriforvaltning og bærekraft; en studie av forvaltningen av atlantisk laks (Salmo salar) og nordøstarktisk torsk (Gadus morhua)

    OpenAIRE

    Meaas, Anne Christine

    2012-01-01

    Laksefisket og torskefisket er forvaltet av to forskjellige sektorer, og laksefisket er i tillegg sektorovergripende på grunn av laksens anadrome livshistorie. Denne oppgaven har tatt for seg disse to forvaltningene, og sett på disse i lys av bærekraftbegrepet. Resultatene ble funnet gjennom litteraturstudier og personlig kommunikasjon med personer i forvaltningen. Lakseforvaltningen har høy sosial bærekraft, og laksefisket har et stort potensial som mål for turister og fritidsfiskere. Lak...

  18. Systemisk psykoterapi och affektiv neurobiologi : en studie av psykoterapeuters upplevelse av sitt arbete på en dagverksamhet kopplat till aktuell evidensbaserad forskning

    OpenAIRE

    Rizzo, Michelangelo

    2015-01-01

    Studien har sin bakgrund i systemisk psykoterapeutisk teori och aktuell affektiv neurobiologi enligt Jaak Panksepps evidensbaserade forskning. Syftet är att undersöka psykoterapeuters beskrivning och erfarenhet av att arbeta systemiskt psykoterapeutiskt och analysera huruvida arbetet ligger i linje med systemisk teori och affektiv neurobiologisk forskning. Studien genomförs vid dagverksamheter av typen behandlingsskolor för barn och ungdomar med stora skolbekymmer och intervjuer har genomfört...

  19. Samtalegrupper for personer med Aspergers syndrom. En kvalitativ studie av hva fagpersoner forteller om planlegging, gjennomføring og effekt av samtalegrupper for personer med Aspergers syndrom

    OpenAIRE

    Jensen, Øyvind

    2014-01-01

    Denne oppgaven er skrevet ut fra problemstillingen: Hvordan beskriver fagpersoner planlegging, gjennomføring og effekt av samtalegrupper for personer med Aspergers syndrom? Den belyser teori om Aspergers syndrom, effekt av samtalegrupper samt andre viktige forhold i tilknytning til samtalegruppe, som kommunikasjon, veiledning og psykoedukasjon. Fire informanter fra nettverket «Nasjonalt fagutviklingsnettverk om psykoedukative grupper for personer med Aspergers syndrom» ble intervjuet, ...

  20. Et sosiologisk blikk på mobbing. En teoretisk studie av paradigmet og fenomenet mobbing

    OpenAIRE

    Stemland, Linn

    2007-01-01

    Mobbing er et tema som har fått stadig mer oppmerksomhet i samfunnsdebatten. Det er gjort lite sosiologisk forskning omkring fenomenet mobbing. Forskningsfeltet mobbing er i dag konstruert og dominert av psykologiens begreper og forståelse. I denne oppgaven prøver jeg å nærme meg en sosiologisk forståelse av begrepet og fenomenet mobbing.

  1. Skriveramme som støtte i arbeidet med fagskriving? Studie av 8. klasse elevers tekstskaping i samfunnsfag

    Directory of Open Access Journals (Sweden)

    Anne Kristine Øgreid

    2016-01-01

    Full Text Available Bruk av formmønster blir jevnlig diskutert som støtte i skriveopplæringen. Hensikten med denne studien er å undersøke sammenhengen mellom lærerens undervisning der bruk av skriveramme inngår, og elevtekster i et skriveprosjekt i en 8. klasse i samfunnsfag. Skriveprosessen er studert og beskrevet gjennom observasjonsnotater og video-opptak, og elevenes tekster er samlet inn som sluttprodukt og tolket i lys av prosesssen rundt skriverammen. Med utgangspunkt i måten skriverammen er realisert i elevenes tekster, kan tekstene sorteres i fire kategorier: 1 Rammen er integrert, 2 Rammen er uthevet, 3 Rammen overskrides og 4 Ingen ramme. Gjennom å sammenligne tekster der rammen ikke synes å ha hatt betydning for tekstskapingen, kategori 4, med de andre kategoriene, diskuteres rammens støtte både ut fra skrivepedagogisk og historiefaglig perspektiv. Undersøkelsen av tekstene i de tre første kategoriene tyder på skriverammen har fungert som støtte, ikke bare i forbindelse med tekstoppbygging, men også som en katalysator for innholdsgenerering og faglig forståelse. Bruk av rigide rammer i skriveopplæringen er kritisert for å fremme en instrumentell og sjangerformalistisk skrivepedagogikk kjennetegnet av reproduksjon og imitasjon av tekstmønstre. Dette ser her ut til å motvirkes av lærerens innramming av skriverammen i en skriveprosess som er kjennetegnet av sterk lærerstyring, steg-for-steg-metodikk og gjennomgående dialog mellom lærer og elever.Nøkkelord: fagspesifikk literacy, literacydidaktikk, skriving i samfunnsfag, skriverammeAbstractTeaching form and the use of models are frequently discussed as a means of supporting school writing instruction. This study investigates the relation between teaching which incorporates the use of writing frames and student texts produced in a writing project conducted in a 8th grade Social Studies classes in a Norwegian lower secondary school. The writing process is examined and described

  2. ADHD og atypisk hånddominans : en studie av forekomst av atypisk hånddominans hos barn og ungdom med ADHD

    OpenAIRE

    Seim, Ronny

    2008-01-01

    Bakgrunn og formål Formålet med undersøkelsen er å undersøke om det blant barn og ungdom med ADHD forekommer høyere grad av atypisk hånddominans sammenliknet med gjennomsnittsbefolkningen, og å gjennom teori undersøke hva årsakene kan være hvis dette forekommer. Problemstilling og forskningsspørsmål Problemstillingen er formulert slik: Finnes det en høyere forekomst av atypisk hånddominans blant barn og ungdom med ADHD, og hvilke(n) årsak(er) kan dette ha hvis en slik forekomst eksi...

  3. Mellom risiko og kontroll - en studie av eksplisitte modelleringsformer i norsk grunnskolelærerutdanning

    Directory of Open Access Journals (Sweden)

    Fride Lindstøl

    2017-12-01

    Full Text Available Å være lærerutdanner skiller seg fra andre stillinger innenfor høyere utdanning: Lærerutdanneren underviser både i fagstoff og i hvordan studentene kan lære bort og adaptere fagstoffet i klasserommet. Det at lærerutdanneren underviser i det å undervise, har implikasjoner for hvordan undervisningen planlegges, gjennomføres og analyseres i lærerutdanningen – undervisningens form blir en del av budskapet. Lærerutdannerens arbeid handler derfor om å utforme, velge og sette i spill aktiviteter og oppgaver som kan adaptere fag, forskning, didaktikk og teori til klasserom og profesjonen. Utforming og montasje av de ulike delene eller episodene i et undervisningsforløp kan betegnes som undervisningsforløpets dramaturgi. I denne artikkelen har jeg gjort en dramaturgisk analyse av tre lærerutdanneres undervisning for å identifisere og beskrive hvordan de bruker eksplisitte modelleringsformer, og hva som skjer når de bruker dem. I etterkant av den dramaturgiske analysen har jeg gjort en konvensjonell innholdsanalyse av intervjudata for å undersøke hvordan lærerutdannerne selv forklarer formålet og erfaringer med å bruke eksplisitt modellering i undervisningen. Analyse av tre lærerutdanneres undervisningspraksis sammenfattes i en modelleringsstige som visualiserer hvordan enkelte former for eksplisitte modelleringsformer tilbyr en egen sirkulær dramaturgi. Studien antyder og drøfter også på hvilken måte modelleringsstigen kan fungere som en dramaturgisk modell, som kan brukes som utgangspunkt for lærerutdanneres planlegging, gjennomføring og analyse av egen undervisning. Studien er et bidrag til å utvikle og forske på hvordan eksplisitte modelleringsformer kan brukes for å skape sammenheng mellom praktisk lærerarbeid og teoretisk metarefleksjon i lærerutdannerens undervisning. Innsamling av data er gjort i profesjonsverksted, som kan forklares som en læringsarena hvor lærerutdannere fra ulike fag samarbeider om

  4. En teoretisk utdyping av rom og materialitet som pedagogisk ressurs i barnehagen

    Directory of Open Access Journals (Sweden)

    Solveig Nordtømme

    2015-07-01

    Full Text Available Abstract: This article is a theoretical exploration with the aim of discussing an ontological basis for space and materiality as educational resources in kindergarten. Attention is directed on children’s play experiences interacting with space and materiality, and how children use and create space. The metaphors front stage, space in between, and backstage (inspired from Erving Goffman, 1969, which form the study's main findings, are used as the backdrop for the issue and analyzes. The empirical material used in this exploration has been collected with an ethnographic methodological approach in two kindergartens. Maurice Merleau-Ponty’s (1962 focus on bodily experience and presence in space, along with concepts from Latour’s (2005 actor-network theory, is used to explore the data. The article contributes with theoretical tools for professionals in kindergarten teaching, to shed light on the importance of space, materiality and play in children's everyday life in kindergarten.Sammendrag: Denne artikkelen diskuterer et ontologisk grunnlag og er en teoretisk utforskning av rom og materialitet som en pedagogisk ressurs i barnehagen. Oppmerksomheten er rettet mot barns lekeerfaringer i samspill med rom og materialitet, og hvordan barn bruker og skaper rom. Metaforene hovedrom, mellomrom, og bakrom (inspirert fra Erving Goffman, 1969, som danner studiens hovedfunn, blir brukt som et bakteppe for problemstilling og analyser av det empiriske materialet fra to barnehager. Maurice Merleau-Ponty publikasjoner The Phenomenology of Perception (Merleau-Ponty, 1962 med sitt fokus på kroppslig erfaring i levd rom, blir brukt sammen med begreper fra Latours aktør-nettverksteori (Latour 2005 til å utforske hvordan rom og materialitet kan være pedagogiske ressurser. Artikkelens kunnskapsbidrag er å presentere et teoretisk verktøy for barnehageprofesjonen og kunnskaper om lekens betydning i barns hverdag i barnehagen.

  5. Angiographic analysis of animal model aneurysms treated with novel polyurethane asymmetric vascular stent (P-AVS): feasibility study

    OpenAIRE

    Ionita, Ciprian N; Dohatcu, Andreea; Sinelnikov, Andrey; Sherman, Jason; Keleshis, Christos; Paciorek, Ann M; Hoffmann, K R; Bednarek, D. R.; Rudin, S.

    2009-01-01

    Image-guided endovascular intervention (EIGI), using new flow modifying endovascular devices for intracranial aneurysm treatment is an active area of stroke research. The new polyurethane-asymmetric vascular stent (P-AVS), a vascular stent partially covered with a polyurethane-based patch, is used to cover the aneurysm neck, thus occluding flow into the aneurysm. This study involves angiographic imaging of partially covered aneurysm orifices. This particular situation could occur when the vas...

  6. Kvällspressen, ledaren och könet : En studie om mediebevakningen av Mona Sahlin och Fredrik Reinfeldt

    OpenAIRE

    Yazdanfar, Sara

    2010-01-01

    Mona Sahlin och Fredrik Reinfeldt har under valet 2010 varit bevakade av medier som statsministerkandidater. Uppsatsen analyserar vilka likheter och skillnader det finns rapporteringen av dem på kvällspressens framsidor, hur genus framställs och vad kvällspressen fokuserar på i rapporteringen av dem. Med hjälp av tabloidformats- och genusteorier av text och bild samt en kritisk diskursanalys och semiotisk analys som metod har slutsatser framkommit. Rapporteringen av dem har inte varit positiv...

  7. Etikk i anvendt idrettspsykologi: en kvalitativ studie av idrettspsykologiske rådgiveres etiske utfordringer i anvendt idrettspsykologi, og håndtering av disse

    OpenAIRE

    Ulltang, Espen

    2015-01-01

    Masteroppgave - Norges idrettshøgskole, 2015 Idrettspsykologi er et fag som arbeider for å utvikle mentale ferdigheter hos utøvere og trenere. De som arbeider med anvendt idrettspsykologi møter en rekke etiske utfordringer i sin praksis, men kunnskap om dette synes mangelfullt i Norge. Internasjonalt er det publisert en rekke essays, artikler, og bøker om etiske utfordringer i anvendelsen av faget, men ingen studier viser hvordan norske idrettspsykologiske rådgivere opplever sl...

  8. Multivariat analyse av 18F-FDG PET av tre brystkreft-xenografter i mus

    OpenAIRE

    Skappel, Ingvild

    2015-01-01

    Denne masteroppgaven tar utgangspunkt i et studie hvor man har analysert bilder innhentet fra dynamisk PET (Positron Emission Tomography) av mus med implanterte menneskelige brystkreft-xenografter, utført ved Oslo Universitetssykehus i mars 2014. 2-deoksy-2-[18F]fluoro-D-glukose (FDG), en glukoseanalog merket med radioaktivt fluor (18F), er benyttet som tracer. Ved dynamisk FDG PET avbildes aktiviteten av 18F i kroppsvevet av interesse ved flere tidspunkt etter injeksjon av tracer. I denne op...

  9. Metodrumsundervisning : En kvalitativ studie av simulering inom vård- och omsorgsutbildning

    OpenAIRE

    Leibring, Ingela

    2015-01-01

    Den här avhandlingen handlar om vårdlärares arbete med simulering av arbetsuppgifter i metodrum Ett metodrum kan ses som en hybrid mellan klassrum och sjukhussal. I denna skolmiljö övas arbetsuppgifter som förekommer inom vård och omsorg. Det saknas patienter att öva på och ibland sjukvårdsmaterial, vilket innebär en utmaning för vårdläraren att skapa en autentisk miljö. Syftet med studien är att undersöka hur vårdlärare arbetar med simulering av arbetsuppgifter i metodrumsundervisning för vu...

  10. Förändringar av arbetssätt vid implementering av BIM : En kvalitativ studie av två traditionella projekteringars arbetssätt och tid- och resursplanering samt vilka förändringar som är nödvändiga vid implementering av BIM

    OpenAIRE

    Jansson, Magnus; Knutsson, Kristian

    2012-01-01

    I en rapport från 2005 framtagen av FoU-Väst i samverkan med Centrum för management i byggsektorn (CMB) konstateras att en betydande del av allt slöseri i byggsektorn är kopplat till fel och konsekvenserna av dessa, med andra ord felkostnader. Studien visar att felkostnader står för cirka 10 % av ett projekts produktionskostnad.   Byggsektorn står nu, år 2012, inför förändringar i sitt arbetssätt för att minska antalet fel, öka kvaliteten och effektiviteten. BIM – Building Information Modelin...

  11. Plosivane i Bjerkreim. Ein synkron studie av preaspirasjon og klanglause lenes

    OpenAIRE

    Tengesdal, Eirik

    2015-01-01

    På verdsbasis er preaspirasjon eit sjeldant språkljodsfenomen. I Europa finn ein det berre i nord, og det er eit arealfenomen. Ein finn det millom anna i islandsk, færøysk, skotsk-gælisk, sume dialektar i Noreg, Sverige og England, og i flestalle samiske språk. Eitt av hovudfyremåli med denne uppgåva er å granska plosivane til tri informantar frå Bjerkreim kommune (i Rogaland) i mange ulike fonologiske kontekstar for å kunna påvisa at preaspirasjonen er systematisk her. Eit anna hovudfyremål ...

  12. "Snaprevyen" : en studie av NRKs nyhetsformidling på Snapchat under det amerikanske presidentvalget i 2016

    OpenAIRE

    Restad, Julie Stenset

    2017-01-01

    Nyheter er ikke lenger bare forbeholdt massemediene. Norske nyhetsaktører har den siste tiden for alvor begynt å ta i bruk sosiale medier for å formidle nyheter, også Snapchat. I motsetning til tidligere studier som ser på bruksmåter av Snapchat, vil denne studien se på hvilke grep avsender tar i bruk for å formidle nyheter i applikasjonen. Denne masteroppgaven tar for seg hvordan den norske allmennkringkasteren NRK har tatt i bruk den sosiale medie-plattformen Snapchat til å formidle nyheter...

  13. Dual chamber pacing with optimal AV delay in congestive heart failure: a randomized study.

    Science.gov (United States)

    Capucci, A; Romano, S; Puglisi, A; Santini, M; Pagani, M; Cazzin, R; Zanuttini, D; Mangiameli, S; Moracchini, P V; Neri, R; De Ciuceis, P; Circo, A; Cavaglià, S; De Seta, F

    1999-07-01

    A prospective randomized trial was set up to evaluate contractile parameters and quality of life in patients with congestive heart failure. We describe the results from 38 patients in sinus rhythm and with chronic heart failure due to congestive cardiomyopathy, prospectively randomized to optimal medical therapy (Group 1, 19 patients) or optimal medical therapy plus dual chamber pacemaker programmed to optimal AV delay (Group 2, 19 patients). At a 6 month follow-up, 7/19 patients in Group 1 had died compared with 5/19 patients in Group 2. During follow-up, there were few significant changes in evaluated parameters except for mitral regurgitation time, which was prolonged in Group 1 and shortened in Group 2. The systolic left ventricular diameter shortened significantly only in Group 2. An energy and activity questionnaire showed that the effect of DDD pacing in the latter patient population was beneficial. From these results we may conclude that at the 6 month follow-up DDD pacing with echo-optimized AV interval programming can improve quality of life without affecting survival.

  14. Pastorer i trosbevegelsen : en studie av to norske pastorer sin autoritetsforståelse og rolleforståelse

    OpenAIRE

    Bryne, Jarle

    2007-01-01

    Jeg har valgt bevisst et omfattende sammendrag. Sammendraget er utformet med tanke på at det skal være mulig for leseren å få et inntrykk av mine resultater i prosjektet uten at leseren trenger å lese hele prosjektet. Jeg har laget et sammendrag fra hvert kapittel. Kapittel 1: Prosjektet mitt handler om undersøkelser av to sentrale ledere i trosbevegelen. Henholdsvis Åge Åleskjær som er leder av Oslo Kristne Senter på Kjeller og Enevald Flåten som inntil 2006 var leder av Levende Ord Bibel...

  15. Verdivurdering av Prosafe

    OpenAIRE

    Sanne, Tom

    2006-01-01

    Prosafe ASA er et offshore selskap som eier og driver verdens største flåte av halvtnedsenkbare bolig- og service rigger. I tillegg er de en ledende eier og operatør av flytende produksjons- og lagringsfartøyer. Selskapet har uttrykt følgende visjon: ”Prosafe har som visjon å være en ledende og innovativ leverandør av produkter og tjenester til utvalgte nisjer i den globale olje- og gassindustrien.”(Prosafe.no) Prosafe har mesteparten av sine inntekter, kostnader og gjeldsfo...

  16. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  17. Pastorer i trosbevegelsen : en studie av to norske pastorer sin autoritetsforståelse og rolleforståelse

    OpenAIRE

    Bryne, Jarle

    2007-01-01

    Masteroppgave i kristendomskunnskap - Universitetet i Agder 2007 Jeg har valgt bevisst et omfattende sammendrag. Sammendraget er utformet med tanke på at det skal være mulig for leseren å få et inntrykk av mine resultater i prosjektet uten at leseren trenger å lese hele prosjektet. Jeg har laget et sammendrag fra hvert kapittel. Kapittel 1: Prosjektet mitt handler om undersøkelser av to sentrale ledere i trosbevegelen. Henholdsvis Åge Åleskjær som er leder av Oslo Kristne Senter på Kjel...

  18. The Meter arrives. A study of the information around the introduction of individual electricity meters; Maetaren kommer. En studie av informationen kring infoerandet av individuella elmaetare

    Energy Technology Data Exchange (ETDEWEB)

    Maardsjoe Blume, Karin; Lindstedt, Inger

    2008-10-15

    From 1st July 2009 all electricity meters will be read once a month, which means that individual electricity meters will be installed for all users - private customers and businesses alike. This change will create the need for information to be circulated to the users about what will happen, why and what is expected of users. With a specific focus on the relation with private customers, the aim of this study has been to describe and analyse the information and communication strategies used by electricity and energy companies. The methodology has largely consisted of text and material analyses, in combination with an in-depth interview in order to study a company's entire communication chain. The material studied has consisted of ELAN-companies' information material and campaigns. The study's long-term objective is to contribute to a better understanding between user and company and improved knowledge of the field. Which information and communication strategies have been identified in the analysis? Three main areas are in focus here: the choice of genre, the choice of rhetorical approach and the interplay and overlap of texts and images. In terms of genre, it is clear that the spectrum is both wide and varied: letters, brochures, advertisements, postcards, 'road shows' with celebrities as attractions, etc. As the information requirement is great, the choice of genre and the creation of different kinds of material and campaigns are also wide-ranging. The companies have chosen to work in different ways, however, and the dividing line seems to be set between large and small companies, or in other words, companies with or without strong local ties. The companies with strong local connections - and generally speaking not very large - tend to use letters and personal contact. The large international companies make use of a number of contact channels to both stimulate customer interest and make contact. The rhetorical approach relates to the focus

  19. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    OpenAIRE

    John Olav Bjørnestad; Anne Valen-Senstad Skisland; Olle Söderhamn

    2010-01-01

    Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatning...

  20. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  1. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  2. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  3. Analytiske læsestrategier og spørgsmål. Om at tænke med poststrukturalistiske og ny-materialistiske begreber gennem empirisk materiale

    DEFF Research Database (Denmark)

    Søndergaard, Dorte Marie

    2017-01-01

    , forstås som manualer. Artiklen starter med at skitsere konturerne af de begrebslige optikker, som den analytiske tænkning kan tage form igennem i mødet med det empiriske materiale. Det videnskabsteoretiske afsæt, forskningens horisont, de analytiske ambitioner og tanker om forskningskvalitet kommer derfor...

  4. Hvorfor kommer de ikke? Minoritetsspråklige foreldres erfaringer med hjem-skole-samarbeid i lys av teorier om makt og anerkjennelse

    OpenAIRE

    Evensen, Tone

    2013-01-01

    Mastergradsoppgave i tilpasset opplæring, Avdeling for lærerutdanning og naturvitenskap, Høgskolen i Hedmark, 2009. Norsk sammendrag Dette er en masteroppgave i tilpasset opplæring ved Høgskolen i Hedmark. Oppgaven er en empirisk undersøkelse av minoritetsspråklige foreldres erfaringer med hjem–skole-samarbeid. Bakgrunnene for undersøkelsen er forskning som viser at samarbeidet mellom hjem og skole er viktig for elevenes resultater i skolen, samtidig viser det seg at minoritetsspråklige...

  5. Robust AVS Audio Watermarking

    Science.gov (United States)

    Wang, Yong; Huang, Jiwu

    Part III of AVS(China Audio and Video Coding Standard) is the first standard for Hi-Fi audio proposed in China and is becoming more popular in some IT industries. For MP3 audio, some efforts have been made to solve the problems such as copyright pirating and malicious modifications by the way of watermarking. But till now little efforts have been made to solve the same problems for AVS audio. In this paper, we present a novel robust watermarking algorithm which can protect the AVS audio from the above problems. The watermark is embedded into the AVS compressed bit stream. At the extracting end, the watermark bits can be extracted from the compressed bit stream directly without any computation. This algorithm achieves robustness to decoding/recoding attacks, and low complexity of both embedding and extracting while preserves the quality of the audio signals.

  6. Universell utforming og den vanskelige avgrensingen av «alle»

    Directory of Open Access Journals (Sweden)

    Lars Christian Risan

    2013-12-01

    Full Text Available Universell utforming er et prinsipp hvor målsetningen er at «utforming av produkter og omgivelser [skal skje] på en slik måte at de kan brukes av alle mennesker, i så stor utstrekning som mulig, uten behov for tilpassing og en spesiell utforming.» (Aslaksen mfl, 1997, den første norske definisjonen I løpet av de siste 15 årene har dette prinsippet blitt fremmet i Norge som et utvetydig fremskritt. Det kan imidlertid være farlig å tro at en ren teknisk løsning kan bygge bro over politiske kontroverser (Imrie 2012, og i denne artikkelen vil vi vise hvordan viktige ideologiske premisser er skjult under paraplyen om universalitet. Vårt empiriske felt er norsk boligpolitikk fra etterkrigstiden og fram til i dag. Innenfor dette feltet ser vi at det har vært argumentert for ulike versjoner av «universell utforming» de siste 40 årene, selv om navnet «universell utforming» er av nyere dato. Vi vil vise hvordan prinsippet har endret seg fra å ha et sosialdemokratisk innhold – før det ble omdøpt til «universell utforming» – for å bli inkorporert i et nyliberalt boligpolitisk paradigme de siste 15 årene. De sosialdemokratiske forgjengerne til «universell utforming» ble til dels formulert som videreutviklinger av en boligpolitikk for sosial rettferdighet og økonomisk likhet. Med innføringen av begrepet «universell utforming» har denne brede sosiale rammen forsvunnet, men under dekke av universalitet og entydig framskrittsoptimisme har denne politiske endringen blitt underkommunisert.[i] [i] Prosjektet er finansiert av Husbanken. Prosjektmedarbeiderne har bestått av NIBR-forskerne Erik Henningsen, Siri Nørve og Lars Risan. Underveis har disse forskerne intervjuet og snakket med en rekke personer innenfor feltene funksjonshemming- og boligpolitikk. Vi takker også Jon Guttu, Olav Rand Bringa, Tore Lange for mange konstruktive innspill. 

  7. Tid till att bli svensk: En studie av mottagandet av nyanlända barn och familjer i den svenska förskolan

    Directory of Open Access Journals (Sweden)

    Johannes Lunneblad

    2013-05-01

    Full Text Available This paper is from a study about the integration of young refugee children and their families in Sweden. The preschool has here a special responsibility in this mission for children in the age 1-5. The setting for the study is a multiethnic area located on the outskirts of the city. Methodologically an extended case is used. The study has so far been conducted during a period of 14 months doing fieldwork 1-2 days a week. The analyse focus on how the educators educate practice and talk about how the immigrant parents raise and foster their children. This is described as part of a wider ambition to integrate immigrants in Swedish society.

  8. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  9. Evaluation and development of methods for determining methane emissions from biogas plants - Literature Study; Vaerdering och utveckling av maetmetoder foer bestaemning av metanemissioner fraan biogasanlaeggningar - Litteraturstudie

    Energy Technology Data Exchange (ETDEWEB)

    Holmgren, Magnus Andreas (SP, Boraas (Sweden)); Willen, Agnes; Rodhe, Lena (JTI, Uppsala (Sweden))

    2011-11-15

    Previous work in areas such as framework of voluntary commitment shows that there is a need for techniques for measurement of methane and other greenhouse gases from various sources in the handling of organic residuals. There are no established methods for determining for instance emissions of methane from open or partially open tanks and cisterns, typically residue storage and the like. This report gives results from Phase 1 of this project, in which literary studies, market research studies, interviews and site visits have been made to identify a number of methods applied for the determination of emissions from open areas, such as liquid surfaces, but also land. Focus is on methods that can be applied to plants for biological treatment, which also includes the water treatment process at the treatment plants, but also the procedures used in measurements on land, landfills and processing plants are studied. First, the report gives a brief overview of a large number of measurement methods, where more detailed descriptions of four methods are given. The four methods are considered to be the most promising to pursue in the following phases of the project: - chamber technology; - sampling hood; - plume measurement with DIAL (Differential Absorption Lidar); - air input in a covered storage.

  10. Studies of radioactive deposition on farm buildings and testing of some methods for decontamination; Studier av radioaktiv belaeggning paa lantbruksbyggnader och utprovning av laempliga dekontamineringsmetoder

    Energy Technology Data Exchange (ETDEWEB)

    Andersson, Inger [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Nutrition and Management; Erlandsson, B. [Lund Univ. (Sweden). Dept. of Nuclear Physics; Hansson, J.; Dolby, C.M. [Swedish Univ. of Agricultural Sciences, Lund (Sweden). Dept. of Farm Buildings

    1993-12-31

    Studies were made of radioactive fallout on roofs of farm buildings and of some methods of decontamination. The aim was to find ways of reducing the external radiation dose to farmers working and farm animals housed in stables in a fallout situation. The roof material studied was steel plate (A) and tile (B,C, D), each with four sample areas of ca. 1 m{sup 2}. The roof samples were collected at three places and from totally four building in regions which in 1986 (after the Chernobyl fallout) has a {sup 137}Cs ground depositions of 3040 kBq/m{sup 2} (A, B, C) and > 100 kBq/m{sup 2} (D). Four different decontamination methods were tested: 1. High pressure washing with water. 2. Repeated high pressure washing with water. 3. Application of foam of a sanitizing chemical for livestock buildings followed by high pressure washing with water. 4. Application of a solution of KCl followed by high pressure washing with water. In C, the effect of decontamination expressed as the percentage decrease of the {sup 137}Cs activity was on average for all methods, 55%. This material was coated before the decontamination by a marked growth of algae or moss, which was effectively washed off during the sanitizing procedure. In B, the average activity decontamination effect was 25%, while in D (with the highest original activity, but without growth of organic material) the effect was very small, 3%. In A, the activity level before decontamination was so low that measurements after decontamination were considered unnecessary. Method number 4 was the most effective in B and C, 32% and 64%, respectively, while method number 3 was the most effective in D, 5.7%. The results indicate that good effects can be achieved in radioactivity decontamination of roof material with equipment and chemicals which are normally available on farms.

  11. Teaterledare på 120 timmar? : En studie om skapandet av en teaterledarutbildning

    OpenAIRE

    Schönfeldt, Ylva

    2014-01-01

    This paper is a qualitative study of the pedagogical conditions and the knowledge necessary for the creation and development of an education regarding leadership in the field of amateur theatre. The purpose of the study has been for participants to reflect and create knowledge about the creation and implementation of a course for leaders of amateur theatre. Questions raised in the study concern the students’ previous experience of drama, theatre and leadership; their desire to become leaders ...

  12. Angiographic analysis of animal model aneurysms treated with novel polyurethane asymmetric vascular stent (P-AVS): feasibility study

    Science.gov (United States)

    Ionita, Ciprian N.; Dohatcu, Andreea; Sinelnikov, Andrey; Sherman, Jason; Keleshis, Christos; Paciorek, Ann M.; Hoffmann, K. R.; Bednarek, D. R.; Rudin, S.

    2009-02-01

    Image-guided endovascular intervention (EIGI), using new flow modifying endovascular devices for intracranial aneurysm treatment is an active area of stroke research. The new polyurethane-asymmetric vascular stent (P-AVS), a vascular stent partially covered with a polyurethane-based patch, is used to cover the aneurysm neck, thus occluding flow into the aneurysm. This study involves angiographic imaging of partially covered aneurysm orifices. This particular situation could occur when the vascular geometry does not allow full aneurysm coverage. Four standard in-vivo rabbit-model aneurysms were investigated; two had stent patches placed over the distal region of the aneurysm orifice while the other two had stent patches placed over the proximal region of the aneurysm orifice. Angiographic analysis was used to evaluate aneurysm blood flow before and immediately after stenting and at four-week follow-up. The treatment results were also evaluated using histology on the aneurysm dome and electron microscopy on the aneurysm neck. Post-stenting angiographic flow analysis revealed aneurysmal flow reduction in all cases with faster flow in the distally-covered case and very slow flow and prolonged pooling for proximal-coverage. At follow-up, proximally-covered aneurysms showed full dome occlusion. The electron microscopy showed a remnant neck in both distally-placed stent cases but complete coverage in the proximally-placed stent cases. Thus, direct flow (impingement jet) removal from the aneurysm dome, as indicated by angiograms in the proximally-covered case, was sufficient to cause full aneurysm healing in four weeks; however, aneurysm healing was not complete for the distally-covered case. These results support further investigations into the treatment of aneurysms by flow-modification using partial aneurysm-orifice coverage.

  13. Kampklubb : en kommentert oversettelse av Fight club av Chuck Palahniuk

    OpenAIRE

    Gottschalk, Morten Peter

    2006-01-01

    Oppgaven er en kommentert oversettelse av romanen Fight Club av Chuck Palahniuk. Den inneholder en oversettelse av de sju første kapitlene i romanen. Kommentardelen tar for seg oversetterproblemer, og diskuterer disse i detalj. Det dreier seg om stil, syntaks, oversettelse av navn med betydning og problemer der kulturelle forskjeller mellom USA og Norge skaper oversetterproblemer. Som bakgrunnsmateriale brukes Gideon Tourys begreper om adekvate og akseptable oversettelser, og hvordan kildekul...

  14. Restaurangernas val av livsmedel

    OpenAIRE

    Korpihalkola, Janica

    2009-01-01

    Syftet med detta lärdomsprov är att ta reda på vilka livsmedel restaurangerna i Vasa har valt att använda samt varifrån de skaffar sina råvaror och livsmedel. Avsikten var även att undersöka om valet av livsmedel skiljer sig vid lunch och a la carté -mat och om det finns skillnader mellan privata och kedjerestauranger med tanke på val av livsmedel. I teoridelen beskriver jag om hur restaurangerna och deras användning av råvaror har utvecklats på 1900-talet och om olika valmöjligheter som ...

  15. Nykonstruktion av trippelsaxlyftbord

    OpenAIRE

    Gisselman, Niklas

    2010-01-01

    SammanfattningDenna rapport behandlar konstruktion av ett trippelsaxlyftbord. Lyftbord är ett bord som harmöjlighet att lyfta eller sänka en bordsskiva till en höjd som underlättar arbete. Dessa lyftbordutgår från en av SIS standardiserat arbetsgång för att uppfylla CE-märkning. En förändring idenna standard har öppnat en marknad för lyftbord som lågfartshissar upp till 3 våningsplansom Edmolift avser att täcka. Av denna anledning vill Edmolift konstruera etttrippelsaxlyftbord med en kapacite...

  16. Potential and barrier study. Energy efficiency of Norwegian homes; Potensial- og barrierestudie. Energieffektivisering av norske boliger

    Energy Technology Data Exchange (ETDEWEB)

    Mjoenes, Christian; Pettersen, Folke Vogn Haug; Kristoffersen, Bjoerge Sandberg; Birkeland, Bjoern Mangor; Essen, Jan von; Haarberg; Karl Johan

    2012-01-15

    On behalf of Enova SF, Prognosesenteret AS and Entelligens AS carried out a potential and barrier study of energy efficiency of the Norwegian housing stock. The study made use of newer and known studies of the Norwegian housing stock, known and documented barriers to energy efficiency, and new and extensive studies of several topics which have only been partially or never explored before. Through unique analysis and a case-based approach, it revealed a real energy efficiency potential in Norwegian homes with known technology and revealed representativeness, relevance, strength and extent of the barriers that prevent that one can realize most of the technical energy efficiency potential in the Norwegian housing stock. (eb)

  17. Merchandising-computer trials 1995 - studies on six merchandising systems; Apteringsdatortest 1995 - studier av sex apteringssystem

    Energy Technology Data Exchange (ETDEWEB)

    Sondell, J.; Essen, I. von

    1996-11-01

    Skogforsk has conducted a series of studies on the second generation of merchandising computers (bucking-to-value computers) available on the Swedish market. The harvesters were moved to the same study site in southern Sweden. Each machine processed about 50 Norway spruce trees and the price lists and study conditions were kept the same for all six systems. The layout of the systems was described and the ergonomics briefly evaluated. The accuracy of the length and diameter measuring and how the systems exploited the value of the wood were studied. The results will be used both by the manufacturers for future development and by the forest companies as a basis for investment decisions. 11 refs, 4 figs, 5 tabs

  18. Dekonversion och självuppfattning : En religionspsykologisk studie av dekonvertiters berättelser

    OpenAIRE

    Holmström, Lena

    2012-01-01

    This study focuses on aspects of cult experiences, given by deconverted former members of closed religious movements. Their testimonies were published in books or interviews. The aims of the study were to understand the interaction between the religious group and its members, living in high tension towards mainstream society and their testimonies of altered self-esteem during attraction, membership, deconversion and defection. The purpose was to understand how a person´s self-esteem is affect...

  19. Sjuksköterskornas upplevelser av det emotionella arbetet : En fenomenologisk hermeneutisk studie

    OpenAIRE

    Johansson, Pia

    2015-01-01

    Background: A nurse who is working in the health care is expected to show the best side for other people. An emotional work demands a lot of the role of a nurse, when she has to deal with her feelings after the given situation to satisfy the patient. Aim: The purpose of the study is to seek understanding of what nurses perceive to be the essence of the emotional work in health care. The study also wants to understand what factors could affect the meeting both positively and negatively between...

  20. Leaching of wood ash - Laboratory and field studies; Lakning av vedaska - Laboratorie- och faeltstudier

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, Per-Erik

    2012-02-15

    High forest production leads to diminishing amounts of base cations and micro nutrients in forest soils. This is due to uptake in, and harvest of, the trees. Losses can be compensated for by spreading stabilized wood ash on the forest ground, which means recycling of base cations and micro nutrients. Chemical composition of wood ash can easily be described by standard methods in the laboratory. However, this does not include the process of leaching in nature, such as which components and leaching rate for different compounds. During field conditions several factors are added, which are not available in the laboratory. After almost 10 years in the forest soils there still remains large quantities of the original product. Only 10-30 % of the wood ash products and 5 % of the lime product has been leached. In the laboratory study the leached amount was slightly larger, at the most 35 % for wood ash and 20 % for lime. Both studies indicate long time for weathering of the products in forest soils. Slower leaching rate from pellets of wood ash compared to leaching rate from crushed wood ash in the laboratory study is not verified by the field study. This indicates limited possibilities to control rates of leaching in the environment

  1. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  2. "Utdanningsreformer som moderniseringsoffensiv. En studie av hjelpepleieryrkets rekruttering og dannelseshistorie, 1960 - 2006."

    OpenAIRE

    Høst, Håkon

    2007-01-01

    The dissertation describes and analyses how central education reforms through a period of more than 40 years influences on a particular field of vocational education and work, auxiliary nursing. The reforms do not meet a field that is easily reconstructed through central planning and modernisation. The analytical perspective of the dissertation is to study how education reforms interact with other conditions contributing to the shaping of this field, as the established recruitm...

  3. Diktator og medmenneske. En studie av lederskap til sjøs

    OpenAIRE

    Kolbræk, Espen Jan

    2012-01-01

    This thesis explores management and well-being on ships in the Norwegian merchant marine. These vessels appear as closed institutions which in many ways represent societies in miniature. One goal of this study is to reflect upon different perspectives on ship management, and on many of the challenges that captains face today. About two-thirds of the Norwegian merchant fleet consists of foreign seamen. Thus, the ships can be seen as cultural meeting places. Ethnic diversity, isolat...

  4. Studies of gas flow in grate fired boilers. Studier av gasstroemning i rosteldade pannor

    Energy Technology Data Exchange (ETDEWEB)

    Eriksson, Jan (Vattenfall Utveckling AB, Aelvkarleby (Sweden)); Tryman, R. (FOA, Tumba (SE))

    1991-01-22

    As a first step towards understanding the gas flow in a grate fired boiler, the isothermal flow in a water model has been studied. Laser-Doppler velocimetry of mean velocities and turbulence was performed in two coordinate directions at about 230 points. The FLUENT program was used for numerical calculations of the flow in the model, and an acceptable agreement with the measurements was achieved. (L.E.).

  5. Preliminary study of the heating market in Sweden; Foerstudie av vaermemarknaden

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-07-01

    The successive deregulation of the market for electric power, in Sweden as well as abroad, results in an increased competition in generation and trade of electricity. This market that previously was known for its oligopoly in the production sector and its monopoly in the distribution sector has now been opened for competition. This study is focused on the district heating sector, because it is still comparatively unregulated, and because it partly comprises what is called natural monopolies.

  6. Levd skuespillerliv og rolletildeling. En studie av kvinner i norsk institusjonsteater

    Directory of Open Access Journals (Sweden)

    Rikke Gürgens Gjærum

    2015-12-01

    Full Text Available The article presents findings from the qualitative study Women in Norwegian theatre, Kvinner i norsk teater (KIT. The researchers have examined the experiences of actresses on the distribution of dramatical roles/parts in Norwegian institutional theatres, in a lifespan perspective. The study is based on 20 qualitative research interviews of a strategic selection of actresses from smaller and larger institutional theatres. We discuss the data with a feministic view and six issues are highlighted in the article: 1. Repertoir, 2. Focus on looks and appearances, 3. Ageism, 4. Role characteristics, 5. Role ambitions/wishes of the actresses, 6. Nobility, 7. Prosesses of change. In the KIT study we find both active and creative innovating actresses and actresses who appear creative but yet more passive. A central discovery is that the success criterion for achieving an enriching professional life as an actress in Norwegian institutional theatres, is to dare “to take the wheel" in order to avoid marginalisation and ageism from the institution.

  7. Kommunal självstyrelse - en myt? : En lokalhistorisk studie av Borgviks kommun 1861-1924

    OpenAIRE

    Opperud, Märit

    2006-01-01

    The hypothesis of this study is that the local government act in Sweden 1862 was an instrument for the state to keep its´ political influence on the local level. It did not open for local self-government. The swedish historians Dahlkvist and Strandberg description of the Swedish local government act support this hypothesis, as does the analysis of political scientists Pettersson and Söderlind. The general opinion that the local government act opened for local self-government does still exist ...

  8. Evaluering av inflammatoriske mediatorer i diagnostikk av alvorlige neonatale infeksjoner

    Directory of Open Access Journals (Sweden)

    Henrik Døllner

    2009-10-01

    Full Text Available  Formål: SAMMENDRAGStudie design: Resultater: IL-6 predikerte uavhengig infeksjon (bidrag til infeksjonsdiagnosen. En kombinert parameter bestående av CRP≥ 10 mg/l og/eller IL-6 > 50 pg/mlga en sensitivitet på 96% (95% CI: 88–100%, en spesifisitet på 74% (95% CI: 65–83%, en negativ prediktivverdi på 99% (95% CI: 96–100% og en positiv prediktiv verdi på 49% (95% CI: 35–63%.Konklusjon: diagnosis of severe neonatal infections  ObjectiveENGLISH SUMMARY Study design Results: of IL-6 yielded independent contributions to the diagnosis of infection ( mediator made any further contribution to the diagnosis. A combined parameter of CRP≥ 10 mg/l and/or IL-6 >50 pg/ml yielded a sensitivity of 96% (95% CI: 88–100%, a specificity of 74% (95% CI: 65–83%, a negativepredictive value of 99% (95% CI: 96–100% and a positive predictive value of 49% (95% CI: 35–63%.Conclusion: severe neonatal infections.IL-6 in combination with CRP may constitute a valuable parameter in the early diagnosis ofp p p = 0.03. No other Twentyfour neonates with sepsis, clinical sepsis and pneumonia had significantly raised serumlevels of all six mediators compared to noninfected neonates (all : Blood samples were collected at admittance from 165 neonates who were suspected to have asevere bacterial infection and serum concentrations of the six inflammatory mediators were determined. Weanalysed the mediators, either isolated or in combination, as diagnostic parameters by multiple logisticregression, receiver-operator characteristic plots and predictive value theory (sensitivity and specificity.: To study C-reactive protein (CRP, interleukin-6 (IL-6, soluble tumor necrosis factor receptors(TNFR p55 and p75 and the adhesion molecules ICAM-1 and E-selectin in the early diagnosis of neonatalsepsis.The value of inflammatory mediators in the . Nor J Epidemiol 1997; 7 (1: 73-78.IL-6 i kombinasjon med CRP synes å være en verdifull parameter ved utredning

  9. Survey of biological processes for odor reduction; Kartlaeggning och studie av biologiska processer foer luktreduktion

    Energy Technology Data Exchange (ETDEWEB)

    Arrhenius, Karine; Rosell, Lars [SP Technical Research Inst. of Sweden, Boraas (Sweden); Hall, Gunnar [SIK Swedish Inst. for Food and Biotechnology, Gothenburg (Sweden)

    2009-09-15

    This project aims to characterize chemical and subsequently odor emissions from a digester plant located closed to Boraas in Sweden (Boraas Energi och Miljoe AB). The digestion produces mainly 2 by-products, biogas and high quality organic biofertilizer. Biogas is a renewable source of electrical and heat energy and subsequently digester have a promising future. Unfortunately, release of unpleasant odours is one of the problems that may limit development of the technique as odours strongly influence the level of acceptance of the neighbours. The number of complaints due to odours depends mostly, upon the degree of odour release, the weather condition and plant environment (which influence the risks for spreading out), and the tolerance of the neighbours. These parameters are strongly variable. Many processes inside the plant distributed on a large surface may contribute to odour release. Chemical emissions were studied, in this project, by extensive sampling inside the plant. Results were then evaluated regarding risk for odour releases. The goal was to suggest controls and routines to limit releases. The conditions leading to the higher risks for odour emissions were studied by performing sampling at different periods of the year and subsequently different weather conditions. At first, places for measurement were chosen together with personal of the plant. Three zones are considered to mainly contribute to the odour emissions: the landfill region, the cisterns region and the leaching lake region. Totally 13 places were studied with regard to odour and chemical emissions under 2008-2009 at different weather conditions. Some results from a previous project (2007) are also presented here. Results show that the spreading out of can be maintained to an acceptable level as long as the plant is functioning without disturbances. The early stages of the treatment of waste should be confined in locals with closed doors to avoid spreading out of odours. Through controlled

  10. Commercial kitchens - Feasibility study of energy consumption and food wastage; Storkoek - Foerstudie av energifoerbrukning och livsmedelssvinn

    Energy Technology Data Exchange (ETDEWEB)

    Rolfsman, Lennart; Pettersson, Ulrik; Barr, Ulla-Karin; Sund, Veronica

    2010-07-01

    A pre project aiming at the end to create demonstration examples of full scale professional kitchens is reported. To create a big impact school meals were chosen for the investigation. In Sweden all children are during the day given a cooked lunch. For that reason large kitchens exist in all schools. There are two main different organizations. A central kitchen delivers hot meals to each school where the meals are served to the children. The other model is local kitchens in each school. There are more non technical differences between different communities making the need to analyze more than one kitchen of each type. The two parameters in the study are energy and wasted food

  11. Tegnmakerens skrivelek: En a/r/tografisk studie av en fireårings tegnmaking i mulighetsrike verksteder

    Directory of Open Access Journals (Sweden)

    Full Text Available Artikkelen er et kunnskapsbidrag til tidlig litterasitet studert gjennom a/r/tografisk metodologi, i utøverens (a = artist, utforskerens (r = researcher og utdannerens (t = teacher (heretter artografi sammenvevde trippelperspektiv. Blikket er rettet mot en fireårings tegnmaking i verksteder som tilbyr et mangfold av skrivemedier. Videomaterialet viser jentas respons på spørsmål om hun kan skrive, og om hun da vil skrive navnet sitt eller noe annet, så lenge hun har lyst. Artografisk metodologi tillater utvikling av en rhizomatisk analysetekst basert på observasjon, videoopptak, forskernotater og foto. Teksten belyser at jentas tegnmaking er literasistet preget av en lek med former som samspiller med hennes persepsjoner knyttet til verkstedmiljøenes affordances ADDIN EN.CITE Gibson1986123(Gibson, 19861231236Gibson, James J.The Ecological Approach to Visual Perception1986LondonLawrence Erlbaum Associates (Gibson, 1986. Denne skriveleken inneholder mer enn lek med bokstaver, tall og symboler som forberedelse til skriveferdighet. Ytterligere nærstudier av utvalgte grafemer i denne skriveleken, finner at de har narrative, hybride og estetiske trekk som røper jentas interkulturelle kontekst.  ; Solveig Åsgard Bendiksen

    2017-01-01

    Full Text Available Artikkelen er et kunnskapsbidrag til tidlig litterasitet studert gjennom a/r/tografisk metodologi, i utøverens (a = artist, utforskerens (r = researcher og utdannerens (t = teacher (heretter artografi sammenvevde trippelperspektiv. Blikket er rettet mot en fireårings tegnmaking i verksteder som tilbyr et mangfold av skrivemedier. Videomaterialet viser jentas respons på spørsmål om hun kan skrive, og om hun da vil skrive navnet sitt eller noe annet, så lenge hun har lyst. Artografisk metodologi tillater utvikling av en rhizomatisk analysetekst basert på observasjon, videoopptak, forskernotater og foto. Teksten belyser at jentas tegnmaking er literasistet preget av en lek med former som samspiller med hennes persepsjoner knyttet til verkstedmiljøenes affordances ADDIN EN.CITE Gibson1986123(Gibson, 19861231236Gibson, James J.The Ecological Approach to Visual Perception1986LondonLawrence Erlbaum Associates (Gibson, 1986. Denne skriveleken inneholder mer enn lek med bokstaver, tall og symboler som forberedelse til skriveferdighet. Ytterligere nærstudier av utvalgte grafemer i denne skriveleken, finner at de har narrative, hybride og estetiske trekk som røper jentas interkulturelle kontekst.  

  12. Kommuneplanens samfunnsdel som forankringsredskap i lokalt folkehelsearbeid : case-studie av en planprosess i en norsk kommune

    OpenAIRE

    Bagge, Cecilie Merethe

    2016-01-01

    Folkehelseloven fra 2012 styrker kommunenes ansvar for folkehelsearbeidet, og har et mål om at folkehelsearbeidet skal foregå i alle etater, ikke bare i helsesektoren. Plan- og bygningsloven fra 2008 styrker kommuneplanleggingen, med kommuneplanens samfunnsdel som retningsgivende for kommuneorganisasjon og -samfunn. Det systematiske folkehelsearbeidet skal styrke koblingen mellom planlegging og folkehelse, og innebærer at oversikt over helsetilstand skal ligge til grunn for fastsetting av fol...

  13. Processing biofuels from farm raw materials - A systems study; Pelletering och brikettering av jordbruksraavaror - En systemstudie

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Daniel; Bernesson, Sven

    2008-03-15

    Use of processed biofuels (pellets, briquettes) has greatly increased in Sweden in recent decades, mainly to replace fossil fuels in large boilers, e.g. in coal powder boilers. More recently, the demand from private households and residential heating systems has also increased, mainly due to conversion from fossil heating oil. This increased interest in pellets and briquettes for heating is beginning to cause a shortage of the traditional raw materials, sawdust and wood shavings, and therefore attention is turning to using a variety of agricultural products as raw material. Such raw materials include cultivated energy crops and wastes and by-products from agriculture. This study describes the typical systems currently used for production of pellets and briquettes and investigates the possibility of using energy crops (Salix, reed canary-grass and hemp) and various wastes and by-products from processing of farm products (straw, cereal screenings, rape-seed meal and distiller's waste) as raw materials. Previous experiences of pelletizing and briquetting of these raw materials are reviewed in order to comprehensively identify possible combustion problems that may occur. On the basis of the results obtained, scenarios for possible production systems in a five-year perspective are presented and the costs and energy demands for these systems calculated. These future scenarios include large scale plants and micro-scale plants, as well as static and mobile equipment. The five main conclusions from the study are: - The farm raw materials of greatest interest for large-scale production are pelleted Salix and reed canary-grass. They have competitive prices and acceptable fuel properties and could be mixed with sawdust in existing large-scale pelletizing factories in Sweden. - Straw has low production costs but can cause serious ash-related problems. Hemp has too high production costs to be of commercial interest, while distiller's waste and rape-seed meal currently

  14. Evaluation of an accelerated mineralization process for ashes - feasibility study; Evaluering av jordmaansbildande askbehandlingsprocess (EJA) - foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Ecke, Holger; Bjurstroem, Henrik

    2005-03-01

    In Japan, expenses for landfilling yield about 400 USD per ton of ash, which gives an incentive to reduce the amount of landfilled ash. At NIES (National Institute for Environmental Studies) in Tsukuba, Japan, the AMT process (Accelerated Mineralization Technology) was developed aiming at the treatment of ashes and production of soil-like material for reuse. The objective of the project EJA was to evaluate the AMT process on the basis of available information and the possibilities the process could offer with respect to the conditions present in Sweden. With support of researchers at NIES, available literature including unpublished manuscripts on the AMT process was compiled, translated and evaluated. During treatment, the ashes are washed, aged and mixed with up to 5 % by weight of biodegradable organic matter. The material is stabilized at landfill. During up to several decades, metals are demobilized through a combination of three mechanisms, viz. carbonation, clay formation, and humification. Also persistent organic pollutants (POP) are demobilized due to humification products or they are degraded anaerobically. When the treatment is completed, the reuse of the material is envisaged. Due to the long treatment period, the AMT method might not be favored by ash producers in Sweden. In the future, landfill companies could be interested in the technology, since they are experienced to handle waste at long sight. This, however, requires that the legislation does not pose any hindrance for the implementation of the method, e.g. regarding the requirement to add organic matter to the ash. Above all, it remains several years of research on the AMT process to fully understand and evaluate the underlying biological and chemical processes as well as their interaction.

  15. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    2017-01-01

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  16. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  17. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  18. Förändringen av Incoterms klausulerna samt deras användning bland finländska företag

    OpenAIRE

    Storås, Tea; Granberg, Emilia

    2011-01-01

    Lärdomsprovet behandlar förändringen av Incoterms klausuler samt deras användning bland finländska företag. Ämnet behandlar företag i Finland och dess användning av Incoterms 2010 klausuler vid export och import. Vi avgränsar vårt arbete till att utreda hur Incoterms 2010 påverkat finländska företag samt hur övergången skett från de gamla Incoterms 2000 klausulerna till de nya Incoterms 2010 klausulerna. Lärdomsprovet är uppdelat i en teoretisk del samt i en empirisk del. Den teoretiska delen...

  19. Randomized, double-blind, active-controlled study evaluating the safety and immunogenicity of three vaccination schedules and two dose levels of AV7909 vaccine for anthrax post-exposure prophylaxis in healthy adults.

    Science.gov (United States)

    Hopkins, Robert J; Kalsi, Gurdyal; Montalvo-Lugo, Victor M; Sharma, Mona; Wu, Yukun; Muse, Derek D; Sheldon, Eric A; Hampel, Frank C; Lemiale, Laurence

    2016-04-19

    AV7909 vaccine being developed for post-exposure prophylaxis of anthrax disease may require fewer vaccinations and reduced amount of antigen to achieve an accelerated immune response over BioThrax(®) (Anthrax Vaccine Adsorbed). A phase 2, randomized, double-blind, BioThrax vacccine-controlled study was conducted to evaluate the safety and immunogenicity of three intramuscular vaccination schedules and two dose levels of AV7909 in 168 healthy adults. Subjects were randomized at a 4:3:2:4:2 ratio to 5 groups: (1) AV7909 on Days 0/14; (2) AV7909 on Days 0/28; (3) AV7909 on Days 0/14/28; (4) half dose AV7909 on Days 0/14/28; and (5) BioThrax vaccine on Days 0/14/28. Vaccinations in all groups were well tolerated. The incidences of adverse events (AEs) were 79% for AV7909 subjects and 65% for BioThrax subjects; 92% of AV7909 subjects and 87% of BioThrax subjects having AEs reported Grade 1-2 AEs. No serious AEs were assessed as potentially vaccine-related, and no AEs of potential autoimmune etiology were reported. There was no discernible pattern indicative of a safety concern across groups in the incidence or severity of reactogenicity events. Groups 2-4 achieved success for the primary endpoint, demonstrated by a lower 95% confidence limit of the percentage of subjects with protective toxin neutralizing antibody NF50 values (≥0.56) to be ≥40% at Day 63. Group 1 marginally missed the criterion (lower bound 95% confidence limit of 39.5%). Immune responses were above this threshold for Groups 1, 3 and 4 at Day 28 and all groups at Day 42. Further study of an AV7909 two-dose schedule given 2 weeks apart is warranted in light of the favorable tolerability profile and immunogenicity response relative to three doses of BioThrax vaccine, as well as preliminary data from nonclinical studies indicating similar immune responses correlate with higher survival for AV7909 than BioThrax vaccine. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  20. Å være et Jehovas vitne. En kvalitativ studie av Jehovas vitners tro og praksis

    OpenAIRE

    Førre, Hilde Sjo

    2015-01-01

    Denne avhandlingen har tatt utgangspunkt i følgende problemstilling: Hvordan fremstiller en gruppe Jehovas vitner sin tro og praksis? Og hvordan samsvarer dette med fremstillingen i en læreboktekst? For å finne svaret på problemstillingen, har to kvalitative metoder blitt tatt i bruk. Jeg har utført et fokusgruppeintervju med fire Jehovas vitner, samt en lærebokanalyse av en læreboktekst. Studien har derimot hovedvekten på problemstillingens første del, med fokus på hva som er fremtredende i ...

  1. Mat som egner seg til kos : en kvalitativ studie av hva barneskoleelever i Oslo mener om kosemat

    OpenAIRE

    Bremer, Torgeir

    2013-01-01

    Sammendrag Bakgrunn: Barns kosthold er viktig i et folkehelseperspektiv, ettersom et dårlig kosthold identifiseres som en av de viktigste årsakene til overvekt. I tillegg er barndommen en tid i livet hvor grunnlaget for helse og kostholdsvaner legges. Overvekt hos barn er et betydelig problem i Norge, og norske barn har et kosthold som blant annet inneholder for mye fett og sukker. Å kose seg med mat er et velkjent fenomen i det norske kostholdet, og handler tilsynelatende om å spise usunn...

  2. ”På samme planet": en kvalitativ studie av hva personer med Asperger syndrom forteller om å delta i samtalegrupper

    OpenAIRE

    Neset, Bjørg

    2011-01-01

    Diagnosen Asperger syndrom er i følge ICD – 10 (WHO1993) en gjennomgripende utviklingsforstyrrelse som skiller seg fra autisme ved at personene som får denne diagnosen ikke har noen forsinkelser i språkutvikling og har en normal intelligens. For øvrig er de andre kriteriene for diagnosen sammenfallende med de som gjelder for personer med autisme. En av hovedvanskene for denne gruppen mennesker er å forstå andre i sosialt samspill, og forstå mellommenneskelig kommunikasjon, særlig nonverbal ko...

  3. Insight on AV-45 binding in white and grey matter from histogram analysis: a study on early Alzheimer's disease patients and healthy subjects

    Energy Technology Data Exchange (ETDEWEB)

    Nemmi, Federico; Saint-Aubert, Laure; Peran, Patrice [Inserm, Imagerie Cerebrale et Handicaps Neurologiques UMR 825, Centre Hospitalier Universitaire de Toulouse (France); Universite de Toulouse, UPS, Imagerie Cerebrale et Handicaps Neurologiques UMR 825, Centre Hospitalier Universitaire de Toulouse, Toulouse (France); Adel, Djilali; Salabert, Anne-Sophie; Payoux, Pierre [Inserm, Imagerie Cerebrale et Handicaps Neurologiques UMR 825, Centre Hospitalier Universitaire de Toulouse (France); Universite de Toulouse, UPS, Imagerie Cerebrale et Handicaps Neurologiques UMR 825, Centre Hospitalier Universitaire de Toulouse, Toulouse (France); Centre Hospitalier Universitaire de Toulouse, Service de Medecine Nucleaire, Pole Imagerie, Toulouse (France); Pariente, Jeremie [Inserm, Imagerie Cerebrale et Handicaps Neurologiques UMR 825, Centre Hospitalier Universitaire de Toulouse (France); Universite de Toulouse, UPS, Imagerie Cerebrale et Handicaps Neurologiques UMR 825, Centre Hospitalier Universitaire de Toulouse, Toulouse (France); Centre Hospitalier Universitaire de Toulouse, Service de Neurologie, Pole Neurosciences, Toulouse (France); Barbeau, Emmanuel J. [Centre Hospitalier Universitaire de Toulouse, Service de Neurologie, Pole Neurosciences, Toulouse (France); Universite de Toulouse, UPS, Centre de Recherche Cerveau et Cognition, CNRS, CerCo, Toulouse (France)

    2014-07-15

    AV-45 amyloid biomarker is known to show uptake in white matter in patients with Alzheimer's disease (AD), but also in the healthy population. This binding, thought to be of a non-specific lipophilic nature, has not yet been investigated. The aim of this study was to determine the differential pattern of AV-45 binding in white matter in healthy and pathological populations. We recruited 24 patients presenting with AD at an early stage and 17 matched, healthy subjects. We used an optimized positron emission tomography-magnetic resonance imaging (PET-MRI) registration method and an approach based on an intensity histogram using several indices. We compared the results of the intensity histogram analyses with a more canonical approach based on target-to-cerebellum Standard Uptake Value (SUVr) in white and grey matter using MANOVA and discriminant analyses. A cluster analysis on white and grey matter histograms was also performed. White matter histogram analysis revealed significant differences between AD and healthy subjects, which were not revealed by SUVr analysis. However, white matter histograms were not decisive to discriminate groups, and indices based on grey matter only showed better discriminative power than SUVr. The cluster analysis divided our sample into two clusters, showing different uptakes in grey, but also in white matter. These results demonstrate that AV-45 binding in white matter conveys subtle information not detectable using the SUVr approach. Although it is not more efficient than standard SUVr in discriminating AD patients from healthy subjects, this information could reveal white matter modifications. (orig.)

  4. Projektering av robotcell

    OpenAIRE

    Carnbo, Linda; Suonperä, Nadja

    2012-01-01

    Syftet med examensarbetet var att projektera en fysisk robotcell till Haldex i Landskrona, tillverkare av bromshävarmar, då det finns ett behov hos dem att effektivisera sin produktion för att kunna bibehålla konkurrenskraften och tillverkningen i Sverige. Bromshävarmen är en mogen produkt vilket medför att det inte skulle bli lönsamt att omforma den utan istället fokusera på tillverkningen. Därför vore lösningen att automatisera den del av monteringslinan som inte tillför något värde till sl...

  5. Känsliga kvinnor & drivna män : En genusinriktad studie av Aftonbladets och TT Spektras Melodifestivalbevakning 2011

    OpenAIRE

    Ljung, Rebecka

    2011-01-01

    Medier är i dag en stor informationskälla. Därmed är medierna också medskapare av verkligheten, inklusive genus - även kallat socialt kön. I denna uppsats analyserar jag 19 artiklar med bilder från Aftonbladet och TT Spektra. Ämnet är den svenska musiktävlingen Melodifestivalen och artiklarna handlar om både kvinnor och män i liknande situationer. Texterna kan tänkas ha lockat många läsare, eftersom tv-programmet Melodifestivalen har höga tittarsiffror. Uppsatsens primära syfte är att undersö...

  6. Utveckling av ett snabblyftblock

    OpenAIRE

    Svensk, Johanna; Schönning, Lisa

    2014-01-01

    Detta examensarbete har genomförts i samarbete med Svero Lifting. Företaget säljer och utvecklar lyftanordningar. Svero Lifting arbetar idag med att reducera vikten på företagets komponenter genom ett materialbyte och har påbörjat utveckling av en ny lyftanordning, en blockvagn och ett snabblyftblock. Svero Lifting vill fortsätta utveckla företagets lyftanordning så att komponenterna i lyftanordningen passar varandra och utmärker sig på marknaden. Idag har Svero Lifting inga CAD-modeller elle...

  7. När ens fasta plats försvinner : En kvalitativ studie om anställdas upplevelser av bytet från traditionellt till aktivitetsbaserat kontor

    OpenAIRE

    Hansen, Alicia; Vadsten, Johanna

    2017-01-01

    Denna studie har utgångspunkt i den trend där allt fler organisationer, såväl privata som offentliga, idag inför aktivitetsbaserade kontor. Studiens syfte är att undersöka de anställdas upplevelser av den förändringsprocess som genomförts till aktivitetsbaserat kontor och deras upplevelser av att arbeta aktivitetsbaserat. Dessa upplevelser har belysts utifrån teorier rörande meningsskapande. En kvalitativ studie har genomförts på en myndighet i Stockholmsregionen genom åtta semistrukturerade ...

  8. Gruppebaserede øvelser: en empirisk analyse af muligheder og udfordringer

    Directory of Open Access Journals (Sweden)

    Morten Kyed

    2016-10-01

    Full Text Available Gruppebaseret øvelsesundervisning har et vigtigt, men stadig ikke fuldt (aner-kendt læringspotentiale som redskab i universitetspædagogikken. I denne artikel formidles hovedresultaterne fra den første større danske undersøgelse af erfaringer med gruppebaseret øvelsesundervisning gennemført blandt samtlige studerende og undervisere på sociologistudiet på Aalborg Universitet. Undersøgelsen viser, at undervisere og studerende er enige om øvelsernes læringsmæssige relevans. Endvidere er der enighed om, at øvelsernes primære formål er at diskutere metodiske og teoretiske begreber samt at koble undervisningens begreber til praksis. Dog er deres incitamenter forskellige; underviserene er ofte orienterede mod at træne kritisk og kreativ tænkning gennem aktiv involvering og kollektiv vidensdeling, mens de studerende er ek-samensorienterede. Undersøgelsen viser desuden udfordringer dels i forhold til koordinering underviserne imellem og dels i forhold til de studerendes faglige diversitet og aktivitetsniveau i forbindelse med øvelsesundervisningen. Artiklen slutter derfor af med at diskutere en række organisatoriske og praktiske tiltag, som kan forbedre de studerendes aktivitet, læring og oplevelse af ’alignment’ mellem øvelsesundervisningen, læringsmålene og eksamen. Group-based exercises have an important but still not fully acknowledged role as a learning tool in university pedagogy. This article reports key findings from a study of the experiences of sociology students and teachers at Aalborg University who participated in group-based exercises. The study reveals that teachers and students agree on the relevance of the exercises and that the main purposes of these are to discuss theoretical and methodological concepts and to connect concepts to practice. However, the incentives they stress are different; teachers are often focused on training academic thinking through collective involvement and knowledge sharing, while

  9. Studenters opplevelse av egen og andres bruk av bærbar datamaskin i forelesninger

    Directory of Open Access Journals (Sweden)

    Halgeir Leiknes

    2014-02-01

    Full Text Available Denne studien har sett nærmere på studenters bruk av egen bærbar datamaskin (heretter kalt PC i en forelesningssituasjon. Vi har sett på studenters begrunnelse for bruk og faktiske anvendelse av PC. Studien ble gjennomført i to omganger med fire års mellomrom, der både PC-brukere og de som ikke brukte PC (ikke-brukere svarte.Studenters bruk av PC fremstår som et bevisst valg, og flertallet av studenter velger å ikke benytte PC. Andelen som bruker PC har økt noe, men økningen kan i stor grad forklares med økt tilgjengelighet av egen PC fra 2007 til 2011.Vi ser en klar tendens til at brukerne og ikke-brukerne har ulik oppfatning av andelen faglig og ikke-faglig bruk av PC. Forskjellen består i at ikke-brukerne rapporterer langt mer ikke-faglig aktivitet. Resultatene indikerer at ikke-brukerne forstyrres langt mer av underholdningsrelatert PC-bruk enn av faglig bruk og at de er svært sensitive for slik ikke-faglig bruk.SummaryThis study examined students’ use of their own laptop computer (hereafter called PC in a lecture setting. We have looked at students’ actual use of the PC, as well as their reasons for doing so. The study was conducted in two rounds, separated by four years, with both PC users and non-users (those who did not use a computer responses.Students’ use of PC appears to be a conscious choice, and the majority of students choose not to use a PC. The proportion using a PC increased slightly, but this increase can be largely explained by the increased availability and affordability of PCs from 2007 to 2011.We see a clear tendency for users and non-users to have different perceptions of the proportion of professional and non-professional use of the PC; non-users report far greater non-professional activities. The results indicate that non-users are disrupted far more by entertainment-related PC use than professional use and that they are very sensitive to such non-professional use.

  10. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  11. Formann i motstandsbevegelsen og fremst i hylekoret - eller toppledelsens forlengede arm? : en komparativ studie av mellomlederens betydning for endring i offentlige organisasjoner

    OpenAIRE

    Eriksen, Erik; Worum, Jørgen

    2015-01-01

    Denne avhandlingen er basert på en undersøkelse av offentlige organisasjoner som drives døgnet rundt. Det som er undersøkt er hvilken betydning det har for endring i en organisasjon at det er en leder med personalansvar på jobb samtidig med de ansatte. Undersøkelsen er gjennomført som en komparativ analyse av to caser der det er brukt kvalitativ metode ved intervju av 11 ansatte i Levanger kommune og Oslo politidistrikt. Vi har undersøkt forskjellen mellom en organisasjon der l...

  12. Mapping of the image quality in myocardial scintigraphy: A national study; Kartlaeggning av bildkvalitet vid myokardscintigrafi: en nationell studie

    Energy Technology Data Exchange (ETDEWEB)

    Ohlson, Maria; Gustafsson, Agnetha (Radiofysikavd., Universitetssjukhuset, Linkoeping (SE)); Gretarsdottir, Jakobina (Diagnostik, Sahlgrenska Universitetssjukhuset, Goeteborg (SE)); Olsson, Eva (Fysiologiska kliniken, Universitetssjukhuset, Linkoeping (SE)); Johansson, Lena (Klinisk Fysiologi, Sahlgrenska Universitetssjukhuset, Goeteborg (SE))

    2008-04-15

    The aim of this study was to make a survey over the physical parameters and how they affect the image quality and the final diagnosis for myocardial perfusion SPECT in Sweden. Another aim was to evaluate the need for standardized acquisition and processing protocols for myocardial perfusion SPECT. All thirty nuclear medicine departments in Sweden that perform myocardial perfusion SPECT participated in the study. A thorax heart phantom was used to simulate two patients. All studies were acquired and processed with the parameters used clinically in each hospital respectively. A quantitative and a qualitative evaluation were performed. At each hospital, the local nuclear medicine physician interpreted the images as if they were true patient images. There are great differences in the acquiring and processing parameters used in myocardial perfusion SPECT studies in Sweden. The image quality varies greatly for the different hospital but was approved for the majority of the hospitals. Images from two hospitals were considered to be too poor to be diagnosed. The interpretations of the local nuclear medicine physicians differ but the majority has reported an adequate diagnosis. One third of the hospitals have reported false positive defects. All steps in the chain from the acquisition to the evaluation of the medicine physician must be performed with high quality. The determinative factors are the noise reduction filter, the orientation of the slices in the heart and the judgement of the local medicine physician. The acquiring and processing parameters proposed by EANM should be used. The hospitals are also recommended to investigate in the time and resources available, in order to educate all staff involved in the evaluation of myocardial studies

  13. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  14. Study of flue gas condensing for biofuel fired heat and power plants; Studie av roekgaskondensering foer biobraensleeldade kraftvaermeanlaeggningar

    Energy Technology Data Exchange (ETDEWEB)

    Axby, Fredrik; Gustafsson, J.O.; Nystroem, Johan; Johansson, Kent

    2000-11-01

    This report considers questions regarding flue gas condensing plants connected to bio-fuelled heat and power plants. The report consists of two parts, one where nine existing plants are described regarding technical issues and regarding the experience from the different plants. Part two is a theoretical study where heat balance calculations are made to show the technical and economical performance in different plant configurations and operating conditions. Initially the different parts in the flue gas condensing plant are described. Tube, plate and scrubber condensers are described briefly. The different types of humidifiers are also described, rotor, cross-stream plate heat exchanger and scrubber. Nine flue gas-condensing plants have been visited. The plants where chosen considering it should be bio-fuel fired plant primarily heat and power plants. Furthermore we tried to get a good dissemination considering plant configuration, supplier, geographical position, operating situation and plant size. The description of the different plants focuses on the flue gas condenser and the belonging components. The fuel, flue gas and condensate composition is described as well as which materials are used in the different parts of the plant. The experience from operating the plants and the reasons of why they decided to chose the actual condenser supplier are reported.

  15. Knihovna Sociologického ústavu AV ČR

    Czech Academy of Sciences Publication Activity Database

    Hesová, Nela

    2017-01-01

    Roč. 7, č. 3 (2017) E-ISSN 1805-2800 Institutional support: RVO:68378025 Keywords : library Subject RIV: AF - Documentation, Librarianship, Information Studies https://www.lib.cas.cz/casopis-informace/knihovna-sociologickeho-ustavu-av-cr/

  16. #SponsoredPost : En kvalitativ studie av hur samarbeten mellan Influencers och företag konstrueras på Instagram

    OpenAIRE

    Andreasson, Jennifer; Hildebrand, Louise

    2016-01-01

    Under år 2016 har marknadsföringsstrategin influencer marketing, att låta inflytelserika personer dela budskap om varumärken online i form av sponsrade innehåll, ökat i popularitet. Den här uppsatsen ämnar öka förståelsen kring hur Influencers konstruerar inlägg som är sponsrade av företag på medieplattformen Instagram i Sverige idag. Vår ambition är att bidra med kunskap inom området marknadskommunikation, som företag i sin tur kommer kunna använda sig av i framtida samarbeten. I den här stu...

  17. I nöd och lust : En praktisk studie om hållbara bröllopssminkningar inspirerat av årstidernas färger

    OpenAIRE

    Guldbrand, Ida

    2016-01-01

    Syftet med detta arbete är att beskriva med vilka sminktekniker och produkter man får till hållbara bröllopssminkningar inspirerade av årstidernas färger, för att visa hur färger, tekniker och produkter anpassas i bröllopssminkningar. Detta för att visa de egna kunskaperna inom området och för att kunna inspirera blivande brudar. Arbetet kommer även vara till nytta för estenomer, branschmänniskor och andra människor som är intresserade av området då de också kan inspireras av arbetet. So...

  18. Opplevelsen av god helse på tross av KOLS

    OpenAIRE

    Blakseth, Margrethe

    2017-01-01

    Master i folkehelsevitenskap med vekt på endringer av livsstilsvaner, 2017 Bakgrunn: Verdens helseorganisasjon (WHO) kom i 1978 med utsagnet og et ambisiøst mål kalt «Helse for alle i år 2000». I 2013 i Almaty ble det på nytt diskutert de globale utfordringene. Her ble det fokusert på to hovedtemaer, ulikheter i helse og den økte byrden av kroniske sykdommer. Hovedvekten ble lagt på samarbeid mellom helsevesenet og brukerne for å imøtekomme disse problemene. I Stortingsmelding 26 snakkes d...

  19. Mixning, samplingsbaserad & livespelad musik : En kvalitativ studie i vilka förhållningssätt nutida etablerade mixningstekniker har till två kategorier av musikinstrumentering

    OpenAIRE

    Johansson, Joel

    2017-01-01

    Med kunskap om mixningsstilar och mixningsideal i musikgenrer som grund, undersöker den här forskningen en kategorisering av musik som tar fäste i instrumentering. Syftet är att undersöka möjliga mixningsstilar och mixningsideal beroende på om instrumenteringen är samplingsbaserad eller livespelad. Forskningen ämnar till att kunna presentera hur nutida mixningsteknikers och producenters tankevärldar ser ut kring fenomenet. Metoden som använts är en kvalitativ datainsamling med hjälp av semist...

  20. Apolipoprotein AV does not contribute to hypertriglyceridaemia or triglyceride lowering by dietary fish oil and rosiglitazone in obese Zucker rats

    NARCIS (Netherlands)

    Dorfmeister, B.; Brandlhofer, S.; Schaap, F. G.; Hermann, M.; Fürnsinn, C.; Hagerty, B. P.; Stangl, H.; Patsch, W.; Strobl, W.

    2006-01-01

    AIMS/HYPOTHESIS: Apolipoprotein AV (apoAV) is a recently discovered apolipoprotein with a triglyceride-lowering effect in genetically modified mice. Transcription of the human gene encoding apoAV (APOA5) is suppressed by insulin and stimulated by fibrates. Our goal was to study the expression of

  1. Hva påvirker krangling og slåssing i drikkesituasjoner? En sammenlignende studie av Oslos generelle befolkning og kafégjester i Oslo

    Directory of Open Access Journals (Sweden)

    Bente Træen

    2009-10-01

    Full Text Available  sAMMENDRAGFormålet med denne studien er, med utgangspunkt i to ulike materialer, å beskrive negative konsekvenser av egetalkoholbruk. Hva predikerer at urbane mennesker angrer på noe de har sagt eller gjort, kommer opp i krangel ellerhavner i slåsskamp under alkoholpåvirkning, og er det forskjeller i så henseende mellom de som er mye og liteeksponert for andre mennesker når de drikker? I det såkalte kafégjestmaterialet ble data innhentet ved hjelp avspørreskjemaer besvart av 1053 gjester på 41 offentlige skjenkesteder i Oslo. I tillegg er det benyttet data fra etrepresentativt utvalg av 297 personer i Oslo (Osloutvalget. Resultatene viste at andelen som rapporterte negativeerfaringer i samband med eget alkoholbruk var høyere i kafégjestmaterialet enn i Osloutvalget. I beggematerialene rapporterte yngre respondenter oftere enn eldre at de hadde angret på noe de hadde sagt eller gjort,kranglet med noen og kommet opp i slagsmål. Å angre på noe sagt eller gjort hadde ingen sammenheng medantallet timer tilbrakt ukentlig på kaféer i materialene. Blant kafégjestene, men ikke blant Oslofolk generelt, haddeantall timer tilbrakt ukentlig på kaféer sammenheng med å ha kranglet og å ha slåss med noen i en drikkesituasjon.Å havne i slåsskamp eller håndgripeligheter hadde sammenheng med antallet timer tilbrakt ukentlig på kaféer ibegge materialene. Korrelasjonen mellom antall dager med hardere drikkeepisoder på kafé, og antall timerukentlig på kafé, var sterk både i Osloutvalget og i kafégjestmaterialet. Det er sannsynlig at det er harderedrikking på utesteder som er avgjørende for å krangle eller slåss med noen i beruset tilstand, og ikke det åtilbringe tid på utesteder per se. Dette tyder på at større offentlig innsats for å kontrollere at de bestemmelsenesom gjelder for offentlig skjenking av alkohol overholdes, kan redusere voldsnivået på skjenkestedene.Træen B. What influences quarrelling and fighting in

  2. Modeomslag - en empirisk studie om hur ett modeomslag skapas från idé till publicering

    OpenAIRE

    Norrgård, Annika

    2013-01-01

    Syftet med detta examensarbete är att undersöka hur man producerar ett modeomslag, processen från att en idé föds till ett slutresultat som publiceras i en modetidning. Respondenten vill även undersöka på vilket sätt modeomslagen har utvecklats genom årtionden och vilka skillnader som syns på omslaget. Med undersökningen vill respondenten fördjupa sin kunskap inom området och sätta fokus på omslagsbilden. Arbetet skall ge personer inom branschen, samt andra med intresse för modebilder och mod...

  3. Såga rakt och tillverka uttryck : En studie av hantverkskunnandet i slöjdämnet

    OpenAIRE

    Frohagen, Jenny

    2016-01-01

    Sloyd is related to craft knowing, making traditions and materiality. The meaning of knowing in sloyd is vaguely articulated and thereby can be interpreted by teachers in different ways. This study aims at contributing to an articulation of craft knowing within sloyd education. The study was carried out in the form of two learning studies, each one focusing on a specific object of learning. The knowing of sawing straight was studied through phenomenographic analysis of video recordings of stu...

  4. Open absorption heat pump for waste heat utilization in the forest industry. A study of technical and economic potential; Oeppen absorptionsvaermepump foer uppgradering av spillvaerme fraan skogsindustrin. Studie av teknisk och ekonomisk potential

    Energy Technology Data Exchange (ETDEWEB)

    Westermark, Mats; Vidlund, Anna

    2006-02-15

    Waste heat from the forest industry is mainly humid air or humid flue gases with somewhat too low dew point for direct use as district heating or for other qualified purposes. Upgrading of the temperature by heat pumps is thus often necessary for the full use of the waste heat. This study evaluates an open absorption heat, based on hygroscopic condensation. The hygroscopic condenser has the potential to replace mechanical heat pumps or conventional absorption heat pumps (based on lithium bromide) for the upgrading of heat from humid gases. The goal for the project is to evaluate technology and potential for an open absorption heat pump for heat recovery from humid gases in the forest industry. In an open heat pump the humid gas is brought in direct contact with the hygroscopic liquid (whereas a conventional heat pump uses an intermediate circuit with evaporation of water in the evaporator). The direct contact makes it possible to recover the heat at a higher temperature than the dew point of the humid gas without the use of evaporator. The target group for the study is the forest industry and its suppliers of technology and knowledge. The study has been carried out in cooperation with representatives from the forest industry and from suppliers of equipment. The study shows that the forest industry has good potential to upgrade waste heat from humid air to district heating. The waste heat can be extracted from various humid gases such as exit air from paper machines, wood driers, green liquid quenchers and flue gases from soda boilers, mesa kilns, bark-fired boilers and gas engines. Hygroscopic condensation is considered to give economic and environmental advantages compared to conventional absorption heat pumps due to much less consumption of driving heat. An interesting special case is the regeneration of the hygroscopic medium by direct contact with hot flue gases and for this application a patent application has been filed. Upgrading of waste heat to process

  5. Kvinnor och män i möte : En samtalsanalytisk studie av interna arbetsmöten

    OpenAIRE

    Milles, Karin

    2003-01-01

    The aims of this thesis were to describe the verbal interaction in workplace meetings and to relate them to the order of gender. The material consists of five workplace meetings with both female and male participants and was transcribed using a system developed for the purposes of the study. Both the videotapes and transcripts were used in the analyses. Three main studies were carried out. The first study aimed at describing the structuring of the verbal interaction during the meetings, espec...

  6. Homo economicus på NMBU : en komparativ studie av økonomistudenter og ikke-økonomistudenter

    OpenAIRE

    Stene, Eirin

    2017-01-01

    A number of independent studies have shown that those who study economics are more prone to selfish behavior than students of other subjects. One explanation behind these findings seems to be that there is an ideological element in business studies that emphasize the importance of selfish behavior – the notion of the so-called homo economicus. The purpose of this master thesis has been to compare different student groups to investigate whether economics students act more in line with cert...

  7. Gåvan 2.0 : En museologisk studie av förmålsdonationer och dess bakomliggande motiv

    OpenAIRE

    Fjellström, Daniel

    2011-01-01

    The Gift 2.0 - A Museological Study of donations of Objects and its Underlying Motives, is a study in order to explain why people choose to donate items for museums, rather than any other alternative.The empirical study consists of qualitative, semi-structured research-interviews conducted with seven selected curators from various museums, with extensive experience of the subject acquisition. I have chosen to only examine Swedish cultural-historical museums. The hypothesis that I assumed was ...

  8. Ny versjon av standarden ISO 15489

    OpenAIRE

    Herbjørn Andresen

    2016-01-01

    Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. ...

  9. En analyse av Yoga-kundalini-upanisad

    OpenAIRE

    Martinsen, Fred

    2006-01-01

    Avhandlingen En analyse av Yoga-kundalini-upanisad bygger på den indiske asketen Narayanaswamy Aiyers engelske oversettelse av Yoga-kundalini-upanisad, utgitt i Thirty Minor Upanisad-s, Including the Yoga Upanisad-s (Oklahoma, Santarasa Publications, 1980). Denne hinduistiske teksten er omtalt som en av de 21 yoga-upanishadene, den åttisjette av de 108 klassiske upanishadene, og utgjør en del av tekstkorpuset Krsna-Yajurveda. Teksten fungerer som en manual i øvelser fra disiplinene hathayoga,...

  10. "Film med undertext" : - "En studie om tillgänglighet av film för döva och personer med hörselnedsättning."

    OpenAIRE

    Tärnskär, Filip; Jonatan, Helgason

    2016-01-01

    Den här uppsatsen utforskar döva och hörselnedsattas upplevelse av film. Syftet är att undersöka möjligheter i hur man kan öka tillgängligheten av film då man inte längre kan förlita sig på ett ljudberättande. Den undersökande delen av uppsatsen består av två delar. Arbetet med kandidaten inleddes med en enkätundersökning där målgruppen, döva och personer med hörselnedsättning, fick beskriva sin upplevelse av film. Den andra delen av undersökningen bestod av att praktiskt testa resultatet av ...

  11. Biofuel Drying - Literature Study and Definitions, Concepts and Terms; Torkning av biobraensle - litteraturstudie samt definitioner, begrepp och termer

    Energy Technology Data Exchange (ETDEWEB)

    Sanati, Mehri; Faghihi, Mostafa

    2001-09-01

    The report contains one section with definitions and explications of terms in the field of drying of biofuels. The second section presents, in english, the result of a literature study in the same subject, based on 90 literature references.

  12. Environmental effects of the use of polymers in the biogas industry - Pre study; Miljoeeffekter av polymerer inom biogasbranschen - Foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Henriksson, Gunilla; del Pilar Castillo, Maria; Jakubowicz, Ignacy; Enocksson, Haakan; Ascue Contreras, Johnny; Lundgren, Per; Engstroem, Thomas

    2011-07-01

    Avfall Sverige - Swedish Waste Management's Steering Group for certification of digestate [1] got an inquiry from the biogas industry if the use of polymers as additive in the biogas process is allowed. A requirement according to the certification system is that any additive used must be free from negative effects on the digestate or the soil quality. This study is initiated because of the limited knowledge of how the use of polymers affects the environment. The study is intended to be used as a basis for a decision by the Steering Group concerning the use of polymers in digestate and for an approval by the agri-food industry. The purpose of this study is to gather basic knowledge on the polymers used in dewatering and to identify polymer candidates and analytical methods for further studies of degradation, accumulation and toxicity. The project is limited to include a literature review, a survey concerning the use of polymers at biogas and sewage treatment plants, an impact analysis and a compilation of relevant laws and directives through contacts with authorities. No laboratory or field tests are included in this study. Sewage treatment plants (STPs) were included in the survey as they have been using polymers for dewatering of sewage sludge for many years and therefore should have substantial knowledge about polymers and their environmental effects. According to the literature, the side chains of polyacrylamide (PAM) can be degraded both aerobically and anaerobically. However, the polymer backbone degrades slowly or not at all in the environment, possibly leading to accumulation. Reported effects of PAM on the biogas process are conflicting, showing both inhibitory effects and no effects on the biogas process. Knowledge about the environmental impacts to be expected from spreading polymer amended bio-manure or sewage sludge is limited. The authorities have not handled the issue before and have no further information. Polymer amended sewage sludge has been

  13. Sociala medier och den personliga integriteten : En studie av studenters syn på nätet

    OpenAIRE

    Borgström, Thomas

    2016-01-01

    Social media has revolutionized how people communicate with eachother. It’s been used by a lot of people in the world and people sharing everything from pictures, videos and information. Personal information has become the new economic value, where authorities and companies can sell it to third party. The aim of the study has focused on how students perceive their own use with regard to privacy on social media and what they feel about privacy settings. To answer these questions data collectio...

  14. Forståelse av åndelighet og åndelig omsorg for gamle mennesker – en hermeneutisk studie

    Directory of Open Access Journals (Sweden)

    Linda Rykkje

    2016-06-01

    Full Text Available Understanding spirituality and spiritual care for older people – a hermeneutical study In old age, spirituality and existential issues may become salient. The study aim is an understanding of older peoples’ perception of spirituality and spiritual care in a Norwegian context. Gadamer hermeneutics is the guiding methodology. 30 interviews were conducted with 17 participants between 74-96 years, six self-reliant, five with homecare, and six nursing home residents. The findings present understanding of spirituality, soul and spirit, the meaningful in life, inner peace, care from family in old age, and spiritual care. The study discusses spirituality as a force that contributes to wholeness and health, especially by the experience of “inner calm and peace”. That which may contribute to inner peace is love for fellow human beings and being with others, religion and nature, together with meaningful activities and feeling “alive”. Spiritual care involves “to care about” the whole person through compassionate care, presence, listening, touch and facilitating socializing and activities.

  15. Hjälten Tor : En studie om framställningen av Tor i film och text

    OpenAIRE

    Hansson-Böe, Louise

    2014-01-01

    Abstract In this study you are going to meet the Nordic Good Thor. I will present a short historic presentation of the Nordic mythology, about the Ragnarok and also I will give a short presentation on several other Gods.   I have done three film analyses on movies about Thor. The movies are Thor, The Avengers and Thor- the Dark World. I have compared these three movies about Thor with the Thor that is presented in the literature. I have seen closely on the appearance of Thor, his character an...

  16. Den årliga julfesten : en kvalitativ studie om socialiseringsprocessen in i organisationskulturer med hjälp av riter

    OpenAIRE

    Severin, Beatrice; Angeklint, Emmy

    2015-01-01

    Denna studie syftar till att skapa en förståelse hur julfester fungerar som en rit för socialisering in i organisationskulturer och hur de kan upplevas ur medarbetares perspektiv. För att göra det möjligt att undersöka detta syfte definierades tre frågeställningar: ”Hur upplever medarbetare att organisationens medlemmar kommunicerar angående julfesten?”, ”Vilken mening tillskriver medarbetare inom organisationer julfester?” samt ”Vilken betydelse anser medarbetare inom organisationer att julf...

  17. Review study 1995. Localization of the repository for spent nuclear fuel; Oeversiktsstudie 95. Lokalisering av djupfoervar foer anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    This report gives an overview of the studies performed by SKB pertinent to selection of a site for the Swedish repository for spent nuclear fuels, and is written for both experts in the various fields involved, decision-makers and the interested general public. The review can not comprise all detailed factors necessary for deciding the localization, but deals mainly with conditions on the land surface and can point out areas which are not well suited or less interesting as a site. It also treats several scientific, technical and social bases in different parts of the country. 120 refs, 53 figs.

  18. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  19. Experimental and theoretical studies of the gas flow in grate-fired boilers; Studier av gasstroemning i rosteldade pannor

    Energy Technology Data Exchange (ETDEWEB)

    Eriksson, Jan; Tryman, R. [National Defense Research Establishment, Tumba (SE)

    1990-12-19

    In order to obtain a deeper understanding of the gas flow characteristics of a real boiler, the isothermal flow in a perspex water model of a 12 MW grate-fired boiler has been studied. Comparison between measured and calculated cold flow velocities were made. The model dimensions were 0.24 m width, 0.5 m length and 0.7 m height. The width of the boiler relative to other dimensions were such that the general flow pattern in the study has been treated as two-dimensional. Laser-Doppler-Velocimetry (LDV) measurements of horizontal and vertical velocity profiles including turbulent velocity components were carried out. Measurements were performed in about 230 positions. Numerical calculations were carried out with the fluid flow simulation program FLUENT. Two different grid sizes were used and the k-epsilon turbulence model as well as the Algebraic Stress Model (ASM) have been applied. Standard values of the model constants were used. Comparison between measured and calculated data show acceptable agreement. The mean velocities are qualitatively very well and quantitatively quite well predicted, meaning for example that the extent of the recirculation zones in the upper part of the boiler is quite correctly given by the calculations. For the turbulence quantities, the qualitative agreement is good, although quite large quantitative discrepancies exist. The results are, in the opinion of the authors, positive enough to motivate further efforts directed towards the modelling of the gas flow in the real boiler.

  20. Upplevelsen av utnyttjadkompetens : En studie hur första linjens chefer i Landstinget i Jönköpings länupplever att deras kompetens utnyttjas

    OpenAIRE

    CARLSSON Johan; Siljehult, Mats

    2009-01-01

    Hur upplever första linjens chefer att deras kompetens utnyttjas av arbetsgivaren? I detta arbete har vi utifrån Ellström steoretiska ram och begreppsförklaring undersökt upplevelserna hos åtta intervjupersoner i Landstinget i Jönköpings län i syfte att få mer kunskap om hur den gruppen ser på hur deras kompetens utnyttjas. Vi har utifrån fem grupper av efterfrågad kompetens i rekryteringsannonser  djupintervjuat åtta första linjens chefer. Vi har efterfrågat hur de upplever efterfrågad kompe...

  1. Den koreanske bølgen - En kulturvitenskapelig studie av sørkoreansk populærkultur, og hvordan den har nådd Vesten

    OpenAIRE

    Kvinge, Kristin Øyvindsdatter

    2016-01-01

    Hensikten med denne oppgaven er å se på den koreanske bølgen, som ofte refereres til som Hallyu. Den tar for seg både Hallyu som innhold og Hallyu som fenomen. Den koreanske bølgen har spredd seg hurtig i løpet av de siste 20 årene, noe som har bidratt til å gjøre Korea til en av de hurtigst økende økonomiene i den moderne tid. Denne oppgaven forsøker å se nærmere på hvordan Hallyu har nådd Vesten, med fokus på Europa og Norge. Før analysen vil oppgaven se nærmere på hv...

  2. Vilken betydelse har karisma i dagens samhälle? : En socialkonstruktivistisk studie av karisma i självhjälpslitteratur

    OpenAIRE

    Sandstedt, Elin

    2012-01-01

    Karisma är ett fenomen som under lång tid väckt stort intresse och fascination bland människor, däribland mig själv. Däremot är begreppet aningen diffust och det har därför varit svårt att hitta en entydig definition av karisma. För att undersöka dimensionerna av karisma har jag i denna uppsats valt att undersöka karismans betydelse i dagens samhälle. Syftet med undersökningen har varit att undersöka hur fenomenet karisma som begrepp konstrueras i en bestämd social kontext i samhället idag, v...

  3. Säg något intressant! : En kvalitativ studie av marknadskommunikation på Facebook

    OpenAIRE

    Johansson, Elin; Johansson, Hanna; Nilsson, Camilla

    2011-01-01

    ABSTRACT Elin Johansson, Hanna Johansson, Camilla Nilsson Say something interesting! A qualitative study of marketing communication on Facebook                               Pages: 36 With the emergence of social media, new ways has been created for companies to reach out to its audience. From being dependent on journalists to provide information, companies today have the ability to self-publish information in the open media channels. The use of social media should not replace traditional mar...

  4. Environmental impacts of wind power. Case study of wind turbines in living environment; Vindkraftens Miljoepaaverkan. Fallstudie av vindkraftverk i boendemiljoe

    Energy Technology Data Exchange (ETDEWEB)

    Widing, Angelica; Britse, Gunilla; Wizelius, Tore [Gotland Univ., Visby (Sweden). Windpower information centre

    2006-06-15

    The aim of this project has been to get more knowledge about the impact of noise, shadows and on the view of the landscape from wind turbines. Further to be able to increase the reliability and relevance of the methods used to calculate and evaluate nuisances from wind turbines in applications for wind power development. We have also tried to find other factors that can play a role for the evaluation of wind turbines, if they will be considered as a nuisance or not. The research has focused on a critical review of the methods and regulations that are used in Sweden and other countries, and case studies to find out how people living neighbors with wind turbines will be affected by noise, rotating shadows, visual intrusion and other factors. This report includes the case studies of wind turbine areas at Gotland. Three different areas on the island Gotland in the Baltic Sea, with wind turbines in the close neighborhood, were chosen for case studies: Naer, Klintehamn, Naesudden. In these places only persons who live close to wind turbines have been interviewed; in Nar all who live within 1100 meters from two large wind turbines, in Klintehamn a sample of those who live ESE of the turbines and get shadow flicker from them during sunset, and on Naesudden those households that live in the middle of a large wind farm with 81 turbines. In total 94 persons in 69 households have been interviewed. The acceptance of wind power among people living as close neighbors is quite high. However, the nuisance and annoyance can be reduced further, if the recommended values for noise immission etc are applied correctly. To do that the ability of project developers and authorities that grant permissions to evaluate the calculated immission has to be raised, since specialist competence and experience is necessary to do predictions of actual immission from the models used for calculations. The recommended minimum distances between wind turbines and houses that some communities have

  5. Hälsa i sociala medier : En kvalitativ studie om hur hälsoinformatörer upplever och påverkas  av hälsobudskap i sociala medier.

    OpenAIRE

    Hedström, Anna

    2015-01-01

    Title: Hälsa i sociala medier - En kvalitativ studie om hur hälsoinformatörer upplever och påverkas  av hälsobudskap i sociala medier. Title: Health in social media - A qualitative study of how health communicators perceive and are affected by health messages in social media. Author: Anna Hedström Institute: Karlstad University. Faculty of health, nature and engineering sciences. Tutor: Owe Stråhlman Date: 150615 Number of pages: 34 Keywords: eHealth literacy, health communication, health inf...

  6. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  7. Aksjonsbasert utdanning : en studie av entreprenørskapsutdanningen ved Chalmers, og hvordan denne modellen kan forbedre læringsutbyttet på master i entreprenørskap og innovasjon på NMBU

    OpenAIRE

    Thomassen, Heidi Sunde

    2014-01-01

    Utdanning innen entreprenørskap og innovasjon er en økende trend, og NMBU har tilbudt sitt masterprogram siden 2008. Denne oppgaven har som formål å se om mer praktisk undervisning i master i entreprenørskap og innovasjon kan gi økt praktisk læringsutbytte for NMBU-studenter. Jeg har gjennomført et kvalitativt case-studie der Chalmers Entreprenørskole i Gøteborg er caset. Caset er valgt fordi Chalmers er ledende i Norden på entreprenørskapsutdanning. NMBU kan dra fordeler av å se på denn...

  8. Bankvärldens framtid : En studie kring hur banker utnyttjar den teknologiska utvecklingen och digitaliseringen av tjänster, samt dess påverkan på kundrelationer, förtroende och lojalitet

    OpenAIRE

    Grip, Sebastian; Hellström, Gustav; Skyttevall, Tobias

    2017-01-01

    Titel: Bankvärldens framtid: En studie kring hur banker utnyttjar den teknologiska utvecklingen och digitaliseringen av tjänster samt dess påverkan på kundrelationer, förtroende och lojalitet   Nivå: Kandidatuppsats i företagsekonomi   Akademi: Akademin för Ekonomi, Samhälle och Teknik, Mälardalens Högskola   Författare: Sebastian Grip, Gustav Hellström och Tobias Skyttevall (92/04/22), (94/02/28), (95/05/21) Handledare: Hadjikhani, Annoch   Datum: 05–06–17   Bakgrund: Att skapa en lojal kun...

  9. Visualisering av farmakologiska substanser i levervävnad med hjälp av masspketrometrisk bildtagning

    OpenAIRE

    Mäkinen, Matias

    2017-01-01

    Målet för detta forskningsprojekt var att utveckla en metod med vars hjälp det är möjligt att detektera farmakologiska substanser i levervävnad med hjälp av masspektrometrisk bildtagning, så kallad MALDI-MSI. I litteraturen finns beskrivet tillämpningar av MALDI-MSI med vars hjälp det detekterats till exempel lipider i vävnader eller såsom i denna studie farmkologiska substanser. Arbetet bestod av två delmoment. I den första delen isolerades hepatocyter ur råttlever genom att perfusera k...

  10. Bildbaserade medier : -en kvalitativ studie av hur unga kvinnor använder sig av olika sociala medier för olika sociala ändamål

    OpenAIRE

    Lantz, Imad

    2017-01-01

    This study analyses how young women present themselves on social media, using Facebook and Instagram as their main networking tools. The purpose of this study is to find out how these women use social media, how they motivate their choice between Facebook and Instagram, how Facebook and Instagram create the needs for these women, and how these women decide the difference between Facebook and Instagram. Previous surveys from earlier studies regarding this topic have been collected trough books...

  11. Effektivitetsundersokning av medeltida kastmaskiner

    OpenAIRE

    Lemne, Jennifer

    2013-01-01

    Through the ages mankind has developed and tested a cascade of varying weapons of war, large and small, and has has striven to push these creations to the limits of their time. A grand example of this are the medieval siege engines that have changed shape several times over the centuries. After all this time the eciency of these siege engines will have reached their peek. . . right? In this study the eciency of several siege engines will be evaluated and the possibility of improvement will be...

  12. Att rekonstruera julens budskap -En kvalitativ studie av hur kommersiella företag och hjälporganisationer använder sig av föreställningar om julen i reklamfilm.

    OpenAIRE

    Falk, Rebecka

    2015-01-01

    The purpose of this study is to investigate and increase the understanding of how the two commercial companies IKEA and SAS and the two aid organizations/nonprofit organizations UNICEF and Save the Children use perceptions of Christmas to produce messages in their Christmas advertising/commercial film. The study also discusses if there may be communicative and pictorial similarities and differences in how these brands constructs messages in commercials, and why it may be that the brands choos...

  13. Vidareutveckling av PROFIBUS-modul

    OpenAIRE

    Forsberg, Andreas; Larsson, Christoffer

    2010-01-01

    Denna rapport beskriver ett examensarbete som gjordes på företaget Motion Control i Västerås AB. Rapporten följer projektets utvecklingssteg och beskriver hur arbetet med att ta fram elektronik och inbyggd programvara för en kommunikationsmodul har framskridit. Kommunikationsmodulen ska fungera som en länk mellan en styrenhet och en I/O-enhet.   De inledande delarna av rapporten tar upp undersökningar på kommunikationsprotokollen PROFIBUS och PROFINET som är vanliga kommunikationsmetoder inom...

  14. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease.

    Science.gov (United States)

    Paech, Christian; Dähnert, Ingo; Kostelka, Martin; Mende, Meinhardt; Gebauer, Roman

    2015-01-01

    Junctional ectopic tachycardia (JET) is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV) block and the occurrence of JET. Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001), whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56). temporary third degree AV block did not suffer from JET. A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  15. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease

    Directory of Open Access Journals (Sweden)

    Christian Paech

    2015-01-01

    Full Text Available Aim: Junctional ectopic tachycardia (JET is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV block and the occurrence of JET. Materials and Methods: Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. Results: The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001, whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56. temporary third degree AV block did not suffer from JET. Conclusions: A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  16. Från elitidrott till yrkeskarriär : En studie av elitidrottsutövares upplevelser av karriärövergång och ledarkvalitéer

    OpenAIRE

    Hellgren, Alfred; Hörnberg, Henrik

    2017-01-01

    There have been numerous of examples where former elite athletes have had a problem with adaptingto the life as a civilian. Research has shown that it is common among former athletes to experiencenegative emotions when ending an elite career in sports. What separated the ones who successfullymoved on to achieve greatness outside of the sports environment? This study was about female formerelite athletes which have a senior position and their views on what role the elite career had on theirfol...

  17. ”…från att vara ett föremål av guld till en ’rostig metallbit’.” : en rättssociologisk studie, med en diskursanalytisk metod, av domar med hederskontext

    OpenAIRE

    Heller, Paulina; Ulfsparre, Karin

    2006-01-01

    This paper discusses honour related crimes and the judicial process within the legal system in a Swedish context. The empirical base of the study is four cases, with an honour background, and we have used discourse analysis as our method. We have developed four tools for analysing the sentences with which we observed aspects such as; language, the roles of victim and perpetrator that the involved can undertake, the different identities that the sentence might create and finally how the storie...

  18. Reversing the direction of paced ventricular and atrial wavefronts reveals an oblique course in accessory AV pathways and improves localization for catheter ablation

    NARCIS (Netherlands)

    Otomo, K.; Gonzalez, M. D.; Beckman, K. J.; Nakagawa, H.; Becker, A. E.; Shah, N.; Matsudaira, K.; Wang, Z.; Lazzara, R.; Jackman, W. M.

    2001-01-01

    The purpose of this study was to determine how often accessory atrioventricular (AV) pathways (AP) cross the AV groove obliquely. With an oblique course, the local ventriculoatrial (VA) interval at the site of earliest atrial activation (local-VA) and the local-AV interval at the site of earliest

  19. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  20. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  1. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  2. Förpackning av keramiska substrat

    OpenAIRE

    Karlsson, Jan

    2008-01-01

    Detta examensarbete handlar om forpackning av keramiska substrat. Canning ar det universella namnet pa forpackning av keramiska substrat. Keramiska substrat kan vara katalysatorer eller partikelfilter som anvands som ett efterbehandlingssystem i bensin och Diesel applikationer. Examensarbetet genomfordes hos Scania CV AB. I installationsprocessen sveps en keramisk fibermatta runt det keramiska substratet. Substratet inkapslas sedan med ett metalholje. Rapporten inleds med att beskriva olika i...

  3. Fra idealer til praksis. En Latour-inspirert studie av barnehageprosjektet ”Ergonomi og pedagogikk hånd i hånd – helse i hver bevegelse”

    Directory of Open Access Journals (Sweden)

    Maiken Marie Jordal

    2015-06-01

    Full Text Available Abstract: This article is based on the study of the project: “Ergonomics and pedagogics hand in hand – health in every movement” (EPH and the implementation of it in a Norwegian kindergarten. A central idea in the EPH- project is that by focusing on children’s motor development, and allowing them to be more independent in daily activities, ergonomic benefits that will ease employees' workday will be achieved. Our study of this project is inspired by Bruno Latour's perspectives on the relation between humans and materiality and the data is sampled by field observations. The main question we rise and discuss in the article is: What tensions might arise when ideals to benefit both children’s independency and the employer’s ergonomic health are to be implemented simultaneously in a kindergarten context? Overall, the results of the study shows that the tension between children’s attempt to be independent, on the one hand, and the adult’s’ tendency to strive for tidiness and security, on the other, is significant. This can partly be explained by that humans may interact differently with a given materiality than the original purpose of it was. Physical environments may also invite for multiple ways of using it and thus the very same material organization may promote as well as constrain a good synergy between ergonomic and pedagogic ideals. We therefore conclude that to fulfill both children’s and adult’s needs at the same time, in the specific material space a modern kindergarten represents, might imply some very distinct challenges that planners and users should take into account. Sammendrag: Artikkelen fokuserer på det fysiske miljøets virkning på idealet om å best mulig forene ansattes helse og barns selvhjulpenhet i en barnehagekontekst. Den bygger en studie av implementeringen av sentrale idealer i prosjektet: ”Ergonomi og pedagogikk hånd i hånd – helse i hver bevegelse” (EPH. En sentral tanke bak

  4. Efficient Software HEVC to AVS2 Transcoding

    Directory of Open Access Journals (Sweden)

    Yucong Chen

    2016-09-01

    Full Text Available The second generation of Audio and Video coding Standard (AVS is developed by the IEEE 1857 Working Group under project 1857.4 and was standardized in 2016 by the AVS Working Group of China as the new broadcasting standard AVS2. High Efficient Video Coding (HEVC is the newest global video coding standard announced in 2013. More and more codings are migrating from H.264/AVC to HEVC because of its higher compression performance. In this paper, we propose an efficient HEVC to AVS2 transcoding algorithm, which applies a multi-stage decoding information utilization framework to maximize the usage of the decoding information in the transcoding process. The proposed algorithm achieves 11×–17× speed gains over the AVS2 reference software RD 14.0 with a modest BD-rate loss of 9.6%–16.6%.

  5. Arctic Visiting Speakers Series (AVS)

    Science.gov (United States)

    Fox, S. E.; Griswold, J.

    2011-12-01

    The Arctic Visiting Speakers (AVS) Series funds researchers and other arctic experts to travel and share their knowledge in communities where they might not otherwise connect. Speakers cover a wide range of arctic research topics and can address a variety of audiences including K-12 students, graduate and undergraduate students, and the general public. Host applications are accepted on an on-going basis, depending on funding availability. Applications need to be submitted at least 1 month prior to the expected tour dates. Interested hosts can choose speakers from an online Speakers Bureau or invite a speaker of their choice. Preference is given to individuals and organizations to host speakers that reach a broad audience and the general public. AVS tours are encouraged to span several days, allowing ample time for interactions with faculty, students, local media, and community members. Applications for both domestic and international visits will be considered. Applications for international visits should involve participation of more than one host organization and must include either a US-based speaker or a US-based organization. This is a small but important program that educates the public about Arctic issues. There have been 27 tours since 2007 that have impacted communities across the globe including: Gatineau, Quebec Canada; St. Petersburg, Russia; Piscataway, New Jersey; Cordova, Alaska; Nuuk, Greenland; Elizabethtown, Pennsylvania; Oslo, Norway; Inari, Finland; Borgarnes, Iceland; San Francisco, California and Wolcott, Vermont to name a few. Tours have included lectures to K-12 schools, college and university students, tribal organizations, Boy Scout troops, science center and museum patrons, and the general public. There are approximately 300 attendees enjoying each AVS tour, roughly 4100 people have been reached since 2007. The expectations for each tour are extremely manageable. Hosts must submit a schedule of events and a tour summary to be posted online

  6. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  7. Situasjonsbestemt ledelse av studentgrupper i friluftsliv

    Directory of Open Access Journals (Sweden)

    Odd Lennart Vikene

    2014-05-01

    Full Text Available Artikkelen gir et praktisk eksempel på hvordan ulike studentgrupper i forbindelse med bygging av nødbivuakk i vinterfjellet opplevde min situasjonsbestemte ledelse som veileder. Teorigrunnlaget viser til situasjonsbestemte ledelsesmodeller og hva som kjennetegner god veiledning i friluftsliv. Datainnsamlingen bygger på kvantitative data fra et spørreskjema og benyttes til å analysere studentenes opplevelse av veileders ledelse ut i fra rangeringsmetoden Visuell Analog Skala (VAS. Fra samme spørreskjema var det også et åpent spørsmål som benyttes til refleksjon over studentenes opplevelse av sikkerhet i undervisningssituasjonen. Resultatene viser at studentgruppene opplevde klare ledelsesforskjeller gjennom de ulike fasene som ledelsen ble delt opp i, men at ledelsesatferden varierte lite i forhold til gruppenes erfaringsgrunnlag. Resultatene tyder på at jeg som veileder i stor grad har blitt påvirket av mine tidligere erfaringer og den potensielle risikoen som ligger ved aktiviteten. Selv om den situasjonsbestemte ledelsen varierte lite mellom de tre gruppene, viser resultatenes store standardavvik at de ulike smågruppene opplevde at ledelsen varierte. Dette tyder på at jeg som veileder til en viss grad har evnet å benytte situasjonsbestemt ledelse i praksis. På grunn av studentgruppenes relativt like oppfatning av ledelsen i de ulike fasene, viser resultatene også noe av vanskelighetene veileder har i forhold til å gjøre en korrekt vurdering av gruppens evner og erfaring i relasjon til læringssituasjonene som oppstår. Sentralt for ledelsen er likevel at studentgruppene opplevde ledelsen som betryggende, noe som gir studentene et godt grunnlag for senere opplevelser i tilknytning til vinterfriluftsliv og bygging av nødbivuakk.

  8. Introduksjon til bruk av prosessimuleringsprogrammet Aspen Plus

    OpenAIRE

    Sjøvik, Torbjørn Eig

    2013-01-01

    Denne masteroppgaven er en introduksjon i bruk av prosessimuleringsprogrammet Aspen Plus, med tanke på framtidig bruk i prosessfagene ved institutt for matematiske realfag og teknologi ved Universitetet for Miljø og Biovitenskap. Målet var å finne ut om programmet er egnet å bruke i undervisning av prosessfag. For å løse problemstillingen ble simuleringer i Aspen Plus satt opp og løst, med økende grad av vanskelighet. Dette resulterte i en brukerveiledning, som kan hjelpe nye brukere i å k...

  9. Multimodale Konstitueringsprocesser i Empirisk Forskning

    DEFF Research Database (Denmark)

    Højgaard, Lis; Søndergaard, Dorte Marie

    2010-01-01

    Multimodal konstitueringsanalyse forsøger at undvige privilegering af diskurs henholdsvis materialitet. Multimodal konstitueringsanalyse drejer optikken fra stabil tilstand, definition, kausalitet og forudsigelse/kontrol til tilblivelsesprocesser, bevægelighed og forstyrrelse/ændring. Analytikken...

  10. A simulation study on the impact of the blood flow-dependent component in [18F]AV45 SUVR in Alzheimer's disease.

    Science.gov (United States)

    Ottoy, Julie; Verhaeghe, Jeroen; Niemantsverdriet, Ellis; Engelborghs, Sebastiaan; Stroobants, Sigrid; Staelens, Steven

    2017-01-01

    Increased brain uptake on [18F]AV45 PET is a biomarker for Alzheimer's disease (AD). The standardised uptake value ratio (SUVR) is widely used for quantification but is subject to variability. Here we evaluate how SUVR of a cortical target region is affected by blood flow changes in the target and two frequently used reference regions. Regional baseline time-activity curves (TACs) were simulated based on metabolite-corrected plasma input functions and pharmacokinetic parameters obtained from our previously acquired data in healthy control (HC; n = 10), amnestic mild cognitive impairment (aMCI; n = 15) and AD cohorts (n = 9). Blood flow changes were simulated by altering the regional tracer delivery rate K1 (and clearance rate k2) between -40% and +40% from its regional baseline value in the target region and/or cerebellar grey (CB) or subcortical white matter (WM) reference regions. The corresponding change in SUVR was calculated at 50-60 min post-injection. A -40% blood flow reduction in the target resulted in an increased SUVRtarget (e.g. SUVRprecuneus: +10.0±5% in HC, +2.5±2% in AD), irrespective of the used reference region. A -40% blood flow reduction in the WM reference region increased SUVRWM (+11.5±4% in HC, +13.5±3% in AD) while a blood flow reduction in CB decreased SUVRCB (-9.5±6% in HC, -5.5±2% in AD), irrespective of the used target region. A -40% flow reduction in both the precuneus and reference WM (i.e., global flow change) induced an increased SUVR (+22.5±8% in HC, +16.0±4% in AD). When considering reference CB instead, SUVR was decreased by less than -5% (both in HC and AD). Blood flow changes introduce alterations in [18F]AV45 PET SUVR. Flow reductions in the CB and WM reference regions resulted in a decreased and increased SUVR of the target, respectively. SUVR was more affected by global blood flow changes when considering WM instead of CB normalization.

  11. Fortid nr. 3/2008. Ringvirkninger av Israels opprettelse

    OpenAIRE

    2008-01-01

    Leder (s. 5) Korttekster: Mindre nasjon. Mer teori. Av Geirr Olav Gram (s. 7-8) Historiefaget i all sin bredde. Av Maria Halle (s. 8-9) Tema: Ringvirkninger av Israels opprettelse Al-Nakba 1948 - 60 år siden katastrofen. Av Jørgen Jensehaugen (s. 9-10) "Et folk som alle andre": Norsk-jødiske perspektiver på opprettelsen av Israel. Av Vibeke Kieding Banik (s. 12-19) Remembering Al-Nakba 60 years later. Av Ahmad H. Sa'di (s. 20-26) Israel and the exodus of the Jews of ...

  12. Novel method of predicting the optimal atrioventricular delay in patients with complete AV block, normal left ventricular function and an implanted DDD pacemaker.

    Science.gov (United States)

    Miki, Yuko; Ishikawa, Toshiyuki; Matsushita, Kohei; Yamakawa, Youhei; Matsumoto, Katsumi; Sumita, Shinichi; Uchino, Kazuaki; Kimura, Kazuo; Umemura, Satoshi

    2009-04-01

    The optimal atrioventricular (AV) delay setting is important for achieving optimal AV synchrony in patients with an implanted DDD pacemaker. Using pulsed Doppler echocardiography is the most common method of predicting the optimal AV delay, but it is a complicated and time-consuming method. Therefore, an automatic optimizing function of the AV delay at different atrial rates is desirable for achieving a favorable hemodynamic state. This study aimed to predict the optimal AV delay using phonocardiography. The amplitude of the first heart sound (S1) recorded on the phonocardiogram was measured with different AV delays in 6 patents with complete AV block, normal left ventricular function and an implanted DDD pacemaker. The correlation between the amplitude of S1 and the length of the AV delay was a cubic curve (y=974.15x(3)-23.084x(2)-8.0074x+0.7495, R2=0.9511). The length of the AV delay at the inflection point of the curve showed a significant positive correlation with the optimal AV delay determined by pulsed Doppler echocardiography (R=0.9254, P<0.01). This study demonstrated a novel simple method of predicting the optimal AV delay using phono-cardiography.

  13. Opplevelse av luksus : en konformativ og eksplorativ analyse av luksusbegrepet mot smarttelefoner og nettbrett.

    OpenAIRE

    Akimov, Sergej Aleksandrovitsch

    2011-01-01

    Formålet med denne studien var å undersøke luksusopplevelsen til smarttelefoner og nettbrett, med utgangspunkt i underliggende luksusmotiver. Den fastsatte problemstillingen var todelt. For det første skulle jeg identifisere graden av luksus på smarttelefoner av to ulike merker og hvilke motiver som var de mest fremtredende for disse produktene. Den andre delen av problemstillingen fokuserte på hvorvidt det eksisterer forskjeller i opplevd luksus på ett merke, på tvers av to produktkategorier...

  14. Konstruktion av hisslås

    OpenAIRE

    Lundin, Christian; Dalstam, Robert

    2010-01-01

    Examensarbetet ”Konstruktion av hisslås” som utförts på avdelningen för maskinteknik vid Blekinge Tekniska Högskola i samarbete med Nami lift AB i Tollarp. Dagens hisslås köper Nami av en leverantör som nu blivit uppköpta av Namis konkurrent. Därför vill de undersöka om det finns en möjlighet att tillverka egna lås till ett billigare pris. Önskemålet var att låset skulle vara en elektromekanisk konstruktion som drivs av en solenoid och låset måste uppfylla de säkerhetskrav som finns för hissa...

  15. Distributed Trust Management and Rogue AV Software

    Science.gov (United States)

    2010-06-10

    Software Secured Order 0 WIN PC® Defender 6 Months License SubsaiJtjon indudes ~ version updates, definition updates, standart rustomer support... standart customer support for 1 year. Only today limited ollerwith special discount~ $69.99. Q Lifetime UNUMITED LlceMt, Best Cholet ! WIN PC...2010 Basic Business Model • Rogue AV basic: $0 • Rogue AV full: $30-$100 • Multi-year licensing: ~$20 more • Bundling other applications: ~$20 more

  16. Konformasjonsanalyse og teoretiske beregninger av morfin

    OpenAIRE

    Syvertsen, Linda

    2013-01-01

    Master i biomedisin Morfin og morfinderivater er de beste smertestillende medisinene vi har i dag. Dessverre har disse medikamentene en mørk bakside i form av alvorlige bivirkninger som blant annet eufori, avhengighet og respirasjonsundertrykkelse. Til tross for omfattende forskning, har man hittil ikke klart å utvikle morfinderivater med like god smertestillende effekt, men med færre alvorlige bivirkninger. Mye forskningsarbeid har blitt utført i forbindelse med fremstilling av ulike deri...

  17. Fysisk terrorsikring i byens uterom : en studie av fysiske terrorsikringstiltak og hvordan slike kan integreres i byens uterom, hvor Oslo Rådhus brukes som arena for å teste ut, og diskutere ulike tilnærminger

    OpenAIRE

    Bakke, Lars Arne

    2015-01-01

    Bombeangrepet i regjeringskvartalet 22. juli 2012 med påfølgende flytting av departementer til midlertidige lokaler i kvadraturen, og planlegging av et fornyet regjeringskvartal, har for alvor satt terrorsikring i byens uterom på dagsorden. Denne masteroppgaven søker å gjøre rede for hvordan fysiske terrorsikringstiltak kan kamufleres, og integreres på en måte som minimerer skaden på byrommet, men likevel sikrer. Første del av oppgaven tar sikte på å forstå hvordan en planlegger fysisk t...

  18. Creep damage in welds of X 20 CrMoV 12 1 steel. Part 2 - Studies of long term service exposed material and damage data base and calculation of damage distribution and damage resistance; Krypskador i svetsar av X 20 CrMoV 12 1 staal. Etapp 2 - Studier av lingtidspiverkat material och skadedatabas samt berakning av skadefordelning och skadetilighet

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan; Borggreen, Kjeld; Weilin Zang; Nilsson, Henrik; Samuelson, Aake

    2004-09-01

    The present project has been consisted of the following pieces of work on welds of X20 CrMoV 12 1: Analysis of, by use of replica testing, creep damage development in 368 welds in 11 Danish high pressure steam lines with operation up to 200,000 h. Metallographic investigations of four welds from a retired live steam line with approximately 182 000 h in operation. - Evaluation of the influence of the two most common etching methods on the interpretation of creep cavitation. Analysis of the time security of the material, i.e. influence of enhanced temperature or stress on creep life time. Finite element simulations of the creep behaviour of X20 welds where effects of HAZ creep properties, system stresses and degree of multiaxiality in the rupture criterion are studied. In addition a literature study on publications of creep life time in X20 steel was performed in a first, already reported part of the project. The results of the comprehensive replica testing and the metallographic investigations show clear-cut that welds of this material have an excellently long creep life that indeed will reach 200,000 h. The creep damage at that time is in general very limited. The typical creep life for welds of X20 can be evaluated to at least 250,000 h. The reason for that it is not possible to evaluate an even longer creep life is the fact that creep testing and finite element simulations show that creep elongation and creep damage will accelerate considerably later in the creep life than some low alloy steels. In the worst case this acceleration could start already just after 200,000 h. It is also demonstrated that welds of the X20 steel can stand system stresses much better than low alloy steels. Recommendations for how and when inspections and testing of welds of the current material should be performed have been issued. They have been adapted to the findings in the project. The recommendations can, as long as severe damage is absent, allow for longer inspection intervals

  19. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  20. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  1. Mönsteranalys av inomhusluft. Undersökning av luftkvaliteten i sjuka hus med flytspackelproblem

    OpenAIRE

    Bornehag, Carl-Gustaf

    1994-01-01

    Den hälsomässiga effekten som rapporteras i samband med sjuka-hus syndromet (SBS), vars orsak är okänd, kan betraktas som ett mönster av icke specifika symptom såsom irritationer i ögon, näsa och mun, upplevelser av torra sletnhinnor och hud, hudrodnad, mental trötthet och upplevelse av svag men ihållande lukt. Aven exponeringar i inomhusluften kan beskrivas som ett mönster av en mängd olika ämnen, exempelvis VOC, partiklar, sporer m. m. Detta innebär att en av svårigheterna med att undersöka...

  2. Postprandial increase of plasma apoAV concentrations in Type 2 diabetic patients.

    Science.gov (United States)

    Pruneta-Deloche, Valérie; Ponsin, Gabriel; Groisne, Laure; Fruchart-Najib, Jamila; Lagarde, Michel; Moulin, Philippe

    2005-08-01

    Postprandial hypertriglyceridemia is considered as a risk factor for cardiovascular disease in Type 2 diabetes. However, little is known about the underlying mechanisms. Since the recently discovered apolipoprotein (apo) AV was identified as a modulator of triglyceride (TG) metabolism, the aim of the study was to determine the postprandial apoAV profile of Type 2 diabetic patients. We compared data from 11 patients with Type 2 diabetes mellitus to that of 12 non-diabetic normolipidemic subjects following the ingestion of a lipid-rich cream. Postprandial apoAV was elevated in diabetic patients but no correlation was observed either with plasma TG concentration or with the intensity of lipoprotein lipase-dependent lipolysis. These data obtained in human subjects suggest that plasma apoAV concentration does not play an acute or a direct role in the regulation of plasma TG in the postprandial state.

  3. [F-18]-AV-1451 binding correlates with postmortem neurofibrillary tangle Braak staging.

    Science.gov (United States)

    Marquié, Marta; Siao Tick Chong, Michael; Antón-Fernández, Alejandro; Verwer, Eline E; Sáez-Calveras, Nil; Meltzer, Avery C; Ramanan, Prianca; Amaral, Ana C; Gonzalez, Jose; Normandin, Marc D; Frosch, Matthew P; Gómez-Isla, Teresa

    2017-06-13

    [F-18]-AV-1451, a PET tracer specifically developed to detect brain neurofibrillary tau pathology, has the potential to facilitate accurate diagnosis of Alzheimer's disease (AD), staging of brain tau burden and monitoring disease progression. Recent PET studies show that patients with mild cognitive impairment and AD dementia exhibit significantly higher in vivo [F-18]-AV-1451 retention than cognitively normal controls. Importantly, PET patterns of [F-18]-AV-1451 correlate well with disease severity and seem to match the predicted topographic Braak staging of neurofibrillary tangles (NFTs) in AD, although this awaits confirmation. We studied the correlation of autoradiographic binding patterns of [F-18]-AV-1451 and the stereotypical spatiotemporal pattern of progression of NFTs using legacy postmortem brain samples representing different Braak NFT stages (I-VI). We performed [F-18]-AV-1451 phosphor-screen autoradiography and quantitative tau measurements (stereologically based NFT counts and biochemical analysis of tau pathology) in three brain regions (entorhinal cortex, superior temporal sulcus and visual cortex) in a total of 22 cases: low Braak (I-II, n = 6), intermediate Braak (III-IV, n = 7) and high Braak (V-VI, n = 9). Strong and selective [F-18]-AV-1451 binding was detected in all tangle-containing regions matching precisely the observed pattern of PHF-tau immunostaining across the different Braak stages. As expected, no signal was detected in the white matter or other non-tangle containing regions. Quantification of [F-18]-AV-1451 binding was very significantly correlated with the number of NFTs present in each brain region and with the total tau and phospho-tau content as reported by Western blot and ELISA. [F-18]-AV-1451 is a promising biomarker for in vivo quantification of brain tau burden in AD. Neuroimaging-pathologic studies conducted on postmortem material from individuals imaged while alive are now needed to confirm these observations.

  4. Främjandet av kvinnliga entreprenörer

    OpenAIRE

    Palm, Caroline; Lindqvist, Jessica

    2008-01-01

    Trots en ökande trend av antalet kvinnliga entreprenörer är proportionen till manliga entreprenörer fortfarande relativt låg. Anledningen kan bland annat bero på att entreprenörskap definieras efter egenskaper som återfinns bland typiska manliga egenskaper som till exempel riskbenägenhet och en stor självtillit. Med stor sannolikhet är detta en av orsakerna till att få kvinnor kan identifiera sig själva med rollen som entreprenör. Denna studie undersöker vad som i nuläget utförs för att främj...

  5. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2016-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  6. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2015-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  7. Veileder for kravspesifikasjon for leie av kontorarealer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne

    Investorer og leietakere blir stadig mer interessert i helse- og miljøkvaliteter. Men kunnskapen er lav hos de fleste om hva de skal etterspørre og hvordan slike kvaliteter kan dokumenteres. Meglere har en viktig rolle som formidler av kvaliteter. Grønn Byggallianse har i samarbeid med blant annet...... Norsk Eiendom, Enova og NGBC utarbeidet en mal for standard kravspesifikasjon for leie av kontorlokaler. Målet med malen er å bidra til at leietager får det produktet han trenger til riktig pris og at man unngår unødig miljøbelastning. Målet er videre at å bidra og stimulere til, at innleie....../utleie prosesser startes med en dialogbasert prosess. Standarden er tenkt som et hjelpemiddel til en systematisk gjennomgang av, og diskusjon av hvilke kvaliteter som har prioritet, høy, middel eller lav prioritet for leietaker. Resultatet av dialog og diskusjon fastlegger endelige krav til kvalitet og...

  8. Reindeer and Wind Power - Study from the installation of two wind farms in Mala sameby; Renar och Vindkraft - Studie fraan anlaeggningen av tvaa vindkraftparker i Malaa sameby

    Energy Technology Data Exchange (ETDEWEB)

    Skarin, Anna; Nellemann, Christian; Sandstroem, Per; Roennegaard, Lars; Lundqvist, Henrik

    2013-05-15

    In the track of ever-expanding new infrastructure, such as wind power, roads and power lines, it becomes increasingly important to map and understand how free-ranging animals and wildlife respond. During the past decades, human - rangifer interactions have been assessed in over a hundred studies, with a strong bias on wild reindeer and caribou, although more recently also studies on domesticated reindeer in Norway, Finland, Sweden and Russia have been done with similar results. To clarify further the possible responses of domesticated reindeer to various disturbance sources, a review was made of over 15 existing disturbance studies of domesticated reindeer, we also discuss the effect of domestication on reindeer. The review shows the same pattern of avoidance in domesticated reindeer as for wild reindeer and caribou despite the domestication process. Sami reindeer husbandry today is an extensive form of pastoralism, which has led to a low degree of tameness among the reindeer. Domesticated reindeer can avoid infrastructure and human activity up to 12 km from the disturbance source and the avoided distance may shift between seasons and years and type of disturbance source, as well as diminish during periods of extreme starvation or insect harassment, similar to observation in wild reindeer and caribou. To get an overall picture of how the reindeer use their grazing land, it is therefore important to study large-scale and long-term habitat use of the reindeer whether they are domesticated or not. In this report, we want to share new information on how existing infrastructure such as roads and power lines in the landscape and construction phase of a new infrastructure for a wind farm affects the free roaming of the reindeer in a summer grazing area in a managed forest in northern Sweden.

  9. Costs for Alternatives to District Heating. A study of real costs on local heating markets; Alternativkostnad till fjaerrvaerme. En studie av verkliga kostnader paa lokala vaermemarknader

    Energy Technology Data Exchange (ETDEWEB)

    Carlson, Annelie; Lehtmets, Marti; Andersson, Sofie

    2008-07-01

    Heating comprise the major part of the cost of supporting a building with necessities like electricity, heat, refuse collection and water and sewage. As these costs increase, it is becoming more interesting to find other solutions in order to reduce them. One alternative is to convert to another heating system. Several price analyses comparing different heating systems have been performed. Avgiftsgruppen publishes one report on a yearly basis, where the costs to support a building with necessities and how they vary between communities are listed. The latest report states that it is less expensive in 75 % of the communities in Sweden to convert from district heating to a pellets boiler or a ground-source pump. However, other studies have established that the heat market is a local market with local conditions. Therefore you need to compare alternative heating costs that are specific to the area instead of estimated average costs at a national level. The purpose of this survey is to study a local heat market in order to verify the real cost of the alternative heating systems to district heating and if these costs vary between different communities. The hypothesis is that it is not possible to generalize the heating cost on a national level. Instead, a local market should be studied to make an accurate cost comparison between heating options. Three communities are studied in order to find real and verified investment costs in pellet boilers and heat pumps. The investments that are of primary interest are those performed in buildings similar to the multi-dwelling house used in earlier price analyses. Furthermore, the building should be located within the distribution network of district heating in order to illustrate the competition between the heating alternatives. The result of the study illustrates the difficulties to find real and verified costs of completed investments in alternative heating systems in buildings that is of primary interest for this study. Contacts

  10. Utprøving av metodikker for modellering av overvann i et urbant område ved bruk av ArcGIS, MIKE21 og MIKE FLOOD

    OpenAIRE

    Johansen, Jarle Andre; Moldekleiv, Hans Jakob Saxe

    2016-01-01

    I de siste århundrene har det blitt registrert forandringer i klimasystemet. Det er sannsynlig at dette er en konsekvens av menneskers forbruk av fossilt brennstoff. Klimaendringene vises i en høynet middeltemperatur for store deler av jordkloden. I Norge blir klimaendringene synlige i form av at det har blitt mer nedbør og at nedbørshendelsene har blitt mer intense. Denne tendensen blir av de fleste forskere framskrevet til å vedvare. Samtidig med klimautviklingen har samfunnet blitt forandr...

  11. IAS 41 - Värdering av skog

    OpenAIRE

    Hellsten, Fredric; Thorsson, Johan

    2006-01-01

    Införandet av standarden IAS/IFRS i Sverige är en effekt av den internationalisering som skett de senaste åren. En stor skillnad märks bland de företag som nu måste redovisa tillgångar till verkliga värden istället för som tidigare till historiska värden. Skogskoncernerna ställs inför ett sådant faktum. Effekten blir att en mer rättvisande bild av skogens värde uppkommer. De intervjuade företagen, Bergvik Skog AB, Holmen, SCA, Sveaskog och Öhrlings PricewaterhouseCoopers håller med om att dol...

  12. Dicty_cDB: FC-AV21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV21 (Link to dictyBase) - - - Contig-U15736-1 FC-AV21E (Li...nk to Original site) - - - - - - FC-AV21E 635 Show FC-AV21 Library FC (Link to library) Clone ID FC-AV21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV21Q.Seq.d/ Representative seq. ID FC-AV2...1E (Link to Original site) Representative DNA sequence >FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq....ignments: (bits) Value FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq.d/ 573 e-162 VHK407 (VHK407Q) /CSM/VH/V

  13. Dicty_cDB: FC-AV22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV22 (Link to dictyBase) - - - Contig-U16260-1 FC-AV22Z (Li...nk to Original site) - - FC-AV22Z 672 - - - - Show FC-AV22 Library FC (Link to library) Clone ID FC-AV22 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV22Q.Seq.d/ Representative seq. ID FC-AV2...2Z (Link to Original site) Representative DNA sequence >FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq....ignments: (bits) Value FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq.d/ 1281 0.0

  14. Bioseguridad en granjas avícolas

    OpenAIRE

    Sandra L. Ricaurte Galindo

    2005-01-01

    La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extr...

  15. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  16. Utforming av innendeltaker-design grafer i Microsoft Excel 2007

    OpenAIRE

    Strømgren, Børge; Løkke, Gunn; Olsen, Fie; Løkke, Jon Arne

    2010-01-01

    I artikkelen gis det beskrivelser av hvordan grafer for framstilling av innendeltaker tilba-ketrekkingsingsdesign (reversering), multielementdesign og multippel basislinjedesign kan konstrueres i Microsoft Excel 2007 for Windows. Det gis tips om hvordan ferdige grafer kan overføres fra Excel til andre relevante programmer. Forutsetning for bruk av framstillingen er korrekt installert Microsoft Excel 2007 for Windows. Beskrivelsene er tenkt å gi utfyllende informasjon om konstruksjon av innend...

  17. En kartlegging av forekomsten av forskjellige rusmidler blant norske motorvognførere pågrepet av politiet, med mistanke om påvirket kjøring

    Directory of Open Access Journals (Sweden)

    Kari-Mette Beylich m. fl Beylich m. fl

    2009-10-01

    Full Text Available  SAMMENDRAGSjåfører som mistenkes for påvirket kjøring blir i første omgang vurdert av politiet med henblikk på om det kunskal rekvireres alkoholanalyse eller om det også skal tas prøve med hensyn på andre rusmidler (narkotika,medikamenter med ruspotensial ved Statens rettstoksikologiske institutt (SRI. Rutinemessig vil SRI undersøkedet politiet rekvirerer, men prøvene lagres inntil to år etter at de er analysert. Ved supplerende analyse i ettertidkan man således få et mer fullstendig bilde av hva mistenkte, påvirkede bilførere hadde i kroppen da de avgaprøve. I den foreliggende undersøkelsen ble 1197 prøver fra februar og september 1993 analysert på et bredtspekter av andre rusmidler foruten alkohol, uavhengig av hva politiets mistanke hadde vært. Vi fant da at alkoholalene var til stede i 55 % av prøvene, andre rusmidler alene i 16%, både alkohol og andre rusmidler i 14%, mensverken alkohol eller andre rusmidler ble påvist i 15% av prøvene. Politiets mistanke med hensyn til alkoholpåvirkningble bekreftet av analyseresultatene i 71% av tilfellene, og mistanke om forekomst av andre rusmidler i58% av tilfellene. Tidligere studier og denne undersøkelsen viste at bilførere som mistenkes for påvirket kjøringsynes å representere en gruppe med storbruk av alkohol og misbruk av andre stoff.Beylich K-M, Christophersen AS, Skurtveit S, Bjørneboe A, Mørland J. Frequency of different drugs in  ENGLISH SUMMARYDrivers apprehended under the suspicion of drunken or drugged driving are primarily evaluated by the police withregard to whether alcohol or drugs should be looked for in the blood samples taken shortly after apprehension.Until March 1996 all blood samples were sent to the National Institute of Forensic Toxicology (NIFT, for analysis.NIFT routinely perform only those analyses requested, but the samples are stored for up to two years afteranalysis. By later additional analyses of this material one could obtain a more

  18. Institusjonelle felt og forståelser av evaluering

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Furubo, Jan-Eric

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av refo...

  19. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  20. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  1. Smertelindring av opioidavhengige pasienter. En oppgave om sykepleieres holdninger og kunnskaper om smertelindring av opioidavhengige pasienter

    OpenAIRE

    Selvig, Katrine Magelssen

    2013-01-01

    Hensikten med oppgaven var å belyse sykepleieres holdninger og kunnskap om smertelindring av opioidavhengige pasienter.Det viste seg at sykepleierne oppfattet å ikke ha tilstrekkelig kunnskap om smertelindring til opioidavhengige pasienter. Det å utvikle en tillitsfull relasjon var nødvendig for å yte god pleie. Holdninger ble identifisert som den viktigste faktoren som påvirket sykepleiernes intensjon om å yte pleie av høy kvalitet.

  2. Storytelling inom extern kommunikation : En kvalitativ studie om hur startupföretag använder sig av storytelling inom den externa innehållsmarknadsföringen

    OpenAIRE

    Sjöqvist, Sacharias; Mörén Rolandsson, Alexander

    2015-01-01

    Företagskulturen har förändrats i Sverige och det blir vanligare att startupföretag etablerar sig på marknaden. Dessa startupföretag lider av strukturella begränsningar gällande resurser och tillgångar. Samtidigt konkurrerar de på en marknad bland större, mer etablerade företag. Ett påtagligt problem uppstår när en växande företagsform, som gynnar marknaden och den övergripande samhällsnyttan, tvingas möta dessa utmaningar på grund av den särskilda företagsformens utgångspunkter. Av denna anl...

  3. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  4. Postmoderne overbelastning : en komparativ analyse av tre storbyromaner

    OpenAIRE

    Andersen, Øystein

    2006-01-01

    Denne oppgaven er en komparativ analyse av tre storbyromaner; Crash av J.G. Ballard, Requiem for a Dream av Hubert Selby Jr, og Fight Club av Chuck Palahniuk. I hver av disse romanene skildres en form for stagnert storbytilværelse, der hovedkarakterenes liv er repeterende og stillestående. I et postmoderne samfunn i evig forandring, er det viktig å kunne tilpasse seg disse endringene, skifte kurs og ta i bruk nye muligheter. Dette er den postmoderne livsstrategi, en nødvendig strategi for å l...

  5. Uten lovlig opphold = uten rettigheter? Tilværelsen til migranter uten oppholdstillatelse i lys av normativ teori om rettferdighet

    Directory of Open Access Journals (Sweden)

    Katrine Fangen

    2012-11-01

    Full Text Available Migranter som fortsetter å oppholde seg i et land etter avslag på søknad om opphold, eller som unnlater å søke om oppholdstillatelse, utfordrer det juridiske rammeverket for nasjonalstater og statsborgerskap. I denne artikkelen diskuteres livssituasjonen til migranter uten lovlig opphold opp mot normativ kosmopolitisk teori om universelle rettigheter. Dette er belyst i internasjonal litteratur, men i mindre grad innenfor en norsk kontekst. Vi tar i denne artikkelen for oss tre empiriske eksempler: tilværelsen i såkalte ventemottak, tilværelsen utenfor ventemottakene og tilværelsen for barn uten lovlig opphold. Gjennom eksemplene diskuterer vi rettighetsspørsmål i migrantenes liv. Vi viser hvordan menneskerettighetene ikke er tilstrekkelige for å ivareta migrantenes velvære, og hvordan rettigheter migrantene faktisk har, ikke fremstår som reelle fordi det oppleves som risikabelt å benytte seg av dem. Artikkelen setter normativ kosmopolitisk teori i perspektiv ved å diskutere den konkrete situasjonen til migrantene, og spør til slutt hva som kan være konsekvensene av at rettigheter blir ulikt fordelt?Nøkkelord: rettferdighet, rettigheter, migrasjon, ulovlig opphold, kosmopolitismeEnglish summary: Without legal residency = no rights? A discussion of the situation of migrants who have settled without official authorisation, in light of the normative theory of justiceMigrants who continue to reside in a country after having received a negative answer to their residence application, or who stay without registering themselves in the first place, challenge the legal framework of national states and citizenship. In this article, we illustrate the situation of migrants without legal residence in light of normative cosmopolitan theory focusing on the universality of rights. We discuss three empirical contexts: life in the so-called waiting reception centers, life outside the waiting reception centers, and the situation of children

  6. En studie i dyslektikers kommunikativa och känslomässiga interaktion med användandet av specialgjorda datorprogram : Genom forskning med användare/elever på en gymnasienivå och enligt specialpedagog/speciallärare

    OpenAIRE

    Gullström, Wictor

    2008-01-01

    Den här C-uppsatsen är en studie om dyslektikers kommunikativa interaktion med kompenserande specialgjorda datorprogram för träning i sitt användande av att skriva olika sorters texter. Ämnets olika nyckelord är det som är relevant för denna C-uppsats.   Denna studies undersökningar har skett genom intervjuer med en speciallärare och en specialpedagog som är en form av experter på detta område och kan extra fakta om de olika eleverna (respondenterna). De har intervjuats för att få koll på vad...

  7. Left-sided approach of AV junction ablation for drug refractory atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Yoga Yuniadi

    2006-06-01

    Full Text Available AV junction ablation has been proven effective to treat symptomatic atrial fibrillation refractory to antiarrhythmias or fail of pulmonary vein isolation. However, about 15% of conventional right-sided approach AV junction ablation failed to produce complete heart block. This study aimed to characterize His bundle potential at ablation site during conventional or left-sided approach of AV junction ablation. Twenty symptomatic AF patient (age of 60.5 ± 9.28 and 11 are females underwent conventional AV junction ablation. If 10 applications of radiofrequency energy are failed, then the ablation was performed by left-sided approach. Seventeen patients are successfully ablated by conventional approach. In 3 patients, conventional was failed but successfully ablated by left-sided approach. The His bundle amplitude at ablation site was significantly larger in left-sided than correspondence right-sided (16.0 ± 4.99 mm vs. 6.9 ± 4.02 mm respectively, p = 0.001, 95% CI -14.0 to -4.3. ROC analysis of His bundle potential amplitude recorded from right-sided revealed that cut off point of > 4.87 mm given the sensitivity of 81.3% and specificity of 53.8% for successful right-sided approach of AV junction ablation. In case of failed conventional approach, the left-sided approach is effective for AV junction ablation. An early switch to the left-sided approach may avoid multiple RF applications in patients with a low amplitude His-bundle potential (< 4.87 mm. (Med J Indones 2006; 15:109-14Keywords: Atrial fibrillation, AV junction ablation, left-sided approach

  8. Samhandling på tvers av lokasjoner ved hjelp av videokonferanse : Casestudie av virtuelle møter innenfor driftsorganisasjonen i Det norske oljeselskap

    OpenAIRE

    Volden, Helene

    2016-01-01

    Globaliseringen de siste årene har bidratt til endringer av samfunnet og organisasjonslivet. Arbeid skjer til alle døgnets tider og man befinner seg på ulike steder. Teknologien tillater å kunne gjennomføre møter på tvers av lokasjoner, og antall virtuelle møter er spådd en økning fremover. Olje- og gassindustrien er de mest erfarne brukerne av videokonferanse i norsk næringsliv. Denne studien skal belyse hvordan virtuelle møter kan bli mer effektive i arbeidet på tvers av loka...

  9. Atorvastatin and fenofibrate increase apolipoprotein AV and decrease triglycerides by up-regulating peroxisome proliferator-activated receptor-α

    Science.gov (United States)

    Huang, Xian-sheng; Zhao, Shui-ping; Bai, Lin; Hu, Min; Zhao, Wang; Zhang, Qian

    2009-01-01

    Background and purpose: Combining statin and fibrate in clinical practice provides a greater reduction of triglycerides than either drug given alone, but the mechanism for this effect is poorly understood. Apolipoprotein AV (apoAV) has been implicated in triglyceride metabolism. This study was designed to investigate the effect of the combination of statin and fibrate on apoAV and the underlying mechanism(s). Experimental approach: Hypertriglyceridaemia was induced in rats by giving them 10% fructose in drinking water for 2 weeks. They were then treated with atorvastatin, fenofibrate or the two agents combined for 4 weeks, and plasma triglyceride and apoAV measured. We also tested the effects of these two agents on triglycerides and apoAV in HepG2 cells in culture. Western blot and reverse transcription polymerase chain reaction was used to measure apoAV and peroxisome proliferator-activated receptor-α (PPARα) expression. Key results: The combination of atorvastatin and fenofibrate resulted in a greater decrease in plasma triglycerides and a greater increase in plasma and hepatic apoAV than either agent given alone. Hepatic expression of the PPARα was also more extensively up-regulated in rats treated with the combination. A similar, greater increase in apoAV and a greater decrease in triglycerides were observed following treatment of HepG2 cells pre-exposed to fructose), with the combination. Adding an inhibitor of PPARα (MK886) abolished the effects of atorvastatin on HepG2 cells. Conclusions and implications: A combination of atorvastatin and fenofibrate increased apoAV and decreased triglycerides through up-regulation of PPARα. PMID:19694729

  10. Interaktionens betydelse för barns lärande - en studie av barns möte med slöjd i förskolan

    Directory of Open Access Journals (Sweden)

    Eva Ahlskog-Björkman

    2014-06-01

    Full Text Available Syftet med den här artikeln är att diskutera på vilket sätt interaktion och socialt samspel har betydelse för hur barn i förskolan kan engageras i en lärandeprocess. Den empiriska studien utgörs av en  videofilmad episod över en vävaktivitet i förskola. Genom att använda videografisk observation kan mänsklig aktivitet beskrivas och av den anledningen används  videografi som metodologisk ansats. I studien analyseras på vilket sätt interaktionen mellan de som är närvarande, oberoende av barnens ålder, kan bidra till att stimulera den lärande aktiviteten. Barnens slöjdaktivitet beaktas ur ett sociokulturellt lärandeperspektiv. Ett centralt tema inom detta perspektiv är kommunikation där språket och redskapen står för de medierande faktorerna. Barnens kontakt med redskapen och deras upplevelser och erfarande av slöjdaktiviteten diskuteras i relation till den närmaste utvecklingszonen. Ytterligare beaktas den videofilmade sekvensen ur ett socialt perspektiv där barnpedagogens agerande gentemot barnen lyfts fram och diskuteras. Analys och tolkning av datamaterialet strävar efter att synliggöra mänsklig interaktion och dess betydelse för att motivera och engagera barnen i deras slöjdaktivitet.  

  11. Dimensionering av Södersjukhusets sterilcentral

    OpenAIRE

    Munguia Chang, Daniel; Dahlgren, Emma

    2016-01-01

    I dagsläget pågår en omfattande planering av utbyggnationen samt upprustningen av Södersjukhuset. Byggnationen beräknas preliminärt vara i bruk under mars 2018. I och med förändringen kommer sjukhuset få en helt ny sterilcentral.  Till en sterilcentral anländer kontaminerat medicinskt gods från tillhörande eller externa sjukhus. Efter att ha genomgått diskdesinficering och autoklavering på sterilcentralen kommer godset så småningom ut som sterilt för ytterligare användning.  Det finns idag en...

  12. FastVDO enhancements of the AV1 codec and comparison to HEVC and JVET codecs

    Science.gov (United States)

    Topiwala, Pankaj; Dai, Wei; Krishnan, Madhu

    2017-09-01

    This paper describes a study to investigate possible ways to improve the AV1 codec, in several directions, most particularly in the context of 10-bit HDR video content, and 8/10 bit image content. Applications to SDR video, and 360 content are discussed elsewhere. For HDR content, a data adaptive grading technique in conjunction with the AV1 codec is studied. For image content, lapped biorthogonal transforms for (near) lossless compression is studied. For scalability-type applications, we introduce advanced resampling filters which outperform current ones. It is asserted that useful improvements are possible in each of these categories. In particular, substantial value is offered in the coding of HDR content, very competitive with HEVC HDR10, in a coding framework offering backwards compatibility with SDR. We also provide a rudimentary comparison of AV1 to the standard HEVC as well as the developing JVET codecs.

  13. Uppkopplad eller nedkopplad? -Konflikt mellan förnuft och känsla : En etnografiskt inspirerad studie av fyra studenters vardag online och offline

    OpenAIRE

    Saller, Nathalie

    2015-01-01

    Purpose: The aim of this thesis has been to study and obtain greater understanding of the consequences of active social media use. Specifically, in terms of social identity, social life and the sense of belonging. Secondly, the thesis studies the consequences of disconnecting and for a limited amount of time opt out of the social media context. Method/material:  The study is based on an explorative, cultural ethnographically-inspired method, in which four respondents were studied: two men and...

  14. Beta-amyloid deposition and cognitive function in patients with major depressive disorder with different subtypes of mild cognitive impairment: (18)F-florbetapir (AV-45/Amyvid) PET study.

    Science.gov (United States)

    Wu, Kuan-Yi; Liu, Chia-Yih; Chen, Cheng-Sheng; Chen, Chia-Hsiang; Hsiao, Ing-Tsung; Hsieh, Chia-Ju; Lee, Chin-Pang; Yen, Tzu-Chen; Lin, Kun-Ju

    2016-06-01

    The objective of this study was to evaluate the amyloid burden, as assessed by (18)F-florbetapir (AV-45/Amyvid) positron emission tomography PET, in patients with major depressive disorder (MDD) with different subtypes of mild cognitive impairment (MCI) and the relationship between amyloid burden and cognition in MDD patients. The study included 55 MDD patients without dementia and 21 healthy control subjects (HCs) who were assessed using a comprehensive cognitive test battery and (18)F-florbetapir PET imaging. The standardized uptake value ratios (SUVR) in eight cortical regions using the whole cerebellum as reference region were determined and voxel-wise comparisons between the HC and MDD groups were performed. Vascular risk factors, serum homocysteine level and the apolipoprotein E (ApoE) genotype were also determined. Among the 55 MDD patients, 22 (40.0 %) had MCI, 12 (21.8 %) non-amnestic MCI (naMCI) and 10 (18.2 %) amnestic MCI (aMCI). The MDD patients with aMCI had the highest relative (18)F-florbetapir uptake in all cortical regions, and a significant difference in relative (18)F-florbetapir uptake was found in the parietal region as compared with that in naMCI subjects (P depression severity (β = -3.607, t = -2.874, P = 0.006). We found preliminary evidence of brain beta-amyloid deposition in MDD patients with different subtypes of MCI. Our findings in MDD patients support the hypothesis that a higher amyloid burden is associated with a poorer memory performance. We also observed a high prevalence of MCI among elderly depressed patients, and depressed patients with MCI exhibited heterogeneously elevated (18)F-florbetapir retention as compared with depressed patients without MCI. The higher amyloid burden in the aMCI patients suggests that these patients may also be more likely to develop Alzheimer's disease than other patients diagnosed with major depression.

  15. Effekten av fear appeals : en studie om marknadsföringsstrategin fear appeals och dess påverkan på mottagaren

    OpenAIRE

    Paulsson, Meryem

    2009-01-01

    The purpose of this thesis is to study if there are any relations between the perceptions of a fear appeal message in relation to the individual experiences of the area. Furthermore to give a general view over research made on fear appeals. The research is made in a qualitative approach were the case study is used. Interviews were used to get relevant information from the chosen respondents. The results if the thesis indicates that there is a relation depending on individual experiences durin...

  16. För systemets skull och inte för naturens bästa : En studie av hållbar turism inom boendesektorn

    OpenAIRE

    Åkesson, Amanda

    2013-01-01

    In this study environmental work in the Swedish hotel chain "Scandic" is investigated. Earlier studies point out sustainability and different environmental certificate programs as essential for the housing sector to contribute to sustainable tourism. The purpose and willingness to fulfill such a mission has been investigated by interviewing central actors in the hotel chain. The result shows that there is a desire to be part of environmental certificate programs mainly for the reason to be pa...

  17. Oppdragelsessyn i endring? : En komparativ studie av populære oppdragelsesbøker utgitt i Norge i perioden 1950-2000

    OpenAIRE

    Azimeh, Malek

    2017-01-01

    Masteroppgave pedagogikk PED511 - Universitetet i Agder 2017 The topic of this assignment is to study if the view of parenting has changed in Norway. There have been many discussions about parenting and what it entails. This study is limited to popular books that have been released in Norway between 1950 and 2000. The parenting books emphasise different aspects in the children’s upbringing and how that positively affects their development. The primary research question is to examine the...

  18. Oppdragelsessyn i endring? : En komparativ studie av populære oppdragelsesbøker utgitt i Norge i perioden 1950-2000

    OpenAIRE

    Azimeh, Malek

    2017-01-01

    The topic of this assignment is to study if the view of parenting has changed in Norway. There have been many discussions about parenting and what it entails. This study is limited to popular books that have been released in Norway between 1950 and 2000. The parenting books emphasise different aspects in the children’s upbringing and how that positively affects their development. The primary research question is to examine the views of parenting and its development from four books from the...

  19. Hur ”vi” konstruerar ”vi” : En deduktiv diskurspsykologisk studie av vi-dem konstruktioner utifrån social identitetsteori

    OpenAIRE

    Nee, Belinda

    2014-01-01

    The ambition of this paper is to study the construction of the categorization between “us” and “them” in a religious minority, represented by Jehovah’s Witnesses and a nationalist political party, represented by the Swedish Democrats. This will be done by a discursive psychology analysis of their official publications on each group’s website. By a deductive study using Henri Tajfel’s Social Identity Theory trying to disclose the psychological processes; social categorization, social identity,...

  20. Perspektiv på historiefilmslitteracitet : en didaktisk studie av gymnasieelevers historiska och emotionella meningsskapande i mötet med spelfilm

    OpenAIRE

    Deldén, Maria

    2017-01-01

    The present study addresses what happens when historical feature film is used in history education. The purpose of this thesis is to develop new knowledge of historical film literacy through a study of the feature film's didactical potential in an educa­tional context. This is carried out through an analysis of the historical meaning making among upper secondary students when viewing historical feature films, and special attention is paid to the importance of emotions in the students' meaning...

  1. Spectroscopic studies of Cepheids in Circinus (AV Cir, BP Cir) and Triangulum Australe (R TrA, S TrA, U TrA, LR TrA)

    Science.gov (United States)

    Usenko, I. A.; Kniazev, A. Yu.; Berdnikov, L. N.; Kravtsov, V. V.

    2014-12-01

    Based on high-resolution spectra taken with the 1.9-m telescope of the South African Astronomical Observatory, we have determined the atmospheric parameters and chemical composition for three small-amplitude (AV Cir, BP Cir, and LR TrA), two classical (R TrA and S TrA), and one double-mode (U TrA) Cepheids. The averaged atmospheric parameters have been estimated for three Cepheids (AV Cir, BP Cir, and U TrA) observed at various pulsation phases. In all Cepheids, except U TrA, the metallicity has turned out to be higher than the solar one by 0.1-0.2 dex. The abundances of the key elements of the evolution of yellow supergiants (C, O, Na, Mg, Al) show that these objects have already passed the first dredge-up, while those of the remaining elements are nearly solar. Comparison of our results on the Cepheids from the list (except U TrA) with those of other authors shows significant differences in C and O abundance estimates for AV Cir, R TrA, S TrA, and LR TrA. For AV Cir and BP Cir, the H α line profiles are symmetric but with a slight asymmetry in the core at approximately the same phase near 0{·/ P } 7: on the "blue" side for AV Cir and on the "red" one for BP Cir. BP Cir exhibits a distinct asymmetry in the absorption lines of neutral atoms and ions at various pulsation phases, which can be explained by nonradial first-overtone pulsations. The constancy of the H α absorption line profiles with pulsation phase for AV Cir and BP Cir may suggest the presence of a hydrogen envelope around them. For the double-mode Cepheid U TrA, an asymmetry is observed in the cores of the H α line and the absorption lines of neutral atoms and ions at various pulsation phases, which can be explained by nonradial pulsations in the Cepheid's atmosphere. The absorption lines of neutral atoms and ions of metals in LR TrA closely resemble those in the well-known Cepheid BG Cru: secondary "blue" and "red" components whose line depths vary with pulsation phase are noticeable. This Cepheid

  2. Studies on planting, weed control and fertilizing when growing short rotation willow coppice; Utvaerdering av teknik foer plantering, ograesbekaempning och goedsling vid salixodling. Studier 1997

    Energy Technology Data Exchange (ETDEWEB)

    Danfors, B.

    1998-12-01

    The report describes work studies into planting of Salix, weed control in newly planted plantations and annual stands, and fertilization in tall stands of Salix. The study is a continuation of work on Salix performed at JTI during 1989 and 1991. The report gives a description of the background to the problem, a brief review of earlier work, a description of the purpose of the study, and an account of its planning, extent and accomplishment. The results presented cover planting and weed control at four sites with an early follow-up of results, a description of the weed control and, further, a review of the results after the end of the growing season. The fertilization procedure used on six occasions is also discussed, together with spreading results using diagrams illustrating the distribution of the fertilizer. As mentioned above, similar studies were conducted at JTI during 1989 and 1991 In comparisons both concerning the level of knowledge and access to mechanical equipment, we may note that there has been considerable development within the sectors dealing with planting, weed control and fertilizing. Continued major tasks are to take the technical development further and to disseminate the new knowledge to growers prepared to invest in production of Salix as biofuel 13 refs, 18 figs, 9 figs

  3. Knowledge platform for calculating climate impact from construction and building materials. Literature study; Kunnskapsplattform for beregning av klimabelastning fra bygg og byggematerialer. Litteraturstudie

    Energy Technology Data Exchange (ETDEWEB)

    Roenning, Anne; Lyng, Kari-Anne; Vold, Mie

    2011-07-01

    Greenhouse gas emissions from building linked today to a large extent to the energy consumption during the operating period. Through increasingly stringent energy requirements and other changes, the energy consumption for the operation could go down over time. This means in this case that the energy required to produce, transport and set up the building, to a greater extent can be relatively more important in a life-cycle analysis. KRD in that regard ha given Oestfoldforskning the commission to conduct a literature study that will provide an overview and assessment of the literature / research papers describing various building materials climate impact and how this translates into a lifetime (LCA - Life Cycle Assessment), and thus describe the knowledge platform these analyzes are based in. It also means a description of the factors that affect the climate and the environment, including the stages of life that are important. Literature study is conducted by searching scientific databases (Springer Link, Science Direct, Google Scholar, Norwegian EPD database of declarations). The literature search is limited to studies that are based on LCA as a methodology for calculating the climate impacts associated with the construction and building materials. Based on the review of literature is also undertaken an analysis focusing on explaining the methodological platform between the studies are based on, in order to explain why the results differ and / or may not be comparable.(eb)

  4. "Come as You Are" : En undersøkelse av fansens sakralisering av Kurt Cobain.

    OpenAIRE

    Winding-Sørensen, Anne

    2011-01-01

    I denne oppgaven tar jeg bruker jeg populærkulturen for å vise hvordan religiøse uttrykk kommer til synes gjennom fansens sakralisering av deres idol. For å vise hvordan ulike subkulturer i samfunnet bruker kjendiser for å skape en identitet og tilhørighet til andre mennesker har jeg brukt Kurt Coabin som eksempel på hvordan grungebevegelsen ikke bare var en musikkstil, men ble også en livsstil som skape rammer og strukturer for den gruppen av mennesker som følte et samhold til andre i denne...

  5. Fylogenetisk analyse av helgenom NGS-data av Bacillus cereus-gruppen

    OpenAIRE

    Simensen, Benedicte Been

    2015-01-01

    Sammenlikning av bakteriers genom er en effektiv måte å kartlegge hva som skiller arter og stammer fra hverandre. For å sammenlikne hele genomer fra bakterier er det vanlig å sekvensere. Utfordringen er dagens sekvenseringsteknologi, som ikke klarer å lese av hele lengden til genom-sekvensen, men kutter DNA-molekylene i kortere fragmenter før avlesning. Resultatet etter sekvensering er et stort antall korte fragmenter som etter sekvensering må pusles sammen til et fullstendig genom. Til dette...

  6. Kossan i sociala medier : Personifiering av kon inom marknadsföring av mejeriprodukter

    OpenAIRE

    Carlsson, Andrea

    2017-01-01

    Syftet med studien var att undersöka porträtterandet av kossan inom marknadsföring av mejeriprodukter i sociala medier. Undersökningens analys utfördes på mejeriföretaget Arlas Instagramkonto @arlasverige. Instagramkontots inlägg som publicerats mellan december månad 2015 till december månad 2016 innehållande en eller flera verkliga kossor analyserades. Metoderna som brukades var kvalitativ bild- och textanalys med kvantitativa inslag. Frågeställningarna undersökningen baserades på var: Hur p...

  7. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  8. Refining of wood waste from saw mills - a feasibility study for Alex sawmill; Foeraedling av saagverkens biprodukter - en oevergripande energi- och exergistudie oever Alex saag

    Energy Technology Data Exchange (ETDEWEB)

    Kullendorff, A.; Ryden, A. [SEP Scandinavian Energy Project AB (Sweden); Renstroem, R. [Karlstad Univ. (Sweden)

    1998-03-01

    An overall energy balance has been made for the Alex sawmill, with separate balances for the boiler and the timber dryer. Parallel to this energy balance, an exergy study has been compiled for the same systems. A heat demand has been identified from these balances and three different systems has been studied. Two of these imply a refinement of the by-products produced in the mill. System I: Hot water boiler as the present system; System II: Hot water boiler integrated with a back pressure dryer; System IIb: Hot water boiler integrated with a back pressure dryer and a plant for pelletizing the biofuel; System III: Steam boiler followed by power production integrated with a back pressure dryer; and System IIIb: Steam boiler followed by power production integrated with a back pressure dryer and a plant for pelletizing the biofuel. The study shows that System II seems to be the most interesting system from an energy and economical point of view with an additional revenue of about 15 MSEK/year. The dryer for this system is a newly developed not yet commercial atmospheric back pressure dryer especially suited for saw mills and small district heating companies. Other types of dryers could also be considered. Other types have not been evaluated here. The exergy study shows that the back pressure dryer almost double the yield of exergy, compared to the present situation. In addition to this, one has to take the fictitious 'profit in exergy' from the following combustion into account. If a steam boiler is installed instead of the hot water boiler, and power generation is added, then the exergy conservation will be improved even more compared to the system with the back pressure dryer. From an exergy point of view a system with power generation and back pressure drying will give an exergy yield of more than four times of that of todays system.

  9. Socionomen som chef inom vården : En kvalitativ studie av mötet mellan medicinsk och social kompetens

    OpenAIRE

    Lundholm, Anna

    2013-01-01

    The purpose of this paper is to investigate how social workers, working in a management position in the health care system, perceive the encounter of the medical and social perspective. With seven qualitative interviews, the study tries to conclude whether or not social workers are accepted at managerial positions within the health care sector. The social worker is, as a manager in health care, a leader but at the same time in a professional alienation from the medical caregivers. Organizatio...

  10. Musikalisk kunskapsutveckling i högre musikutbildning : en kulturpsykologisk studie av musikerstudenters förhållningssätt i enskild instrumentalundervisning

    OpenAIRE

    Holgersson, Per-Henrik

    2011-01-01

    The aim of this thesis is to obtain a deeper understanding of students’ approaches to musical knowledge as it is distributed through one-to-one tuition in higher music education (HME). With a cultural-psychological perspective according to Bruner, the project was designed as a longitudinal, qualitative study of eight students in the performance program that concludes with a Bachelor of Arts degree in music. Two main musical genres were represented: Western classical music, and jazz and contem...

  11. The potential for solar heat for industrial processes - A preliminary study of Swedish possibilities; Solenergi i industriell processvaerme. En foerstudie av svenska moejligheter

    Energy Technology Data Exchange (ETDEWEB)

    Kovacs, Peter; Quicklund, Henrik; Pettersson, Ulrik

    2003-06-01

    This report starts with a short introduction to solar thermal energy applications in Sweden and to the utilization of energy in general in the Swedish industry. The investigation is focusing on options for industrial solar heating applications. As waste heat recovery in many cases is competing with, or might be supplemented by solar heat, this field is also given some attention in the study. The conclusions are that possible applications are numerous, mainly within food- and mechanical industries, but that low prices on energy, unused potentials for heat recovery and low awareness about the possibilities for solar heat makes the situation tough today. Increasing prices on electricity and oil and decreasing costs for solar energy combined with a continuously growing awareness about environmental issues are key factors that speak for solar heating in a longer perspective. The large potential for industrial solar heat will be in countries further south and this may offer opportunities for Swedish industry to export products and knowledge. Some companies offers large scale solutions for solar heating and research competence within material science and optics will be needed in the development of new collector types. Swedish technology for district heating- and cooling and heat storage in boreholes could also be applied in large scale industrial applications. The literature study on waste heat recovery shows that 90 % of the waste heat comes from the large energy consumers in industry: Pulp and paper, chemical, petroleum and steel and metal industries. Almost everything is used for district heating. The potential for waste heat recovery in Sweden has been largely underestimated by several studies during the nineties and the development has been quite remarkable.

  12. Kritik av riskbegreppet - berättigad eller ej?

    DEFF Research Database (Denmark)

    Nexøe, Jørgen; Halvorsen, Peder; Kristiansen, Ivar Sønbø

    2009-01-01

    "Först och främst inte skada" (Primum non nocere) - så lyder ett av buden i den Hippokratiska eden. Men alla medicinska åtgärder kan medföra oönskade effekter. Undersökning och behandling av friska i förebyggande syfte är inget undantag. Ett problem är att negativa effekter och skador av förebygg...

  13. Om implementering av frekvenshopping i OpenBTS.

    OpenAIRE

    Bremseth, Morten

    2011-01-01

    Denne Rapporten gir en forklaring på hva programvaredefinert radio er generelt. Den omtaler en konkret realisering ved hjelp av programvaren GNU Radio og den universale radioenheten USRP (Universal Software Radio Peripheral). GSM forklares slik at leseren får den nødvendige oversikten som trengs for å forstå resten av rapporten. Frekvenshopping forklares generelt og hvordan det er gjort i GSM. Det fremstilles en mulig realisering av frekvenshopping med USRP. Programvaren som benyttes for å o...

  14. Technique for compressed bundles for harvest of whole straw willow. Pilot study; Teknik foer komprimerande helskottsskoerd av salix i buntform. Foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Eriksson, Hans (Vaesteraeng Lantbruk AB (Sweden))

    2008-06-15

    The pilot study was initiated by the need of a new technology that has been raised from the problem, and by the specifications of requirements, that has been described from the project 'Salix Maelardalen'. The need has been crystallized by the energy company Maelarenergi AB, Vaesteraas, in their handling of bio fuel, among many other fuels. The company Maelarenergi AB can see a potential in the use of Salix of a considerable volume. There is a special need by the means of the big volume handling of Salix, since the Salix raw material must be able to be delivered under a longer period or for intermediate storage. 8-9 months could be an adequate storage period. The possibility for intermediate storage could do the flow of fuel raw material to the combined power and heating plant is harmonized to the special requirements of fuel. The storage capability in chipped raw Salix chips is very short and that's why chipped Salix are not going to be a sustainable system combined with the handle of big volume together with portioned inflow to the plant. The production of Salix chips in a system of direct chipping is a very delicate system. The ground conditions with frozen and dry grounds are important for a system with heavy machines. The last years have not given such climate conditions. A big problem with practicability has been coming up. The number of days for contract work during the harvest period without interruption, because of hard conditions, has been decreased to the level that the capacity very considerably falls below what is economical defensible. The needs of larger areas for harvesting during fewer days under good conditions counteract each other. In the 'hot flow' during the harvest when the harvest machine will work with escort vehicles/container transports in the field can be impossible to realize because of for example the breakdown of the soil structure. The organization around 'hot flow system' is a very heavy programme

  15. Inter-Dye Distance Distributions Studied by a Combination of Single-Molecule FRET-Filtered Lifetime Measurements and a Weighted Accessible Volume (wAV Algorithm

    Directory of Open Access Journals (Sweden)

    Henning Höfig

    2014-11-01

    Full Text Available Förster resonance energy transfer (FRET is an important tool for studying the structural and dynamical properties of biomolecules. The fact that both the internal dynamics of the biomolecule and the movements of the biomolecule-attached dyes can occur on similar timescales of nanoseconds is an inherent problem in FRET studies. By performing single-molecule FRET-filtered lifetime measurements, we are able to characterize the amplitude of the motions of fluorescent probes attached to double-stranded DNA standards by means of flexible linkers. With respect to previously proposed experimental approaches, we improved the precision and the accuracy of the inter-dye distance distribution parameters by filtering out the donor-only population with pulsed interleaved excitation. A coarse-grained model is employed to reproduce the experimentally determined inter-dye distance distributions. This approach can easily be extended to intrinsically flexible proteins allowing, under certain conditions, to decouple the macromolecule amplitude of motions from the contribution of the dye linkers.

  16. Minnesvärda episoder i undervisningen- en studie av elevers episodiska minnen från en undervisningssekvens i biologi

    Directory of Open Access Journals (Sweden)

    Ola Magntorn

    2011-02-01

    Full Text Available This study explores primary school students’ abilities to recall events from a teaching sequence taking place 18 months earlier. The aim of the teaching sequence was to develop students’ ability to read nature in a river habitat. The concept reading nature has to do with an ability to recognise organisms and relate them to material cycling and energy flow in the specific habitat which is to be read. In this study the aim is to analyse the episodes the students recall in order to find patterns in students’ views of memorable learning events. Combining the affective and cognitive domains by first hand experiences which challenge students’ everyday conceptions and to involve them in the design of the activities make lasting impressions in the long term memories of the majority of students. These memorable episodes can be useful to relate to in the further classroom teaching about the content knowledge of science in order to make it more meaningful for the students.

  17. Bakteriell produksjon av sulfid for felling av metaller i avløpsvann fra gruver optimalisering og oppskalering av prosessen

    OpenAIRE

    Nygaard, K.; Christensen, B

    1995-01-01

    Det er gjennomført forsøk i laboratorieskala og i liten pilotskala for å vurdere om bakteriell sulfat-reduksjon kan utnyttes til å produsere hydrogensulfid for felling av tungmetaller i sur avrenning fra nedlagte kisgruver. Det ble tilført etanol som vekstsubstrat for bakteriene. I laboratorieforsøkene ble det påvist sulfatreduksjonsaktivitet allerede etter få dager, mens det i pilotforsøkene tok ca 7 uker å få i gang prosessen. Metaller ble fjernet fra vannfasen som metallsulfider. Effektivi...

  18. "Jag har typ en tallinje i huvudet" : Elevers upplevelse av träning med applikationen Vektor

    OpenAIRE

    Åbonde, Lena; Strömbom, Carina

    2017-01-01

    Syftet med denna studie var att undersöka hur elever i behov av särskilt stöd i matematik beskriver sin upplevelse av träning med applikationen Vektor och om de uttrycker någon förändring av sina grundläggande strategier efter träning. Flera forskare är överens om att arbeta med hjälp av digitala verktyg får effekter på elever både när det gäller kunskap och motivation. Vad det är som gör att de blir motiverade och lär sig mer och om effekterna sitter i, finns det delade meningar om. Åtta ele...

  19. "Det är inte mig det är fel på, det är huset" : en studie av prognosfaktorer och bemötande med fokus på sjuka hus-syndromet

    OpenAIRE

    Edvardsson, Berit

    2015-01-01

    Bakgrund: Sick Building Syndrome, SBS, är fortfarande 2015 ett tillstånd som vållar mycket diskussion. Symtomen kan grupperas i slemhinnesymtom, hudsymtom och allmänna symtom. I definitionen ingår att personen/ personerna som fått symtom har exponerats för dålig inomhusluft i en speciell byggnad. När personen inte är i byggnaden så förbättras eller försvinner symtomen. Många olika faktorer kan orsaka eller medverka till uppkomst eller försämringar av SBS-symtom, som t.ex. luftens innehåll av ...

  20. Ekonomisk styrning för samskapande av värde : En studie om värde och vilken styrning som passar för samskapande

    OpenAIRE

    Ståhlbom, Carl; Wilhelmsson, Viktor

    2016-01-01

    Introduktion: Konceptet samskapande av värde utvecklades inom marknadsföringslitteraturen i början av 2000-talet från Prahalad och Ramaswamy (2000). Redan då betonade författarna att ett företag som strävar efter att samskapa måste anpassa sitt ekonomiska styrsystem efter det. Trots det är forskningen om vilken ekonomisk styrning som kan användas för samskapande bristfällig än idag. Det finns tydliga skillnader mellan fälten där litteraturen om ekonomisk styrning främst utgår från tillverknin...

  1. Lederen som innovatør og balansekunstner: en kvalitativ studie av lederes erfaringer fra forskningssamarbeid mellom helse- og velferdstjenestene og høyere utdanning

    Directory of Open Access Journals (Sweden)

    Marit Alstveit

    2016-12-01

    Managers in health and welfare services have overall responsibility to develop the services according to official regulations and the needs of society. They are expected to provide high quality, research based services. Higher education is expected to transform education and research that improve the services, and to develop research collaborating with the practical field. This study investigates experiences of managers in health and welfare services taking part in research collaboration with higher education. Data were collected through focus group interviews with altogether 14 participants involved in 21 projects, and analysed by using qualitative content analyses. The experiences of the managers can be summarised as “Being an innovator and equilibrist in order to develop the service”. Managers appear to play an important role in bridging between health and welfare services and higher education. In order to enhance research partnerships between health and welfare services and higher education formal collaborative structures should be established.

  2. Måltidsupplevelsen på restaurangutifrån barns perspektiv : en kvalitativ studie av familjens restaurangbesök

    OpenAIRE

    Roth, Louise; Åquist, Monica

    2012-01-01

    Barn i åldrarna 4-9 år har tydliga önskemål kring hur de vill att deras restaurangbesök ska se ut. I samarbete med Barnens Bästa Bord har en kvalitativ studie gjorts med fokus på barns önskemål vid restaurangbesök. Syftet med uppsatsen var att undersöka barnens önskemål när de går på restaurang med hänsyn till hela måltidsupplevelsen gällande mat, miljö, meny och bemötande. Metoderna som har använts är bildövning där barn har ritat sin favoriträtt, fokusgruppintervjuer med barn samt enkätunde...

  3. Friluftsliv som del av behandling for sykelig fedme - opplevelser og meninger fra deltagernes perspektiv

    OpenAIRE

    Haugen, Anders Lund; Tangen, Steffen

    2010-01-01

    En kombinert studie, med innhenting av både kvalitative og kvantitative data. Har som formål å få innsikt i hvordan friluftsliv oppleves blant mennesker som er til behandling for sykelig fedme ved en behandlingssinstitusjon. Begrunnelse for valg av tema: Overvekt og fedme er et økende problem over hele verden, og WHO omtaler dette som en epidemi som må behandles og forebygges. Overvekt og fedme gir forringet livskvalitet for den enkelte og har en betydelig samfunnskostnad med tanke på tapt...

  4. Reduction of NO{sub x} from a pellet burner - a parametric study; Reduktion av NOx fraan en pelletsbraennare - en parameterstudie

    Energy Technology Data Exchange (ETDEWEB)

    Eskilsson, David; Roennbaeck, Marie; Tullin, Claes [Swedish National Testing and Research Inst., Boraas (Sweden); Leckner, Bo [Chalmers Univ. of Technology, Goeteborg (Sweden). Dept. of Energy Conversion

    2000-05-01

    NO{sub x} emissions from small-scale combustion of pellets derive mainly from the fuel nitrogen. A conversion from combustion of oil to pellets will probably lead to increasing NO{sub x}-emissions. Today, pellets are produced mainly from sawdust and wood shavings which consist of pure wood with a low nitrogen content. The expected increase in pellet utilisation will probably lead to that other raw materials with higher nitrogen content will be used. This means that NOx-emissions from small-scale BAKE combustion of pellets can increase dramatically if not 'low-NO{sub x} burners' are developed. This report can be used as a support in the development of new design and automatic control strategies for pellet burners. NH{sub 3} and HCN dominate the nitrogen compounds in the volatiles leaving the pellet during the devolatilisation. The fuel properties, the residence time and the devolatilisation conditions affect the ratio between these two compounds. The transformation of NH{sub 3} to N{sub 2} takes place through a short and relatively uncomplicated reaction path while the reduction of HCN has a much more complex reaction path with a slower chemical kinetics which leads to longer reaction times. The optimal stoichiometry depends on the residence time, mixing and the composition of the devolatilisation gas in the primary zone. The objective with this study has been to, with a modified pellet burner, minimise NOx in practical experiments with a small literature study as background. In the experiments reported in this project, the performance of a modified pellet burner and the emissions have been studied while the ratio between primary- and secondary air and the addition of primary air have been varied. During the experiments, the air flow, the different emissions, the boiler effect and the temperature in the burner have been measured continuously. A few parameters have been identified as crucial for the NO{sub x}-emissions: Addition of primary air: The primary

  5. Study of the occurrence of organic matter, metals and chemicals in the SFR; Utredning kring foerekomst av organiskt material, metaller och kemikalier i SFR

    Energy Technology Data Exchange (ETDEWEB)

    Sundqvist, J.O. [Swedish Environmental Research Inst., Stockholm (Sweden)

    2001-03-01

    Low- and intermediate level operational waste from the Swedish nuclear power plants, and the Studsvik facility, is currently placed in a repository, termed SFR-l (final repository for radioactive operational waste) near the Forsmark power plant. Two important components in the waste, which can affect the function of the repository, are organic materials, e.g. cloth and paper, and metals (scrap). The release of radionuclides from the repository may be affected by chemical reactions that involve both organic materials and metals. After sealing the repository, the conditions can be such that complexing agents (e.g. isosaccarinic acid) may form when organic materials degrade. These agents typically increase the mobility of radionuclides. Formation of gas, mainly due to metal corrosion, may affect the barrier system, surrounding the waste, such that the release of radionuclides is enhanced. SKB makes an annual report with a compilation of the waste that has been placed in SFR-l . The compilation contains both the amount of waste placed in the repository during the last year and a compilation of the waste that have been placed since the stall of SFR. Moreover, SKB provides a prognosis of the future situation in SFR-1 every third year. SKI (the Swedish Nuclear Power Inspectorate), is responsible for reviewing this reporting. This study was initiated with the purpose of evaluating the uncertainties in SKB's estimates of the amounts of organic matter, metals and chemicals in the waste in SFR- I. The estimates of the quantities of e.g. cellulose and metals in the waste are based on a method which is utilising what is called normal-containers. The waste is classified into certain waste categories. For each waste category there is a specified, presumed composition, named normal-container. The results of this study suggest that the documentation provided by SKB is lacking in some respects. There are for instance examples of incomplete notification of waste and container

  6. Comparison between existing recycle processes for composite materials - a study regarding microwave pyrolysis; Jaemfoerelse av befintliga aatervinningsprocesser foer kompositmaterial - en foerstudie gaellande mikrovaagspyrolys

    Energy Technology Data Exchange (ETDEWEB)

    Pettersson, Carina; Andreasson, Sune (Stena Metall AB (Sweden)); Skrifvars, Mikael; Aakesson, Dan (Hoegskolan i Boraas (Sweden))

    2009-07-01

    The purpose of this project has been to investigate the possibilities to use recycled composites as energy recycling based on microwave pyrolysis and also to evaluate the microwave pyrolysis technique for the recycling of combined materials, such as composites. Composites can be recycled by mechanically grinding into a material which can be used as a filler in virgin composites. However, several earlier studies have showed that this will give a material with inferior quality, and there is presently no economical viable use of the recycled material. Composites can be incinerated together with other waste materials but the high content of inorganic material results in a material with low energy content. Composites typically contain 40-50 weight-% glass fibres, and in some cases be as high as 60-75 weight-%. Consequently, composites often end up at landfill sites and processes to recycle composites do not exit. Large volumes of composites are produced in Europe and these products will largely end up on landfill site after end-of-life as systems to recycle these products do not exist. These composites represent a large amount of energy which presently is not utilized. Processes and materials to produce composites are being developed continuously. This in addition to the need for light weight materials in the aerospace, windmills and automotive industry spurs the use of composites. It is therefore of outmost importance to develop processes to recycle of composites. Recycling of composites by the use of microwave pyrolysis has been studied in this project. Microwave pyrolysis is a process where the material is heated by microwave in an inert environment. The project has been focusing on the recycling of glass fibre reinforced composites as this type of composite makes the large volume of composites. Pyrolysis of glass fibre reinforce composites will result in two fractions - one oil fraction and one inorganic fraction. The oil fraction was analyzed with calorimetry and

  7. Risk based methods for optimised operation of power stations - a pilot study; Riskbaserade metoder foer optimerad drift av kraftvaermeverk - en foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Gunnars, Jens; Gustavsson, Fredrik [Det Norske Veritas AB, Stockholm (Sweden)

    2002-03-01

    Methods for risk based planning and management of maintenance and operation of mechanical components in power stations have been studied. Risk based methods may be utilised for analysis of the risk level with reference to both safety and economy of the plant. The methods can be an important tool for planning and optimisation of the annual investment in different types of maintenance actions, with the purpose of improving long term profitability. The risk based planning can include: selection of components, inspection intervals, coverage, planning of time for replacement/repair of components, and selection of operation conditions. The first part of the report is a general survey and description of risk based methods for analyse of mechanical components. Some problems specific to power stations are discussed. Application of quantitative RBI is illustrated for the water system in steam boiler number 5 at Aabyverket. The possibilities to decrease inspection costs or increase availability also for power stations is obvious, and is expected to result in competitive advantages. The use and understanding of quantitative reliability methods are a necessary and essential part of any RBI assessment.

  8. Effects of small hydropower plants on low-and moss flora. A feasibility study; Virkninger av smaa vannkraftverk paa lav- og mosefloraen: en forundersoekelse

    Energy Technology Data Exchange (ETDEWEB)

    Ihlen, Per G.; Bjelland, Torbjoerg; Vaskinn, Kjetil; Johnsen, Geir Helge

    2012-07-01

    We have established a list of lichen- and moss flora of a waterway to be developed for hydropower production (Vangjolo) and in a control water system (Roesgrovi), both in Voss in Hordaland. The waterways have similar bedrock, exposure, vegetation and elevation. To monitor any change in the flora, it was laid out 20 fixed routes from each river systems where low-and moss flora were recorded. To relate this to the monitoring of potential impacts, l flow, humidity, air temperature, water temperature and dew point temperature were logged. It was recorded 66 species total for Roesgrovi and Vangjolo, and 32 mosses, 29 lichens and 5 vascular plants. The results show that the rivers are so similar to the low-and moss flora that they can form the basis for further investigations. This is also shown by the DCA-analyses. The waterways comprises a combination of species with the same requirements as to moisture, and contains species of high and low Ellenberg indicator values for moisture. There is no statistically significant difference between Roesgrovi and Vangjolo in the fixed routes average values. The hydrological and local climatic measurements also show that the river systems are comparable for further study of possible changes after development. (eb)

  9. Pelletizing using forest fuels and Salix as raw materials. A study of the pelletizing properties; Pelletering med skogsbraensle och Salix som raavara. En undersoekning av pelleterbarheten

    Energy Technology Data Exchange (ETDEWEB)

    Martinsson, Lars; Oesterberg, Stefan [Swedish National Testing and Research Inst., Boraas (Sweden)

    2004-08-01

    Three common forest fuels: light thinning material, cull tree and logging residues as well as energy forest fuel (Salix) has been used as fuel pellet materials. Logging residues and Salix were stacked for approximately 6 and 10 months respectively. Parameters varied for each raw material have been the moisture content and the press length of the die. These parameters have been changed to obtain best possible quality, mainly concerning mechanical durability. Pellets were also produced from bark free shavings in order to use as a reference in this study. Physical as well as chemical properties have been compared. It was comparatively easy to press logging residues and Salix into durable pellets and, even with larger press length, the production of pellets was higher than it was for the other raw materials. The density was equal for all pellets while the mechanical durability was better for all tested raw materials compared with the reference material. The fact that all raw materials besides the reference material contains bark which has an improving effect on the degree of hardness. The quality properties were mainly about the same or better for pellets made of light thinning material and cull tree respectively, compared with the reference pellets. However, the ash content was approximately twice as high compared with the reference pellets. The pellets made of logging residues and Salix respectively were of very good quality concerning duration and density but the ash content was approximately 10 times higher than in the reference pellets. Additionally, the nitrogen content was 6-9 times higher compared with the reference pellets.

  10. Study of flue gas condensers with reference to corrosion risks, biofuel quality, techniques and choice of material; Kartlaeggning av roekgaskondenseringsanlaeggningar med avseende paa korrosionsrisker, biobraenslekvaliteter, teknik och materialval

    Energy Technology Data Exchange (ETDEWEB)

    Stenqvist, Per-Aake

    2012-02-15

    Corrosion in flue gas appliances installed in small and medium sized biomass fired boiler plants has become a problem in an increasing number of sites around Sweden. A trend seems to be that the problems are greater in those plants that use so called terminal chips than those that utilize more homogeneous fuels. In pace with the increasing number of biomass power plants in the country, the demand for cheaper fuel is increased. Through the increasing number of fuel terminals the market is provided even with biofuel mixes in the form of traditional wood chips mixed with bark, forest residue, sawdust, willow, returned wood, etc. Both users and suppliers of boiler and flue gas systems, and fuel suppliers have currently no clear rules or guidelines for relationships between different chemical properties of fuels, technologies, operating data and material. In this report has experience in the form of questionnaires completed by field visits, interviews of operational personnel and literature studies been compiled from a number of plants using different types of flue gas condensers for increased energy output from various types of bio fuels. The purpose of this assignment is to survey the flue gas condensation plant in biomass fired boiler plants for the presence of corrosion damage made in relation to the use of technologies and fuel qualities. A milestone is that the report will be able to be used to support the selection of materials and appropriate techniques for both new facilities and for the repair and improvement of existing ones. Another objective is to compile existing experience and assessment criteria which are reported in the literature. This report describes some typical construction techniques, whenever applicable harmful images and links to various substances present in fuels, ash and condensate

  11. Interpretation of architecture changes by combined use of historical sources, IR Termography and GPR: the study case of San Francesco convent near Montella (AV), Italy

    Science.gov (United States)

    Geraldi, Edoardo; Loperte, Antonio; Dolce, Carmen

    2010-05-01

    In order to reconstruct architectural changes during the centuries often we are forced to trust merely on the evidences of documentary and iconographical sources which could sometimes supply the description of the monument or of a specifically building phase. Such approach does not solve all the questions related to the interpretation of historical data (graphics, descriptions) useful for finding previous configurations of the building. The historical building structure and shape, as they appear at the present are often the final result of a stratification of different phases deeply connected with artistic and technological features of the age during which the building has been designed and realized. Stylistic features, building techniques and functional aspects change in time leaving often written traces in archive sources such as on the building masonry texture (sometimes hidden by plaster) or under the floor. In such situation the Non Destructive Testing investigations by means of infrared thermography and GPR could be useful to characterize masonry, to survey inhomogeneities in the masonry as well as to detect buried walls belongings to ancient building phases. This paper deals with the emblematic study case of San Francisco convent near Montella in Southern Italy. Its complex vicissitudes experienced in last centuries have been the reason of radical transformations of the church and its surrounding buildings. Historical research provided important information on structural interventions and planimetric transformations carried out between the 17th and 18th century. Such data have been correlated with the results obtained by infrared thermography surveys on plastered facades of the convent and GPR profiles carried out under the stone paved floor of the church and cloister, thus improving the knowledge of historical building phases of the monument. The integrated use of building analysis techniques based on NDT techniques together with historical and

  12. Lightning study - climate change and the impact on the incidence of lightning adaptation needs in the power supply; Lynstudien - Klimaendringenes betydning for forekomsten av lyn tilpassingsbehov i kraftforsyningen

    Energy Technology Data Exchange (ETDEWEB)

    Midtboe, Knut Helge; Haugen, Jan Erik; Koeltzow, Morten Andreas Oedegaard

    2011-04-15

    , but also for the network owner, since they cost money and require repair. In the results from Met.no not only an increase in lightning frequency is highlighted, in addition we must also allow for greater variations in different seasons and geographic areas. Areas that until now have been little troubled by lightning may be more exposed, and not least, already known 'problem areas' have more challenges to deal with. Planning under uncertainty. It is difficult with current knowledge to conclude a linear relationship between increased lightning frequency and increase in future outages, but that there will be a connection can not be excluded. Increase in lightning frequency will rise to the need to put this phenomenon in as an important factor in the planning of preventive measures for existing and future construction. Each business must assess the need for specific measures as a basis for prevention and for the dimensioning of the necessary emergency repairs. Through the emergency requirements of the regulations to conduct risk and vulnerability analysis for the individual business, it would be natural from NVE's side to expect that the companies take this or similar studies as the basis for such assessments own challenges. NVE's supervisory activities on emergency area has increased and will increase in the coming year. (Author)

  13. Barndom på nett - En kvalitativ analyse av mammabloggeres fremstilling av egne barn på Internett

    OpenAIRE

    Sinding-Larsen, Helene

    2015-01-01

    Master i sosialt arbeid Denne studien tar for seg et relativt nytt og lite utforsket tema, nemlig fremstillinger av barn i mammablogger. Mammablogger kan forstås og utforskes som en slags personlig dagbok på Internett, hvor bloggeren deler fortellinger fra seg og sine barns hverdagsliv. Jeg har, gjennom et sosialkonstruksjonistisk perspektiv og inspirert av diskursteori, rettet fokus mot hvordan et utvalg av norske mammabloggere fremstiller sine barn. De ulike fremstillingene jeg har funne...

  14. Betydning av fruktose for kostrelaterte helseproblemer

    OpenAIRE

    Kolderup, Astrid

    2013-01-01

    Synet på sukker som næringsmiddel har endret seg de siste ti-årene. Tidligere antakelser, som blant annet at sukker ikke virker fetende, er i dag erstattet med kunnskap om klare sammenhenger mellom sukkerinntak og sykdom. Fruktoses rolle i denne sammenhengen er fortsatt noe uklar. Målet med denne litteraturgjennomgangen er å beskrive kroppens håndtering av fruktose, samt diskutere fruktoses rolle i kostrelaterte helseproblemer, med fokus på blodglukosehomeostase, fedme og karsykdom. På gr...

  15. Diskursordning och hegemoni : Representationer av en skola

    OpenAIRE

    Öhman, Anna

    2012-01-01

    Den här artikeln utforskar, genom en mångperspektivistisk diskursanalys, tidningsartiklar, en vetenskaplig artikel, ett myndighetsbrev, bloggar och ett reportage skrivna om en specifik grundskola i Sverige, som har blivit känd för sitt lyckade utvecklingsarbete med elevernas studieresultat. Enligt denna artikel är bilden som förmedlas genom media mycket positiv tills en artikel följd av en blogg, förändrade diskursordningen på ett hegemoniskt sätt. Den här artikeln beskriver den diskursiva fö...

  16. Påvirkning av personlighetstrekk på klageprosesser, og effekten av kausal prosess på hindsight bias

    OpenAIRE

    Iqbal, Quddos

    2010-01-01

    Hindsight bias er et begrep som omhandler en persons evne til å føle på forhånd hva resultatet blir. Et begrep som ser på folks følelse av å vite at hendelses utfall ble som forventet. Grad av self monitoting forteller om en persons handlinger er refleksjoner av han og hans meninger, eller av andres forventninger. Avhandlingen tar for seg self monitoring i interaksjon med hva slags klagetype en er (påfører selvforskyldt skade på mobil telefon, eller produktfeil), og hva slags klagebehandling ...

  17. Frequency-dependent electrophysiological remodeling of the AV node by hydroalcohol extract of Crocus sativus L. (saffron) during experimental atrial fibrillation: the role of endogenous nitric oxide.

    Science.gov (United States)

    Khori, Vahid; Alizadeh, Ali Mohammad; Yazdi, Hamidreza; Rakhshan, Elnaz; Mirabbasi, Abbas; Changizi, Shima; Mazandarani, Masumeh; Nayebpour, Mohsen

    2012-06-01

    The study assessed the hydroalcohol extract effects of Crocus sativus L. (saffron) on (i) the basic and rate-dependent electrophysiological properties of the AV node, (ii) remodeling of the AV node during experimental atrial fibrillation (AF) and (iii) the role of nitric oxide (NO) in the effects of saffron on the AV node. Stimulation protocols in isolated AV node were used to quantify AV nodal recovery, facilitation and fatigue in four groups of rabbits (n = 8-16 per group). In addition, the nodal response to AF was evaluated at multiple cycle lengths and during AF. Saffron had a depressant effect on AV nodal rate-dependent properties; further, it increased Wenckebach block cycle length, functional refractory period, facilitation and fatigue (p saffron on the AV node (p Saffron increased the zone of concealment in experimental AF (p saffron. Saffron increased the AV nodal refractoriness and zone of concealment. These depressant effects of saffron were mediated by endogenous NO. Copyright © 2011 John Wiley & Sons, Ltd.

  18. Apolipoprotein AV Accelerates Plasma Hydrolysis OfTriglyceride-Rich Lipoproteins By Interaction With Proteoglycan BoundLipoprotein Lipase

    Energy Technology Data Exchange (ETDEWEB)

    Merkel, Martin; Loeffler, Britta; Kluger, Malte; Fabig, Nathalie; Geppert, Gesa; Pennacchio, Len A.; Laatsch, Alexander; Heeren, Joerg

    2005-02-22

    Apolipoprotein A5 (APOA5) is associated with differences intriglyceride levels and familial combined hyperlipidemia. In genetically engineered mice, apoAV plasma levels are inversely correlated with plasmatriglycerides. To elucidate the mechanism by which apoAV influences plasma triglycerides, metabolic studies and in vitro assays resembling physiological conditions were performed. In hAPOA5 transgenic mice(hAPOA5tr), catabolism of chylomicrons and VLDL was accelerated due to a faster plasma hydrolysis of triglycerides by lipoprotein lipase (LPL).Hepatic VLDL and intestinal chylomicron production were not affected. The functional interplay between apoAV and LPL was further investigated by crossbreeding a human LPL transgene with the apoa5 knockout, and the hAPOA5tr to an LPL deficient background. Increased LPL activity completely normalized hypertriglyceridemia of apoa5 deficient mice,however, over expression of human apoAV modulated triglyceride levels only slightly when LPL was reduced. To reflect the physiological situation in which LPL is bound to cell surface proteoglycans, we examined hydrolysis in the presence or absence of proteoglycans. Without proteoglycans, apoAV derived either from triglyceride-rich lipoproteins, hAPOA5tr HDL, or a recombinant source did not alter the LPL hydrolysis rate. In the presence of proteoglycans, however, apoAV led to a significant and dose-dependent increase in LPL mediated hydrolysis of VLDL triglycerides. These results were confirmed in cell culture using a proteoglycan-deficient cell line.A direct interaction between LPL and apoAV was found by ligand blotting.It is proposed, that apoAV reduces triglyceride levels by guiding VLDL and chylomicrons to proteoglycans bound LPL for lipolysis.

  19. "Det första jag gör när jag vaknar är att logga in på Facebook" : En studie om hur användare av de sociala nätverken upplever den användargenererade produktionen

    OpenAIRE

    Magnusson, Per

    2011-01-01

    Abstract Title: The first thing I do when I wake up is to log on to Facebook. A study regarding how users of Social Networks experiences the User Generated production. (Det första jag gör när jag vaknar är att logga in på Facebook. En studie om hur användare av de sociala nätverken upplever den användargenererande produktionen.) Number of pages: 37 (39 including enclosures) Author: Per Magnusson Tutor: Christian Christensen Course: Media and Communication Studies C Period: Fall semester 2010...

  20. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  1. Beta-amyloid deposition and cognitive function in patients with major depressive disorder with different subtypes of mild cognitive impairment: {sup 18}F-florbetapir (AV-45/Amyvid) PET study

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Kuan-Yi; Liu, Chia-Yih; Chen, Chia-Hsiang; Lee, Chin-Pang [Chang Gung Memorial Hospital and Chang Gung University, Department of Psychiatry, Tao-Yuan (China); Chen, Cheng-Sheng [Kaohsiung Medical University Hospital and College of Medicine, Kaohsiung Medical University, Department of Psychiatry, Kaohsiung (China); Hsiao, Ing-Tsung; Hsieh, Chia-Ju; Yen, Tzu-Chen; Lin, Kun-Ju [Chang Gung Memorial Hospital, Department of Nuclear Medicine and Molecular Imaging Center, Kuei Shan Hsiang, Taoyuan (China); Chang Gung University, Department of Medical Imaging and Radiological Sciences and Healthy Aging Research Center, Tao-Yuan (China)

    2016-06-15

    The objective of this study was to evaluate the amyloid burden, as assessed by {sup 18}F-florbetapir (AV-45/Amyvid) positron emission tomography PET, in patients with major depressive disorder (MDD) with different subtypes of mild cognitive impairment (MCI) and the relationship between amyloid burden and cognition in MDD patients. The study included 55 MDD patients without dementia and 21 healthy control subjects (HCs) who were assessed using a comprehensive cognitive test battery and {sup 18}F-florbetapir PET imaging. The standardized uptake value ratios (SUVR) in eight cortical regions using the whole cerebellum as reference region were determined and voxel-wise comparisons between the HC and MDD groups were performed. Vascular risk factors, serum homocysteine level and the apolipoprotein E (ApoE) genotype were also determined. Among the 55 MDD patients, 22 (40.0 %) had MCI, 12 (21.8 %) non-amnestic MCI (naMCI) and 10 (18.2 %) amnestic MCI (aMCI). The MDD patients with aMCI had the highest relative {sup 18}F-florbetapir uptake in all cortical regions, and a significant difference in relative {sup 18}F-florbetapir uptake was found in the parietal region as compared with that in naMCI subjects (P < 0.05) and HCs (P < 0.01). Voxel-wise analyses revealed significantly increased relative {sup 18}F-florbetapir uptake in the MDD patients with aMCI and naMCI in the frontal, parietal, temporal and occipital areas (P < 0.005). The global cortical SUVR was significantly negatively correlated with MMSE score (r = -0.342, P = 0.010) and memory function (r = -0.328, P = 0.015). The negative correlation between the global SUVR and memory in the MDD patients remained significant in multiple regression analyses that included age, educational level, ApoE genotype, and depression severity (β = -3.607, t = -2.874, P = 0.006). We found preliminary evidence of brain beta-amyloid deposition in MDD patients with different subtypes of MCI. Our findings in MDD patients support the

  2. AV Rising: Demand, Budgets, and Circulation Are All Up.

    Science.gov (United States)

    Oder, Norman

    1998-01-01

    A survey of 486 public libraries found that audiovisual (AV) budgets have increased 53% in the last five years. Provides data on average size of AV collections; budget break downs; circulation; audiobook, video, and music CD purchases; popular authors and titles in abridged and unabridged audiobooks; and problems with audiobook, video, and music…

  3. Bochdalek Hernia As A Cause Of Intermittent AV Block.

    Science.gov (United States)

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-09-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  4. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  5. EST Table: AV398806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398806 NV060303 11/12/09 GO hit GO:0005488(binding)|GO:0005515(protein binding)|G... aa gnl|Amel|GB16637-PA 10/09/10 74 %/237 aa gi|91092680|ref|XP_971368.1| PREDICTED: similar to AGAP009538-PA [Tribolium castaneum] AV398806 NV06 ...

  6. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  7. Förstudie till implementering av Electronic Flight Bag

    OpenAIRE

    Löfgren Bengtson, Erik

    2013-01-01

    Flygbranschen har på senare år blivit överrumplad av den snabba expansionen av Electronic Flight Bags (EFB) och introduktionen av bärbara läsplattor har öppnat upp för ett mer ekonomiskt alternativ till fast installerad utrustning. Med anledning av detta har NextJet beslutat sig för att genomföra en förstudie för att se om det går att implementera EFB i bolaget på ett säkert och kostnadseffektivt sätt. Den här studien visar att implementering av Electronic Flight Bag inte kunde påvisa några d...

  8. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  9. Cofactor requirement of HpyAV restriction endonuclease.

    Science.gov (United States)

    Chan, Siu-Hong; Opitz, Lars; Higgins, Lauren; O'loane, Diana; Xu, Shuang-Yong

    2010-02-05

    Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M) systems in microorganisms. We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++). The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  10. Psykologiske kontrakter og påfølgende leder-medarbeider-utveksling - En studie av sammenhengen mellom psykologiske kontrakter fra tidligere arbeidsforhold og påfølgende sosial og økonomisk leder-medarbeider-utveksling

    OpenAIRE

    Gaard, Ida Elisabeth Simonsen; Gogstad, Katrine Zajaczkowski

    2016-01-01

    Master i økonomi og administrasjon I denne studien utvikler vi og tester en modell som knytter tidligere transaksjonelle og relasjonelle psykologiske kontrakter til to ulike former av bytterelasjoner med påfølgende leder; økonomiske og sosiale utvekslingsforhold. I tråd med våre forventninger, viste resultatene at transaksjonelle kontraktsbrudd i et tidligere ansatt-organisasjonsforhold hadde en positiv sammenheng med et økonomisk utvekslingsforhold med påfølgende leder. Arbeidstakere som ...

  11. Effect of Digoxin on A-V Conduction

    Science.gov (United States)

    Spurrell, R. A. J.; Harris, A. M.; Howard, M. R.

    1971-01-01

    The effect of digoxin on A-V conduction in 19 patients with known disease of their conduction tissue was studied while a demand pacing system was in position. Fifteen had transient complete heart block after myocardial infarction and four had chronic intermittent complete heart block. The patients were studied on return to sinus rhythm. In no instance was a return to either second- or third-degree heart block precipitated in these patients despite therapeutic levels and, in some cases, high serum level of digoxin for a period of seven days. The duration of complete heart block after myocardial infarction was 4·3 days in those taking digoxin while in heart block and 3·3 days in those who started digoxin only after return to sinus rhythm. PMID:5106313

  12. Framtagning av en Maintenance Organisation Expositon

    OpenAIRE

    Vukasinovic, Zoran; Mehmeti, Adnan

    2012-01-01

    För att få bedriva underhållsverksamhet på flygplan över 5700kg så måste underhållsorganisationen i fråga vara godkänd av Transportstyrelsen samt följa EU:s flygsäkerhetsmyndighet EASAs Part 145 regelverk. För att berörda myndigheter ska få sig en insikt i hur underhållsorganisationera ser ut och fungerar så måste dessa skriva en verkstadshandbok som beskriver verksamheten och processer. Detta är ett krav som finns beskrivet i Part 145 regelverket. Uppgiften blev att skriva ett förslag på kap...

  13. American AV: Edgar Dale and the Information Age Classroom.

    Science.gov (United States)

    Acland, Charles R

    2017-01-01

    This article demonstrates how the influential scholar Edgar Dale, alongside a generation of educational technologists, helped build an essential place for AV materials and pedagogical methods in the American classroom. It also shows that, for decades, the Payne Fund philanthropy supported multimedia research agendas that shaped ideas about teaching and technology, far beyond involvement in their famed studies on motion pictures and children in the 1930s. With his writings and research programs, Dale advanced concepts of media experience and systematicity, which came to be understood as common sense to the information society. In so doing he was a leading contributor to the discursive and ideological structure of our age of technological and informational abundance.

  14. Transcriptomic differences of genes in the avian target of rapamycin (avTOR) pathway in a divergent line of meat-type chickens selected for feed efficiency.

    Science.gov (United States)

    Lee, J; Aggrey, S E

    2016-06-30

    Avian target of rapamycin (avTOR) is a highly conserved serine-threonine kinase that serves as an intracellular energy and nutrient sensor and regulates cell division, growth, and apoptosis. The role of avTOR in mediating feed intake and growth in poultry is unknown. We studied avTOR signaling activities in duodenum and liver tissues at days 35 and 42 in chickens divergently selected for low (LRFI) or high (HRFI) residual feed intake. The differential expression of genes involved in the avTOR pathway was assayed using real-time polymerase chain reaction. In the duodenum, avTOR was up-regulated in the LRFI chickens at both time points as compared with the HRFI chickens. Other genes found to be differentially expressed at day 35 included v-akt murine thymoma viral oncogene homolog, eukaryotic translation elongation factor 2, eukaryotic translation initiation factor 4E binding protein 1, 3-phosphoinositide dependent protein kinase-1, ribosomal protein S6 kinase, 70 kDa, polypeptide 1 (RPS6KP1), avTOR associated protein, LST8 homolog, ghrelin, phosphoinositide-3-kinase (PI3K), forkhead box O1, and p53 E3 ubiquitin protein ligase homolog (MDM2). At day 42, there was no change in the expression of the avTOR target RPS6KP1 or MDM2. In the liver, changes in the expression of components of the avTOR pathway primarily occurred at day 42, and differential gene expression suggests that avTOR complex 1 (avTORC1) affects feed efficiency at day 42. avTORC1 may be activated in the duodenum of feed-efficient birds to increase nutrient mobilization to other peripheral tissues. Furthermore, activation of avTOR in relation to feed efficiency may be tissue specific and may depend on the tissue's need for growth and nutrient transport. Genetic markers in key genes involved in the avTOR/PI3K pathway could be developed to improve feed efficiency in meat-type chickens.

  15. The Pattern of Brain Amyloid Load in Posterior Cortical Atrophy Using 18F-AV45: Is Amyloid the Principal Actor in the Disease

    Directory of Open Access Journals (Sweden)

    Emilie Beaufils

    2014-11-01

    Full Text Available Background: Posterior cortical atrophy (PCA is characterized by progressive higher-order visuoperceptual dysfunction and praxis declines. This syndrome is related to a number of underlying diseases, including, in most cases, Alzheimer's disease (AD. The aim of this study was to compare the amyloid load with 18F-AV45 positron emission tomography (PET between PCA and AD subjects. Methods: We performed 18F-AV45 PET, cerebrospinal fluid (CSF biomarker analysis and a neuropsychological assessment in 11 PCA patients and 12 AD patients. Results: The global and regional 18F-AV45 uptake was similar in the PCA and AD groups. No significant correlation was observed between global 18F-AV45 uptake and CSF biomarkers or between regional 18F-AV45 uptake and cognitive and affective symptoms. Conclusion: This 18F-AV45 PET amyloid imaging study showed no specific regional pattern of cortical 18F-AV45 binding in PCA patients. These results confirm that a distinct clinical phenotype in amnestic AD and PCA is not related to amyloid distribution.

  16. A case of pancreatic AV malformation in an elderly man.

    Science.gov (United States)

    Gupta, Vipin; Kedia, Saurabh; Sonika, Ujjwal; Madhusudhan, Kumble Seetharama; Pal, Sujoy; Garg, Pramod

    2018-02-05

    A 60-year-old man presented with recurrent abdominal pain and weight loss for 6 months. Abdominal imaging showed a large vascular lesion in the head and neck of pancreas suggestive of arteriovenous malformation (AV malformation). Endoscopic ultrasound was done which showed features of AV malformation with no evidence of pancreatic malignancy. Surgery was planned for definitive treatment of malformation. Digital subtraction angiography with angioembolization was done prior to surgery to reduce vascularity of the lesion. He recovered after a pylorus preserving pancreaticoduodenectomy. Histopathology of the resected specimen confirmed the pancreatic AV malformation. There has been no recurrence at 2 years of follow-up.

  17. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger. Oslo vann og avløpsverk (OVA)

  18. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger.

  19. In vivo studies of the SERT-selective [{sup 18}F]FPBM and VMAT2-selective [{sup 18}F]AV-133 radiotracers in a rat model of Parkinson's disease

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Julie L. [Department of Pharmacology, University of Pennsylvania School of Medicine, Philadelphia, PA 19104 (United States); Oya, Shunichi; Parhi, Ajit K.; Lieberman, Brian P.; Ploessl, Karl; Hou, Catherine [Department of Radiology, University of Pennsylvania School of Medicine, Philadelphia, PA 19104 (United States); Kung, Hank F. [Department of Pharmacology, University of Pennsylvania School of Medicine, Philadelphia, PA 19104 (United States); Department of Radiology, University of Pennsylvania School of Medicine, Philadelphia, PA 19104 (United States)], E-mail: kunghf@sunmac.spect.upenn.edu

    2010-05-15

    Introduction: The utility of [{sup 18}F]FPBM [2-(2'-((dimethylamino)methyl)-4'-(3-[{sup 18}F] -fluoropropoxy)phenylthio)benzenamine], a selective serotonin transporter (SERT) tracer, and [{sup 18}F]AV-133 [(+)-2-Hydroxy-3-isobutyl-9-(3-fluoropropoxy)-10-methoxy-1,2,3,4,6, 7-hexahydro-11bH-benzo[a]quinolizine], a selective vesicular monoamine transporter 2 (VMAT2) tracer, were tested in the 6-hydroxydopamine (6-OHDA) unilateral lesioned rat model. Methods: Positron emission tomography (PET) imaging of three 6-OHDA unilateral lesioned male Sprague Dawley rats (Rats 1-3) were performed with [{sup 18}F]FPBM and [{sup 18}F]AV-133 to examine whether changes in SERT and VMAT2 binding, respectively, could be detected in the brain. The brains of the three rats were then removed and examined by in vitro autoradiography with [{sup 18}F]FPBM and the dopamine transporter ligand, [{sup 125}I]IPT [N-(3'-[{sup 125}I]-iodopropen-2'-yl)-2-beta-carbomethoxy-3-beta-(4-chloro phenyl) tropane, for confirmation. Biodistribution of [{sup 18}F]FPBM in a separate group of p-chloroamphetamine (PCA) treated rats were also performed. Results: PET image analysis showed varying levels of SERT binding reduction (Rat 1=-11%, Rat 2=-4%, Rat 3=-43%; n=2) and a clear and definitive loss of VMAT2 binding (Rat 1=-87%, Rat 2=-72%, and Rat 3=-91%; n=1) in the left striatum when compared to the right (non-lesioned side) striatum. The results from PET imaging were corroborated with quantitative in vitro autoradiography. Rats treated with a selective serotonin toxin (p-chloroamphetamine) showed a significant reduction of [{sup 18}F]FPBM uptake in the cortex and hypothalamus regions of the brain. Conclusion: The preliminary data suggest that [{sup 18}F]FPBM and [{sup 18}F]AV-133 may be useful for the examination of serotonergic and dopaminergic neuron integrity, respectively, in the living brain.

  20. Festival + sted = ?: Vinjerock - en festivals påvirkning på stedsidentitet og stedsutvikling

    OpenAIRE

    Sørbo, Ingelin

    2011-01-01

    Festivaler har blitt en viktig del av opplevelsesøkonomien og stedene de er lokalisert. Denne oppgaven er et case-studie av musikkfestivalen Vinjerock i Vang kommune, og fokuserer på hva slags innvirkninger festivalen har på stedsidentitet og stedsutvikling. Oppgavens empiriske grunnlag baseres på kvalitative intervju med syv aktører fra Vang og Valdres-regionen som er involvert i Vinjerock på ulike måter. Oppgaven består av en todelt analyse: den første delen av analysen fokuserer på festiva...

  1. Er mere meditation relateret til større behandlingseffekter? – Empirisk baserede anbefalinger til en mere kontekstuel meditationsforskning og interventionspraksis

    DEFF Research Database (Denmark)

    Jensen, Christian Gaden; Holde, Louise Victoria Alliverti

    2016-01-01

    Meditation is increasingly applied in health promotion and clinical interventions although the influence of meditation during multimodal interventions is unclear. Even among meditation-based interventions (MBI), theories and recommendations concerning meditation vary substantially. Our primary...... purpose is to discuss from an empirical base if MBI-participants’ amount of meditation practice is a substantial factor for the treatment effects. We investigate this especially by reviewing MBI-research on dose-effect relationships between meditation and outcome changes, and neuroimaging studies...... of meditators and MBI-participants. The clinical evidence shows that participants’ amount of meditation practice is not consistently related to treatment effects. Neuroscientific studies support this notion, since previous meditation practice has not been consistently or specifically related to structural...

  2. Compositional mapping of Vesta quadrangle Av-10

    Science.gov (United States)

    Tosi, F.; Palmer, E.; De Sanctis, M. C.; Nathues, A.; Pieters, C.; Ammannito, E.; Capaccioni, F.; Frigeri, A.; Palomba, E.; Zambon, F.; Jaumann, R.; Le Corre, L.; Preusker, F.; Stephan, K.; Raymond, C. A.; Reddy, V.; Russell, C. T.

    2012-04-01

    The Dawn spacecraft entered orbit around asteroid 4 Vesta in mid-July 2011. Since then, the Visible and InfraRed Imaging Spectrometer (VIR) acquired hyperspectral images of Vesta's surface in the overall wavelength range from 0.25 to 5.1 μm. During the Approach and Survey mission phases (23 July through 29 August 2011), VIR obtained resolved images of Vesta with spatial resolution between 1.31 km and 0.68 km/pix. More than 65% of the surface, from the South Pole up to ˜40°N, was observed under different illumination conditions and local solar elevations. Further data were acquired in the subsequent HAMO and LAMO phases. Based on this datasets, the Dawn Team is conducting mineralogical mapping of Vesta's surface in the form of 15 quadrangle maps. In this work we present the results of the spectroscopic analysis carried out for the quadrangle Av-10 ("Oppia"), spanning Vesta's latitude 22S° - 22N° and longitude 288° - 360°. Vesta is known to have a basaltic surface from visible/near-infrared reflectance spectroscopy. Although pyroxenes' spectral signatures at about 0.9 and 1.9 µm are ubiquitous on Vesta and largely dominate its surface composition, significant variability in slope, strength and wavelength position of the center of these features can be measured, which indicate multiple physical surface processes. Absorption band depth is sensitive to abundance, texture and multiple scattering effects. On the other hand, the position of the band centers is sensitive to Calcium and Magnesium abundance in pyroxenes, which is crucial to establish a link with Howardite, Eucrite and Diogenite meteorites' clan (HEDs). On the basis of several spectral indices, the surface of Vesta can be divided into different terrain types, which are mostly related to specific geological units or morphological surface features. By combining VIR channels and ratios into colour images, the presence and abundance of these materials can be revealed. Among the terrain types identified on

  3. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  4. Navy AV-8B Crash Survivable Flight Incident Recorder (CSFIR)

    National Research Council Canada - National Science Library

    1998-01-01

    ...) met at the Naval Air Weapons Development Center, Building P302, China Lake, CA for a Program Review I Technical Interchange Meeting in support of the AV-8B Crash Survivable Flight Incident Recorder System (CSFIR...

  5. Porträtt - bilder av människan

    OpenAIRE

    Fagerholm, Tanja

    2016-01-01

    Mitt examensarbete är nödvändigtvis inte ett slutresultat av mina visuella arbeten under studietiden utan snarare resultatet av en ständigt pågående process i att hitta min plats inom konsten. En frågeställning jag brottats med under studiernas gång är begreppet konstnär. Vad är en konstnär? Vad är konst? För att närma mig förväntningarna på hur en riktig konstnär bör vara har jag gått tillbaka till en klassisk form av måleri, nämligen avbildning av människor. Istället för att använda mi...

  6. EST Table: AV403989 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403989 pg--0306 10/09/28 100 %/137 aa ref|NP_037751.1| Q protein [Enterobacteria ...phage HK97] gb|AAF31144.1| Q protein [Enterobacteria phage HK97] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404408 pg-- ...

  7. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  8. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  9. EST Table: AV399879 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399879 NV120899 10/09/28 100 %/196 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  10. EST Table: AV399317 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399317 NV120063 10/09/28 100 %/262 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  11. EST Table: AV399810 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399810 NV120810 10/09/28 69 %/173 aa ref|YP_002884353.1| PP34 [Bombyx mandarina n...ucleopolyhedrovirus] gb|ACQ57304.1| PP34 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399543 NV12 ...

  12. EST Table: AV399857 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399857 NV120871 10/09/28 88 %/122 aa ref|YP_002884320.1| ODV-E25 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57271.1| ODV-E25 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399408 NV12 ...

  13. EST Table: AV399758 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399758 NV120722 10/09/28 100 %/229 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  14. EST Table: AV399854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399854 NV120868 10/09/28 86 %/123 aa ref|YP_002884262.1| BRO-A [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57213.1| BRO-A [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399449 NV12 ...

  15. EST Table: AV399743 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399743 NV120679 11/12/09 n.h 10/09/28 84 %/219 aa ref|NP_047426.1| ARIF-1 [Bombyx... mori NPV] gb|AAC63695.1| ARIF-1 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399743 NV12 ...

  16. EST Table: AV404219 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404219 pg--0716 10/09/28 88 %/150 aa ref|YP_002928933.1| Host specificity protein... J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404050 pg-- ...

  17. AVS (Application Visualization System) user`s guide

    Energy Technology Data Exchange (ETDEWEB)

    Masuko, Kenji; Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Gorai, Kazuo; Yamazaki, Kazuhiko

    1996-03-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS for image processing software and an animation processing system (video, frame scan converter). This report summarizes the information to use AVS and to develop and maintain computer and network environment for image processing. (author).

  18. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  19. EST Table: AV403342 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403342 msgV0350 11/12/09 GO hit GO:0004867(serine-type endopeptidase inhibitor ac...erpin-28 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403342 msgV ...

  20. EST Table: AV399322 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399322 NV120068 10/09/28 86 %/174 aa ref|NP_047489.1| VP39 [Bombyx mori NPV] gb|A...AC63758.1| VP39 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  1. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  2. The effectiveness of video-based training of an electronic medical record system: An exploratory study on computer literate health workers in rural Uganda : Ändamålsenligheten hos videobaserad undervisning av ett elektroniskt patientjournalsystem: en explorativ studie av datorvana sjukvårdsarbetare på Ugandas landsbygd

    OpenAIRE

    Hammarbäck, Axel

    2015-01-01

    Aims The purpose of this study is to explore the possibilities for video-based learning of computer systems in the field of medical education in rural sub-Saharan Africa. Background Low-income countries are forced to perform healthcare services with resources already spread too thin. The use of electronic medical records can increase the cost-effectiveness of delivering healthcare services, but the low computer literacy in sub-Saharan Africa is an obstacle necessary to overcome. E-learning an...

  3. Cold model study of a fuel bed on a moving grate. Stage 1- Parameter study of the interaction between grate/pusher movements and fuel bed; Kallmodellstudie av en braenslebaedd paa roerlig rost. Etapp 1- Parameterstudie av samspelet mellan rost-/pusherroerelser och braenslebaedd

    Energy Technology Data Exchange (ETDEWEB)

    Broden, Henrik; Larfeldt, Jenny [TPS Termiska Processer AB, Nykoeping (Sweden)

    2004-03-01

    A cold model study on fuel bed transportation on a moving grate has been done. The objective of the project has been to study the interaction between pusher and grate movement, fuel properties, inclination of the grate and the stroke length of the grate rods affects bed feeding. The cold rig has twelve rows of rods, where every second row is movable and every second is fixed. The inclination of the grate can be invariably adjusted up to 20 deg and the maximum stroke of the rods is 10 cm. The experiments show that the feeding ratio between the pusher and the grate to a large extent controls the resulting fuel bed height at the grate. The trials also demonstrate that the grate inclination, stroke length of the grate rods and fuel properties affects the bed height. Reduced grate inclination increases the bed height, which demonstrates that the force of gravity is important for the bed feeding. Trails with reduced grate stroke length, at maintained feeding ratio, resulted in an increased bed height, which probably was caused by fuel particle arching in the vicinity of the moving rods. Fuel particle arching reduces the ability for the moving grate rods to transfer force to the fuel bed. In other aspects identical trials with dry wood chips and wet bark show that fuel properties also affects the bed height. Wet bark is more difficult for grate to feed, which results in an increased bed height. The experiments show that in principle bed transportation occur in parallel to the grate plane during grate feeding. Vertical mixing hardly exists. Detailed studies on fuel particle movement at different depth of the fuel bed show that particles at or near the surface are transported more quickly along the grate than particles deeper into the bed. The existence of a velocity gradient in the fuel bed is an important finding since it explains how dispersion of fuel particles can exist in spite of the absence of vertical mixing. The velocity gradient can also contribute to the

  4. En teoretisk receptionsanalyse og en empirisk test

    OpenAIRE

    Illum, Astrid; Christiansen, Line Flege

    2006-01-01

    Udgangspunktet for dette projekt, er et kommunikationsprodukt bestående af en plakat, en annonce og en pjece. Produktet er en kampagne mod voksenmobning på arbejdspladsen med overskriften 'Mobning er psykisk vold'. Vi går i dette projekt ud fra Ecos teori om modellæseren, som et teoretisk begreb om mulighederne for faktiske læsninger, og analyserer vores produkt ud fra denne teori. Derefter undersøger vi, om vores målgruppe henholdsvis besidder de kompetencer og anvender de konventioner, s...

  5. Den empiriske uddannelsesvidenskab og kvalitet i studieaktivitet

    DEFF Research Database (Denmark)

    Keiding, Tina Bering; Qvortrup, Ane

    2015-01-01

    Bidraget kobler studieaktivitetesmodellen med kvalitetsindikatorer for god undervisning, og viler blandt andet, hvorledes modellen kan støtte samtænkning af forskellige undervisnings- og læringsformater med henblik på øge den aktive læretid...

  6. Onlinespel en upplevelse : en kvalitativ undersökning av ungdomars attityder om onlinespel

    OpenAIRE

    Moradi, Armin

    2010-01-01

    AbstractTitle: Onlinegaming – A qualitative study of young people's attitudes about online gaming(Onlinespel – En Kvalitativ undersökning av Ungdomars attityder om onlinespel)Number of pages: 34 (35 including enclosures)Author: Armin MoradiTutor: Else NygrenCourse: Media and Communication Studies CPeriod: Autumn 2009University: Division of Media and Communication, Department of Information Science,Uppsala UniversityPurpose/Aim: The purpose of my thesis is that from a social perspective to exa...

  7. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  8. Stability and activity of lactate dehydrogenase on biofunctional layers deposited by activated vapor silanization (AVS) and immersion silanization (IS)

    Science.gov (United States)

    Calvo, Jorge Nieto-Márquez; Elices, Manuel; Guinea, Gustavo V.; Pérez-Rigueiro, José; Arroyo-Hernández, María

    2017-09-01

    The interaction between surfaces and biological elements, in particular, proteins is critical for the performance of biomaterials and biosensors. This interaction can be controlled by modifying the surface in a process known as biofunctionalization. In this work, the enzyme lactate dehydrogenase (LDH) is used to study the stability of the interaction between a functional protein and amine-functionalized surfaces. Two different functionalization procedures were compared: Activated Vapor Silanization (AVS) and Immersion Silanization (IS). Adsorption kinetics is shown to follow the Langmuir model for AVS-functionalized samples, while IS-functionalized samples show a certain instability if immersed in an aqueous medium for several hours. In turn, the enzymatic activity of LDH is preserved for longer times by using glutaraldehyde as crosslinker between the AVS biofunctional surface and the enzyme.

  9. Internkommunikation på IKEA : En funktionsanalys av IKEA Uppsalas interna kommunikation

    OpenAIRE

    Johansson, Fredrik

    2007-01-01

    Abstract Title: Internal communication at IKEA – A functional analysis of IKEA Uppsalas internal communication (Intern kommunikation på IKEA – En funktionsanalys av IKEA Uppsalas interna kommunikation) Author: Fredrik Johansson Aim: The purpose of this study is to analyze the internal communication at IKEA Uppsala. Are the channels of communication working efficiently? How is the information received by the employees? Finally I will make a few suggestions on how the internal communication can...

  10. Overføring av avløpsvann fra Bekkelagets rensedistrikt til Sentralrenseanlegg Vest, SRV. En vurdering av konsekvensene for forholdene i Indre Oslofjord

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1985-01-01

    Vurderingen legger særlig vekt på oksygenforholdene i Vestfjorden under sprangsjiktet . Det sikreste tiltaket ser ut til å være en ombygging av Bekkelaget R.A.til kjemisk rensing. Overføring til SRV vil gi økt direkte utslipp av oksygenforbrukende stoff til Vestfjorden. For overføring av 1/3 av avløpsvannmengden er det mulig at dette oppveies av minsket belastning fra organisk produksjon i overflaten. Overføringer på 2/3 og 3/3 ser ut til å gi uakseptable konsekvenser for oksygenforholdene i ...

  11. Maillard reaction and enzymatic browning affect the allergenicity of Pru av 1, the major allergen from cherry (Prunus avium).

    Science.gov (United States)

    Gruber, Patrick; Vieths, Stefan; Wangorsch, Andrea; Nerkamp, Jörg; Hofmann, Thomas

    2004-06-16

    The influence of thermal processing and nonenymatic as well as polyphenoloxidase-catalyzed browning reaction on the allergenicity of the major cherry allergen Pru av 1 was investigated. After thermal treatment of the recombinant protein rPru av 1 in the absence or presence of carbohydrates, SDS-PAGE, enzyme allergosorbent tests, and inhibition assays revealed that thermal treatment of rPru av 1 alone did not show any influence on the IgE-binding activity of the protein at least for 30 min, thus correlating well with the refolding of the allergen in buffer solution as demonstrated by CD spectroscopic experiments. Incubation of the protein with starch and maltose also showed no effect on IgE-binding activity, whereas reaction with glucose and ribose and, even more pronounced, with the carbohydrate breakdown products glyceraldehyde and glyoxal induced a strong decrease of the IgE-binding capacity of rPru av 1. In the second part of the study, the effect of polyphenoloxidase-catalyzed oxidation of polyphenols on food allergen activity was investigated. Incubation of rPru av 1 with epicatechin in the presence of tyrosinase led to a drastic decrease in IgE-binding activity of the protein. Variations of the phenolic compound revealed caffeic acid and epicatechin as the most active inhibitors of the IgE-binding activity of rPru av 1, followed by catechin and gallic acid, and, finally, by quercetin and rutin, showing significantly lower activity. On the basis of these data, reactive intermediates formed during thermal carbohydrate degradation as well as during enzymatic polyphenol oxidation are suggested as the active chemical species responsible for modifying nucleophilic amino acid side chains of proteins, thus inducing an irreversible change in the tertiary structure of the protein and resulting in a loss of conformational epitopes of the allergen.

  12. Relationship of Serum Apolipoprotein A-V Levels, Oxidative Stress and Inflammatory Biomarkers with Hypertriglyceridemia in Type 2 Diabetes Mellitus.

    Science.gov (United States)

    Sharma, Devesh; Garg, Seema; Mehndiratta, Mohit; V Madhu, S; Puri, Dinesh

    2017-04-01

    Serum levels of triglycerides (TGs) are often found to be raised in type 2 diabetes mellitus (T2DM). TG levels ≥ 2.2 mM, systemic inflammation and oxidative stress (OS) are known to increase the risk of incident cardiovascular disease (CVD) substantially. In recent years, apolipoprotein A-V (Apo A-V protein) has attracted considerably as a modulator of circulating TG levels. The study was conducted in order to evaluate the levels of Apo A - V proteins and markers of inflammation and OS in patients of T2DM with and without hypertriglyceridemia (HTG) and also to assess correlation between them. T2DM patients were categorized into two groups of 40 participants, according to criteria for risk of CVD: group 1/ controls (TG ≤ 1.65 mM, n = 40) and group 2/ cases (TG ≥ 2.2 mM, n = 40). Despite the routine investigations, serum levels of Apo A-V, interleukin-6 (IL-6) and Insulin were estimated using ELISA, free fatty acids (FFA) with fluorometric assay and malondialdehyde (MDA) was measured using a spectrophotometer. Comparison of levels and correlation between variables was carried out with appropriate statistical tools. Serum Apo A-V protein levels were found significantly lower (P = 0.04) and MDA was significantly higher (P = 0.049) in cases. MDA correlated with TG levels positively (P = 0.000) and negatively with high density lipoproteins (HDL) (P = 0.000). However Apo A-V protein levels did not correlate with TG levels (P = 0.819, r = -0.027), IL-6 (r = 0.135, P = 0.269), FFA (r = 0.128, P = 0.277) and MDA (r = -0.217, P = 0.073). IL-6 levels significantly and positively correlated with HOMA-IR (r = 0.327, P = 0.004) in the all patients. In patients of T2DM, low levels of Apo A-V are associated with HTG, indicating that Apo A-V is linked with TG metabolism. Burden of oxidative stress is greater in HTG of T2DM as is evident from MDA levels and its correlation with TG levels. Since oxidative stress is an important patho-physiological basis which increases the risk

  13. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  14. Influence of commercial (Fluka) naphthenic acids on acid volatile sulfide (AVS) production and divalent metal precipitation.

    Science.gov (United States)

    McQueen, Andrew D; Kinley, Ciera M; Rodgers, John H; Friesen, Vanessa; Bergsveinson, Jordyn; Haakensen, Monique C

    2016-12-01

    Energy-derived waters containing naphthenic acids (NAs) are complex mixtures often comprising a suite of potentially problematic constituents (e.g. organics, metals, and metalloids) that need treatment prior to beneficial use, including release to receiving aquatic systems. It has previously been suggested that NAs can have biostatic or biocidal properties that could inhibit microbially driven processes (e.g. dissimilatory sulfate reduction) used to transfer or transform metals in passive treatment systems (i.e. constructed wetlands). The overall objective of this study was to measure the effects of a commercially available (Fluka) NA on sulfate-reducing bacteria (SRB), production of sulfides (as acid-volatile sulfides [AVS]), and precipitation of divalent metals (i.e. Cu, Ni, Zn). These endpoints were assessed following 21-d aqueous exposures of NAs using bench-scale reactors. After 21-days, AVS molar concentrations were not statistically different (pprecipitation were not vulnerable to NAs, indicating passive treatment systems utilizing sulfide production (AVS) could be used to treat metals occurring in NAs affected waters. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  16. EST Table: AV399445 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399445 NV120238 11/12/09 n.h 10/09/28 100 %/284 aa ref|YP_002884369.1| IE-1 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  17. Distribusjon av Polonium i fisk, med og uten avleiringshemmer

    OpenAIRE

    Veddeng, Hanne

    2012-01-01

    I forbindelse med utvinning av petroleumsressurser blir det sluppet ut store mengder produsert vann. Produsert vann er formasjonsvann fra reservoaret som følger med ved produksjonen av olje og gass. Når formasjonsvannet kommer i kontakt med sjøvann felles det ut uorganiske salter, som BaSO4. Dette er såkalte scaleavleiringer som utgjør et problem for oljeindustrien da det blant annet tetter igjen produksjonsrørene og gir en mindre effektiv produksjon. Som løsning på problemet tilsetter oljein...

  18. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  19. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  20. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  1. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  2. Analys av Arbetsmiljöverkets tillämpning av enkätverktyget NOSACQ-50

    OpenAIRE

    Andersson, Robin

    2013-01-01

    År 2013 införde Arbetsmiljöverket ett nytt webbaserat enkätverktyg som skall kunna ge ett mått av säkerhetskulturen hos företag och organisationer. Denna enkät baserades på tidigare forskning som tog fram en enkät, NOSACQ-50, för just detta ändamål. Värt att notera är att Arbetsmiljöverkets version är förkortad där vissa påståenden togs bort och vissa skrevs om. Det är detta som analysen behandlar. Hur påverkas resultaten av dessa förändringar som genomfördes av Arbetsmiljöverket? Analysen un...

  3. Do acid volatile sulfides (AVS) influence the accumulation of sediment-bound metals to benthic invertebrates under natural field conditions?

    Science.gov (United States)

    De Jonge, Maarten; Dreesen, Freja; De Paepe, Josefina; Blust, Ronny; Bervoets, Lieven

    2009-06-15

    The present study evaluates the influence of acid volatile sulfides (AVS) on accumulation of sediment-bound metals in benthic invertebrates under natural field conditions. Natural sediments, pore water, surface water, and two species of widespread benthic invertebrates (Chironomus gr. thummi and Tubifex tubifex) were collected from 17 historical polluted Flemish lowland rivers and measured for metal concentrations. Different sediment characteristics were determined (AVS, organic matter, clay content) and multiple regression was used to study their relationship with accumulated metals in the invertebrates. Physical and chemical analysis of the field samples indicated low metal concentrations in the water and pore water, but very high metal concentrations in the sediment and the invertebrates, especially for Pb (5.99 micromol/ g). In general, metal accumulation in chironomids and tubificid worms was most strongly correlated with total metal concentrations in the sediment and sediment metal concentrations normalized for organic matter and clay content. Following the results of the linear regression model, AVS did not turn out to be a significant variable in describing variation in metal accumulation. Our study clearly demonstrates that, in addition to the results gained from experiments under lab conditions, benthic invertebrates can accumulate metals from unspiked field sediments even when there's an excess of AVS.

  4. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...... for konflikt og hjelpeløshet. Helsefremmende arbeid basert på dialog og tidlig intervensjon kan forhindre at online-spilladferd kommer ut av kontroll....

  5. Open Source AV solution supporting In Situ Simulation and Clinical education

    DEFF Research Database (Denmark)

    Simonsen, Eivind Ortind; Pociunas, Gintas; Dahl, Mads Ronald

    2015-01-01

    for a portable AV system for VAD. The system would make use of components widely available and easily replaceable. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost and a potential continues improvement and expansion of the AV system. Summary of results...... debriefing in a mobile, in situ simulation environment using an AV system constructed from “off the shelf” components and Open Source software....

  6. Rensing av avløpsvann fra settefiskanlegg med Algas Microfilter

    OpenAIRE

    Ohren, J.A.

    1987-01-01

    Rensing av avløpsvann fra settefiskanlegg er foretatt med Algas Microfilter: Under vanlig drift var avløpsvannets innhold av suspendert stoff, TOC, total nitrogen og total fosfor lavt. Renseeffektene var følgelig også lave. Ved vask av fiskekarene i settefiskanlegget økte ovennevnte innhold av forurensninger i avløpsvannet betydelig. Renseeffektene gjennom silen økte også betydelig. Algas

  7. Outlook on renewable fuels in Sweden - Update and extension of the study 'Opportunities for renewable fuels in Sweden to 2030' by Grahn and Hansson, 2010; Utsikt foer foernybara drivmedel i Sverige - Uppdatering och utvidgning av studien 'Moejligheter foer foernybara drivmedel i Sverige till aar 2030', av Grahn och Hansson 2010

    Energy Technology Data Exchange (ETDEWEB)

    Hansson, Julia [IVL, Stockholm (Sweden); Grahn, Maria [Chalmers Tekniska Hoegskola, Goeteborg (Sweden)

    2013-02-15

    The purpose of this study is to update and extend the authors' analysis, from 2010. The report includes a compilation of other actors visions for the development of renewable fuels, a compilation of control means for renewable fuels, a survey of existing and planned production for biofuels in Sweden and outlook to the world. There is a discussion of Sweden's future import opportunities, a survey of the state of infrastructure and vehicles, and finally scenarios for the development of renewable fuels in Sweden to 2030, with different assumptions. The study's analysis is based on literature studies, contacts with actors in the field and on the results of our own scenarios. The scenarios provide a picture of the potential contribution of renewable fuels, to the Swedish road transport sector, can range from 7 to 16 TWh in 2020 and 13-30 TWh in 2030 (of which 5 to 13 TWh in 2020 and 13-26 TWh in 2030 is the possible domestic contribution that is., without imports)

  8. Att översätta könsneutralt : En empirisk undersökning med fokus på översättning till svenska och tyska på Europaparlamentet

    OpenAIRE

    Melzer, Sarah Maria

    2011-01-01

    I denna uppsats undersöks om, och i så fall hur, man översätter könsneutralt på Europaparlamentet. Man kan översätta könsneutralt genom att till exempel skriva han eller hon, använda passiv eller plural. För att kunna undersöka hur man översätter könsneutralt, redogörs för vad genus och könsneutralt språk är, vilken roll genus spelar för denna typ av översättning, vilka olika genusaspekter som är viktiga för tyska och svenska, och terminologiska aspekter. Den teoretiska utgångspunkten bygger ...

  9. Undersøkelser av utfordringer og vurdering av tiltak for renseanlegg tilknyttet Orklas produksjonslokaler på Rygge

    OpenAIRE

    Langfeldt, Samson

    2017-01-01

    Bakgrunnen for oppgaven ligger i at avløpsvannet fra produksjon av syltete rødbeter, sylteagurker, surkål m.m. ikke overholder kravene som er gitt i påslippsavtalen med kommunen. Dette kan føre til konsekvenser for fabrikkeierne, og ha negative konsekvenser på avløpsnettet. Denne oppgaven har fokusert på å finne årsaken til disse problemene samtidig som den gjør en teknisk analyse av mulige løsninger som kan fungere for anlegget. På anlegget er det blitt gjort undersøkelser avløpsvannets alka...

  10. Clearance of materials from dismantling of nuclear facilities in Sweden - a study on whether the EU recommendations are applicable in Sweden; Friklassning av material fraan rivning av kaerntekniska anlaeggningar i Sverige - en utredning om EU:s rekommenderade regler aer tillaempbara i Sverige

    Energy Technology Data Exchange (ETDEWEB)

    Hamrefors, Gunilla [Westinghouse Electric Sweden AB, Vaesteraas (Sweden)

    2004-02-01

    The report presents a study on whether the EU recommendations on clearance of metals, buildings and building rubble from the dismantling of nuclear facilities are applicable in Sweden. Analyses are made to estimate the amounts of waste that would be released from dismantling of the Swedish nuclear power plants and to what degree the costs of the licence holders would be influenced. A summary and evaluation of different methods and equipments for measurement is also given. The main conclusion is that the EU recommendations are applicable in Sweden.

  11. Atrial rate adaptive pacing: what happens to AV conduction?

    Science.gov (United States)

    Linde, C; Nordlander, R; Rosenqvist, M

    1994-10-01

    To investigate if an nonphysiological prolongation of the AV interval is common during activity sensor modulated atrial rate adaptive (AAIR) pacing, 21 patients with sinus node disease treated with fixed rate atrial (AAI) or AAIR pacemakers were examined. Spike-Q intervals were compared at different heart rates obtained by overdrive pacing at rest and during exercise (Study I), measured during exercise at unresponsive (AAI), optimal (AAIR) and over responsive programming (AAIR+) of the activity sensor (Study II), and finally examined by 24-hour Holter recording in AAI and AAIR pacing modes (Study III). Study I: The spike-Q interval increased significantly with increasing heart rate at rest, but not during exercise. At rest the spike-Q interval was significantly higher at all heart rates compared to exercise. There was a significant positive correlation between the maximal spike-Q interval at rest and the maximal spike-Q interval during exercise (r = 0.63). Study II: The spike-Q interval was shortest in the AAI and longest in the AAIR+ mode in all patients. Study III: During AAI or AAIR pacing the spike-Q interval was longest at night and shortest in the morning. The mean spike-Q interval was longer in AAIR than in AAI pacing. No statistical difference between the maximal spike-Q intervals observed during the two modes was, however, found. Variations in spike-Q interval are generally caused by changes in autonomic tone or medication with drugs with antiarrhythmic effect.(ABSTRACT TRUNCATED AT 250 WORDS)

  12. Kemiinnehåll i undervisningen för nybörjare. En studie av hur ämnesinnehållet får konkurrera med målet att få eleverna intresserade av naturvetenskap

    Directory of Open Access Journals (Sweden)

    Astrid Berg

    2012-06-01

    Full Text Available This study describes the dilemma of making science interesting on the one hand, and to introduce students into a scientific teaching practise on the other in a laboratory based teaching practise. The study was conducted in a grade four class in Swedish compulsory school by video- and tape-recorded classroom observations. The recordings and copies of students’ writing and drawing were analysed by using a two-fold strategy. Firstly, the constituted content was analysed by focusing the classroom communication, the tools used and the teacher’s guiding. Secondly, the various laboratory experiments where analysed in order to identify the potential chemistry content. The result indicates that the constituted chemistry content is reduced and sometimes wrong in relation to the potential content. This can be explained by a teaching tradition that focuses on the importance of making science interesting and fun. However, striving for this may create a learning-situation where students do not learn how to use tools to make relevant hypotheses and observations. What can be regarded as irrelevant hypotheses and observations is not questioned. Further, right or wrong results in the scientific practise are not dealt with neither in the self-produced texts nor in the classroom discussions. One main conclusion is that students enjoy the lessons but the introduction into the scientific practise is not facilitated. 

  13. Environmental analysis of the system for the households' wastewater and organic waste. Synthesis of handling systems studied in the research program 'Organic waste as a plant nutrient resource'; Miljoesystemanalys av hushaallens avlopp och organiska avfall. Syntes av hanteringssystem undersoekta inom FoU-programmet 'Organiskt avfall som vaextnaeringsresurs'

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, E. [Chalmers Inst. of Technology, Goeteborg (Sweden). Sanitary Engineering; Joensson, Haakan; Sonesson, Ulf [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Agricultural Engineering; Gruvberger, C.; Dalemo, M. [Swedish Inst. of Agricultural Engineering, Uppsala (Sweden); Stenstroem, T.A. [Swedish Inst. for Infections Disease Control, Stockholm (Sweden)

    2001-11-01

    Knowledge derived within the RandD programme 'Organic waste as a plant nutrient resource' was in this study used to compare four systems for handling wastewater and organic waste. In the conventional system, the sewage is treated in a sewage plant (SP) with mechanical, biological (incl. 70% nitrogen reduction) and chemical treatment. The sludge is anaerobically digested, dewatered and stored for 20 days. In the energy forest irrigation system the SP has no special nitrogen or phosphorus reduction and the effluent water is stored during winter and used for irrigation during summer. In the liquid compost system the wastewater from the vacuum toilets is co-treated with organic household waste in a reactor at 55 deg C for 7 days. In the other systems, the organic household waste is treated in a central windrow compost. In the urine separation system, the source-separated urine is hygienised by separate storage for 6 months. In the liquid compost and urine separation systems the grey water or the grey water plus faecal wastewater respectively is treated in a SP with phosphorus reduction but without nitrogen reduction. The residual products of the systems fertilise arable land 10 km away. The mass flows, environmental effects, energy turnover and resource utilisation were simulated using ORWARE (ORganic WAste REsearch model), assuming that the wastewater and organic household waste from 20,000 people were treated by the systems. Table values were used for composition of wastewater etc. Industrial wastewater and surface water were excluded from the study. The risk of disease transmission was discussed from the flows and faecal concentrations of the wastewater and from estimated intake of Salmonella, EHEC and Cryptosporidium by some animals under assumed conditions. Throughout the study, it was assumed that the systems function well, without disruptions, and that they are used as intended. The compared environmental effects and resource usage were prioritised in

  14. Environmental system analysis of the waste water and organic wastes from households - synthesis of handling systems studied in the program 'Organic waste as a plant nutrient resource'; Miljoesystemanalys av hushaallens avlopp och organiska avfall - syntes av hanteringssystem undersoekta inom FoU-programmet 'Organiskt avfall som vaextnaeringsresurs'

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, E.; Joensson, Haakan; Gruvberger, C.; Dalemo, M.; Sonesson, Ulf; Stenstroem, T.A. [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden)

    2001-03-01

    Knowledge derived within the R and D programme 'Organic waste as a plant nutrient resource' was in this study used to compare four systems for handling wastewater and organic waste. In the conventional system, the sewage is treated in a sewage plant (SP) with mechanical, biological (incl. 70% nitrogen reduction) and chemical treatment. The sludge is anaerobically digested, dewatered and stored for 20 days. In the energy forest irrigation system the SP has no special nitrogen or phosphorus reduction and the effluent water is stored during winter and used for irrigation during summer. In the liquid compost system the wastewater from the vacuum toilets is co-treated with organic household waste in a reactor at 55 deg C for 7 days. In the other systems, the organic household waste is treated in a central windrow compost. In the urine separation system, the source-separated urine is hygienised by separate storage for 6 months. In the liquid compost and urine separation systems the grey water or the grey water plus faecal wastewater respectively is treated in a SP with phosphorus reduction but without nitrogen reduction. The residual products of the systems fertilise arable land 10 km away. The mass flows, environmental effects, energy turnover and resource utilisation were simulated using ORWARE (ORganic WAste REsearch model), assuming that the wastewater and organic household waste from 20 000 people were treated by the systems. Table values were used for composition of wastewater etc. Industrial wastewater and surface water were excluded from the study. The risk of disease transmission was discussed from the flows and faecal concentrations of the wastewater and from estimated intake of Salmonella, EHEC and Cryptosporidium by some animals under assumed conditions. Throughout the study, it was assumed that the systems function well, without disruptions, and that they are used as intended. The compared environmental effects and resource usage were prioritised

  15. Durability of pellets made from different wood fuel assortments - The effect of moisture content, particle size and temperature development during storage. A laboratory-scale study; Haallfasthet hos braenslepellets tillverkade av olika traedbraenslesortiment - betydelsen av fukthalt, fraktionsstorlek och temperaturutveckling under lagringen. En laboratoriestudie

    Energy Technology Data Exchange (ETDEWEB)

    Lehtikangas, Paeivi [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Management and Products

    2001-02-01

    Durability of fuel pellets is one of the most important quality variables. The aim of this pilot study was to investigate the effect of moisture content and particle size distribution on the durability of pellets made out of sawdust, logging residues and bark from Norway spruce and Scots pine. Moreover, the durability of pellets made out of logging residues which were exposed to high temperature development was investigated. Pellets were manufactured using a laboratory press CPM Europe. The determined quality parameters were moisture content, percentage of accept-pellets (percentage of pellets of the total amount of raw material), temperature and density of individual pellets. The pelleting process was controlled by monitoring the raw material input to the press, vibration and power consumption. From the results of this study the following preliminary conclusions can be drawn: * Increase moisture content and temperature during pelleting had a positive correlation with the percentage of the accept-pellets, especially concerning the bark assortments, and * Pellets made out of particles smaller than 1 mm resulted in a significantly (Student's t-test) higher percentage of accept-pellets than pellets made out of particles of 1-2 mm. Moreover, the process temperature was probably too low (max. 86 deg C) to activate softening of the lignin. A lower press temperature was sufficient to produce the same percentage of accept-pellets of fresh bark than with other raw materials. A possible reason for that is the presence of high amounts of extractives in bark, which could develop an adhesive nature during thermal treatment.

  16. SplicerAV: a tool for mining microarray expression data for changes in RNA processing

    Directory of Open Access Journals (Sweden)

    Garcia-Blanco Mariano A

    2010-02-01

    Full Text Available Abstract Background Over the past two decades more than fifty thousand unique clinical and biological samples have been assayed using the Affymetrix HG-U133 and HG-U95 GeneChip microarray platforms. This substantial repository has been used extensively to characterize changes in gene expression between biological samples, but has not been previously mined en masse for changes in mRNA processing. We explored the possibility of using HG-U133 microarray data to identify changes in alternative mRNA processing in several available archival datasets. Results Data from these and other gene expression microarrays can now be mined for changes in transcript isoform abundance using a program described here, SplicerAV. Using in vivo and in vitro breast cancer microarray datasets, SplicerAV was able to perform both gene and isoform specific expression profiling within the same microarray dataset. Our reanalysis of Affymetrix U133 plus 2.0 data generated by in vitro over-expression of HRAS, E2F3, beta-catenin (CTNNB1, SRC, and MYC identified several hundred oncogene-induced mRNA isoform changes, one of which recognized a previously unknown mechanism of EGFR family activation. Using clinical data, SplicerAV predicted 241 isoform changes between low and high grade breast tumors; with changes enriched among genes coding for guanyl-nucleotide exchange factors, metalloprotease inhibitors, and mRNA processing factors. Isoform changes in 15 genes were associated with aggressive cancer across the three breast cancer datasets. Conclusions Using SplicerAV, we identified several hundred previously uncharacterized isoform changes induced by in vitro oncogene over-expression and revealed a previously unknown mechanism of EGFR activation in human mammary epithelial cells. We analyzed Affymetrix GeneChip data from over 400 human breast tumors in three independent studies, making this the largest clinical dataset analyzed for en masse changes in alternative mRNA processing

  17. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  18. EST Table: AV401520 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401520 e96h0828 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  19. EST Table: AV398543 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398543 NV021933 10/09/28 92 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 93 %/1

  20. EST Table: AV400552 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400552 br--1440 10/09/28 93 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 94 %/1

  1. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  2. EST Table: AV404642 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404642 prgv0279 10/09/28 81 %/116 aa ref|NP_001091796.1| programmed cell death pr...otein 5-like protein [Bombyx mori] gb|ABJ97180.1| programmed cell death protein 5-like protein [Bombyx mori

  3. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  4. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  5. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  6. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  7. EST Table: AV398357 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398357 NV021720 10/09/28 44 %/103 aa ref|XP_002435218.1| charged multivesicular b...ody protein, putative [Ixodes scapularis] gb|EEC08042.1| charged multivesicular body protein, putative [Ixod

  8. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  9. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  10. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  11. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  12. EST Table: AV399390 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399390 NV120162 11/12/09 n.h 10/09/28 100 %/181 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopol

  13. EST Table: AV399744 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399744 NV120680 10/09/28 98 %/185 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  14. EST Table: AV399272 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399272 NV120003 10/09/28 100 %/126 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus

  15. EST Table: AV399898 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399898 NV120920 10/09/28 86 %/105 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  16. EST Table: AV399551 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399551 NV120385 10/09/28 99 %/123 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  17. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  18. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  19. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  20. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  1. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  2. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  3. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  4. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  5. EST Table: AV402755 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402755 heS30447 10/09/28 32 %/161 aa ref|XP_001988342.1| GH10620 [Drosophila grims...hawi] gb|EDW03209.1| GH10620 [Drosophila grimshawi] 10/08/28 32 %/161 aa FBpp0144526|DgriGH10620-PA 10/08/2

  6. EST Table: AV404071 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404071 pg--0407 11/12/09 n.h 10/09/28 100 %/244 aa ref|YP_002928933.1| Host speci...ficity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW295

  7. EST Table: AV404427 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404427 pg--0966 11/12/09 n.h 10/09/28 91 %/168 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  8. EST Table: AV404050 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404050 pg--0381 11/12/09 n.h 10/09/28 99 %/161 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  9. EST Table: AV400190 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400190 br--0867 10/09/28 67 %/134 aa ref|XP_974541.1| PREDICTED: similar to Media...%/108 aa gnl|Amel|GB13317-PA 10/09/10 67 %/134 aa gi|91083293|ref|XP_974541.1| PREDICTED: similar to Media

  10. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  11. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  12. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  13. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  14. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  15. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  16. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  17. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  18. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  19. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  20. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  1. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  2. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  3. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  4. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  5. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  6. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  7. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  8. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  9. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  10. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  11. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  12. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  13. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  14. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  15. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  16. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  17. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  18. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  19. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  20. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  1. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  2. Imaging characteristic of dual-phase {sup 18}F-florbetapir (AV-45/Amyvid) PET for the concomitant detection of perfusion deficits and beta-amyloid deposition in Alzheimer's disease and mild cognitive impairment

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Kun-Ju; Hsiao, Ing-Tsung; Hsieh, Chia-Ju; Wey, Shiaw-Pyng; Yen, Tzu-Chen [Linkou Chang Gung Memorial Hospital and University, Department of Nuclear Medicine and Molecular Imaging Center, Taoyuan (China); Chang Gung University, Department of Medical Imaging and Radiological Sciences and Healthy Aging Research Center, Taoyuan (China); Hsu, Jung-Lung [Linkou Chang Gung Memorial Hospital, Section of Dementia and Cognitive Impairment, Department of Neurology, Taoyuan (China); Taipei Medical University, Graduate Institute of Humanities in Medicine, Taipei (China); Huang, Chin-Chang; Huang, Kuo-Lun [Linkou Chang Gung Memorial Hospital and University, Department of Neurology, Taoyuan (China)

    2016-07-15

    We investigated dual-phase {sup 18}F-florbetapir (AV-45/Amyvid) PET imaging for the concomitant detection of brain perfusion deficits and beta-amyloid deposition in patients with Alzheimer's disease (AD) and amnestic mild cognitive impairment (MCI), and in cognitively healthy controls (HCs). A total of 82 subjects (24 AD patients, 44 MCI patients and 14 HCs) underwent both dual-phase {sup 18}F-AV-45 PET and MRI imaging. Dual-phase dynamic PET imaging consisted of (1) five 1-min scans obtained 1 - 6 min after tracer injection (perfusion {sup 18}F-AV-45 imaging, pAV-45), and (2) ten 1-min scans obtained 50 - 60 min after tracer injection (amyloid {sup 18}F-AV-45 imaging). Amyloid-negative MCI/AD patients were excluded. Volume of interest analysis and statistical parametric mapping of pAV-45 and {sup 18}F-AV-45 images were performed to investigate the perfusion deficits and the beta-amyloid burden in the three study groups. The associations between Mini-Mental State Examination (MMSE) scores and global perfusion deficits and amyloid deposition were investigated with linear and segmental linear correlation analyses. HCs generally had normal pAV-45 findings, whereas perfusion deficits were evident in the hippocampus, and temporal, parietal and middle frontal cortices in both MCI and AD patients. The motor-sensory cortex was relatively preserved. MMSE scores in the entire study cohort were significantly associated with the degree of perfusion impairment as assessed by pAV-45 imaging (r = 0.5156, P < 0.0001). {sup 18}F-AV-45 uptake was significantly higher in AD patients than in the two other study groups. However, the correlation between MMSE scores and {sup 18}F-AV-45 uptake in MCI patients was more of a binary phenomenon and began in MCI patients with MMSE score 23.14 when {sup 18}F-AV-45 uptake was higher and MMSE score lower than in patients with early MCI. Amyloid deposition started in the precuneus and the frontal and temporal regions in early MCI, ultimately

  3. Physical, Structural and Operational Vulnerability of Critical Facilities in Valle de Chalco Solidaridad, Estado de Mexico, Mexico. Case of study: Avándaro, San Isidro and El Triunfo

    Science.gov (United States)

    Garcia Payne, D. G.; Novelo-Casanova, D. A.; Ponce-Pacheco, A. B.; Espinosa-Campos, O.; Huerta-Parra, M.; Reyes-Pimentel, T.; Rodriguez, F.; Benitez-Olivares, I.

    2010-12-01

    Valle de Chalco Solidaridad is located in Mexico City Metropolitan Area in Estado de Mexico, Mexico. In this town there is a sewage canal called “La Compañía”. A wall of this canal collapsed on February 5, 2010 due to heavy rains creating the flooding of four surrounding communities. It is important to point out that this area is frequently exposed to floods. In this work, we consider a critical facility as an essential structure for performance, health care and welfare within a community or/and as a place that can be used as shelter in case of emergency or disaster. Global vulnerability (the sum of the three measured vulnerabilities) of the 25 critical facilities identified in the locations of Avándaro, San Isidro and El Triunfo was assessed using the Community Vulnerability Assessment Tool developed by the National Oceanic and Atmospheric Administration (NOAA). For each critical facility we determined its operational, structural and physical vulnerabilities. For our analysis, we considered the four main natural hazards to which Valle de Chalco is exposed: earthquakes, floods, landslides and sinking. We considered five levels of vulnerability using a scale from 1 to 5, where values range from very low to very high vulnerability, respectively. A critical facilities database was generated by collecting general information for three categories: schools, government and church. Each facility was evaluated considering its location in relation to identified high-risk areas. Our results indicate that in average, the global vulnerability of all facilities is low, however, there are particular cases in which this global vulnerability is high. The average operational vulnerability of the three communities is moderate. The global structural vulnerability (sum of the structural vulnerability for the four analyzed hazards) is moderate. In particular, the structural vulnerability to earthquakes is low, to landslides is very low, to flooding is moderate and to sinking is

  4. Optimizing reed canary grass cropping to increase profitability. Field studies of plant varieties, intercropping with legumes and barley, fertilization and soil compaction; Optimering av odlingsaatgaerder i roerflen foer oekad loensamhet. Faeltstudier av sorter, samodling med baljvaexter och korn, goedsling samt markpackning

    Energy Technology Data Exchange (ETDEWEB)

    Palmborg, Cecilia; Lindvall, Eva (Swedish Univ. of Agricultural Sciences, Umeaa (Sweden). Agricultural Research for Northern Sweden)

    2010-05-15

    Reed Canary Grass is a promising crop for biofuel production. For reed canary grass the first year is an establishment year when the small biomass is not harvested. The second year the biomass is usually cut in late autumn but the harvest (removal of the biomass from the field) is delayed until spring. This technique has resulted in lower costs and increases in fuel quality through lower ash contents, including lower contents of chlorine, sodium and potassium. However costs for production are still high, especially establishment costs, fertilization costs and harvesting costs. The aim of this project was to test ways to cut costs per MWh by increased yields, and decreased establishment costs. The methods used have been variety trials to develop more productive plant material, intercropping with nitrogen fixing legumes to reduce the nitrogen demand of the crop, fertilization with waste material (sewage sludge, reed canary grass ash or poultry manure) and harvest at frozen ground as a strategy to reduce soil compaction and harvest damages on the crop. Reed canary grass grown as a fuel has so far been grown as a mono culture. However, when it is been grown for forage, or as a biogas crop, intercropping with legumes has been successful in some studies. In addition to NPK-fertilizers sewage sludge, ash from combustion of reed canary grass and poultry manure was used. An economic calculation showed that the establishment costs (the first two growing seasons) can be lowered by intercropping with red clover. However it is also involves more risks, related to weeds, and cannot be recommended on fallow soil with a large seed bank of weeds. A ten year old reed canary grass ley was used for the experiment. Two 25 m wide strips were harvested with a mower on November 19 2008 when the top soil was frozen. The harvested material was chopped and removed from the field the following day. The following spring, May 19 2009, the remaining reed canary grass on the field was cut with a

  5. E-Læring som pedagogisk virkemiddel for innlæring av anatomi, fysiologi og biokjemi i sykepleierutdanningen

    Directory of Open Access Journals (Sweden)

    Mona Elisabeth Meyer

    2014-02-01

    Full Text Available Utgangspunktet for studien er at naturvitenskaplige fag, særlig anatomi, fysiologi og biokjemi (AFB, oppleves som vanskelig for sykepleierstudentene. Hensikten var å undersøke om læringsverktøyet e-læring, i form av nettester, kan være et effektivt virkemiddel til innlæring av og påvirke læringsutbyttet i AFB.Førsteårsstudentene i bachelorutdanningen i sykepleie ved Høgskolen i Akershus fikk et spørreskjema med 23 spørsmål som ble besvart anonymt.Resultatet av studentundersøkelsen viste at nettoppgavene ble mye brukt, og at studentene mente de ga et godt læringsutbytte. Nettoppgaver med umiddelbar feedback gir stor studentaktivitet og «time-on-task». Testene kan tette hullet mellom det studentene forventes å kunne og det de faktisk kan, og egner seg til faktafag som m å pugges og forstås. E-læring kan gi god hjelp til studenters strukturering av tid, læringsstrategier og selvregulering.Læringsutbyttet av nettester diskuteres i lys av nytten av umiddelbar feedback i et pedagogisk perspektiv.AbstractThe starting point of the study is that the natural sciences, particularly anatomy, physiology and biochemistry (collectively known as APB, are often difficult subjects for nursing students. The aim was to investigate whether e-learning tools, in terms of web services, can be an effective educational tool and affect learning outcomes in APB.First year students in the Bachelor's degree program in nursing at Akershus University College of Applied Sciences received a questionnaire with 23 questions, which were answered anonymously.The results of the student survey showed that online tasks were widely used, and that students felt they resulted in good learning outcomes. Online training with immediate feedback shows great student activity and “time-on-task.” These tests can close the gap between what the students are expected to know and what they actually do, and is suitable for factual subjects requiring both memorization and

  6. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  7. Rekonstruering av cyanobakterien Planktothrix sine forekomster i Hålandsvatnet fra 1980 fram til 2014 under påvirkning av den vertsspesifikke parasitten Chytridiomycota

    OpenAIRE

    Westerås, Anne Charlotte

    2016-01-01

    Cyanobakterier har eksistert i ~ 3,5 milliarder år, noe som gir dem en historisk evolusjonær fordel ved tilpasning til enten menneskeskapte eller naturlige endringer. Algene kan danne oppblomstringer som ofte er giftige, hvorpå toksiske forekomster er et resultat av oligopeptid-produksjon. Slike peptider kodes av en meget gammel del av cyanobakterienes genom, og individer innenfor samme algepopulasjon kan ha ulik oligopeptid sammensetning eller profiler. Derfor antas horisontal ge...

  8. Mellom fiksjon og fakta. : En studie av medias omtale av legemiddelindustrien.

    OpenAIRE

    Austdal, Linn

    2008-01-01

    OBJECTIVES: Find out which problems related to pharmaceutic industry the massmedia are debating, and see if there are differences between what is written in a public newspaper contra journals for health professionals. METHODS: Using the internet to search for articles from 2007-01-01 to 2008-06-30 in the newspaper Aftenposten and the two medical journals Dagens Medisin and Tidsskriftet. Classifying the subjects and problems debated and compare the three medias. RESULTS: A total of 1...

  9. Ledares uppfattningar av ledarskap. : En kvalitativ studie av motivation, beteende och reglering.

    OpenAIRE

    Dinesen, Sanne

    2015-01-01

    Background: Knatteskutt is one of the largest organizations in children's sports. Operations are located in approximately 150 cities / areas and have both sports and dance focus. The children are aged 3-7 years and may try several sports activities or dance styles during the semester, focusing on play and motor skills. All who are leaders at Knatteskutt has undergone Swedish Sports Promotion of Child Leaders Training. There are also regional managers around Sweden is as a sounding board for l...

  10. Fremre korsbåndskade og utvikling av sekundær artrose

    OpenAIRE

    Holm, Stine

    2013-01-01

    Oppgaven er en blanding av et litteraturstudie og en kohortestudie. I litteraturstudien har jeg sett på hva fremre korsbånd og artrose er, og hvilke risikofaktorer som kan bidra/progrediere utvikling av artrose hos korsbåndsopererte. I kohortestudien har jeg og veilederen sett på forekomsten av artrose hos korsbåndsopererte- 10-20 år etter ACL rekonstruksjon. Ved hjelp av røntgen og klinisk undersøkelse vurderte vi tidligere korsbåndsopererte og grad av artroseforandringer. Vi så også på hvor...

  11. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  12. Hur arbetar forskollarare med bild? En studie av fem forskollarare som leder barn i bildaktiviteter (How Do Preschool Teachers Work with Art Activities? A Study of Five Preschool Teachers Leading Children in Art Activities).

    Science.gov (United States)

    Skoog, Eva

    Art education has traditionally played an important role in the Swedish preschool. The subject includes a variety of activities, and different aims have been stressed from both aesthetic and pedagogical points of view. This study sought to describe and analyze how preschool teachers work with children in art activities. The investigation used a…

  13. A study of the influence of noise from offshore wind power plants on the marine bottom fauna; En studie om hur bottenlevande fauna paaverkas av ljud fraan vindkraftverk till havs

    Energy Technology Data Exchange (ETDEWEB)

    Wikstroem, Andreas; Granmo, Aake

    2009-09-15

    The aim of this study was to examine changes of behaviour and activity patterns in marine soft bottom fauna under the influence of low frequent noise. Controlled experiments were performed at Kristineberg Marine Research Station in Fiskebaeckskil. The experiments were performed utilizing generator and vibrator techniques producing frequencies of 61, 178 and 721 Hz with an average sound pressure around 99 dB re 1 muPa. The selection of frequencies was based upon the sound profile measured at Utgrunden offshore wind farm in Kalmarsund (Ingemansson Technology, 2003) with the aim of recreating natural conditions. In order to quantify the sound exposure, measurements on both sound pressure and water particle acceleration in the test tanks were performed. In total four different marine soft bottom species were studied: a common little white mussel (Abra nitida), brittle star (Amphiura filiformis), brown shrimp (Crangon crangon) and juvenile plaice (Pleuronectes platessa). For the white mussel its burrowing ability was studied. First the speeds of burrowing down into the sediment and thereafter, the burrowing activity in the surface layer of the sediment for the duration of 96 hours were registered. During the experiments with the brittle star Amphiura filiformis the number of arms active in gathering food were observed shortly after the sound had started and for a period of 72 hours. When the brown shrimp was exposed for sound the number of prey items consumed during one day and after 4 days were observed. The study on juvenile plaice was only a shorter pilot study where the fish were exposed for sound during 15 minutes. During this restricted time swimming activity and burrowing activity were observed and after the initial 15 minutes also the respiration frequency during measurement for one minute were documented. The study showed that the burrowing activity increased for the white mussel compared to the controls during exposure of frequencies around 178 Hz after 24

  14. Energy from waste - An integrated study of the waste management system and the energy system in Joenkoeping; Energi fraan avfall - en integrerad studie av avfallshanterings- och energisystemet i Joenkoeping

    Energy Technology Data Exchange (ETDEWEB)

    Olofsson, Mattias

    2001-07-01

    The aim of the study is to evaluate, from a systems perspective, the effects of increased energy recovery from waste by incineration with heat recovery and/or anaerobic digestion. The waste management system and the energy system (In the study the district heating system has been evaluated as the energy system) are included in the analysis. The study is focused on finding cost efficient solutions under different scenarios. These solutions are also evaluated regarding their effects on the emissions of greenhouse gases. Furthermore, the impacts of these solutions on the operators working in the systems are studied. The base year for the study is 2010. This year is chosen for two reasons: i) The bans on land filling of combustible waste and organic waste, respectively, are in force. ii) The reduction of emissions of greenhouse gases according to the Kyoto protocol should be fulfilled. The increased energy recovery from waste is studied by analysing six alternatives. The six alternatives result in changes both of the waste management system and the energy system compared to the present situation in Joenkoeping. The alternatives are analysed under four different scenarios. In all scenarios, waste incineration with heat recovery for district heating is the cost efficient alternative for the studied system (the waste management system and the energy system). The important conclusions from the study are: It is cost efficient to increase the recovery of materials for the operators in the studied system. However, a major condition for this conclusion is that the prices of recovered materials are not allowed to decrease when the recovery of materials is increasing. Due to the choice of system boundaries, it is not possible to judge whether increased recovery of materials is cost efficient for the society. After sorting waste for material recovery, it is cost efficient to incinerate the remaining part for heat production. After sorting waste for material recovery, it is not

  15. The glial cell modulators, ibudilast and its amino analog, AV1013, attenuate methamphetamine locomotor activity and its sensitization in mice

    Science.gov (United States)

    SNIDER, SARAH E.; VUNCK, SARAH A.; VAN DEN OORD, EDWIN J.C.G.; ADKINS, DANIEL E.; MCCLAY, JOSEPH L.; BEARDSLEY, PATRICK M.

    2014-01-01

    Over 800,000 Americans abuse the psychomotor stimulant, methamphetamine, yet its abuse is without an approved medication. Methamphetamine induces hypermotor activity, and sensitization to this effect is suggested to represent aspects of the addiction process. Methamphetamine’s regulation of 3'-5'-cyclic adenosine monophosphate (cAMP) levels may be partially responsible for its behavioral effects, and compounds that inhibit phosphodiesterase (PDE), the enzyme that degrades cAMP, can alter methamphetamine-induced behaviors. Methamphetamine also activates glial cells and causes a subsequent increase in pro-inflammatory cytokine levels. Modulation of glial cell activation is associated with changes in behavioral responses, and substances that oppose inflammatory activity can attenuate drug-induced behaviors. Ibudilast (aka AV411; 3-isobutyryl-2-isopropylpyrazolo-[1,5-a]pyridine), inhibits both PDE and glial pro-inflammatory activity. Ibudilast’s amino analogue, AV1013, modulates similar glial targets but negligibly inhibits PDE. The present study determined whether ibudilast and AV1013 would attenuate methamphetamine-induced locomotor activity and its sensitization in C57BL/6J mice. Mice were treated b.i.d. with ibudilast (1.8-13 mg/kg), AV1013 (10-56mg/kg) or their vehicles intraperitoneally for 7 days, beginning 48 h before 5 days of daily 1-h locomotor activity tests. Each test was initiated by either a methamphetamine (3 mg/kg) or a saline injection. Ibudilast significantly (Pmethamphetamine's locomotor activity without significantly affecting activity by itself. AV1013 had similar anti-methamphetamine effects, suggesting that glial cell activity, by itself, can modulate methamphetamine's effects and perhaps serve as a medication target for its abuse. PMID:22306241

  16. Fra fagarbeider til yrkesfaglærer: Førsteårsstudenters opplevelser av undervisning og veiledning i akademiske skriveferdigheter

    Directory of Open Access Journals (Sweden)

    Marit Lindset

    2017-04-01

    Full Text Available Introduksjon: Yrkesfaglærerstudentene begynner på en utdanning der gode skriveferdigheter er en forutsetning for å klare seg gjennom utdanningen. Som lærerutdannere opplever vi at mange studenter strever med å beherske de kravene som stilles til akademisk skriving i høyere utdanning. Dette var bakgrunnen for at to lærere ved 3-årig yrkesfaglærerutdanningen i Trondheim startet en studie hvor formålet var å utforske hvordan førsteårstudentene opplevde et innføringskurs i skriving av akademiske oppgaver og ulike former for tilbakemelding på oppgaver i studiet (skriftlige, muntlige og digitale.Teori: Studien støtter seg i hovedsak til Illeris sine perspektiver på læring.Metode: Dataene utgjør 24 refleksjonslogger av 12 førsteårsstudenter i perioden 2014 – 2015. Analysene baserer seg på Lindseth og Norbergs fenomenologiske- hermeneutiske fremgangsmåte.Resultat: Studien viser at studentene ser et innføringskurs i akademisk skriving som helt nødvendig og av stor betydning for utvikling av deres skriveferdigheter og for videreutvikling av oppgaver. Konkrete, skriftlige tilbakemeldinger direkte i teksten sammen med en oppsummerende tekst til slutt er en form for tilbakemelding studentene opplever som viktig og nyttig. Muntlige tilbakemeldinger virker oppklarende og motiverende. Sammen med muntlige tilbakemeldinger fremheves digitale tilbakemeldinger som svært viktig for å skape trygghet og motivasjon for å jobbe videre.Konklusjon: Førsteårsstudenter forteller om stor usikkerhet og sårbarhet i skrivearbeidet. De opplever et skrivekurs som vesentlig for å mestre kravene som stilles til akademisk skriving i høyere utdanning og ser kvaliteter ved både skriftlige, muntlige og digitale tilbakemeldinger i arbeidet med å ferdigstille oppgaver i studiet. Skriftlige tilbakemeldinger oppleves som helt nødvendige.

  17. Lærerstudenters kommentatorkompetanse om flerkultur og undervisning av flerspråklige elever drøftet i lys av kritisk multikulturalisme

    Directory of Open Access Journals (Sweden)

    Wenche Elisabeth Thomassen

    2016-01-01

    Full Text Available Grunnskolelærerutdanningen har som mål å utdanne studenter med både aktør- og kommentatorkompetanse. Kommentatorkompetanse innebærer evnen til kritisk refleksjon. Planer, forskrifter og retningslinjer for grunnskolelærer-utdanningene fastslår at studentene skal ha kunnskaper om flerkultur og undervisning av minoritetsspråklige elever. Slik kompetanse er fortsatt etterspurt, også blant nyutdannede lærere.I denne undersøkelsen er “kritisk multikulturalisme” brukt som teoretisk tilnærming for å analysere gruppeintervjuer med lærerstudenter. Drøftingen inkluderer også hvordan begreper fra denne teoretiske tilnærmingen fungerer for å forstå lærerstudentenes kommentatorkompetanse. Kritisk multikulturalisme er opptatt av å gi en analyse av undertrykking og institusjonalisering av ulike maktrelasjoner innen utdanning. Begreper som er særlig framtredende, er systemmakt, definisjonsmakt og avmakt. Empirien er en del av et større forskningsprosjekt ved UiS, som studerer praksis i grunnskolelærerutdanningen.Undersøkelsen viser at lærerstudentene viser oppmerksomhet og grad av kritisk kommentatorkompetanse når det gjelder systemnivå og pedagogiske praksiser, men ikke har nødvendigvis tilstrekkelig kunnskap om lover og regler for opplæringen. De savner mer oppmerksomhet på temaet innen lærerutdanningen, særlig konkret didaktikk. Funn i materialet indikerer at det ville være av betydning med en dypere forståelse og mer faglige begreper som grunnlag for refleksjon.Analysebegrepene fra kritisk multikulturalisme kan bidra til å sette studentenes utsagn inn i en større sammenheng og peke på potensielt diskriminerende diskurser, men fanger ikke alt studentene er opptatt av. Dette er et område som det ikke er mye forskning på i Norge, artikkelen er et bidrag til økt kunnskap om flerkultur i grunnskolelærerutdanningene.Nøkkelord: lærerstudenter, flerkultur, flerspråklige elever, kritisk multikulturalisme Abstract

  18. The Vaendoera test road, Sweden: A case study of long-term properties of roads constructed with MSWI bottom ash; Projekt Vaendoera: En studie av laangtidsegenskaper hos vaegar anlagda med bottenaska fraan avfallsfoerbraenning

    Energy Technology Data Exchange (ETDEWEB)

    Bendz, David; Arm, Maria; Westberg, Gunnar; Sjoestrand, Karin; Lyth, Martin; Wik, Ola [Swedish Geotechnical Inst., Linkoeping (Sweden); Flyhammar, Peter [Lund Inst. of Technology (Sweden). Dept. of Water Resources Engineering

    2006-03-15

    The accumulated effects of leaching and aging in a subbase layer of bottom ash were investigated in this study. The paved test road were constructed in 1987 in Linkoeping, Sweden, and has been used until the start of this study. The objective of this study was to investigate: (i) the accumulated effects of leaching and aging (ii) the accumulated effects of load and aging on the geotechnical properties (iii) the prerequisites for separate excavation of the bottom ash for possible reuse. The study started in September 2003 and included tests with falling weight deflectometer, triax testing on undisturbed core samples of bottom ash, sampling for chemical analysis. Three trenches were excavated in the test road, samples of the subbase layer and the subgrade were taken in the shaft walls and brought to the laboratory for leaching tests (EN 12457-2) and extraction, respectively. The extraction procedure was used to estimate extractable and chemically available fractions. It was found that the steady increase of stiffness which had been detected by falling weight deflectometer during the first years after construction had ceased. The undisturbed samples showed stiffness comparable with recently produced bottom ash from the same incineration plant, but lower stiffness if compared with the reference material of crushed rock. The permanent deformation was significantly larger for the samples compared with the crushed rock and recent (1999-2001) bottom ash from other incineration plants. The spatial distribution patterns of leachable easily soluble constituents reveal the existence of horizontal gradients, directed from the center of the road towards the shoulders of the road. This implies that horizontal transport by diffusion is the rate limiting leaching process for all easily soluble constituents underneath the pavement in a road. The bottom ash that was used in the sub-base layer was fresh at the time of the construction of the test road with a pH of about 11. Measured p

  19. From crucial issue to additional question. A study of the political debate about nuclear waste in Sweden 1976-2009; Fraan oedesfraaga till oevrig fraaga. En studie av den politiska debatten om kaernavfallet i Sverige 1976-2009

    Energy Technology Data Exchange (ETDEWEB)

    Nord, Lars; Stur, Elisabeth (Mid Sweden University (Sweden))

    2010-11-15

    The overall purpose of this paper is to investigate how the premises for the political decision processes in the issue of final disposal of the Swedish nuclear waste are affected by changes in the public opinion climate and global events. The paper therefore focuses on questions concerning how the national political debate leading up to decisions interacts with the media debate, and the public opinion dynamic that arises when the two debates relate to each other. Particular interest is devoted to the arguments and standpoints that occur in politics and media and how they refer to the prevailing public opinion situation and to conditions in the surrounding world of a political, legal, economic, ecological and technological nature. An analysis of the arenas and actors involved in the debates ought to provide valuable knowledge regarding how the political agenda has been formed at different points in time. The following questions are of central interest to the study: - What characterizes the parliamentary and the party political debate in the nuclear waste issue, and in what way have actors, standpoints and arguments changed over time? - What characterizes opinion formation and news reporting in the media in the nuclear waste issue and in what way have actors, standpoints and arguments changed over time? The course of the debate at four different times and in connection with four parliamentary elections during the period 1976-2009 is analyzed in the study. The subject of the analysis includes the four parliamentary parties the Centre Party, the Liberal Party, the Moderates and the Social Democrats. These four parties have been chosen because they have been represented in the Swedish Parliament during the entire period studied and are therefore reasonable to compare. The study has mainly been conducted as a qualitative textual analysis of public print, party documents and media content. The qualitative text analysis is complemented to some extent by other existing

  20. Intervensjonsstudien "Forebyggelse av lårhalsbrudd". Metode og praktisk gjennomføring

    Directory of Open Access Journals (Sweden)

    Elisabeth Kvaavik

    2009-11-01

    Full Text Available  Bakgrunn  3 kan forebygge brudd blant sykehjemsbeboere. Her beskrivesmetoden og den praktiske gjennomføringen av studien.Metode  mg vitamin D daglig som 5 ml tran og kontrollgruppa fikk 5 ml tran der vitamin D var fjernet. Endepunktenevar lårhalsbrudd og alle ikke-vertebrale brudd. Et enkelt studieopplegg ble vektlagt. På bakgrunnav styrkeberegningen var målsetningen å inkludere ca. 2000 deltakere.Resultater  Konklusjon  The intervention study”Prevention of hip fractures”. Nor J Epidemiol 2000; 10 (1: 79-85.  Background  3 can prevent suchfractures. Here we present the method and the implementation of the study.Method  mg vitamin D daily in 5 ml cod liver oil for 2 years and the control group received 5 ml cod liver oilwithout vitamin D. The endpoints were hip fractures and all non-vertebral fractures. It was consideredimportant to use a trial that the nursing homes would find easy to implement. According to power calculationthe aim was to include about 2000 participants.Results  Conclusion  : The participation was lower than expected as recruiting nursing homes and nursing homeresidents posed considerable difficulty. However, the great majority of the ward staff at the participatingwards did not find the intervention demanding. A total of 1144 was included in the study.: A total of 1144 residents from 51 nursing homes (of 106 invited in Oslo, Lier and Bergen participated.The participation rate at the individual nursing home varied from 3 to 57%. The participants were85 years old and 3/4 were women. Mean calcium intake from cheese and milk was 450 mg/day, more than40% used a vitamin D supplement while only 3% used a calcium supplement. 1/3 of the participants completedthe 2 years intervention, about 1/3 finished the intervention before 2 years because of death and 1/3finished before 2 years of other causes. The great majority of the wards did not find the interventiondemanding.: A randomised, double

  1. Particles from combustion of fuel with high content of ash - Experimental study of reed canary grass and straw; Partiklar fraan foerbraenning av askrika braenslen - Experimentell studie paa roerflen och halm

    Energy Technology Data Exchange (ETDEWEB)

    Baefver, Linda; Ryde, Daniel

    2010-07-01

    Domestic combustion of solid fuels is, besides traffic and industry, a major source to particles in the air. Increased biomass combustion means a risk of contributing to high concentrations of particles with respect to the environmental goals. Particles are a health risk. The number of ultrafines and the content of the particles are considered crucial for the effects. Gradually, new solid biofuels with high ash content and different ash composition are used. This means an enhanced risk of high particle emission and a change in the formation of particles. The aim of the project is to contribute to the description of the mechanisms for formation of particles at combustion of biomass with high content of ash. The possibility to decrease the particle emission by the use of additives will be especially investigated. Thereby, problems with particle emissions, as well as formation of deposits may be minimized. The project contains two parts. The first one is about combustion of oat grain, and has already been reported. In this report the second part of the project is presented. Reed canary grass and straw were studied. To decrease the particle emission from combustion of straw, tests with straw and the additive kaolin (clay mineral) were also carried out. The fuels were pelletized and contained 4-5 % ash (dry fuel). Reed canary grass (perennial grass) was chosen because it is has potential and it has also been much studied in Sweden. Straw was chosen because it has high accessibility, and is already fired to a certain degree. Straw contained 2.6 times more chlorine than reed canary grass. Reed canary grass had Si as dominating ash element (79 %), and thereafter it contained K (6 %), Ca (6 %) and P (3 %). A good half of the straw ash contained Si and thereafter K (23 %) and Ca (15 %) were most abundant. The fuels were continuously fired in a multi-stoker from Sonnys Maskiner, connected to a boiler from Centrometal. The particles mass concentration was measured by sampling

  2. Sextortyr eller frigörelse : Konstruktioner av sadomasochism i svenska dagstidningar 2007-2011

    OpenAIRE

    Ovesson, Charlotte

    2011-01-01

    Denna studie kom till efter att RFSU hade börjat arbeta med frågor om sadomasochism, och efter att Socialstyrelsen tog bort sadomasochism ur sin diagnosmanual. Syftet med studien är att ta reda på vilka diskurser som används när media talar om sadomasochism. Queerteori är det teoretiska fundamentet i studien. Jag utgår även från Michel Foucaults teorier. Min metod är foucauldiansk genealogisk diskursanalys. Analysmaterialet består av 33 tryckta artiklar från svenska dags- och kvällstidningar....

  3. Intern benchmarking i detaljhandeln : En analys av upplevelser och kritiska framgångsfaktorer

    OpenAIRE

    Petersen, Elina; Wahlström, Mikaela

    2015-01-01

    Bakgrund Benchmarking är ett populärt styrverktyg men studierhar visat att benchmarking inte anses som ett likaeffektivt förbättringsverktyg som andra styrverktyg,vilka kritiska faktorer som ligger bakom enframgånsrik benchmarking bör då undersökas. Efter en genomgång av tidigare studier fann vi dessutom attbrister finns gällande vetskapen hur användandet avintern benchmarking upplevs. Få studier har gjortsinom detaljhandeln där intern benchmarking tycksvara användbart. Syfte Syftet med studi...

  4. Kulturell inverkan pa uppfattning av auktoritet : en jamforelse mellan studenter pa Karlstads och Alicantes universitet

    OpenAIRE

    Linderholm, Anna

    2008-01-01

    Denna studie ämnar undersöka vilka egenskaper chefer besitter som bäst kommer motiverar nästa generations anställda att följa chefers order och beslut och hur detta påverkas av kulturella faktorer. För att uppnå detta syfte har en enkätundersökning utförts bland studenter på ett universitet i Sverige och ett i Spanien, mer specifikt Karlstads och Alicantes universitet. Enkätundersökningen visar hur studenter rangordnar fem faktorer som enligt French och Raven (1959) definierar makt. Responden...

  5. Energieffektivering av skolfartyget M/S Michael Sars

    OpenAIRE

    Ekebom Oscar, Lindholm Andreas

    2017-01-01

    Syftet med detta examensarbete är att undersöka och utvärdera hur värmeförbrukningen ombord på skolfartyget M/S Michael Sars kan effektiveras. Vi genomförde detta på tre olika sätt. Det första var att undersöka hur en isolering av maskinrummet och dess trapphus kan sänka uppvärmningsbehovet. Vi beräknade värmegenomgången genom skrovet samt hur mycket isoleringsmaterial som behövs. Det andra alternativet för energieffektivering är att undersöka hur ett eventuellt byte av fartygets oljeeldade p...

  6. "Det begynder næsten at bli beboeligt ogsaa i digternes verden" - samtidens resepsjon av Henrik Ibsens Lille Eyolf

    OpenAIRE

    Andersen, Torbjørn

    2010-01-01

    Avhandlingen er en undersøkelse av den skandinaviske samtidsresepsjonen av Henrik Ibsens drama Lille Eyolf (1894), begrenset til bokomtaler (ikke oppsetningskritikk). Artikler av Hans Robert Jauss, Jan Mucařovský og Felix Vodička danner det teoretiske utgangspunktet for arbeidet. I tillegg er Per Thomas Andersens klassifisering av fire hovedtyper kriterier for litteraturkritikk benyttet. Undersøkelsen bygger på et stort utvalg av tradisjonelle avisanmeldelser og tidsskriftartikler fra 1...

  7. EST Table: AV399321 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx manda...rina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  8. EST Table: AV399146 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399146 NV060720 10/09/28 91 %/173 aa ref|YP_002884350.1| GP64/67 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57301.1| GP64/67 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP121286 NV06 ...

  9. EST Table: AV399657 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  10. EST Table: AV399890 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399890 NV120911 10/09/28 83 %/222 aa ref|YP_002884341.1| PIF-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57292.1| PIF-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP120262 NV12 ...

  11. EST Table: AV399458 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884259.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63702.1| LEF-6 [Bombyx mori NPV] gb|ACQ...57210.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399457 NV12 ...

  12. EST Table: AV398266 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV02 ...

  13. EST Table: AV399527 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884325.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63769.1| LEF-5 [Bombyx mori NPV] gb|ACQ...57276.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399374 NV12 ...

  14. EST Table: AV403832 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403832 pg--0107 10/09/28 99 %/175 aa ref|NP_001103774.1| receptor expression enhancing... protein isoform 1 [Bombyx mori] gb|ABD36360.1| receptor expression enhancing protein isoform 1 [Bombyx.../10 56 %/174 aa gi|189239379|ref|XP_971918.2| PREDICTED: similar to receptor expression enhancing protein [Tribolium castaneum] NM_001110304 pg-- ...

  15. EST Table: AV399230 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399230 NV060841 10/09/28 97 %/150 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  16. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  17. EST Table: AV399150 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399150 NV060726 10/09/28 98 %/124 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  18. EST Table: AV399180 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399180 NV060769 10/09/28 57 %/213 aa ref|XP_391845.2| PREDICTED: similar to tout-...:AGAP010388 10/09/10 57 %/213 aa gnl|Amel|GB17343-PA 10/09/10 55 %/209 aa gi|91076108|ref|XP_968944.1| PREDICTED: similar to tout-velu CG10117-PA [Tribolium castaneum] FS931854 NV06 ...

  19. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  20. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  1. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  2. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  3. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  4. Var manglende forståelse av tobakksepidemiens dynamikk en årsak til forsinket tobakksprevensjon?

    Directory of Open Access Journals (Sweden)

    Karl Erik Lund

    2009-10-01

    Full Text Available  SAMMENDRAGMens tobakksmotstanden i Norge i første halvdel av det 20. århundre mest var tuftet på moral med utgangspunkti et religiøst paradigme, kom det i løpet av perioden 1955-61 undersøkelser som ga det tobakksforebyggendearbeidet et sekulært vitenskapsbasert fundament. Den medisinske profesjon var imidlertid noe forbeholden til attobakk kunne representere en alvorlig trusel mot folkehelsen. Den avmålte og reserverte holdningen som førstble inntatt av legestanden må bli forstått i lys av manglende kvalitet på de tidligste epidemiologiske undersøkelsene,at legestanden på 1950-tallet selv hadde en meget høy andel røykere, og at mange leger - som høytutdannende og derfor ofte fordomsfrie mennesker - ønsket å distansere seg fra de religiøse avholdsmoralistenesom lenge hadde ledet det tobakksforebyggende arbeidet på et ikke-medisinsk grunnlag. Også fraværet av endypere innsikt i tobakksepidemiens egentlige natur (konfigurasjon kunne være en årsak. Det spesielle tidsforholdetmellom eksposisjon og sykdomsutbrudd i epidemiens dynamikk - ofte kalt "delay-problemet" - var egnettil å forvirre legene og helsemyndighetene. For å forstå årsakene til datidens forvirring vil det bli presentert enfigur som viser ulike tidsvinduer i tobakksepidemiens forløp slik de blir skissert av Verdens helseorganisasjon.Lund KE. Was a lack of understanding of the dynamics of the tobacco epidemic a reason for delayedtobacco prevention? Nor J Epidemiol 1995; 5 (2: 107-113.  ENGLISH SUMMARYIn the first half of the 20th century, the work against tobacco in Norway was based mainly on ethics and areligious paradigm. During the years 1955-61 several major epidemiological studies were publishedwhich provided a secular and scientific basis for tobacco prevention. However, the medical professionseemed to be sceptical about the claims that tobacco represented an important hazard to public health.The formal and reserved attitudes of the doctors

  5. I betraktarens ögon – Betydelsen av kön och ålder för studenters läraromdömen

    Directory of Open Access Journals (Sweden)

    Martin Karlsson

    2011-12-01

    Full Text Available Under senare år har studenters läraromdömen allt mer hamnat i fokus inom skola såväl som högre utbildning. Parallellt med dessa utvecklingar har olika typer av internettjänster genom vilka studenter kan betygsätta sina lärare dykt upp i flera länder. I Sverige lanserades 2008 tjänsten ”Studenter tycker till” (STT där studenter kan registrera sig och fylla i bedömningar av lärare enligt kriterierna utlärningsförmåga, kunskap, engagemang och lärandestöd. I denna studie undersöks betydelsen av lärarens kön och ålder för studenters läraromdömen genom en kvantitativ analys av omdömen av 98 högskole- och universitetslärare som givits på hemsidan STT. Syftet är att synliggöra hur sociala markörer, i detta fall om läraren är man eller kvinna, ung eller gammal, spelar en stor roll för hur en lärare utvärderas. Resultaten visar att kvinnor och unga lärare systematiskt ges lägre betyg av studenter, än män och äldre lärare. Studenter är således inte könsblinda eller oberoende av föreställningar om förhållandet mellan ålder och kompetens i sina bedömningar. Studien aktualiserar betydelsen av sociala markörer så som kön och ålder måste synliggöras och tas i beaktning när studenters utvärderingar av lärare och kurser behandlas inom högre utbildning.

  6. Inkludering av ungdom med minoritetsbakgrunn i NIF-organisert idrett

    Directory of Open Access Journals (Sweden)

    Mari Kristin Sisjord

    2014-10-01

    Full Text Available Norges Idrettsforbund og Olympiske og Paralympiske Komité (NIF har en uttalt målsetting om en åpen og inkluderende idrett. Hvordan kommer dette til uttrykk i den praktiske virksomheten? Denne artikkelen, som bygger på data fra en undersøkelse om likestilling og mangfold i den organiserte idretten (NIF, retter søkelyset mot arbeid med inklusjon av ungdom med minoritetsbakgrunn på ulike organisasjonsnivå i NIF: særforbund, idrettskretser og idrettslag. Datamaterialet er kvalitative intervju med representanter fra ulike organisasjonsnivå. Resultatene viser at NIFs overordnede politikk i varierende grad nedfelles i særforbundenes virksomhet, i idrettskretsene og i idrettslagene. Av særforbundene skiller Fotballforbundet og Klatreforbundet seg ut som aktive pådrivere i arbeidet med inkludering. Mange idrettslag oppfattet slike spørsmål som lite aktuelle i sitt rekrutteringsområde. Representanter for lag som hadde erfaring med inkludering og rekruttering av minoritetsungdom, tilkjennega varierte erfaringer og synspunkter.

  7. O tornar-se avó no processo de individuação

    Directory of Open Access Journals (Sweden)

    Caroline Dal Ri Kipper

    Full Text Available O tornar-se avó assinala um período de transição no ciclo de vida familiar, marcado por transformações psíquicas significativas para os avós, caracterizando a quarta individuação. Este trabalho teve como objetivo investigar a experiência de tornar-se avó e sua importância no processo de individuação. Foi utilizado delineamento de estudo de caso coletivo. Onze avós maternas, com idades entre 49 e 66 anos, cujas filhas tiveram seu primeiro filho, responderam a uma entrevista semi-estruturada. Todas as avós tinham tido seus primeiros netos e a entrevista referia-se a sua experiência como avós desses netos. Os dados mostraram que o ser avó é uma fonte de renovação e renascimento. O estudo propiciou que as participantes refletissem sobre seus diferentes papéis familiares: avó, mãe, neta e filha. Os dados sugerem que tornar-se avó possibilita que antigos conflitos sejam repensados, renovando antigos vínculos e desejos, o que permite que a avó dê mais um passo rumo à sua individuação.

  8. T-760/15: Nederländerna mot Kommissionen : Analys av kommissionens prövning av selektivitet

    OpenAIRE

    Elofsson, Niklas

    2016-01-01

    I takt med att den ökade globaliseringen av den internationella handeln har möjligheterna för multinationella företag att påverka sin beskattning ökat. Företags olika upplägg för att minska sina skattekostnad har bekämpats allt eftersom de har växt fram. Under 2010-talet uppdagades att multinationella företag har fått minskade skatte-kostnader genom tillämpning av APA:or med medlemsstater. Kommissionen har påbörjat ett nitiskt arbete för att stoppa och återvinna dessa skattelättnader. Kommiss...

  9. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  10. Diffusjon av influensa i Norge under spanskesyken 1918-19

    Directory of Open Access Journals (Sweden)

    Svenn-Erik Mamelund

    2009-10-01

    Full Text Available  SAMMENDRAGSpanskesyken var en verdensomspennende influensaepidemi som tok livet av minst 30 millioner mennesker,de fleste i løpet av noen få høstmåneder i 1918, men den strakk seg også inn i 1919. En siste svakbølge fant sted vinteren 1920. De første sporadiske tilfellene av spanskesyken i Norge oppsto i militærleirei begynnelsen av april 1918. Over tre måneder senere kom de første spredte tilfellene av det som skullevise seg å være starten på en ny stor influensapandemi. De første av disse oppsto i Kristiania, mest sannsynligetter smitteimport fra Skottland over Nordsjøen. Sommeren 1918 spredte spanskesyken seg raskt frasør til nord, fra kysten til innlandet innover fjordene, og fra de største byene og industrisentra via mindrebyer og andre tettsteder til landsbygda langs de viktigste ferdselsveiene. Da spanskesyken blusset opp igjenhøsten 1918 spredte den seg langsommere og trolig fra nord til sør, fortsatt fra kysten innover fjordene,men spredning fra byene langs kommunikasjonsveiene var mindre fremtredende. Vinteren 1918/19opptrådte influensaen spredt og sporadisk, tilsynelatende uten bestemt spredningsmønster og rekkefølge.Jernbanen, hurtigruten og automobilrutene spilte trolig en viktig rolle i spredningsprosessen, spesielt andrehalvår 1918. Ulik sosial interaksjon, for eksempel et marked som samlet store folkemengder, kan bidra til åforklare eksplosive utbrudd av influensa og diffusjon på lavt geografisk nivå.Mamelund S-E. The diffusion of influenza in Norway during the 1918-19 Pandemic.Nor J Epidemiol ENGLISH SUMMARYIn 1918-1919, a world-wide pandemic, the Spanish Influenza, swept over the entire globe, killing at least30 million people, most of them during the fall of 1918. A last, but small and less defined wave occurred inthe winter of 1920. The first sporadic cases of Spanish Influenza in Norway are known from army campsin the early days of April 1918. More than three months later, the first scattered

  11. Overvåking av norsk kosthold - metoder og resultater

    Directory of Open Access Journals (Sweden)

    Lars Johansson

    2009-11-01

    Full Text Available  SAMMENDRAGKunnskap om endringer i matvarenes sammensetning og befolkningens kosthold er grunnleggende for utformingog oppfølging av en helsefremmende mat- og ernæringspolitikk. Dagens system for overvåking avkostholdet bygger først og fremst på en matvaredatabase og opplysninger om forbruket av matvarer fra tretyper datasett; matforsyningsstatistikk, forbruksundersøkelser og kostholdsundersøkelser. Det avgis årlig envurdering av utviklingen i norsk kosthold i forhold til mat- og ernæringspolitiske målsettinger. Det norskesystemet for overvåking av kostholdet er blitt betydelig styrket i løpet av 1990-årene ved innføringen avregelmessige kostholdsundersøkelser blant landsrepresentative utvalg av befolkningen i ulike aldersgrupperog økte ressurser til analyse av næringsinnholdet i matvarer. Det er imidlertid beskjedent sammenlignet meddatainnsamlingen i land som USA og Storbritannia. Det norske overvåkingssystemet er forsatt i enutviklingsfase, og det må justeres og kompletteres etter hvert. Dessuten vil det arbeides med å kvalitetssikredatainnsamlingen.Johansson L. Surveillance of the diet in Norway – methods and results.Nor J Epidemiol ENGLISH SUMMARYKnowledge about changes in composition and intake of foods, as well as changes in the prevalence of dietrelatedhealth problems is fundamental for an effective food and nutrition policy. The National Council onNutrition and Physical Activity is responsible for evaluating changes in the diet. Annually the Council publishesreports about trends in the Norwegian diet, and suggests measures to improve the diet. The Council, incooperation with the National Food Authority and the Institute for Nutrition Research, University of Oslo,has established a national food and dietary surveillance system. This system is mainly based on a fooddatabase and food consumption data. The food consumption data include three principally different datasets: food supplies, household consumption surveys

  12. Mineralogic mapping of the Av-9 Numisia quadrangle of Vesta

    Science.gov (United States)

    Frigeri, A.; De Sanctis, M. C.; Ammannito, E.; Buczkowski, D.; Combe, J. P.; Tosi, F.; Zambon, F.; Rocchini, D.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2015-10-01

    In this manuscript we present the mineralogic mapping of the Av-9 Numisia quadrangle of Vesta using the most up-to-date data from the NASA-Dawn mission. This quadrangle is located in Vesta's equatorial zone (22° south to 22° north, 218° to 288° east, in Claudia coordinate system) and takes its name from the impact crater Numisia. The main feature, which dominates the quadrangle, is the Vestalia Terra plateau, a topographic high about 10 km above the surrounding areas. To the south, this region fades into the Rheasilvia basin, while to the north it is bounded by the steep scarp of Postumia basin. The Visible and Infrared mapping spectrometer (VIR) onboard NASA/Dawn provided the main data source for this work, at an unprecedented level of spatial and spectral resolution. In particular we are using spectral parameters to synthesize characteristics of the whole spectra into a single value. Pyroxene-related spectral parameters allow for the detection of lower crust or mantle material (diogenites) and upper crust material (eucrites) in the study area. The combined analysis of albedo from the Framing Camera, the geologic map and the spectroscopic data offer an interesting opportunity to understand better the surface features of this region of Vesta, and their evolution. Numisia, Cornelia, Fabia, Teia and Drusilla are the main craters in the study area, rich in bright and dark material outcrops, pitted terrains and OH-rich materials. Using the spectral parameters we demonstrate that the internal composition of Vestalia Terra is mainly diogenite-rich howardite, as shown by materials excavated by Cornelia and Fabia, and the composition of the slope north of Vestalia Terra. This agrees with the strong positive Bouguer Anomaly observed in the area, indicating a higher density of these features in relation to the surrounding areas. Besides the recently published works based on gravimetric modeling and geologic interpretation, the mineralogic mapping presented herein gives

  13. Föreställningar kring talspråk i förorten : En attitydundersökning av och bland flerspråkiga ungdomar

    OpenAIRE

    Molife, Linn

    2015-01-01

    Detta arbete undersöker hur ungdomar i en Stockholmsförort uppfattar tio olika talprov från fem olika talare (matched guise). Jag har låtit genomföra en enkätundersökning följt av en gruppdiskussion för att få reda hur ungdomarna uppfattar de olika talproven. Studien är inspirerad av Bijvoet och Frauruds SALAM-studie. Slutsatsen är att såväl talare som respondenter i den aktuella studien har en hög grad av sociolingvistisk medvetenhet. Resultatet i gruppdiskussionen visade att tjejer gärna få...

  14. AV block and changes in pacing mode during long-term follow-up of 399 consecutive patients with sick sinus syndrome treated with an AAI/AAIR pacemaker.

    Science.gov (United States)

    Kristensen, L; Nielsen, J C; Pedersen, A K; Mortensen, P T; Andersen, H R

    2001-03-01

    This retrospective study included a large cohort of consecutive patients primarily implanted at Skejby University Hospital with an AAI/AAIR pacemaker because of sick sinus syndrome (SSS) from July 1981 to July 1999. The primary aim of the study was to analyze the risk of developing AV block during long-term follow-up. A secondary aim was to study the incidence and reasons for changes in pacing mode caused by other than AV block. A total of 399 patients (231 women, mean age 71 +/- 13.5 years) were identified. Mean follow-up was 4.6 +/- 3.4 years and occurred at death, reoperation with mode change, pacemaker explant, or end of study. During follow-up, 44 patients had a ventricular lead implanted with a mean delay of 2.8 +/- 3.1 years (range 1 day-10.4 years) after the primary implantation. A total of 30 patients received a ventricular lead because of AV block or AF with bradycardia (annual incidence 1.7%). Another 14 patients received a ventricular lead without having documented AV block or AF with pauses (annual incidence 0.8%). The present observational study documents that in patients with SSS treated with AAI/AAIR pacing, AV block requiring implantation of a ventricular lead occurs at a rate of 1.7% per year. It is considered that AAI/AAIR pacing is safe and reliable as treatment for patients with SSS and normal AV conduction.

  15. Rendyrking av funksjoner i NAV – renere eller mer kaotisk sosialt arbeid?

    OpenAIRE

    Myhre, Tone

    2017-01-01

    Det overordnede temaet for denne oppgaven er sosialt arbeid i NAV. Sosialtjenesten i NAV utgjør en av de største arbeidsplassene for sosialarbeidere i Norge. For å utøve sosialt arbeid i NAV, er det viktig med gode rammebetingelser. I denne oppgaven ønsker jeg derfor å se på hvordan organiseringen av NAV kan påvirke sosialarbeideres utøvelse av det sosiale arbeidet.

  16. The Learning A-V Awards 1982.

    Science.gov (United States)

    Abraham, Lisanne

    1982-01-01

    Teachers, audiovisual librarians, and curriculum specialists evaluated educational films and filmstrips for "Learning" magazine and selected 39 outstanding examples. Their choices are categorized under: (1) language arts/reading; (2) social studies; (3) science; (4) music; (5) values and guidance; (6) health and safety; and (7) computer science.…

  17. Tangofilmer - en genreanalyse : nærstudie av tangofilmgenren som fenomen innen den argentinske filmindustrien

    OpenAIRE

    Hjorteset, Rita

    2007-01-01

    Den argentinske tangoen gjør seg i dag gjeldende både i argentinsk og internasjonal film, noe som har vært utgangspunktet for ideen til denne oppgaven. ”Los muchachos de antes no usaban gomina” (Karene den gang brukte ikke bryl) (1937) regissert av Manuel Romero og ”Tango” (1997) regissert av Carlos Saura representerer to forskjellige eksempler fra tangofilmgenren. I denne oppgaven gjennomgås et korpus av filmer sammensatt av tre kilder i forhold til Rick Altmans 10 påstander om genre i b...

  18. Artificial vision support system (AVS(2)) for improved prosthetic vision.

    Science.gov (United States)

    Fink, Wolfgang; Tarbell, Mark A

    2014-11-01

    State-of-the-art and upcoming camera-driven, implanted artificial vision systems provide only tens to hundreds of electrodes, affording only limited visual perception for blind subjects. Therefore, real time image processing is crucial to enhance and optimize this limited perception. Since tens or hundreds of pixels/electrodes allow only for a very crude approximation of the typically megapixel optical resolution of the external camera image feed, the preservation and enhancement of contrast differences and transitions, such as edges, are especially important compared to picture details such as object texture. An Artificial Vision Support System (AVS(2)) is devised that displays the captured video stream in a pixelation conforming to the dimension of the epi-retinal implant electrode array. AVS(2), using efficient image processing modules, modifies the captured video stream in real time, enhancing 'present but hidden' objects to overcome inadequacies or extremes in the camera imagery. As a result, visual prosthesis carriers may now be able to discern such objects in their 'field-of-view', thus enabling mobility in environments that would otherwise be too hazardous to navigate. The image processing modules can be engaged repeatedly in a user-defined order, which is a unique capability. AVS(2) is directly applicable to any artificial vision system that is based on an imaging modality (video, infrared, sound, ultrasound, microwave, radar, etc.) as the first step in the stimulation/processing cascade, such as: retinal implants (i.e. epi-retinal, sub-retinal, suprachoroidal), optic nerve implants, cortical implants, electric tongue stimulators, or tactile stimulators.

  19. Rettferdige minutter: Fordeling av spilletid i fotballkamper for aldersbestemte klasser

    Directory of Open Access Journals (Sweden)

    Trine Anker

    2010-01-01

    Full Text Available På et fotballag i overgangen mellom barne- og ungdomsfotballen er spilletid på fotballbanen under kamp både en knapp ressurs og en kilde til diskusjoner om fordeling. Spørsmålet som er utgangspunkt for denne artikkelen, er hvilke hensyn som bør tas når trener og lagleder skal fordele samlet spilletid på enkeltspillere. Er det viktigst å vinne fotballkampen, eller har det størst betydning å fordele spilletiden mest mulig likt mellom spillerne? Skal det tas hensyn til guttenes evner, motivasjon og preferanser? Er deres familiebakgrunn og personlighet av betydning? Diskusjonen baserer seg på en gjennomgang av ulike politiske rettferdighetsteorier for fordeling av knappe goder.Nøkkelord: rettferdighet, practice, fordelingsrettferdighet, diskursetikk, idrettsetikkEnglish summary: Minutes of justice: Distribution of time during football matches in a boys' teamDuring a football match, time for playing can be considered as a limited good. In this article the point of departure is the redistribution of time in a boys' football team in the transition phase between children and youth football. The questions are how and under which conditions time for playing should be distributed among the players. Is winning the game more important than trying to let every player play for an equal amount of time? Should the boys' talents, motivation, and preferences be considered while distributing time, or are family background and personality of importance? Different theories of political justice for the distribution of limited goods underpin the discussion of how to distribute the minutes of playing time during a football match.http://dx.doi.org/10.5324/eip.v4i1.1737

  20. Helsekonsekvenser av vektendring - er slanking fordelaktig? En litteraturoversikt

    Directory of Open Access Journals (Sweden)

    Anne Johanne Søgaard

    2009-11-01

    Full Text Available  SAMMENDRAGLangsom vektøkning gjennom livet inntil kroppsmasseindeks (KMI 27 ser ikke ut til å gi særlige negative utfallmht. total dødelighet. En økning på ! 20 kg fra 18 års alder er trolig negativt – det samme er vektøkning ut fra enhøy utgangsvekt. Selv om mange studier finner økt dødelighet hos yngre og middelaldrende personer med KMI > 27,er det foreløpig ingen studier som har vist at vektreduksjon blant friske overvektige personer gir økt levetid. Flerestudier viser tvert imot en assosiasjon mellom vektreduksjon og økt dødelighet. Heller ikke studier som prøver åbegrense analysene til personer med frivillig vekttap, finner redusert dødelighet etter vektreduksjon blant friskeovervektige individer. Noen få studier har vist redusert dødelighet blant overvektige personer med etablertesykdommer eller høy risiko for hjerte-karsykdom og diabetes. Når det gjelder sykelighet har de fleste studier entenikke funnet noen assosiasjon mellom vektreduksjon og sykelighet, eller funnet økt sykelighet. Unntaket er diabetes,der vekttap i enkelte studier samvarierer med redusert sykelighet. Det er i mange studier funnet sammenheng mellomvekttap og økt risiko for lårhalsbrudd og gallesten. De fleste studier har imidlertid vist at moderat vektreduksjon(vekttap på opp til 10% fører til redusert blodtrykk, forbedret glukosekontroll, redusert kolesterolnivå, forbedretdyslipidemi, forbedret lungefunksjon, bedre søvnkvalitet og redusert søvnapnè. Moderat vekttap vil også kunnelindre leddsmerter. Dette tilsynelatende paradoks diskuteres i artikkelen – bl.a. drøftes de metodeproblemer som erinnebygget i mange av studiene. Fordi det har vist seg vanskelig for personer med kraftig overvekt å redusere vektenpermanent – og fordi resultatene mht. helseeffektene av vektreduksjon er usikre, bør hovedinnsatsen settes inn iforhold til å forebygge overvekt/fedme overfor enkeltpersoner med potensielle problemer. Personer med

  1. Lessons learned about [F-18]-AV-1451 off-target binding from an autopsy-confirmed Parkinson's case.

    Science.gov (United States)

    Marquié, Marta; Verwer, Eline E; Meltzer, Avery C; Kim, Sally Ji Who; Agüero, Cinthya; Gonzalez, Jose; Makaretz, Sara J; Siao Tick Chong, Michael; Ramanan, Prianca; Amaral, Ana C; Normandin, Marc D; Vanderburg, Charles R; Gomperts, Stephen N; Johnson, Keith A; Frosch, Matthew P; Gómez-Isla, Teresa

    2017-10-19

    [F-18]-AV-1451 is a novel positron emission tomography (PET) tracer with high affinity to neurofibrillary tau pathology in Alzheimer's disease (AD). PET studies have shown increased tracer retention in patients clinically diagnosed with dementia of AD type and mild cognitive impairment in regions that are known to contain tau lesions. In vivo uptake has also consistently been observed in midbrain, basal ganglia and choroid plexus in elderly individuals regardless of their clinical diagnosis, including clinically normal whose brains are not expected to harbor tau pathology in those areas. We and others have shown that [F-18]-AV-1451 exhibits off-target binding to neuromelanin, melanin and blood products on postmortem material; and this is important for the correct interpretation of PET images. In the present study, we further investigated [F-18]-AV-1451 off-target binding in the first autopsy-confirmed Parkinson's disease (PD) subject who underwent antemortem PET imaging. The PET scan showed elevated [F-18]-AV-1451 retention predominantly in inferior temporal cortex, basal ganglia, midbrain and choroid plexus. Neuropathologic examination confirmed the PD diagnosis. Phosphor screen and high resolution autoradiography failed to show detectable [F-18]-AV-1451 binding in multiple brain regions examined with the exception of neuromelanin-containing neurons in the substantia nigra, leptomeningeal melanocytes adjacent to ventricles and midbrain, and microhemorrhages in the occipital cortex (all reflecting off-target binding), in addition to incidental age-related neurofibrillary tangles in the entorhinal cortex. Additional legacy postmortem brain samples containing basal ganglia, choroid plexus, and parenchymal hemorrhages from 20 subjects with various neuropathologic diagnoses were also included in the autoradiography experiments to better understand what [F-18]-AV-1451 in vivo positivity in those regions means. No detectable [F-18]-AV-1451 autoradiographic binding was

  2. Factors associated with postprandial lipemia and apolipoprotein A-V levels in individuals with familial combined hyperlipidemia.

    Science.gov (United States)

    Almeda-Valdes, Paloma; Cuevas-Ramos, Daniel; Mehta, Roopa; Muñoz-Hernandez, Liliana; Cruz-Bautista, Ivette; Perez-Mendez, Oscar; Tusie-Luna, Maria Teresa; Gomez-Perez, Francisco J; Pajukanta, Päivi; Matikainen, Niina; Taskinen, Marja-Riitta; Aguilar-Salinas, Carlos A

    2014-11-25

    Alterations in postprandial metabolism have been described in familial combined hyperlipidemia (FCH); however, their underlying mechanisms are not well characterized. We aimed to identify factors related to the magnitude of postprandial lipemia and apolipoprotein (apo) A-V levels in subjects with FCH. FCH cases (n = 99) were studied using a standardized meal test. Abdominal obesity was assessed using the waist to hip ratio (WHR). A linear regression model was performed to investigate the variables associated with the triglycerides incremental area under the curve (iAUC). Independent associations between metabolic variables and apo A-V iAUC were also investigated in a randomly selected subgroup (n = 44). The study sample was classified according to the presence of fasting hypertriglyceridemia (≥150 mg/dL) and abdominal obesity (WHR ≥0.92 in men and ≥0.85 in women) to explore differences in parameters. The fasting apo B-48 levels (r = 0.404), and the WHR (r = 0.359) were independent factors contributing to the triglycerides iAUC (r2 = 0.29, P lipemia. Abdominal obesity also contributes to the magnitude of the postprandial response.The triglycerides postprandial increment is the principal factor associated with the apo A-V postprandial response.

  3. EST Table: AV403753 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403753 pg--0010X 11/12/09 GO hit GO:0000287(magnesium ion binding)|GO:0004427(inorganic...39 aa ref|NP_290858.1| inorganic pyrophosphatase [Escherichia coli O157:H7 EDL933] ref|NP_313231.1| inorganic... pyrophosphatase [Escherichia coli O157:H7 str. Sakai] ref|NP_418647.1| inorganic... pyrophosphatase [Escherichia coli str. K-12 substr. MG1655] ref|YP_313123.1| inorganic pyrophosphatase [Sh...igella sonnei Ss046] ref|YP_410472.1| inorganic pyrophosphatase [Shigella boydii Sb227] ref|YP_405834.1| inorganic

  4. EST Table: AV401507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401507 e96h0814 10/09/28 95 %/238 aa dbj|BAG15923.1| transposase [Bombyx mandarin...a] dbj|BAG15924.1| transposase [Bombyx mandarina] dbj|BAG15925.1| transposase [Bombyx mandarina] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS797048 e96h ...

  5. Implementering av multivariabel reglering i DCS-miljö

    OpenAIRE

    Winberg, Johan

    2009-01-01

    Inom processindustrin finns en etablerad reglerhierarki där basreglering sker med PID-regulatorer och där avancerad, multivariabel styrning sköts av MPC-programvara. Steget mellan dessa två nivåer kan upplevas som stort. För mindre och snabba multivariabla processer undvikes helst en multivariabel ansats, med försämrad reglering som följd. På Preem AB har detta upplevts som ett problem. Syftet med examensarbetet har varit att utveckla en alternativ, multivariabel styrstrategi för en process m...

  6. En brukbarhetsanalys av avancerad fastighetsautomation under förvaltningsskedet

    OpenAIRE

    Esselin, Frida; Selimovic, Seherzada

    2015-01-01

    Avancerad fastighetsautomation intog marknaden under 2000-talets första år. Visionen var att skapa smarta byggnader där fastighetsövervakning, klimatstyrning och belysning sammankopplades mot en central huvuddator för att eliminera manuell styrning. Syftet med examensarbetet är att undersöka funktionalitet och reell brukbarhet hos ett av de första installationsobjekten, PostNords huvudkontor. Rapporten presenterar fastighetens övergripande funktioner samt analyserar hur systemstyrningen kan o...

  7. Guerrillero Heroico : Alberto Kordas fotografiske portrett av Che Guevara

    OpenAIRE

    Gulljord, Hanne Gudrun

    2010-01-01

    Fotografen Alberto Diaz Gutiérrez (1928-2001), bedre kjent som Alberto Korda, tok i 1960 et snapshot av Ernesto ”Che” Guevara de la Serna (1928-1967). Korda ga senere dette portrettet tittelen Guerrillero Heroico. Portrettet blir omtalt som vår tids mest reproduserte fotografi. Denne oppgaven behandler den visuelle kulturen som har oppstått rundt dette fotografiet, og tar i den sammenhengen utgangspunkt i de historiske kontekstene som synes medvirkende til at Guerrillero Heroico forflytter...

  8. Konservering av et knust vannfilter i steingods : redde et familieklenodium

    OpenAIRE

    Heggtveit, Hilde

    2007-01-01

    Oppgaven gikk ut på å konservere et vannfilter i privat eie som hadde blitt knust under en flytteprosess. Det var ulike problemstillinger som måtte løses for å gi et best mulig resultat for gjenstand og eier. Gjenstanden er i privat eie og det vil dermed bli andre etiske problemstillinger å ta hensyn til enn med en gjenstand som tilhører et museum. Museer har retningslinjer og strenge etiske regler å forholde seg til vedtekter som er vedtatt av styret til museet og internasjonale komitee...

  9. EST Table: AV398143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398143 NV021176 10/09/28 100 %/213 aa ref|NP_001040254.1| beadex/dLMO protein [Bo...mbyx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 74 %/175 aa FBpp0262745|DyakGE17735-PA ... gnl|Amel|GB11268-PA 10/09/10 81 %/180 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  10. EST Table: AV398425 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398425 NV021796 10/09/28 92 %/176 aa ref|NP_001040254.1| beadex/dLMO protein [Bom...byx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 87 %/123 aa FBpp0262745|DyakGE17735-PA 1...a gnl|Amel|GB11268-PA 10/09/10 76 %/156 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  11. Konstruksjon av GaAs MMIC effektforsterker med integrert linearisering

    OpenAIRE

    Kippernes, Frank Åge

    2009-01-01

    Denne oppgaven tar for seg linearisering av GaAs MMIC effektforsterkere. Det er brukt en pHEMT-prosess og senterfrekvensen ligger på 2,45 GHz. Effektforsterkerne som er konstruert kan levere utgangseffekter i størrelsesorden 1 W. Agilent Advanced Design System (ADS) ble brukt til konstruksjon og simulering. Moderne modulasjonsteknikker med varierende envelope krever lineære forsterkere for å fungere. Ulinearitetene i forsterkeren vil forvrenge signalet og skape støy både i og utenfor båndet...

  12. EST Table: AV403042 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403042 heS30974 10/09/28 62 %/228 aa ref|XP_321040.4| AGAP002015-PA [Anopheles ga...|DwilGK17594-PA 10/08/27 39 %/210 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:P...62 %/230 aa gi|91087317|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 heS3 ...

  13. EST Table: AV404085 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404085 pg--0423X 10/09/28 100 %/117 aa gb|ACH69160.1| myosin heavy chain [Bombyx ...mori] 10/08/28 84 %/116 aa FBpp0291042|Mhc-PO 10/08/27 60 %/116 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... gnl|Amel|GB30329-PA 10/09/10 83 %/116 aa gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] FJ029109 pg-- ...

  14. EST Table: AV404226 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404226 pg--0725 10/09/28 81 %/264 aa gb|ACQ72825.1| myosin heavy chain [Bombyx ma...ndarina] 10/08/28 78 %/264 aa FBpp0291043|Mhc-PP 10/08/27 51 %/264 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... aa gnl|Amel|GB30329-PE 10/09/10 78 %/264 aa gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] FJ029109 pg-- ...

  15. Rail transportation of biofuels; Jaernvaegstransport av biobraenslen

    Energy Technology Data Exchange (ETDEWEB)

    Frosch, Martin; Thoren, Peter

    2010-05-15

    The project has had the task of describing how the rail transportation of biofuels can be increased. This has been made by analyzing the current conditions of five transmission terminals and five different CHP plants, henceforth called reference cases, and the prevailing conditions at their reception terminals. For each of the five reference cases several transport solutions have been created that take in consideration how these conditions affect the efficiency of the transport solutions for 23 different relations. The study will also show to what extent reduction of environmental impacts can be achieved with the rail transportation of biofuels as alternative to road transport. Three of the reference cases are in operation, one under construction and one in the development phase. To develop transportation solutions and identify potential catchment areas for biofuels a slightly higher resolution than what normally is analyzed in existing literature is required. Therefore, these analysis have been made for each of the relevant catchment areas with the help of forest assessment data, kNN-data, from the Swedish agricultural university (SLU), statistics of peat production from the Swedish geological survey (SGU) and the Forestry boards (Skogsstyrelsen) statistical yearbook of 2008. The calculations underlying the transport solutions are relating to the sustainability of each catchment area, constraints and opportunities at both the reception and transmission terminals, and the practical solutions for wagons, containers and number of possible weekly circulations. The target audience is the heating and CHP plants in Sweden, wishing to use rail transport of biofuels, regardless of available infrastructure since remote receiving terminals also can be used if needed. The results of the economical analysis for all possible relations are based on calculations with 20 wagons in each circulation. Due to topographic limitations and limited traction capacity all relations

  16. Yield Mapping in Salix; Skoerdekartering av salix

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, Christoffer; Gilbertsson, Mikael; Rogstrand, Gustav; Thylen, Lars

    2004-09-01

    The most common species for energy forest production is willow. Willow is able to produce a large amount of biomass in a short period of time. Growing willow has a potential to render a good financial result for the farmer if cultivated on fields with the right conditions and plenty of water. Under the right conditions growing willow can give the farmer a net income of 3,000 SEK (about 430 USD) per hectare and year, which is something that common cereal crops cannot compete with. However, this is not the common case since willow is often grown as a substitute crop on fields where cereal crop yield is low. The aim of this study was to reveal if it is possible to measure yield variability in willow, and if it is possible to describe the reasons for yield variation both within the field but also between different fields. Yield mapping has been used in conventional farming for about a decade. The principles for yield mapping are to continuously measure the yield while registering location by the use of GPS when harvesting the field. The collected data is then used to search for spatial variations within the field, and to try to understand the reasons for this variation. Since there is currently no commercial equipment for yield mapping in willow, a yield mapping system had to be developed within this project. The new system was installed on a Claas Jaguar harvester. The principle for yield mapping on the Claas Jaguar harvester is to measure the distance between the feeding rollers. This distance is correlated to the flow through the harvester. The speed and position of the machine was registered using GPS. Knowing the working width of the harvester this information was used to calculate the yield. All collected data was stored on a PDA computer. Soil samples were also collected from the yield mapped fields. This was to be able to test yield against both physical and chemical soil parameters. The result shows that it is possible to measure spatial variations of yield in

  17. Effects of AV-delay optimization on hemodynamic parameters in patients with VDD pacemakers.

    Science.gov (United States)

    Krychtiuk, Konstantin A; Nürnberg, Michael; Volker, Romana; Pachinger, Linda; Jarai, Rudolf; Freynhofer, Matthias K; Wojta, Johann; Huber, Kurt; Weiss, Thomas W

    2014-05-01

    Atrioventricular (AV) delay optimization improves hemodynamics and clinical parameters in patients treated with cardiac resynchronization therapy and dual-chamber-pacemakers (PM). However, data on optimizing AV delay in patients treated with VDD-PMs are scarce. We, therefore, investigated the acute and chronic effects of AV delay optimization on hemodynamics in patients treated with VDD-PMs due to AV-conduction disturbances. In this prospective, single-center interventional trial, we included 64 patients (38 men, 26 women, median age: 77 (70-82) years) with implanted VDD-PM. AV-delay optimization was performed using a formula based on the surface electrocardiogram (ECG). Hemodynamic parameters (stroke volume (SV), cardiac output (CO), heart rate (HR), and blood pressure (BP)) were measured at baseline and follow-up after 3 months using impedance cardiography. Using an ECG formula for AV-delay optimization, the AV interval was decreased from 180 (180-180) to 75 (75-100) ms. At baseline, AV-delay optimization led to a significant increase of both SV (71.3 ± 15.8 vs. 55.3 ± 12.7 ml, p < 0.001, for optimized AV delay vs. nominal AV interval, respectively) and CO (5.1 ± 1.4 vs. 3.9 ± 1.0 l/min, p < 0.001), while HR and BP remained unchanged. At follow-up, the improvement in CO remained stable (4.9 ± 1.3 l/min, p = 0.09), while SV slightly, but significantly, decreased (to 65.1 ± 17.6, p < 0.01). AV-delay optimization in patients treated with VDD-PMs exhibits immediate beneficial effects on hemodynamic parameters that are sustained for 3 months.

  18. Er selvrapportert fysisk aktivitet egnet til å belyse helsevirkninger av lett fysisk aktivitet?

    Directory of Open Access Journals (Sweden)

    Victoria Telle Hjellset

    2011-08-01

    Full Text Available Fysisk aktivitet kan redusere risikoen for flere kroniske sykdommer, og kan vurderes ved bruk av spørreskjema, eller måles objektivt. I en undersøkelse blant innvandrerkvinner fra Pakistan (n=86 har vi sammenlignet selvrapportert (International Physical Activity Questionnaire, IPAQ og objektivt målt fysisk aktivitet (SenseWear Armband. For å sikre at kvinnene forsto hva det ble spurt om ble det benyttet prosjektmedarbeidere fra Pakistan og India som hjalp deltakerne til å svare på spørreskjemaet, som dessuten var oversatt til urdu, punjabi og engelsk. Vi fant ingen signifikant korrelasjon (Spearman mellom de to målemetodene. Selvrapportert fysisk aktivitet var ikke signifikant korrelert med: alder, BMI, livvidde, HbA1c, fastende og ’2-timers glukose’, fastende insulin, C-peptid, sittende systolisk- og diastolisk blodtrykk, totalkolesterol, LDL-kolesterol og triglyserider. På den annen side fant vi en invers relasjon mellom objektivt målt fysisk aktivitet og nevnte variabler. Sammenhengene holdt seg ved aldersjustering (lineær regresjon. Deltakere med selvrapportert god fysisk form hadde lavere BMI, livvidde, serum insulin, triglyserider og diastolisk blodtrykk. Resultatene tyder på at selvrapportering av fysisk aktivitet ikke alltid gir god nok opplysning til å bedømme graden av fysisk aktivitet, slik det ble funnet ved å bruke spørreskjemaet IPAQ på dette utvalget av innvandrerkvinner. Objektiv måling av energiomsetning kan synes nødvendig for å få gode estimater på fysisk aktivitet og dens gunstige helseeffekter. Hjellset VT, Høstmark AT. Is self-reported physical activity suitable for studying health effects of light physical activity?    Nor J Epidemiol 2011; 20 (2: 135-142.ENGLISH SUMMARYPhysical activity can reduce the risk of many chronic diseases, and may be estimated using questionnaires, or measured objectively. In a group of Pakistani immigrant women living in Oslo, Norway, we found no significant

  19. Idrottsplatsen som målpunkt och mötesplats : En studie av idrottande ungdomars rörelsemönster och kontaktskapande mellan områden

    OpenAIRE

    Holmquist, Liz

    2017-01-01

    This research aimed to study how athletic adolescents move between different areas; what the nodes are and to which extent sports fields are of importance. Furthermore, the study was constructed to investigate if sports could be a factor in increasing the movement between residential areas and produce social integration. The methodology includes surveys with four football teams in Stockholm, a group interview with three adolescents and a spatial analysis of the two sport clubs’ (to which the ...

  20. Binding characteristics of 9-fluoropropyl-(+)-dihydrotetrabenzazine (AV-133) to the vesicular monoamine transporter type 2 in rats

    Energy Technology Data Exchange (ETDEWEB)

    Tsao, H.-H. [Department of Medical Imaging and Radiological Sciences, Chang Gung University, Taoyuan, Taiwan (China); Lin, K.-J. [Department of Medical Imaging and Radiological Sciences, Chang Gung University, Taoyuan, Taiwan (China); Department of Nuclear Medicine, Chang Gung University and Memorial Hospital, Taoyuan, Taiwan (China); Juang, J.-H. [Division of Endocrinology and Metabolism, Chung Gung University and Chung Gung Memorial Hospital, Taoyuan, Taiwan (China); Skovronsky, Daniel M. [Avid Radiopharmaceuticals, Philadelphia, PA (United States); Department of Radiology, University of Pennsylvania, Philadelphia, PA 19104 (United States); Yen, T.-C. [Department of Nuclear Medicine, Chang Gung University and Memorial Hospital, Taoyuan, Taiwan (China); Wey, S.-P. [Department of Medical Imaging and Radiological Sciences, Chang Gung University, Taoyuan, Taiwan (China); Kung, M.-P. [Department of Medical Imaging and Radiological Sciences, Chang Gung University, Taoyuan, Taiwan (China); Department of Radiology, University of Pennsylvania, Philadelphia, PA 19104 (United States)], E-mail: kungmp@sunmac.spect.upenn.edu

    2010-05-15

    The vesicular monoamine transporter type 2 (VMAT2) is highly expressed in pancreatic {beta}-cells and thus has been proposed to be a potential target for measuring {beta}-cell mass (BCM) by molecular imaging. C-11- and F-18-labeled tetrabenazine derivatives targeting VMAT2 have shown some promising results as potential biomarkers for BCM. In the present study, we examined the binding characteristics of 9-fluoropropyl-(+)-dihydrotetrabenzazine ([{sup 18}F]AV-133), a potential PET tracer for BCM imaging, in rat pancreas and rat brain. Methods: Pancreatic exocrine cells and pancreatic islet cells were isolated and purified from Sprague-Dawley rats. Membrane homogenates, prepared from both pancreatic exocrine and islet cells as well as from brain striatum and hypothalamus regions, were used for in vitro binding studies. In vitro and ex vivo autoradiography studies with [{sup 18}F]AV-133 were performed on rat brain and rat pancreas sections. Immunohistochemistry studies were performed to confirm the distribution of VMAT2 on islet {beta}-cells. Results: Excellent binding affinities of [{sup 18}F]AV-133 were observed in rat striatum and hypothalamus homogenates with K{sub d} values of 0.19 and 0.25 nM, respectively. In contrast to single-site binding observed in rat striatum homogenates, rat islet cell homogenates showed two saturable binding sites (site A: K{sub d}=6.76 nM, B{sub max}=60 fmol/mg protein; site B: K{sub d}=241 nM, B{sub max}=1500 fmol/mg protein). Rat exocrine pancreas homogenates showed only a single low-affinity binding site (K{sub d}=209 nM), which was similar to site B in islet cells. In vitro autoradiography of [{sup 18}F]AV-133 using frozen sections of rat pancreas showed specific labeling of islets, as evidenced by co-localization with anti-insulin antibody. Ex vivo VMAT2 pancreatic autoradiography in the rat, however, was not successful, in contrast to the excellent ex vivo autoradiography of VMAT2 binding sites in the brain. In vivo/ex vivo islet

  1. InterProScan Result: AV402889 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402889 AV402889_3_ORF1 82B713D3A4F3515D SUPERFAMILY SSF103473 MFS general substra...te transporter 2.6e-13 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  2. InterProScan Result: AV404113 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404113 AV404113_2_ORF2 F3297275DB9590B8 PRODOM PD020518 Q8X5H1_ECO57_Q8X5H1; 9e-3...3 T IPR004195 Bacteriophage lambda head decoration protein D, HDPD Cellular Component: viral capsid (GO:0019028) ...

  3. InterProScan Result: AV399408 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399408 AV399408_2_ORF1 5D6D9219C673BB29 PFAM PF05274 Baculo_E25 1.3e-78 T IPR007938 unintegrated Cellular... Component: viral envelope (GO:0019031)|Cellular Component: host cell nucleus (GO:0042025) ...

  4. Temporal dynamics of AVS and SEM in sediment of shallow freshwater floodplain lakes

    NARCIS (Netherlands)

    Griethuysen, van C.; Lange, de H.J.; Heuij, van der M.; Bies, S.C.; Gillissen, F.; Koelmans, A.A.

    2006-01-01

    Acid volatile sulfide (AVS) is an operationally defined sulfide fraction, which is considered important for trace metal fate in reduced sediments. Understanding AVS formation rates is important for the management of metal polluted sediment. However, little lis known about the fate and dynamics of

  5. InterProScan Result: AV399344 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399344 AV399344_1_ORF2 5604F45CA0D42E5E PFAM PF05314 Baculo_ODV-E27 1.4e-47 T IPR007978 Baculovirus occlus...ion-derived virus envelope EC27 Cellular Component: viral envelope (GO:0019031) ...

  6. InterProScan Result: AV405377 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405377 AV405377_1_ORF1 5614E1377E837F70 SUPERFAMILY SSF103473 MFS general substra...te transporter 2.1e-06 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  7. AVS/Express (application visualization system) user's guide

    Energy Technology Data Exchange (ETDEWEB)

    Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Kume, Etsuo [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-09-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS/Express for image processing software and Stereo viewing system. This report summarizes the information to use AVS/Express efficiently in the computer environment for image processing. (author)

  8. InterProScan Result: AV399409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 429 Baculovirus LEF-11 Biological Process: viral infectious cycle (GO:0019058)|Biological Process: regulation of transcription (GO:0045449) ... ...AV399409 AV399409_1_ORF2 07DC81A7C7B2FA42 PFAM PF06385 Baculo_LEF-11 3e-33 T IPR009

  9. InterProScan Result: AV399297 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ulovirus p35, apoptosis preventing protein Biological Process: anti-apoptosis (GO:0006916)|Molecular Function: caspase inhibitor activity (GO:0043027) ... ...AV399297 AV399297_3_ORF2 F5C6B0DD046B3A9D PFAM PF02331 P35 5.2e-107 T IPR003429 Bac

  10. InterProScan Result: AV401371 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401371 AV401371_2_ORF2 4E899180012BEB2A GENE3D G3DSA:3.30.465.10 no description 7...e-07 T IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 Molecular Function: catalytic

  11. InterProScan Result: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 AV404903_2_ORF1 4CB4FF124EAAC1C5 PFAM PF05187 ETF_QO 1.7e-14 T IPR007859 Electron transfer flav...oprotein-ubiquinone oxidoreductase Molecular Function: electron-transferring-flavoprote

  12. Musernas viskningar förr och nu : En studie av det musiska och inriktningen musiskt lärande. En teoretisk analys samt ett empiriskt bidrag från lärarutbildningen

    OpenAIRE

    Grahn, Margaretha

    2005-01-01

    The purpose of the present thesis is twofold; the first part comprises a theoretical analysis of the concept muse-ical in an attempt to describe similarities and differences between the concepts muse-ical and aesthetic and furthermore, to identify the distinguishing features of a muse-ical approach and a muse-ical program. The second part of the thesis reports on an empirical study among student teachers who have chosen to study the program Muse-ical Learning. They have been interviewed about...

  13. Den långa vägen till biblioteket : En studie om förskolors läsvanor och användning av biblioteket i ett mångkulturellt område

    OpenAIRE

    Sunding, Elisabeth

    2009-01-01

    The purpose of this study has been to examine reading habits and the use of the library by pre­school teachers in a mainly multicultural community, and also explore to what extent activities in the local library are aimed at preschoolers. The study used a sociocultural approach based on Vygotsky’s theories of learning and development and Söderbergh’s theory of early childhood language development, and was carried out during the summer 2009. The methodology used was both quantitative and quali...

  14. Harmoni eller konflikt? – en fallstudie av meningsinnehållet i utbildning för hållbar utveckling. "Harmony or conflict? – A case study of the conceptual meaning of education for sustainable development"

    Directory of Open Access Journals (Sweden)

    Marie Öhman

    2012-06-01

    Full Text Available Conflict or harmony between economic, ecologic and social sustainability are two opposing perspectives that have appeared in the current debate about sustainable development. The aim of this studyis to investigate how the relations between these sustainability aspects are established in a concrete school practice. The present study is a case study and investigates two classes of Swedish upper secondary students presenting a three-weeks thematic assignment concerning sustainable urban planning.The empirical material consists of field notes, audio-recordings, video-recordings and students’texts. In order to analyse the students’ meanings about sustainable development a method inspired from pragmatic discourse analysis is used. The findings show how the students in their language usage constitute a harmony perspective on sustainable development. The results and implications for teaching and learning are finally discussed.

  15. Sociala medier - en påverkande faktor på identitetsutveckling och psykiskt välbefinnande : En kvalitativ studie om unga kvinnors uppfattningar och erfarenheter av sociala medier

    OpenAIRE

    Wiksten, Isabell; Ström, Johanna

    2016-01-01

    Syftet med denna studie är att undersöka och uppmärksamma unga kvinnors uppfattningar och erfarenheter avseende hur sociala medier påverkar deras identitetsutveckling och psykiska välbefinnande. Det är en kvalitativ studie baserad på två fokusgrupper med tre högskole- och universitetsstuderande kvinnor, i åldern 18 - 25. Det genomfördes även en individuell intervju med en professionell som är verksam på en stödmottagning för psykisk ohälsa. Den teoretiska utgångspunkten i analysen är symbolis...

  16. Beroende eller oberoende? : En kvalitativ studie av hur äldre hjälptagare ser på att ha hjälp och stöd

    OpenAIRE

    Hammarström, Gunhild; Torres, Sandra

    2007-01-01

    Dependency or independence? A qualitative study of how elderly home-help recipients regard having help and support Knowledge on elderly people’s understandings of dependence and independence is relatively scarce even though there is plenty of gerontological research on related topics. Although we know how to define and measure different types of dependency, we know, in fact, very little about how elderly home-help recipients themselves regard their situation in terms of dependency, independen...

  17. Pre-study of dynamic loads on the internals caused by a large pipe break in a BWR; Foerstudie av stroemningsinducerade laster paa interndelar vid brott i huvudcirkulationskretsarna i BWR

    Energy Technology Data Exchange (ETDEWEB)

    Marcinkiewicz, Jerzy; Lindgren, Anders [Det Norske Veritas Nuclear Technology AB, Stockholm (Sweden)

    2002-12-01

    Det Norske Veritas Nuclear Technology has performed a literature study of dynamic load on a BWR (Boiling Water Reactor) internals caused by a large pipe break. The goal of the study was to improve the knowledge about the physics of phenomena occurring in the RPV (Reactor Pressure Vessel) after pipe break in the main circulation system and also to make a review of calculation methods, models and computer programs including their capabilities when calculating the dynamic loads. The report presents description of relevant parts of a BWR, initial and boundary conditions, and phenomena determining the loads - rapid depressurization and propagation of pressure wave (including none-equilibrium). Furthermore, the report generally describes possible methodologies for calculating the dynamic loads on internals after the pipe break and the experiences from calculations the dynamic loads with different methods (computer programs) including comparisons with experimental data. Fluid-Structure Interaction methodology and its importance for calculation of dynamic loads on reactor internals is discussed based on experimental data. A very intensive research program for studying and calculating the dynamic loads on internals after pipe breaks has been performed in USA and Germany during the seventies and the eighties. Several computer programs have been developed and a number of large-scale experiments have been performed to calibrate the calculation methods. In spite of the fact that all experiments were performed for PWR several experiences should be valid also for BWR. These experiences, connected mainly to capabilities of computer programs calculating dynamic loads, are discussed in the report.

  18. Hvem vet best? Om styringen av grunnopplæringen under Kunnskapsløftet

    Directory of Open Access Journals (Sweden)

    Petter Aasen

    2010-12-01

    Full Text Available Emnet for artikkelen er iverksettingen av Kunnskapsløftet som styringsreform. Kunnskapsløftet ble av nasjonale utdanningsmyndigheter introdusert som en reform der forutsetningen for å lykkes innebar et systemskifte i styringen av norsk grunnopplæring. Klare nasjonale mål, kunnskap om resultater, tydelig ansvarsplassering, lokal handlefrihet og et godt støtte- og veiledningsapparat skulle være bestanddelene. Artikkelens problemstilling er denne: Hva var statlige myndigheters uttalte intensjoner med systemskiftet, og hvordan oppfatter og vurderer skoleeiernivået den nye styringsmodellen for grunnopplæringen? Artikkelen bygger på prosjektet Evaluering av Kunnskapsløftet - Forvaltningsnivåenes og institusjonenes rolle. Prosjektets datamateriale inkluderer alle forvaltningsnivå (sentralstat, regionalstat, skoleeiere, skoler, lærebedrifter og rommer både kvalitative og kvantitative data. I denne artikkelen bygger fremstillingen av intensjonene bak systemskiftet på dokumenter i reformforarbeidene. Kommuner og fylkeskommuners forventninger til og vurderinger av det signaliserte systemskiftet avdekkes via kvalitative intervju blant utvalgte skoleeiere, som dermed gir innblikk i oppfatninger av systemskiftet generelt og rolle- og ansvarsfordelingen spesielt. Spørreskjemadata fra skoleeiernivået synliggjør allmenne vurderinger av styringsreformen og sier noe om de kvalitative funnenes utbredelse. Funnene våre tyder på at Kunnskapsløftets signaliserte systemskifte ikke virker etter hensikten. Blant skoleeierne er det generelt uklart hva systemskiftet innebærer. Det er heller ingen utbredt oppfatning av at det faktisk skjer endringer i styringer av grunnopplæringen i den retningen reformen la opp til. I vår analyse av forholdet mellom forvaltningsnivåene har vi lagt særlig vekt på spørsmålene om tydelig ansvarsplassering og lokal handlefrihet. Skoleeierne erfarer ikke stor lokal handlefrihet. Fristillingen følges og begrenses

  19. Noise annoyances from wind power: Survey of the population living close to a wind power plant. Final report: Part 3 Main study; Stoerningar fraan vindkraft: undersoekning bland maenniskor boende i naerheten av vindkraftverk. Slutrapport: Del 3 Huvudstudie

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, Eja [Halmstad Univ., Halmstad (Sweden). School of Business and Engineering; Persson-Waye, K. [Goeteborg Univ., Goeteborg (Sweden). Dept. of Environmental Medicine

    2002-02-01

    To evaluate the occurrence of annoyance from wind turbines, a study was performed in Laholm in May 2000. The aim was to obtain dose response relationships between calculated sound levels and noise annoyance and appropriate sound description as well as analysing the influence of other variables on noise annoyance. A questionnaire survey was performed in 6 areas comprising 16 wind turbines, of which 14 had an effect of 600 kW. The purpose of the study was masked. Among questions on living conditions in the countryside, questions directly related to wind turbines were included. The study population (n=518) comprised one randomly selected subject between the ages of 18 to 75 years in each household living within a calculated wind turbine sound level of 25 to 40 dBA. The response rate was 68.7% (n=356). Calculated distributions of A-weighted sound level were performed for each area and plotted on geographical maps in 2.5 dBA steps. Each dwelling could thus be given a sound level within an interval of 2.5 dBA. The most frequently occurring source of noise annoyance was noise from rotor blades. The proportions of respondents annoyed by noise increased with calculated sound level. Among respondents exposed to sound levels of 35.0-37.5 dBA, 43% responded themselves to be rather or much annoyed. A-weighted sound level was only one variable explaining annoyance. Annoyance was correlated to a larger extent by the intrusiveness of the sound character swishing. Noise annoyance was interrelated to the respondents' opinion of the visual impact of wind turbines, while attitude towards wind power in general had no greater influence. Disturbance of spoilt view was reported to a similar degree as noise disturbance. Further investigations are needed to clarify factors of importance for the disturbance of view. All the wind turbines in the study had constant rotation speed. The greater wind turbines that are now erected often have variable speed, which may lead to a sound

  20. Creep damage in welds of X 20 CrMoV 12 1 steel. Part 1 - Literature study and collection of experience; Krypskador i svetsar av X 20 CrMoV 12 1 staal. Etapp 1 - Litteraturstudie och erfarenhetsinsamling

    Energy Technology Data Exchange (ETDEWEB)

    Storesund, Jan [Det Norske Veritas AB, Stockholm (Sweden); Borggreen, Kjeld [Sydtek AB, Malmoe (Sweden)

    2003-05-01

    The present project is a first part of a study of welded joints of the heat resistant steel X 20 CrMoV 12 1 in purpose to improve the methods for residual life assessment of this steel. A literature study and a collection of the experience of the area have been performed. There exists literature concerning damage development in welds to some extent, significantly less than for low alloy steels and in some areas hardly not at all. These areas are, for instance, published results of power plant investigations and metallographical investigations of retired welded components. However, the collection of experience from Danish plant gave amounts of information. It is shown in the literature that the damage development is quite like the typical one of low alloy steels but also that there are differences such as that the damage in a great amount also is formed in the interior of the grains. This can to some extent affect the way to evaluate observed damage. The existing damage scales presupposes intercrystal line damage but can essentially be used all the same. The experience from results of replica testing on components in service show a very slow growth of the damage at lower damage classes. The experience of higher damage classes in plant is small for this material but results of laboratory testing indicate a relatively fast growth. In the collection of experience it is observed that damage preferentially occurs in welds at terminals and nodes, such as T-joints, in the pipeline. Replica investigations should therefore be concentrated to such welds. An erroneous heat treatment resulting in dramatically reduced creep strength is quite frequent in pipeline components. It is recommended to investigate particularly bends systematically with the view to deciding if the microstructure is correct, latest after approximately 100,000 hours of operation. The following areas have been identified as important for the continued work: Finite element calculations using data on welds